2PZ0A

Crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
239
structure length
239
Chain Sequence
b'KTLVIAHRGDSKNVPENTIAAFKRAMELGADGIELDVQLTKDGHLVVIHDETVDRTTNGEGFVKDFTLEEIKKLDAGIKFGEKFAGERIPTLYEVFELIGDKDFLVNIEIKSGIVLYPGIEEKLIKAIKEYNFEERVIISSFNHYSLRDVKKMAPHLKIGLLYQCGLVEPWHMALRMEAYSLHPFYFNIIPELVEGCKKNGVKLFPWTVDRKEDMERMIKAGVDGIITDDPETLINLVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of glycerophosphodiester phosphodiesterase (GDPD) from Thermoanaerobacter tengcongensis, a metal ion-dependent enzyme: insight into the catalytic mechanism.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase
total genus 88
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2pz0A00
1DJZA 4QJ3B 1O1ZA 4F2TA 4GNKB 3EA3A 3QR1A 2FJUB 3QVQA 4F2UA 1PTGA 2OTDA 2OOGA 4I9MA 2PTDA 3V16A 2O55A 4QJ4B 4RV3A 3H4WA 4RW3A 3CH0A 2P76A 4I9TA 6PTDA 4I90A 3KS5A 1ZCCA 4F2BA 2ZKMX 5T9CE 1VD6A 1T8QA 1T6MA 4PTDA 1DJYA 1PTDA 3KS6A 5T9BG 1V8EA 3RLHA 1DJIA 1XX1A 3V1HA 2PLCA 1YDYA 7PTDA 3NO3A 2OR2A 2PZ0A 2ISDA 1QASA 3EA2A 3OHMB 3RLGA 1GYMA 3V18A 4RW5A 4I9JA 3I10A 4S3GA 1DJGA 5PTDA 1AODA 3H4XA 4Q6XA 4QJ5B 3L12A 4I8YA 1DJHA 3MZ2A 4OECA 3PTDA 3QR0A 1QATA 4R7OA 2F9RA 1DJWA 3EA1A 5T91A 1DJXA
chains in the Genus database with same CATH superfamily
1GQJA 3AYVA 3BQ5A 2ZOXA 1KGWA 3UZXA 4JKLA 4WIWA 3VIPA 3HN3A 4M3PA 2EPMX 1YXDA 2BOEX 1GW1A 1MEHA 5XIMA 3IJLA 1IZCA 1JULA 4HYVA 1RV8A 2PRHA 5GNYA 4OVXA 4XB3A 3S5OA 3KOFA 1JZ7A 3XIMA 4IX0A 2OT1A 3RHGA 4WOQA 3EDJA 2VQTA 4E0CA 1WYIA 3UJFA 3AU2A 1VD6A 3LCIA 3O3RA 3KFTA 2X0YA 4JXCA 1PTDA 3RO6A 1UA3A 1N8IA 3G1AA 1B3VA 4G8TA 3U4FA 2PDUA 2NV2A 2YSWA 4AWUA 2C1HA 4L6HA 1I0BA 3OVQA 4REQB 2PRLA 5DRIA 4MTVA 1SQ7A 4JX5A 4EWND 4AISA 3DU0A 5IBXC 4E38A 4FNTA 2RDXA 3C5QA 4XAFA 2FZ9A 1EB3A 1TWDA 4E2DA 1XIJA 4LQ1A 1QNPA 4LTSA 1LF1A 2BTMA 2BVYA 2OQLA 3SGGA 3SCOA 4F0MA 4W88A 2TMDA 2XM2A 4RK8A 2WHJA 3T4WA 1I1WA 2QCEA 5JH2A 1XG4A 3M0YA 1DEDA 3LM3A 3T78A 1E9IA 1G7UA 3R0KA 3T0TA 1DIKA 3NZQA 4GVFA 4QS6A 3MI6A 3LPFA 1JFXA 1FOBA 1C9DA 3DDMA 4JFUA 4GI4A 4PMVA 1T7LA 2R94A 1VCVA 1BPLB 4O0QA 2YB1A 2GK1A 1ENUA 1FWEC 2XG9A 2Y85A 3TN4A 2XIQA 3WF0A 2F84A 3CHEA 1KM3A 3STCA 4ZB5A 3PPCA 5H91A 4JNMA 3IGUA 4IP5A 2FLIA 2C13A 2JGYA 1BRLA 4GABA 1YKWA 4XX6A 2QCFA 1G9HA 4GK8A 1TV7A 3PJWA 4DUXA 5IM51 3PJXA 5G2IA 4HNOA 4ZOBA 1BYDA 1NFGA 1HTIA 4B90A 4M6QA 2V3EA 4MZ1A 1H7WA 1PPIA 4MSSA 4O54A 3SRHA 5DMYA 3S6DA 5JBDA 1A5OC 1P0NA 2CWXA 4QLLA 3NUKA 1R9YA 3IK4A 5EMYA 1P7TB 2CERA 5LIKX 3WLIA 1CGWA 4ZFCA 3MBDA 4K39A 3UGVA 3CUGA 3G22A 1S5TA 3VIFA 2RFGA 3U2EA 5DY2A 1Q6FA 1GPWA 4O1AA 3UG8A 3W23A 9XIAA 2G41A 4H6QA 2Q09A 1DJZA 1JF5A 3RR4A 2D0GA 2Y1HA 5FJOA 1YEYA 2WSQA 1PB0A 3WLMA 3L4ZA 3OIXA 2XINA 1TWSA 5LXEA 1Z89A 3DIPA 4IP7A 3NVDA 5HR7A 4GQQA 2G97A 4WKAA 3PJTA 2HPMA 1US2A 4FSAA 3BOXA 1OBAA 1JEZA 2PWFA 4L1WA 1XM3A 3M0ZA 4DRSA 5D38A 3C8NA 3STEA 3WQVA 2ABAA 2J6XA 1TMQA 1XYAA 4HP5A 5KZDA 3SUWA 4UFKA 3GR7A 4LANA 2A7NA 5BRPA 1AL8A 1DORA 2J7HA 2FGLA 3BAIA 2QQ6A 1E73M 1NFBA 2D0FA 2ZUMA 2F2KA 1XBZA 4HNTA 4JIEA 1BG4A 2ZDSA 3DYMA 3KHJA 4PN2A 1H51A 2ASHA 4LX4A 1W1A1 2OG9A 4B2DD 3BAJA 3NEHA 3W7HA 3H2OA 3QW3A 4U4MA 2XH4A 1MFUA 1ZP4A 2FB3A 4I8DA 2VGIA 1P43A 2IPGA 3MO7A 1W3JA 1CGYA 3G1XA 4ADUA 3P0WA 4U3AA 2DGAA 1JUKA 3MUIA 1PZ0A 1VFLA 4ZZ9A 1ECEA 2VFFA 1QATA 4R7OA 4WOZA 3SDOA 1TYGA 2VNCA 4AIUA 1JCJA 1FH7A 1EZWA 5C2GA 2EJ1A 2BS9A 2VO5A 4FR6A 4JTIA 1KNWA 1BLIA 3N73A 3MWCA 4N6FA 1Z32X 2HJPA 4RV3A 3KRUA 3VD3A 4XG1A 4KRTA 3ZR6A 4J3SA 2J9XA 1T41A 2UY5A 3RPDA 3PWGA 1GYNA 1OGSA 5AYXA 3ZYZA 2GK1B 3VUPA 3WEOA 1E71M 2I14A 4Q33A 1V7AA 4QG8A 5FEWA 3WNMA 3S5SA 3LEPA 2WQPA 1R9ZA 3VKAA 2WMFA 4HNLA 1J79A 2HE5A 4C6QA 1QCWA 1BRLB 1NSJA 4GFSA 4HNCA 3BUVA 3G1YA 2B7PA 2AQVA 3T2QA 3VNKA 3NZRA 4D6GA 3V36A 1CXIA 3ANUA 3EX1A 4C5YA 3NZPA 5C70A 3HOJA 3W71A 3FJ4A 1E5NA 2PP0A 1Q6LA 4XD6A 3S9ZA 5DFAA 4QG6A 3M16A 4EVZA 3ZVIA 3DUGA 1UD4A 3FOKA 4I7VA 1VYPX 3MJYA 4WQ6A 2C79A 3WH9A 9RUBA 4JS3A 4WKHA 1JCLA 1H7PA 4MKSA 1XRTA 1EOMA 2JE8A 3MMUA 4W8BA 1ZS2A 3KTSA 1W3TA 3WNPA 4B16A 1QO2A 2OYLA 1UR3M 4G2DA 2J7CA 3QR1A 4DO5A 3C0QA 3BGAA 4EAMA 2C0HA 3CTTA 4O12A 4EPDC 4OT7A 1TELA 2VFDA 3C2EA 4EK7A 4IIGA 1NQ6A 3A6OA 1AQMA 5RUBA 4H9XA 3JU2A 4Q8TA 3HO8A 3LCXA 4TVCA 3UCCA 3J7HA 4DNHA 4UTIA 2B4GA 3NL6A 5CH9A 4ZO9A 3VIKA 3S5YA 1KRAC 1GHRA 1ZAJA 3P3BA 4L4MA 3GVWA 4CKQA 4MVAA 5SWUA 4ZTYA 4Z2KA 4EPKA 4PBEA 1FH8A 1QASA 3MCNA 3I10A 1SR9A 2CBJA 1TZ9A 4S3GA 2CKSA 3VD4A 2IPJA 1WKDA 2XWEA 1DE6A 4J3WA 3ARXA 1EIXA 4GUGA 2ACQA 3EWXA 5M3WA 3MC5A 3R4IA 3IGSA 3K1DA 5I3IA 4NZ5A 1S2CA 1LRTA 1X97A 4GGBA 3NNTA 4V28A 4GPNA 3PHAA 2PWDA 1W1VA 1BXCA 2NV1A 3APTA 5AY7A 1X96A 2XSAA 4IIHA 4S23A 3GTNA 4C91A 4PMQA 1EHAA 1YMYA 1ONRA 3L2MA 3VIOA 1E4LA 4JTFA 2YW4A 5D2YA 1UPPA 2C0AA 4LS1A 3C2FA 3GU9A 4RZ6A 2J62A 5FF2A 1TR9A 3CZ8A 1NP0A 4QE4A 2I5QA 1FVPA 3A13A 1F3WA 2TAAA 5KEZA 4QSHA 5AC7A 3ZJ6A 4YTQA 2DJLA 3A4XA 3DBPA 3VDCA 1J9YA 2LLEA 4L4OA 3BAKA 4HU4A 4JIPA 2QJIA 2J47A 4RR4A 5A8GA 2TPSA 4CNOA 4ORIA 2AKMA 2CZDA 2DIJA 3U0HA 3B8TA 1A0CA 5HNTA 1QI0A 5CZTA 2I5GA 2ZVIA 5HWJA 3SSZA 2BSLA 4FLRA 4C6BA 2R91A 2RDUA 4D6IA 4E3VA 2FGZA 3OYZA 4C60A 4YN5A 1M65A 4GXMA 4QJ5B 4OFCA 3LCHA 1K9FA 1DJHA 5G5IA 1E6XM 1P0BA 4DBSA 5LNSA 4LGXA 2DW6A 4FOUA 4ICCX 3SQSA 3S2MA 1DJWA 1AD4A 4S1FA 4B9YA 2BOGX 2OSWA 2DY3A 1MMFA 5FJUA 3LYEA 3BAWA 2WWDA 4F2UA 1W32A 3MCOA 1QK0A 1W9XA 2QMJA 4DJFA 1JNEA 4DLMA 1XD0A 2EG7A 3SUTA 1MQPA 3UR5A 3RAOA 2G4JA 3QEZA 4HU8A 1XBYA 2NSOA 4H9YA 1E4NA 1OD0A 3K8LA 2D23A 3N9RA 3GXFA 3W7JA 3TC7A 3R13A 2ANUA 5A8QA 3QJAA 2A7PA 2ZC8A 2FZNA 4A3HA 1ZPTA 5ABGA 1RR2A 1VJZA 3UY7A 4GWEA 2ZTJA 4FXJA 3KTXA 2QDGA 2VOTA 1E6RA 2BNJA 1PWMA 5EL1A 1R30A 1LT7A 2PDNA 3SRFA 3HGRA 5LGZA 1JCXA 2WVVA 5EMMA 4AC1X 4A6GA 3EOSA 4L1XA 4X63A 4M8UA 3WCZA 1GORA 1TMHA 1MDRA 2AAMA 3HU7A 3HMCA 3IIXA 3O2LA 4Y8EA 3LHZA 4AY8A 2YDSA 4XZWA 3WLPA 1GOXA 2J9YA 1RLCL 4NI3A 3WLSA 2B0MA 1CLVA 2Q71A 3EWCA 3IJ8A 3HFTA 4RZBA 4M82A 2ZZ7A 2PCQA 3ECQA 3B4YA 5F1VA 1Q6GA 1W8GA 2A0NA 5T91A 1FWSA 3VAVA 2E1DA 3VIIA 3L0NA 1XCWA 2FVMA 1ZNNA 2OQYA 5HNUA 4PRWA 4OU1A 3HV9A 3ICJA 4LWWA 4C5ZA 2ZRVA 2WB5A 3B9NA 4JYDA 3NPXA 2PDQA 2PWVA 3LPGA 1NFPA 3LI1A 3CH9A 4H9ZA 4TVDA 3UR8A 3RXZA 2GVEA 2QCLA 1YNYA 3LHTA 2J78A 1MXSA 4S2CA 4Q8MA 4R27A 2GJLA 4N0RA 2H9AA 2EO7A 2XIMA 2OJPA 2VEFA 3GH7A 4JNZA 2QPSA 1UR1A 1UD8A 1IWAA 2GWGA 2J66A 1KA9F 1ODZA 1HW6A 5T9BG 3W81A 1QBAA 3M4HA 1R86A 4V15A 1I2OA 3C6CA 1JGIA 5EPDA 1IYXA 1TPC1 1UP0A 3OLGA 2Z00A 4XV0A 2W62A 4IPJA 3VIMA 4YYCA 4JQ3A 2C15A 1TX0A 3CIXA 1XYCA 2WSPA 2VRQA 4XQ6A 3BV4A 1M53A 4GYFA 3BDKA 3T42A 3DI1A 4Y9PA 3VGEA 1RJPA 2BX7A 4PUEA 4CNUA 4ZQOA 3UXAA 2WC7A 3BG9A 2IXUA 3WEZA 1L6YA 3ITTA 1NARA 3UWEA 5LA1A 2C1IA 2BP1A 1QBBA 4BHYA 2SFPA 4UTTA 1KCXA 1IE7C 2FJUB 2ZUTA 3QTGA 4WXYA 3WN6A 3DAQA 1C8QA 3W88A 3LSCA 4J7RA 1IEWA 4DPPA 4DWSC 2H3DA 3G6LA 2PBOA 3LNMA 3V16A 5G2WA 3E3HA 1DQUA 3K8KA 2V5LA 1ZAHA 7A3HA 3BLLA 1ZJHA 5CQ1A 3S5ZA 2HISA 4ZA0A 3NL5A 1UROA 4CLMA 4Y96A 5DCBA 3SCWA 3W7QA 1AQ0A 5CPSA 1L8NA 1RJQA 4NXKA 3AYSA 4DY1A 1AK5A 4RCXA 1FRBA 2QAPA 1NDYA 2PDHA 4MIMA 1AW5A 4IJBA 2PDBA 4A8LA 4H7CA 1NF7A 3GXTA 4XK2A 4UB9A 4C6FA 3EOUA 2YL5A 3H7VA 4KEMA 4WXZA 4BKNA 4NX5A 1VBHA 2X41A 4UFHA 3VDGA 5IFTA 3N14A 1VEMA 1GJUA 2V6AA 1VGAA 2XISA 1D8WA 3H21A 1EGMA 2WVVB 1XH0A 4C7DA 4IXHA 1TJ1A 1ICQA 3QFWA 1TR1A 3CAKA 4YMZA 2XIIA 4IPLA 4OECA 2E5BA 4A3YA 2W0UA 2YCJA 1OYAA 1SGJA 4CN1A 4JZ5A 3GC5A 3NR0A 3IJIA 3NVTA 2JQXA 1SZNA 3ABOA 3N17A 1TV5A 3QGVA 4IUGA 3WMSA 3M0JA 1WA3A 5DMMA 1PDZA 1N8WA 2OLSA 4GVHA 4GINA 5E70A 4C1LA 1TX2A 3SQLA 3BG3A 1MRQA 3UT0A 4H3DA 2J75A 2FIQA 4UTWA 3OGSA 3TC6A 4I9TA 4NJGA 1U5HA 4YTRA 4MLJA 1EP3A 4TTGA 1UPMB 2GYIA 4G56A 1EP2A 4RL3A 4J4KA 2V5KA 1W8SA 1ZBVA 1N2VA 2OYKA 4XD4A 1RH9A 1DP0A 3ZR5A 1CXLA 1PAMA 2DZWA 4AD1A 1L9WA 2GVJA 3V18A 4P7LA 1K7EA 3PBMA 3B9EA 3T9PA 4NUWA 4CD4A 5CJMA 3S2JA 3CXOA 3GTIA 4CCZA 1HO1A 1GNXA 1V6WA 3NM3A 4AYSA 5IOBA 5B7YA 5BXPA 4WDWA 1K77A 2PDKA 5A69A 5G4EA 3CWOX 4BI7A 4GY1A 2OZ0A 3E2RA 3FAWA 3PNZA 1UD5A 2XN0A 4F0SA 1VFFA 8RUCA 1LG1A 3DX5A 1PXGA 1WOAA 2D2HA 3NXLA 1LBFA 2DUAA 3PUDA 4AD0A 2QKFA 4MAZA 5AVNA 4U3CA 1NY1A 2XHYA 5C9RA 3AIEA 1GVEA 4N9BA 2XFWA 4MY9A 1S1RA 1AL7A 1D3GA 3PBGA 4IXXA 4H9TA 3PJUA 1KGXA 1TWIA 2BVDA 3TXVA 1NJJA 5I6SA 4IMFA 3FVDA 1I2PA 2PDGA 3IJ6A 3MV11 3TMLA 1F8MA 3ELFA 3W70A 5T9CE 1P6CA 1JQVA 2ZUUA 3N9SA 5JIWA 2CLIA 4YHGA 4XTIA 1F3XA 3MDWA 2HRWA 4RX0A 3TN5A 2VRKA 4LAZA 2ZX5A 4BR1A 1XSKA 1V6VA 4MF4A 1U33A 4PBGA 4UQEA 3F7JA 4R9XA 3ABZA 1HIZA 3KWSA 2JEPA 1E55A 1EJ7L 3GG7A 2R14A 1RBLA 3ALFA 2ZRYA 3W7LA 5AHLA 5AB3A 4TX6A 3EXSA 1Q6OA 1K8CA 1IWPA 2RDWA 5LIYX 4AD5A 1VRXA 3L5MA 1OCQA 1WZKA 4GACA 4Q4SA 3W7NA 1W31A 1DHPA 4AIBA 3FXYA 1LM1A 4GI6A 1Q66A 4QP0A 1GOQA 2WW5A 4F48A 1SMDA 2O9OA 3SCUA 3W2LA 3LGEA 3N19B 2WQDA 4YNGA 1MW0A 1Q63A 3W72A 3WO8A 3OGRA 4CU8A 2YZRA 2C16A 1A49A 4KH2A 3AS2A 4LVGA 3GRIA 3ATYA 3Q2DA 4JNYA 4S3EA 1QK2A 1B3XA 4MY8A 1J5SA 1LP6A 1PVNA 1OCNA 2WYSA 3SRDA 3VKJA 4W7UA 1LWIA 2EPLX 1R3YA 8A3HA 5M03A 3LCFA 4DX3A 1GTHA 1WDRA 4UZSA 3UJSA 4J9JA 1KV8A 1PIGA 3E1F1 1DWGM 3IRSA 2HSAA 3EB4A 3A9IA 4XIAA 3NURA 3CBWA 1BF6A 4UR8A 3W0KA 1QFEA 3ITVA 5FD0A 1TWWA 4F66A 5TBOA 3S9IA 4YLWA 4PUNA 2VZOA 5TNVA 3NPVA 4AX7A 2CBUA 1BYCA 2CYGA 1NM9A 4KCWA 3MKVA 3QHMA 4NKCA 2PPGA 3AJ7A 3UG5A 2PEVA 1Z9AA 4U5IA 2ZWZA 2OXNA 4BI6A 1XS2A 4QEHA 4ECLA 3GU1A 1FCVA 3NQGA 1XP3A 3RCNA 1FWIC 3NO1A 3W74A 1HVXA 1YTEA 4L9ZA 3AHYA 2CU0A 3RM9A 2CNCA 3AS3A 1W2PA 3NZGA 1S2AA 4TUFA 3AWNA 3WQDA 4FS9A 4RZ5A 1ADSA 3SCSA 3B9AA 3OQEA 4I5RA 1XINA 1PO9A 3BLKA 1YPIA 1HGWA 2WKLA 3W1RA 2QJJA 4R88A 5D02A 1BYAA 3YPIA 3BLOA 3HG2A 3DGBA 4O16A 5E93A 3N9KA 2CPUA 3BPWA 1LORA 1RCQA 4LAMA 1K1DA 2UBPC 5DBUA 3WDPP 1PX3A 5LIXX 4E4UA 4ZXLA 2WVTA 5CBBA 3MW7A 4ZMGA 3ARPA 4GVGA 4MUPA 4GBDA 1S2TA 4UFLA 3V35A 1I0DA 3TNBA 1IXOA 7XIMA 4CQ8A 1JPKA 2ATMA 1O4UA 3U2CA 4ADTA 4DJEC 5BRQA 3W1PA 3WG6A 4JTAA 4G1KA 3AICA 2D3NA 4Z2IA 1W6TA 2QVHA 2WZEA 2Z27A 4HBKA 3LTYA 3AO0A 5BU9A 4W7VA 1F61A 2NUYA 5HANA 3AXKA 1FCUA 2YXGA 3I3EA 3KOWA 3LN3A 1TG7A 1Q6CA 3LMZA 1KFEA 3ITYA 4EF8A 3IJ7A 2G3JA 4BQ4A 1I9CB 3GIYA 2IPFA 1E15A 2ZZ3A 2V3DA 1LL7A 4XBJA 5FSDC 5G4WA 4N9EA 1TPDA 5D2WA 2Z1SA 4HU3A 3TSDA 1W1YA 4R3UA 5E9AA 1AZ2A 2YR1A 2OO6A 1FWJC 3WUGA 2I9UA 1XISA 2A3EA 1BVWA 4LCSA 4P8UA 3W4RA 2FZBA 7PTDA 4QNEA 5K9XA 2YX0A 4L7ZA 1R7OA 1Q6QA 1YW1A 2VURA 2HE8A 4LEFA 5FL0A 1MW1A 1VC4A 3REQA 2J27A 4OE7A 4ZODA 4IIDA 5DLCA 2PTXA 3ZOAA 2YCKX 4FMVA 2I56A 3IGXA 5LNRA 2DZSA 1X1ZA 2VFIA 3QGKC 4DBUA 1JI1A 1B54A 3TJLA 3IJQA 1W9PA 4PULA 4AVNA 4EPBC 1JAKA 2BV9A 2X16A 3W87A 1QI2A 4ZGYA 2DSKA 5H1WA 1YHTA 4DF0A 4HN4A 3VMOA 1PIIA 2J7DA 1IEQA 5LA0A 4DAIA 1H61A 1I2RA 3BSGA 3PFRA 4XSMA 1DXEA 3E38A 3KVLA 5FF0A 2PRMA 3FSUA 1TPUA 2QMKA 4WSHA 3IARA 5FEZA 9CGTA 2PTZA 4QE1A 4AMCA 1FY6A 4LBSA 3H2CA 4S3AA 3NA8A 1V08A 1XFCA 1AJZA 3CEPA 4QE5A 5D9OA 1HKMA 2XJ7A 4RUBA 3W6LA 1G4PA 3PPFA 2RGLA 2PDYA 2BGQA 3OEXA 4JKKA 4GYPC 3GLCA 4WZHA 3LPPA 1JDEA 3B8UA 2JKPA 4MHBA 2FQIA 5F4XA 3L66A 4IT1A 1DWFM 1RVKA 4KETA 1E70M 3ID7A 3FAXA 3EDDA 5FAJA 1B3YA 4FX6M 1ONXA 3MP4A 4L80A 1EUNA 4EKJA 1MNSA 2W27A 2DV0A 4AXNA 2TYSA 4EXQA 4Q8NA 3WELA 3VXGA 1TZ7A 2PGWA 3MI2A 4DNMA 1HZYA 2DDXA 2W6RA 1VH7A 4YVXA 4S3FA 1VZWA 1EJRC 3R5EA 4IFKA 1J0HA 3GW0A 3TOPA 5CLWA 3TAKA 3EMCA 4LRTA 1ZQ5A 3PTKA 3RPTA 3VMPA 1E6SM 3CPGA 3NPWA 3PWAA 3W75A 1NWRA 2L5HA 1Z41A 4O28A 1DWIM 1AFSA 4X9YA 5I3JA 4FIRA 3SZ8A 1UASA 2ZA2A 3VNYA 3VZYA 4A3QA 3V5OA 4FA3A 1JRBA 2Z1KA 5CZJA 4RW3A 4Q7NA 3EOLA 3M5ZA 3OZYA 4HPJA 3BL3A 5AYBA 4FLSA 2AGKA 3PM6A 3KOYA 2C6QA 5DMLA 4DO7A 2WHMA 2QUNA 4XVDA 7TIMA 3TQPA 3FYOA 4HHMA 1SU5A 3AHTA 3WJWA 3UQNA 4HMCA 3L5AA 1OEPA 3TLLA 3OQ8A 1YPFA 2V2HA 5MHBA 3NXFA 3CASA 3ZS4A 2VHLA 2A5HA 1OHLA 4O14A 3VNZA 2D2OA 2KX9A 4ZBCA 4JCLA 3KP0A 3GG0A 3CUXA 3AWOA 3S1XA 3TKFA 4FX7A 5C7VA 1WO2A 2FVKA 3WNNA 3ZZ1A 2PDFA 5LGXA 5KZMA 1L0PA 4ACYA 3N2XA 2QGYA 4F3HA 3STGA 3F2CA 2JFEX 3H2EA 3QR0A 3WQEA 3REQB 3B04A 3GYEA 1F6KA 4H9VA 2NV9A 1NU5A 2J8TA 2PC4A 3WLKX 1FTXA 1U83A 4JTRA 4WKFA 3BCDA 1P1MA 3TV8A 3P82A 3QY6A 1TV4A 3UNDA 4RNIA 5KMYA 2FPVA 1Q6EA 1U5JA 2ZX7A 3T8QA 2CBIA 2F8QA 3TYDA 1RP9A 3OBEA 1Y8BA 2ZCGA 3BSHA 3V5FA 1JJKA 3ZQ9A 1BHGA 3CLWA 1TUFA 4GUHA 2FHCA 6XIMA 4O1DA 1T6MA 1KB3A 4X60A 2Q3RA 2E8YA 4LB4A 1K8XA 3LZ5A 3ARWA 3DC8A 4ROQA 1EO7A 3LV5A 3Q58A 2W4XA 4UNKA 3M7WA 1JUEA 1UP2A 2I17A 4S38A 1KC7A 5BXSA 5TQLA 3R94A 3SIMA 2QV4A 2BGSA 1NEYA 3LD5A 4MZYA 1S38A 1E9LA 4D6HA 1DTUA 4MB1A 3WNKA 4H8NA 3LHVA 3F2BA 4ASTA 2XN2A 4R85A 3RJXA 1KCKA 4UQCA 4UR7A 1FQ0A 1E1EA 5J5RA 4RKAA 3KTCA 5CPOA 5A8MA 2DSUA 3MYOA 1PTAA 4R34A 1DJXA 5DN1A 2Y5SA 1K8ZA 3LRKA 1JPDX 3DOPA 2G4FA 3FDKA 4B5UA 1GEHA 1TPWA 4GZ7A 1TE1A 4JY9A 5CG7A 1VBJA 1GZGA 4IFKB 2GGIA 2Z1WA 4MFEA 2GVLA 4XIMA 3B97A 3E2SA 1X8CA 4IWWA 2DH3A 3CUFA 4M80A 2FPTA 3CUHA 4DJDC 1SFTA 3LQLA 3NM1A 1A50A 2NQZA 1AJ0A 1KR1A 1OVDA 3UZYA 2E5CA 3QPZA 1W3HA 2OO0A 3FYYA 3HG4A 2DW7A 1SSGA 5DEZA 1GUVA 2WXDM 5JVLA 2E25A 4JTUA 3O16A 1ZRQA 2E40A 1JDDA 2PMQA 5B80A 1Z69A 1QNRA 1F7BA 2E9BA 3KDNA 2ESCA 3FIGA 3CK5A 1EJXC 1GQIA 3EX3A 2YOCA 4FF5A 3OGVA 4CCEA 4IJCA 1DJGA 3P67A 2PLJA 2VZVA 3AHZA 4Y9OA 2HVNA 1Q4WA 3IGHX 3WD0A 3PC0A 2I9EA 4EE9A 2AAAA 3W01A 3DHPA 4V33A 3PTDA 3NEVA 5I06A 1OG6A 1K7FA 3W25A 1WDQA 1WZMA 1EC9A 1X6NA 5AC8A 4TV5A 3RU6A 4DM1A 2Z1BA 4U5KA 3PUOA 1RZMA 3MTWA 1IR2A 2H8ZA 3G1FA 2HNEA 4KQNA 1C3FA 3CPUA 3EWWA 1REQA 3SY8A 1UKPA 1OC5A 1VYRA 3HF3A 3FEMA 1AUSL 2FFIA 1L6FA 5AYYA 3GG1A 2RJGA 5DBTA 4NIRA 4UQBA 1UD2A 4B5TA 4CEXC 2CLFA 1K9EA 4UXDA 4UNLA 1B1YA 1XLJA 3NDOA 1ZCCA 2YDRA 1W5NA 1ZGDA 2F6XA 1K9DA 3W07A 1GTEA 1M3UA 4G6CA 2ZUVA 3VINA 4KWOA 3K46A 1TRDA 3CTLA 1A80A 3TOYA 1W37A 3UWYA 1QRQA 3IUIA 2XIBA 4H7ZA 4RW5A 3VIGA 1TV3A 4AC7C 5BZAA 4LVBA 1SFLA 1UWQA 1M7PA 3KVJA 4LY4A 1DTNA 4GY0A 2BB0A 3WLLA 3P81A 1PZ1A 4ICMA 4PBFA 1E1FA 4O18A 3LXAA 4XSLA 2PWGA 5CPQA 3A47A 4H6EA 4FNPA 3CIWA 1UP3A 4YU1A 4GD0A 5D09A 1OY0A 5CPMA 3UA3A 3EMZA 3EA1A 3EDFA 4J3VA 2EG6A 5FJRA 1H49A 4IMGA 3MUAA 3ALGA 2F7FA 4NNAA 3QC0A 4D6EA 3GTFA 2WNQA 2DT2A 3CPRA 4IGMA 2EF9A 1XYLA 1O5QA 3BSMA 3VCRA 4NY2A 4X2RA 1E0UA 4YPJA 1CW2A 2CFFA 3VD5A 4PMOA 1ZTVA 2ZXDA 1IIGA 2VCAA 3G77A 5DF0A 3W27A 3VOIA 3BK0A 4A8RA 3FN9A 4MJMA 2FZDA 1JUBA 4L4PA 1ME9A 3WUBA 4W85A 5HQMA 2EHHA 3WDHA 1XX1A 2CBVA 3CUJA 3A23A 4XAZA 3V1HA 4DJFD 3F2DA 2E6AA 3GBDA 3PAOA 4WD0A 5LXXA 4P5UA 2D3LA 2ZE3A 3WKZA 2GJPA 5C9UA 2WBKA 2PC8A 4AQLA 1H5YA 5BOFA 1WDSA 3IEBA 4I9JA 5E6YA 4AD2A 1HX0A 3WBAA 3LDVA 4IL2A 1M7OA 3VPLA 1QOQA 1W9DM 1VFUA 4GMEA 4QDPA 4ZTXA 2VELA 3BJTA 3WQFA 1XQKA 5F2IA 1XXXA 4D8AA 3K4WA 1HKJA 4C6IA 3MZ2A 4M0XA 1YNPA 2W92A 2X09A 1EUAA 2GSHA 3THCA 1MO0A 3R1ZA 4BF5A 4HD5A 3ZT7A 1H63A 3S6TA 3P61A 3FGCA 3AS0A 1Q8JA 5U4NA 1FWFC 1ZBCA 4U2YA 5E6ZA 2RKXA 5HJYA 1OK4A 3PPHA 3QZEA 3ITXA 4OUEA 1TV2A 3PPGA 1ITUA 4AZIA 3VDHA 1KXQA 1U30A 2GDVA 3R25A 3NJ3A 2IQ0A 3RUBL 1REQB 4EXAA 2XU2A 3GDKA 1IR1A 3BCFA 1G01A 4DVOA 4WY0F 1LUCA 1XUUA 1VEPA 3CYVA 4OHQA 1IXQA 3UCDA 2DVXA 1CB7B 3IS4A 1MEWA 3MCMA 4JQAA 4PTDA 1L6SA 3HPXA 4GG9A 4C6NA 1EOKA 2WNNA 2EPKX 3R8HA 3THDA 4M6VA 2A3LA 3PZMA 4WJXA 4K7VA 1DWJM 3MKCA 2ZWYA 4AW7A 4AY7A 4EOUA 3RX3A 2G3MA 1MSSA 3KWXA 5CAKA 1LL6A 1DJNA 3HGOA 3P14A 4TMCA 1PCKA 5XIAA 3DFYA 4UCFA 2VJXA 2VKZG 1W2VA 3RX4A 1VLWA 2QPUA 3TYBA 3VM7A 3HA1A 5HOSA 1FDJA 3VOHA 2VEMA 4GZEA 4HZ7A 3VFLA 3C86A 4Y6GA 2VR5A 3SGUA 3WENA 2QLYA 4GRSA 3MB9A 1GHSA 3EBVA 4DUOA 4R9OA 2IKJA 4ZO7A 2NUWA 4B91A 5H8MA 3HFYA 2VTFA 1AW2A 1FFQA 2I57A 1TPVA 2ISSA 4YS1A 1T99A 5F2MA 3K1GA 4LCRA 2WM0A 4ATWA 1V93A 1R3RA 1J10A 2VP8A 3K4AA 3FV9A 4HPHA 1JDCA 1HVQA 1JRCA 4M56A 3TYUA 3N1AA 5CPTA 1KCLA 1E51A 3LQGA 4GYPA 2DZPA 1G1YA 3IV8A 3GO2A 3GNNA 4BK9A 3VE7A 5FOOA 1TJRA 4GY7A 4I7UA 4PUDA 4PTMA 3W29A 3MMTA 2ZUNA 4KCVA 3RF9A 1RALA 1WKEA 1XLIA 2WC4A 4FNRA 1M5WA 4FXSA 2V68A 3LPOA 1M9HA 1J18A 2XGZA 1R7AA 1IEVA 4B9ZA 4QAWA 4ZFMA 1VCFA 4KWWA 4WF7A 1FP8A 2CLPA 4MUZA 1KFBA 2FHBA 2V5JA 2NWSA 1UUMA 3VDAA 1B30A 3GNDA 1JDAA 1OFQA 1QMLA 1KLZA 3BZGA 1UYQA 5DQPA 4O13A 4RDYA 4CQDA 1UOZA 4K2SA 5K2ZA 1IZKA 4J3UA 4DN1A 2X2GA 1R2SA 4JFTA 1QUMA 3EEGA 4AHPA 1JZ4A 1ICPA 3KRBA 2QVNA 2XIJA 3QQ0A 5E0KA 3CYJA 1B3OA 2QR6A 4J35A 5G1MA 4YWIA 3HM7A 2VX4A 3W1TA 3A22A 2V82A 4DI9A 4K68A 1XWYA 4BZYA 4H9UA 3H4WA 3FGCB 4IUOA 3AAMA 4Z2LA 2A21A 4AZCA 3AXXA 3ARUA 1DIOA 5A2CA 4JICA 4IGHA 3SBFA 4OV4A 1XC4A 3GHSA 3LZ3A 1GOOA 2HXUA 2WKJA 3ORWA 1VRDA 4DPQA 4DHGA 3NO5A 2XVLA 2A3CA 3UR2A 2JKAA 4LYKA 4AZGA 1R0MA 1O68A 4AF0A 4FAMA 3W7MA 1TJ0A 2W66A 2VXNA 3PB2A 3W84A 3CL7A 1LUCB 1KTCA 1GKPA 4ZQRA 2CZFA 2GUBA 2MNRA 1EX5A 2WNZA 2PFHA 3KM8A 5LNWA 2QIIA 3S3GA 3AXHA 4S3DA 3WUFA 4OBTA 1G6CA 3QZ6A 3GHRA 2CCRA 4US5A 4JCMA 5ABHA 4TQTA 2VX5A 5EMJA 1RXOB 4C6PA 3H54A 2VGBA 2NUXA 5DY3A 2YA2A 1OFAA 4NX0A 1EA0A 4O19A 4PMXA 3EDKA 4KF1A 3IVTA 4HMEA 3HG3A 3GY1A 2VCCA 1CPUA 1CT5A 3PNUA 3VNMA 2BODX 2ZRXA 3FA3A 3C56A 4MJ4A 1MW3A 5KZ6A 3DI0A 5C55A 1PTGA 3EPOA 3NL3A 4WUIA 1R3VA 3T2OA 3M7SA 2F61A 2DSZA 2FH8A 4HVXA 1PV8A 2VEPA 4MWAC 5FJIA 3W2UA 3DC0A 4O8AA 3SN0A 3ZO9A 3GWQA 2J79A 1L6GA 3VA8A 4WRHA 3MHGA 3WIJA 4A8NA 2R1KA 4ROPA 1OGGA 1FWRA 2Y63A 4GQBA 2V2CA 3ARRA 4GH1A 3GVQA 2VEKA 3AIUA 1A5UA 4Z1YA 1R3QA 1VJSA 2P88A 1VFMA 4D2JA 2ZBTA 4TU1A 3SW6A 3GH5A 2A3AA 1GQKA 1Q2SA 3URQA 2ACSA 1UR4A 3S4TA 3FJ6A 3AZRA 5CPNA 4GX8A 3NPUA 4MB4A 3UERA 3IIOA 1WXZA 2Y6ZA 4QJ1A 3UR7A 1M7XA 5M2FX 1TCDA 4Z1DA 1P0DA 3SCQA 1NIUA 1XGDA 3B0PA 2WMIA 1F6PA 3O15A 2R82A 5HA7A 3MT1A 4IISA 5H2ZA 3DFNA 4YWSA 1DKWA 4PFMA 1GOWA 4L56A 1R3SA 3S2LA 3MY9A 2VCBA 4OBRA 2CWNA 2BGNE 3ES7A 2BVWA 4DJDA 1H3GA 4MAVA 3EMQA 5AC4A 4GOAA 3N6QA 1SO3A 1EXPA 5HWNA 2NWRA 3UG4A 1TV8A 3VABA 2Y88A 1GVYA 1UWRA 2E0PA 4BS0A 1A5MC 2C19A 3MP3A 3UYIA 4OWGA 2B7NA 1DJYA 3GR4A 1DJIA 4XZNX 4AZCB 2HK1A 1BAGA 3O6DA 4UC5A 3PSWA 4P8VA 2V9DA 4ZOCA 3HURA 2VGFA 1HJQA 4QSFA 5K9CA 3KCLA 1OSEA 4N4PA 3F4NA 2WM1A 3TTSA 1F2JA 1SM9A 3S47A 2OWXA 3APGA 1DPMA 1UKQA 5I3GA 1EGVA 1J0KA 3PY2A 4E2VA 2PB1A 4LBUA 1XICA 4AF0B 5E5CA 4AFYA 1XLCA 3OLDA 1CGUA 1OGBA 1Y5VA 1YTDA 4M6UA 4CD5A 4IFRA 2I5IA 1KM2A 2V69A 3WLHA 3TIMA 3E0WA 3ONBA 4JTKA 4Q4OA 4WGXA 4KRZA 5I07A 3E2VA 2VVNA 1XJBA 1RA5A 4M6PA 3PZOA 3AMKA 1B5TA 1NP2A 3T1GA 1T5AA 4AIEA 5CBJA 4UFMA 1W1IE 1ZP3A 5I7GA 2FHFA 4PH6A 4IH3A 2E6DA 2NQ5A 4W5ZA 1JYXA 3URBA 3A12A 1XDJA 1JI2A 1Q7ZA 3FA4A 5FEPA 1M03A 1WAWA 2J24A 3WF3A 3QN3A 3UXKA 3CC1A 4PTNA 3L4YA 1EHNA 2TRSA 4PA8A 4LS2A 4QIUA 1W9UA 4LC6A 5AHNA 1LTDA 1JDFA 1ELSA 2QIWA 3EX6A 4O4VA 1IGSA 4D8ZA 1MXGA 1MW2A 5FF7A 3QSRA 1W1ZA 2O92A 3SCRA 1CLXA 1RA0A 1XIDA 2JF6A 1HKWA 5REQA 3I6EA 5CKSA 3FDGA 2W63A 4ZO8A 4BQ2A 4ZQMA 2EXOA 3NO3A 4JTCA 4XZBA 3TUUA 2W91A 1UZHA 4OIFA 1DXIA 2QS8A 4Y7EA 5IFPA 3PZNA 1MUCA 3BLFA 1BKSA 4WY0A 1OF8A 1P0EA 3N4AA 3DERA 2J7EA 4H6KA 4IFOA 4GO9A 1OIMA 2XZ9A 3GQYA 2ZXQA 1L2UA 1E6NA 4QRNA 4GLEA 1A0DA 3GNOA 4PTVA 2VX6A 3SAZA 4RV8A 1UWUA 4XTDA 2J7GA 2WVUA 1AH4A 4EX4A 3FHAA 2HQAA 2E9MA 5H8PA 1PYMA 4FNSA 3OB8A 1KFWA 2OKTA 4XO6A 1OJXA 1RBOB 1KXHA 2WMIB 2ISFA 1LBLA 1UD6A 5L9FA 1EIBA 1VFTA 2OSYA 1NAL1 1ML1A 3WDJA 5CSYA 1GKRA 4WSKA 1LRNA 2VFEA 1B3ZA 3KL0A 1FWNA 3ZXWA 3I7SA 3QQWA 3U7BA 1B4KA 2AKZA 3U9IA 3VKDA 3SO7A 1XYMA 3RLHA 4DXVA 1NELA 1EP1A 5DRCA 1JPIA 1Q7QA 3QR3A 5C9WA 1US3A 3HJZA 4PUKA 1HO4A 4M7TA 3Q4DA 2YDQA 1V7YA 3I6RA 3WDIA 4O57A 3B05A 3T2PA 4XZMX 1QWGA 4D9PA 3I7QA 4D6CA 4PSPA 5F1UA 4A22A 2QHAA 1PZ3A 2YFOA 2DEPA 3UZWA 4L6OA 2P0IA 5D32A 2ZZ6A 3M0MA 3R7MA 3UPWA 1A5BA 1SJAA 4JIIX 1EGZA 2ZUSA 3AIVA 2E67A 3VOFA 2VI0A 3QKZA 2Y7DA 3W1LA 4BF9A 3LSBA 1KFLA 3W2JA 3L4UA 4O0KA 1YBQA 3OPSA 4KMQA 1HL2A 4PCNA 2PDJA 1H62A 3F5JA 1S5NA 4B3ZA 1RUSA 5A6BD 1G4TA 2VX7A 1VQTA 1FWWA 4CCCA 3ZMRA 1UKOA 2G3NA 2YLAA 2GWNA 2DQXA 4A21A 1V77A 3TR2A 1IHIA 3NZ1A 1BTMA 3CO4A 4MM1A 3WD1A 2GDUA 3UNTA 1PKYA 3WQ5A 3LG3A 1BXBA 3B03A 4AEOA 2HDJA 4HMDA 2QDHA 2GDQA 1A4LA 1TE6A 1H5VA 4YCOA 1R8LA 1UG6A 4AVFA 3IVUA 4DM2A 2IS7A 4W7WA 3L0KA 3A21A 3W7CA 3W53A 1XLFA 3OZOA 4JDYA 1TKKA 2BXVA 3IK2A 1X7IA 5REQB 4R5EA 1WDDA 1X1NA 4ZL1A 1SUXA 3WQ8A 3ZSTA 4JN7A 3L0GA 1YE6A 3LTSA 2OX4A 1K03A 2X05A 2JK2A 1J11A 1UWSA 4HA0A 4X0VA 3JR2A 3UXIA 4JAWA 5KSWA 4GYKA 4WY0B 1ITCA 4NF7A 2A85A 3VD7A 1F9CA 4M81A 4AAJA 4C7GA 3E6EA 5DT7A 1LOQA 5FCZA 1GVIA 3UZZA 4V1YA 4W4QA 4H6RA 5LNVA 4LH8A 5E0FA 4K37A 4PB4A 4GZIA 1H1ZA 1GJPA 4PL1A 3LGGA 5FJJA 4U31A 3KBNA 2CHOA 1G5AA 3WDQA 2ZC1A 3CZEA 4QITA 2YCLA 1UJPA 5TIMA 4TXEA 4J2PA 3AXIA 3G0UA 2OWWA 4TVUA 5CSSA 4XZLX 3WBEA 3ARZA 1UCWA 4CNTA 2RGMA 1KM1A 3E5PA 3JZEA 2VEGA 5E1QA 1TRIA 5CGMA 1CI1A 4S2BA 3VM5A 3KCJA 4JN8A 2OR2A 3ZSSA 2ALRA 3ZLFA 3SRKA 2WJEA 3D47A 4JKMA 3EEZA 4RLIA 3P8JA 3TYAA 3AMGA 3WD4A 1HT6A 5A6JA 4ZR8A 2A6NA 1OT1A 2WSKA 3EX2A 3TC3A 3FSTA 4MYXA 2QV5A 2BWGA 2WOQA 1KTBA 3BE7A 4FR1A 2NQJA 3A3WA 1TZZA 4ML9A 4CN6A 1FKXA 2F9RA 2KAUC 1Z7AA 4K7YA 4Y90A 1QNVA 3RLVA 4RPQA 2QULA 2BMBA 4XWUA 4LVDA 4PRTA 2Z2AA 2XH2A 1EF3A 5MKGA 4BCEA 4XZIA 4JEQA 5FESA 2DIEA 3ZM8A 1CBGA 3CAQA 4RDZA 2VZTA 3QLLA 2PCEA 1OFRA 3C2VA 3MI3A 5I0DA 2J7FA 4LUSA 1K3UA 2REQA 3NSMA 1JZ3A 3UA4A 3QMRA 3W7RA 3P5ZA 3ARQA 1Z8AA 4L1GA 4H01A 3S46A 1O5XA 1EH9A 3AUJA 2Q3OA 1IGWA 3CZGA 4X2PA 1KBJA 1YBQB 2IMRA 5JU6A 5HK4A 3WK0A 1V0KA 2PLKA 1EWDA 1SO6A 3STPA 4IMDA 1LOSA 5D04C 4LALA 3CEUA 4PCTA 3RJYA 1HXJA 3R89A 1QNSA 1XPYA 4JQ1A 1CIUA 3TQ0A 2X30A 5I3KA 1J0ZA 3LMYA 2Z4GA 4Z2JA 3D3FA 1QW7A 3L23A 2OQHA 2QPXA 4QLJA 4NHVA 2OELA 3URAA 2EJAA 4E2BA 1GPFA 2Z1XA 4LSBA 1VENA 1KV5A 5HUOA 3RGTA 3CMJA 5G1YA 2DVTA 2WJDA 4K38A 3G3DA 3N6JA 1EZ2A 1IT0A 1XDMA 4F0RA 1KFKA 2W3ZA 4HK7A 1JCYA 1KXTA 4QISA 4DIAA 1DL3A 5FA5A 3HV8A 5K3VA 4E5TA 3MYPA 2NX3A 3E49A 1LWJA 1R2RA 4MWAA 3G1RA 2XVGA 3E9AA 1GJWA 4JL2A 3WLJA 3CU2A 2OEMA 2R24A 4NSBA 1K6AA 1R6WA 2OB3A 3CQJA 2J13A 1F4AA 1EQPA 2Z24A 4JTEA 3LXBA 2VUNA 5EA9A 3RRXA 1LQ2A 4UOQA 1E4MM 4J3TA 3FFSA 1BSLA 2ON3A 4KFOA 4LF1A 1C7TA 4ZOAA 1TIWA 2C3ZA 3GXIA 3VC6A 3GXMA 4AEEA 2XUCA 2XSXA 5CZSA 2YCLB 2ZXAA 3N2BA 3R6IA 3TA6A 1VS1A 1RK6A 3DBNA 1MRAA 2UZ9A 1QHPA 3BWWA 3P2VA 3H22A 3BTNA 2ISDA 3EA2A 3QYSA 4ALDA 1G4EA 2VEIA 4KERA 5A95A 2JIEA 1PL9A 2JALA 2YIHA 3BMWA 3M5YA 3G1DA 3TJ4A 6A3HA 2ZZ1A 1HQTA 4UFJA 4W86A 2Y0FA 3LTPA 3LENA 1P4CA 2NLYA 4XBSA 3ZT5A 5EU9A 4IL0A 1GQNA 1NWSA 5BU6A 4OUIA 2Z25A 1O5KA 2VMFA 4RE3A 4CN4A 2J8GA 1VHNA 4Q8QA 1VPQA 4E4PA 4QEEA 4UZUA 5JMUA 3WLRA 4MB3A 3HMJG 4A8IA 1DJQA 1YQ2A 3QV8A 3U2OA 2Y5EA 1XLDA 4B3KA 2PF0A 4PL2A 2XSBA 2P3EA 3BGJA 4W8AA 4O11A 1ZAIA 5MKGB 1LQ0A 3NTYA 1VKFA 4EANA 3C3NA 1YX1A 1AVAA 4P7QA 1KXVA 3P7YA 5AVHA 3Q94A 4LUSB 1JF6A 1JYWA 1T8XA 2REQB 3VMNA 2CC0A 1UUQA 3MHUA 3G6MA 4IMCA 7ODCA 1OG0A 2VR2A 3AIQA 4H83A 5G2HA 3KOXA 1KO0A 3M0VA 1XDLA 5FI8A 2FB2A 1H7NA 2NVCA 1HF6A 5ENLA 3NDYA 1HL8A 1VAHA 1NVMA 1X8FA 3O0FA 4I3GA 4IQDA 3H6OA 4INFA 3CUZA 4MJ2A 2P10A 3U57A 2V63A 2P0OA 5DCDA 3N18A 2DZUA 3ABQA 3PBUA 1J6OA 4CNNA 3G8EA 4LPCA 4H41A 1G69A 2OGYA 4RXFA 3AISA 1TVLA 4X3ZA 2CHNA 2ZXBA 3W2MA 4C6LA 4HYRA 3DN5A 1KFJA 4Q8OA 2WAGA 4TIMA 4A4AA 1LRQA 2V5DA 1H60A 4QM1A 3RG6A 3D5HA 1RCXB 4FF7A 4BQ3A 3ZWTA 2IUZA 3CB3A 1YADA 4HZ8A 1V3KA 2GOKA 2PS2A 3XINA 5BMXA 3NSXA 2GJXA 1U1UA 1FCQA 3PZ9A 5DCEA 5C8BB 4I9MA 3OBAA 3WNOA 3ZVHA 4KESA 1FHDA 3GHTA 1ZALA 3PSVA 4WDXA 1XRVA 1WKYA 4AD3A 2R9RA 1XIEA 4QCEA 1XKJA 2DORA 4MWAB 1Q7MA 3LX9A 1CNVA 5FACA 3MKKA 4FALA 4Q4PA 3M5XA 1H4PA 4KW2A 2Z6IA 5AN7A 2PD9A 2WWCA 1J12A 4I6KA 1OX5A 5D8WA 4KT2A 2IQDA 3GHUA 1QU4A 3KCOA 3QZAA 4C6CA 1EC7A 3RRAA 3G0SA 1YDYA 3PULA 2VDIA 2DP3A 5FJTA 3HTWA 4ZO6A 2IKGA 3UZJA 1YDVA 1V3JA 4PYSA 3BMXA 1H7OA 3AJXA 4UCGA 2J7BA 2BVTA 1MUMA 2V30A 3POCA 4UQAA 4WGHA 3S9YA 2OPJA 1E56A 3DFQA 5CC6A 4US6A 4FI4A 4LJ3A 3OW1A 2ABBA 4J1OA 1OIFA 1VIZA 1XIBA 3UWWA 4UQDA 1XG3A 2AMGA 3EWZA 1E0WA 1JFHA 3OU8A 4HHPA 4DXXA 1F3EA 2WMGA 1EDQA 8CGTA 4XUYA 4HT3A 3EXRA 5T8GA 4DB7A 4PGLA 1PX8A 3WEMA 3B0VC 4AY1A 2C91A 5C2XA 1P6WA 2FDMA 5FF4A 4AUBA 4PUMA 3RITA 3NCOA 1U22A 3T40A 2ODOA 5CXPA 4H2HA 2Y4SA 1TB3A 1ZENA 1NDVA 1QI3A 4U28A 2NX9A 1R9XA 5EFFA 2C8NA 2PU1A 3EYPA 2E5DA 5G1TA 4YVPA 1QXLA 2WMJA 2J74A 4MNLA 3W7GA 3OLIA 2JBMA 2W5FA 3OVGA 3RK8A 4FX8A 2A3BA 1GVRA 3V5CA 5CAHA 4MKNA 4O1CA 1O6IA 4D8LA 4BI5A 1E6PA 2OZ3A 2E7FA 5D2XA 3FKRA 2PA6A 1MXDA 5AHIA 3MANA 2GQ9A 3GX9A 4DYKA 3R43A 5HMEA 1ICSA 2E1WA 4RE2A 2HNHA 4R7WA 4RXGA 1FHUA 4LVFA 5A8OA 1FP9A 3N12A 5GNXA 3CQKA 3OA3A 3TW6A 3NOEA 3SFWA 2QYGA 4S39A 1IQ8A 5D9NA 3AMDA 2G95A 1JPHA 4XAGA 2ZRUA 4F2TA 5BRBA 1XIMA 1G0CA 4CU7A 1LWHA 3E5BA 3NQDA 4TR9A 1V3IA 3EKLA 4NAEA 3W1MA 1P6BA 3RM4A 1RY0A 2EAWA 3F4CA 1K7XA 3QV9A 3W38A 1ZB5A 2CITA 3TSMA 2PWHA 3RM8A 1OD8A 1GVFA 3UJRA 4QAIA 3T6CA 4XKYA 3RMEA 4PEKA 4Z1AA 1VFOA 5IBXA 2GJXB 6REQA 4N02A 3KLKA 1I8JA 3P6LA 3W37A 3F4VA 2JKEA 1UH3A 3KE0A 1A5NC 1BD0A 3SFKA 4FNQA 5AYZA 1VR6A 1WOBA 3H4GA 3O06A 4NVTA 3SI9A 2CZVA 2DFAA 1MDLA 3SCPA 3GXDA 1A5CA 4CNSA 4K8GA 1YPXA 2D2JA 1I2NA 4LVAA 1V51A 3C0LA 4MWAE 3ONCA 3C2OA 1XCFA 3H2FA 3CLMA 3UPBA 4LB3A 3WLTA 1YNQA 2VC5A 1OX6A 5CZ0A 1QDSA 1YXYA 4E3TA 3QMTA 1UIOA 2Z6JA 3GVVA 3TR9A 3L2LA 3E74A 3SB0A 3M64A 1LLZA 4DBEA 3QPYA 2D1ZA 1OM0A 3GD6A 3UD6A 3F03K 3ZLGA 4DYJA 4J3XA 1JQXA 2OEJA 3JW7A 1L6WA 3VOGA 1TQXA 1R3WA 1KRCC 4WDUA 2YL6A 1I6NA 1XV8A 4GGHA 1Q8AA 2R6OA 5D8ZA 4GI8A 4IM4A 4N4QA 3OHIA 4UTKA 3O07A 5C5YA 5CC7A 3AOFA 3V4BA 2Y7FA 4L5ZA 1P5BA 3QRHA 1HJUA 5JXQA 3UP8A 3IAPA 3BZJA 3VILA 5D30A 1EJVC 2O9RA 1TSIA 4IMAA 3A9BA 3SJNA 3N4EA 4ZQPA 1H0IA 3OZMA 1A4MA 2VWSA 3CAVA 2A3HA 3CMFA 4Z42C 3MVTA 1K9TA 1UMYA 1MVYA 1FCBA 3TYCA 1TVPA 2GUYA 3TQKA 3LB0A 1PZ2A 3E2QA 1D2KA 3UVAA 5HMDA 1SFSA 1JZ8A 2WMKA 5CEWA 4D6JA 3C4UA 4XBKA 7REQA 4L9YA 3RR1A 4JX4A 3INPA 1MQRA 4O0ZA 2YZ5A 3B8VA 4P61A 5BOOA 3QM3A 3ANYA 1BGAA 4ZEPA 4HOZA 3CUIA 1W1TA 1ADOA 3M46A 1WPCA 2E3ZA 1A3HA 1IWBA 4C6DA 2Y8UA 4QROA 3UWQA 5J04A 5BCAA 3CZLA 7TAAA 1JIBA 1S39A 2FJKA 4QJ3B 3MJMA 3LERA 4HMNA 1WXYA 5BROA 1TTIA 3CZKA 2VFHA 3W28A 3AZTA 4OV9A 2I16A 3PANA 4Q8WA 1L2QA 3FX4A 4UTHA 2WMHA 4GIAA 2V5BA 8TIMA 1KKRA 3OA5A 4HN8A 4US5D 1S2WA 4UOJA 3M07A 3HGSA 3QOKA 1XKYA 3LM7A 2H9AB 4MNKA 2ZRWA 3M43A 4LCQA 1O95A 3LCWA 4G7EA 4DBWA 3N29A 4CCDA 4NAEB 4NXSA 2J9ZA 3UBPC 3PBVA 2NLIA 1UR0A 3HPAA 4DWDA 4Q4QA 5EGRA 3FA5A 2PI6A 2JGQA 3ARTA 4GZJA 4HU0A 1I4NA 4XKYB 5A94A 4DJFC 1FHLA 4GYJA 4LUIA 4DUWA 3TCEA 1AMKA 2B7QA 2E68A 2WZMA 2H3BA 1KCZA 2Z2UA 5BW6A 2W61A 4F9JA 1ZJAA 5CCZA 2CXGA 4FEZA 1UC4A 4PCFA 1DHKA 4I5UA 3CT7A 1KTNA 2QZRA 3VI2A 4I7WA 4MMWA 1N7KA 1VHCA 3KBVA 3LHYA 2D20A 3GU2A 4M1RA 3DHUA 5FL1A 1I45A 2V38A 3IIVA 3SUVA 4FXFA 3QYQA 2XH7A 4JTQA 3KRZA 1OCBA 4HNUA 1GVSA 2WJFA 2EEXA 1J4EA 3WK3A 5FIPA 3DG6A 2QJHA 3BJFA 3TP4A 1EJTC 3PB0A 3PG8A 3CQIA 5D4YA 3EA3A 4W93A 4H9MA 4LRSA 1IIHA 2O7SA 1XIGA 3VIHA 3BAXA 2XVPA 2NVDA 3VDBA 4Q8PA 1JZ2A 1AZ1A 3PS7A 3WJZA 1G67A 4GJJA 2P50A 4L61A 1OADA 2QXWA 1QWKA 1AG1O 3SCNA 3QHNA 2E9LA 1W0MA 3BGGA 1E40A 3H70A 2O7QA 4QX4A 1ZHAA 4AYGA 1ZLPA 5AC6A 3MZNA 4O15A 4WSJA 3R0DA 5ABEA 4PE8A 4PUWA 1FA2A 3U4AA 4Z2HA 7CGTA 1GEQA 4DJDD 3U7VA 2KZHA 3KX6A 4E8CA 4KRUA 2NQHA 1T96A 1R85A 2POTA 2QCDA 3FW6A 4LXFA 3WF1A 2X40A 1RBAA 1NDWA 3CAWA 3PN8A 5C2CA 4M29A 4HA3A 2OZTA 4MJZA 1PWLA 3TTYA 3IJDA 1FDZA 3H2AA 4B4FA 2VFGA 3BOLA 4I5XA 4MKVA 4NJHA 5K9DA 7ENLA 4N9DA 2O4MA 4A3UA 7REQB 4LS0A 2Y2WA 3K13A 1IT8A 4WJEA 1OFOA 4AWSA 4ERIA 3HQNA 4IQEA 4ZENA 1ALDA 1EQCA 1Q4NX 2BOFX 5HULA 3NL2A 2AOSA 4RNJA 3NDZA 3CHFA 2FZ8A 2BLEA 3TN6A 1FWHC 1O94A 4OOZA 3DH7A 4XUGA 1JL8A 1R47A 4XKMA 5I03A 5A8NA 5E0CA 4MB5A 3O63A 3QW4B 4MG4A 3UU0A 3IPWA 4S3CA 1EC8A 3WFZA 3AFBA 4FNUA 4HYWA 2XGBA 2UY3A 4GCAA 5DELA 3IUHA 3KAOA 4QJ4B 2J6VA 3ISIX 2QW5A 2NT0A 2OVLA 2AL2A 1YYAA 3NQ8A 1U1JA 1XYFA 1LL4A 4JBRA 4O17A 1NWTA 4S3KA 4FZIA 1XL9A 2O0TA 4UTTC 4KPLA 4TV6A 4GUIA 3U2ZA 3FCPA 5CSRA 1IEIA 1QT1A 1KRMA 4UTLA 4G7EB 1PS9A 3B3DA 4V2XA 1R46A 3S6OA 2AMXA 3K30A 2BXZA 3IVSA 4GA8A 2XFRA 4NRSA 3W7PA 4H00A 4LNCA 1DWHM 2ADAA 1CGXA 4KFPA 1SPQA 1E3ZA 3RCYA 2WJZA 3SSJA 1PIFA 2V8ZA 1A5LC 3L68A 4NU7A 1DQXA 3GK0A 3NGJA 4N2YA 3QHOA 4NQ1A 3CL8A 3V0TA 3ERPA 2NVAA 2G50A 3EWBX 2OYMA 4B5VA 1UUOA 1YE4A 4CNPA 4D6DA 1VEOA 1UWIA 2R1MA 4MLRA 2ISVA 4QHRA 3KVKA 3TVAA 1QPNA 5IHSA 3NQ7A 4EACA 3B4UA 3GM8A 1LDCA 2Y8VA 1B31A 3PBWA 3SY1A 3G5EA 2WHLA 4NJIA 1XLLA 1EF2A 1RD5A 3W73A 2Y89A 1Y65A 3TEVA 3EAUA 3WLOA 2I1OA 4IQLA 3B8DA 1L8PA 3DZ1A 2BY0A 2YPIA 3G1VA 4F8XA 3T07A 3BW3A 3HG5A 1E6QM 3M1ZA 1WAUA 2PSNA 3A4AA 2PP1A 4K3ZA 3T0BA 3B40A 4MZ8A 4NI8A 2DIKA 4UTMA 1ZJBA 3GDBA 3SURA 3MUCA 2P53A 1PDYA 3WJYA 5KZEA 5A6AA 3E96A 4IPPA 3RFAA 4UTWC 4WEVX 3TZNA 2XFYA 4GBUA 5EYWA 2QCDB 5K4XA 3UEQA 2YW3A 1TPB1 1VBRA 3AROA 4HSOA 2OCZA 3WZ0E 2ZX9A 3G0XA 4PC8A 3MHFA 1J01A 3WD3A 4ML4A 1HP4A 3D3AA 4QR6A 2A7RA 1KBBA 3OP2A 3BICA 1WE5A 6TAAA 3ABSA 4NT0A 5MF5A 4WR3A 2VRJA 1V6UA 3G3MA 1XIHA 1WB0A 1VYSX 3GH4A 3GC4A 4MOZA 2Q8ZA 3DYPA 3CL6A 3O7UA 1XBVA 3DKJA 3WL1A 4M7SA 1VIWA 4LEQA 2QUUA 4J27A 2NQLA 5C7HA 1Q45A 3WSUA 3JUGA 1AD1A 3KVMA 4RDWA 3DFPA 3SY5A 4ENLA 3ARVA 4HQVA 5C54A 4LUTA 3K2GA 5GJNA 2VT0A 2V3GA 2AL2B 2OSXA 2VM8A 4OKDA 4KFNA 3ZT6A 2F6KA 4TOQA 4ERGA 3JS3A 4GHRA 4M24A 1P1XA 1M04A 4B4HA 1W3IA 4AWEA 3MQTA 3C2YA 1SMAA 1D9EA 4O1BA 4QLKA 5PTDA 2JF7A 5LHEA 1PBGA 1BWLA 1XCXA 4I8YA 3QKEA 3B8IA 4YTSA 2YCIX 2ZYFA 1V79A 5AHFA 3UESA 2A79A 4JD4A 2HS8A 3HZ3A 3VVGA 3W82A 3S2CA 1N8FA 5KITA 3RILA 1HJSA 1CECA 4GNVA 3HIJA 5GJPA 2GSJA 1Q5MA 1WDPA 5I24A 4TX8A 4C1KA 2Q01A 1Y7VA 3EOEA 3U5YA 1JGMA 3GUWA 4AHQA 3GZ3A 1C93A 1GW9A 3GE7A 3R0UA 4Q8UA 1THFD 3AIBA 5E09A 1I1XA 3ATZA 1R3TA 2ZZ2A 4XAPA 3NQ2A 4NJJA 4RPPA 1KM4A 2ZFAA 2X7VA 3MWAA 1E0TA 1QW8A 2W9MA 2BASA 3DFTA 2ZDRA 1QO5A 2GGJA 2HROA 4NRRA 3W9ZA 1EDTA 4H4IA 3VOCA 4O4WA 2DZXA 1WXJA 3GXPA 2QUTA 3AC0A 4LT9A 4JHOA 4OOUA 1R2TA 3FXGA 3M9YA 2Z28A 2IW0A 4NYUA 4UUIA 3D0CA 3G1HA 4DWSA 1U2YA 1B90A 3W7OA 3IIZA 3O05A 4C6EA 4JGDA 1BVZA 4OZOA 3OBKA 2Y62A 4IJRA 4JFWA 3URNA 5D2VA 4BF7A 1V0LA 5DXYA 2MANA 2HZGA 3GDRA 4H8UA 1PSCA 3EZ4A 3FJNA 4MYAA 2OFJA 2YKKA 1H09A 2P8CA 3E0IA 3B06A 2CZ5A 2E6YA 3T0AA 4JTHA 3N25A 4RE0A 4DELA 5K7JA 2OODA 1AH3A 4HK5A 2EKCA 1F5ZA 3MBFA 3BVJA 1CZ1A 3M6DA 1UJQA 3SCTA 1V0MA 1IXNA 2IXVA 4AD4A 1Q13A 1F73A 3TCSA 3I4KA 3CS2A 5BMWA 3LI0A 2DZTA 1XI3A 1P0KA 3ARYA 2GUUA 2ISWA 1KR0A 1M41A 1UMLA 4IMEA 3W85A 4XD5A 1FWTA 4S3JA 1GVQA 2HK0A 1VLIA 4PMJA 3RDKA 2PURA 1T0OA 4B92A 1EX1A 3W2NA 3CWNA 2E77A 3P8IA 4C7FA 5M17A 4H04A 1ONWA 4YCPA 1AH0A 1WUFA 5D9MA 3VCCA 3MSRA 4LUTB 1FKWA 2GFTA 2HXTA 3CHCA 1A47A 3R2GA 1QJWA 4F0HA 5AZ1A 5LA2A 3U8GA 5F2GA 1VJIA 2ACRA 1DE5A 2B31A 2YBVA 4MDOA 2YA0A 2OOFA 1X6LA 1HKVA 3NQ6A 4IIFA 1C8YA 2V2DA 1XSJA 4ZSTA 4Z1CA 3WFAA 2GLKA 2WNWA 5EBUA 1I60A 1LCOA 3WD2A 4S3BA 3BG5A 3KW3A 5HNNA 2Q6ZA 4TTUA 3PZTA 3VU2A 5AC5A 1P48A 5AECA 2QAFA 1A3XA 2VUYA 3TW7A 4D1JA 3H12A 4JEJA 1TJPA 3GG8A 4MADA 1D7KA 1AA1B 5C6MA 1HUVA 4C6JA 1MYRA 1F6YA 1UQYA 1QOXA 3TZFA 1K4GA 1LQAA 4YTTA 1SJBA 3A4JA 1U5VA 4UIOA 3N3MA 4UMAA 3WH8A 4RJEA 2P1FA 4QDMA 4GIRA 1GONA 4LAUA 1HJVA 1CTNA 2X0HA 3SIZA 4MWAD 1CXHA 4DZ5A 2PLCA 1W1PA 3OODA 1O5RA 3B8WA 3R8RA 4IZGA 4PB3A 5D37A 4PEEA 2Z7KA 1V5XA 5HAOA 4IICA 2QF8A 3WJXA 4NASA 4MFDA 2CZEA 4PMUA 1W5MA 1XLMA 2ICSA 4DZIA 4QGCA 1Z44A 2PUZA 3W7KA 1FBAA 2WANA 4JFVA 5BOEA 1W5QA 3W26A 2QCCA 2W79A 4PMRA 1RK5A 1JNDA 4JQ4A 4L65A 4K1GA 1QW9A 3W22A 1FWDC 3BW4A 4G5DA 1F76A 1E72M 1O66A 3BLDA 4DWSB 2VDGA 4A05A 3NQBA 3OZPA 4V27A 2QCNA 4BA0A 2NQ9A 1GGOA 4PMYA 3CNYA 5M5DA 2ATSA 3HPZA 1DVJA 3W76A 1OT2A 1EFZA 1E9YB 1VCGA 2GPTA 3M44A 2FMNA 4C90A 2XTKA 4PB5A 4ZE4A 1A5KC 3QF0A 4QXIA 3T44A 6ALDA 3RLUA 3TWAA 1KM6A 1TO3A 3TONA 4JTSA 3R12A 1X7FA 1Q6RA 3F1QA 4HHLA 1T8QA 4OQVA 1AW1A 5DXXA 3V7PA 4O1FA 4N9CA 2QUMA 2RAGA 1E1CA 1MFVA 4C1NA 4RNHA 5F4SA 2J88A 3ZFHA 1KM5A 2QF7A 3GW3A 2CETA 1TTPA 3WQ6A 2PZ0A 2CLKA 2D69A 2BFGA 1KWKA 1Q65A 1QPRA 2XWDA 1YDOA 1EYEA 4MPKA 4GJ1A 5I5RA 1AODA 4N42A 5ECVA 5J5DA 3LK6A 2PD5A 5KETA 1NOFA 4LUJA 3KBMA 4MGGA 2D22A 3RN6A 3W1NA 5A6SA 3P0XA 1OFPA 3QFEA 2V81A 1F05A 1D3CA 3TYEA 1E3XA 3C3UA 1G94A 3BJSA 1TTQA 5A6TC 3M5VA 1AMYA 1PHWA 1KGUA 4H1ZA 3M47A 3M0KA 3NQVA 3TLQA 2CEQA 4PMDA 1K8YA 3DESA 3USBA 2WZIA 3LXCA 5AYIA 2CIPA 3FJLA 3W6MA 1ISVA 5FF3A 3GVGA 5DANA 2XZ7A 1SSDA 3LBOA 1SW7A 4W8LA 4LUYA 4HPNA 3GFZA 3QBUA 1EYWA 1HKKA 5LYRA 2XFFA 4XZ9A 3VGGA 3NYZA 1EEPA 5I77A 2J4GA 1H1YA 5D9PA 4AZHA 2HPIA 3TYZA 2UY4A 2WKGA 2E09A 2HCVA 1JVNA 4PMNA 1PCWA 1WKFA 2INEA 1RPXA 1UZ1A 3EKGA 3AS1A 4Q4RA 2HV5A 3VTRA 3L9CA 2PGEA 1QHZA 5ECUA 2FTWA 3Q65A 3HBLA 1IZJA 1F74A 2DT3A 3WK2A 3SEPA 4IGNA 2G3FA 4WVXA 3CQ0A 2R8WA 2VR4A 4GNJA 1ZU8A 4Y9MA 2GGEA 1A3WA 1XLGA 4L9XA 5KTLA 3AUOA 3FVMA 2DQWA 4IOTA 2QCMA 1XH2A 3VGHA 2X1SA 1J2WA 2YJQA 2OKOA 3S83A 1BTCA 3VNJA 4UQ9A 4ATDA 1WP6A 4J28A 3LOTA 3WMLA 5I23A 2INZA 4B5SA 3L67A 2YYTA 4IX2A 1V6XA 1W3NA 2WK2A 3GZAA 2YL9A 2CLMA 2GVYA 1QNQA 1F3TA 2NT1A 4GKLA 4OGZA 1XLAA 4U2ZA 1V03A 4DJEA 2X8RA 4GIEA 5EB8A 3TE9A 2YFNA 1BFNA 1M1BA 3R79A 4IGSA 3L5LA 3MUY1 5HINA 2EKGA 2Z26A 4GE8A 4IHCA 1ZSXA 1UR8A 1E1CB 5AHEA 4C1NB 1GOMA 3M6YA 2FFCA 3VKKA 3VIJA 4JHZA 3TFCA 5I3HA 4OBSA 5IXEA 3GNRA 1VP5A 3HPFA 4YYFA 3WYZA 4C6MA 1WQ5A 1Z42A 3FS2A 5EMKA 6CGTA 1CDGA 1JD9A 5CC5A 3FY1A 4LV9A 5JUVA 3O6CA 2C71A 3KBJA 1EJUC 3CM4A 3W1AA 1E9ZB 4K36A 3HPSA 2WPGA 4JTLA 1BGGA 1KD0A 5G4HC 4M5PA 2F38A 5HDRA 2DSWA 3CMGA 8XIMA 2OX1A 2A1YA 3LHUA 3V1PA 4ADSA 2PF8A 2UY2A 4CQ9A 1V6TA 4X0NA 2ZA3A 4HZ6A 3U6WA 5H6HA 3UCQA 3GS6A 4HSNA 1EDGA 3VO0A 3STFA 4FLQA 3BC9A 4DF1A 1RVGA 4KEVA 3WFLA 4FK9A 3EB3A 2WSRA 4ZE5A 3E02A 2Y70A 3E12A 1W3LA 3SR7A 3O6YX 1RP8A 5A6KA 1AQFA 3W7IA 1FUYA 1F07A 1UR9A 4ZB0A 3NGFA 1XLHA 2DZAA 4KIRA 1UHVA 3BANA 3TTOA 4E2OA 4GKTA 2FVLA 2AGTA 3DYOA 3WF4A 1W56A 5CLTA 3QC3A 4UTUA 3QSTA 3O9NA 4JL1A 3N11A 4GC4A 4CD8A 4M51A 1TREA 1JPMA 5LSMA 3C0JA 2YL8A 3VK5A 3HGJA 4ICNA 4FOJA 1GOKA 4HIBA 3SECA 4TX9A 1CGVA 5HQEA 3FYPA 2QDEA 2QT3A 1O1ZA 4QQ3A 3ITLA 1H41A 1K02A 3B9DA 3EWDA 3Q67A 4MY1A 1SZEA 1UOKA 1KBIA 3A5FA 2NSXA 4GXPA 3CJPA 4BJHA 3AHVA 1TIMA 3PZUA 4R53A 1SO4A 2IKIA 4Q7IA 1S1PA 2Y8KA 1J5TA 4H8HA 3SUUA 3WLQA 3G24A 3W3OA 3TAOA 3AIWA 1XIFA 3KL3A 3S42A 2YGYA 5BWAA 4F2BA 2E6FA 3UFYA 1WNOA 2B7OA 3H7RA 1XIIA 4EF9A 1DOSA 1A0EA 1KLYA 2TSYA 3G8RA 1NOUA 3DENA 1EBHA 3RU8X 4CD7A 5GNZA 1UH4A 3ITGA 4I6VA 3AXMA 3AMLA 2OWCA 4RDVA 1BXNA 3OHMB 3UWVA 1WZLA 2XN1A 5HR6A 1XGZA 1GT8A 3WLNA 1A5SA 5C9ZA 4P7RA 4PTWA 4BWLC 4YTUA 1WUEA 1GG1A 2B81A 3UWUA 4DLFA 1TQJA 2P3ZA 3K8MA 4IP4A 3ME3A 2D2GA 1O60A 4ACZA 3LLXA 3CGTA 1FWBC 2DPEA 4ERAA 3BLEA 4JOMA 3VC5A 4JTGA 4MNMA 2WLYA 5KINA 2PDLA 4F40A 3NG3A 3SGZA 3S1WA 3QVQA 1R38A 2WVSA 4HPGA 3ITOA 4FB7A 3T8LA 4K8EA 1F8IA 3ABRA 1RQBA 1FWAC 2XGIA 5C0QA 4DO6A 1J96A 3P62A 2PLMA 1UWAA 3B0YA 4I90A 5I09A 2OMAA 1I2QA 4HGXA 3UJ2A 1MQQA 1MUWA 3EOOA 4HTYA 2C7FA 4IF2A 4KS0A 3LU2A 1EPVA 2YBTA 1ZBKA 5HBFA 2BDQA 4TO8A 4XAYA 3ZWSA 5JBEA 3ZLHA 3S8HA 3H24A 1V4YA 1VBGA 2CLLA 4LNYA 1W5OA 3P93A 5CG0A 1W17A 3U5UA 2VWTA 3AU6A 1EKOA 3FKKA 3A5VA 2Y7GA 2VC7A 3H8AA 1ITQA 3VNIA 3WNLA 2A2IA 1TTJA 3OVRA 3HQOA 1GQLA 3THQA 3GAYA 4AZ7A 5LKYA 1HNYA 2UWFA 3DHFA 1NWUA 1H11A 3N04A 4AVOA 4ZB2A 3W1UA 4AZ5A 4KBXA 1Q85A 2VZUA 3LY0A 4CQBA 3LRMA 1EL3A 3S1GA 3CIVA 4B15A 3QY7A 5EMUA 3GIQA 4HB7A 1SZFA 2RHGA 3EX4A 3BCJA 3EPMA 2O55A 4BFAA 1Z6KA 3THAA 4HA4A 3I7RA 1XLKA 4QS5A 2ZADA 1C7SA 3NQCA 4HJWA 2BG5A 3PTQA 3KEHA 1J0JA 1OF6A 3DKLA 1MEIA 2GL5A 4KGLA 5GPRA 4RNFA 3TMQA 1OC6A 3SM0A 1POKA 1N82A 1RPKA 1S5WA 1UB3A 1N55A 4PTXA 4Q6JA 2J25A 1IV8A 1W9BM 3LS9A 1YXCA 4IIBA 4LAOA 3N15A 1HP5A 3PWIA 3SN4A 3RX2A 3VX0A 3AI0A 2YA1A 2WHKA 4N7QA 1FXQA 1MI3A 1C8XA 4YXGA 4PSRA 1JAEA 3TTEA 1UBSA 3AMCA 3VKCA 3BXWA 4KWVA 1CEOA 2VC6A 3MU7A 4UWMA 3M0XA 5HMSA 2MUCA 3TA9A 3V3WA 1X98A 3EWYA 3RMJA 1IF2A 1PKLA 1VPYA 1CXFA 3KZSA 2VGGA 3S1VA 2PU0A 4HTBA 5LNUA 1DQWA 5BNKA 1A5AA 2WCSA 3E0FA 4JDBA 4ACZB 2FZMA 5A6BA 4AMAA 5AKQA 4EIVA 1DXFA 2DUXA 5EMLA 4YIWA 3TN3A 1OZMA 4H8VA 2A6LA 2E28A 1SJDA 3KOZA 2FYMA 2ZKMX 3A3XA 2Z2BA 4ZQCA 3R58A 3KP1A 1HN1A 4LY8A 3UYCA 4GO8A 3C52A 4NJKA 4EPEC 2ZX8A 2Y61A 2YXOA 5CSUA 1E4IA 1S3HA 1XGEA 1FDYA 1CB2A 1C92A 2PDIA 2PP3A 3LLDA 1LYXA 3BO9A 4PODA 5AFDA 2FPYA 2VENA 1X6UA 4DZAA 4Q7BA 5JIPA 2OLAA 2POZA 4KCTA 4WX2A 3TW9A 3S5NA 2GQ8A 4KIEA 2HS6A 1TA3A 5A6MA 2CESA 1JD7A 2G0WA 1I75A 3L7RA 3SN1A 4QBXA 1BQCA 1W1B1 1BYBA 4HK6A 2PDPA 1K70A 3GTXA 2G8ZA 4GIYA 1JZ6A 1OZQA 5H8UA 1G7VA 4QQUA 1B57A 4H7VA 4IIEA 2GOUA 1B9ZA 1UD3A 3PZVA 3H26A 3KXQA 5E9XA 2O4QA 2XDFA 4EP8C 2V67A 1E43A 3FHQA 3UW6A 1HJXA 3UY8A 4DAFA 1SO5A 4PMZA 3SQMA 3II1A 1OX4A 3PAJA 3NAVA 3TROA 3B0UX 3CT2A 1OCJA 3CV7A 5LZLA 3NSNA 4WK9A 4D71A 3GIPA 5CJ5A 3T4CA 1R5YA 3IV3A 3USZA 2G3IA 3CV6A 3AALA 5EFDA 5BXRA 3KS6A 3PZGA 3QV6A 3T0DA 3PF3A 1CGTA 1V0NA 4NZFA 1DYSA 4DBDA 4AIOA 1LG2A 5IRPA 3KLLA 2BY1A 3ENLA 2VD9A 3E0VA 2RUSA 3OYXA 2XH0A 1RQHA 4C65A 1BVNP 4R7JA 1UZ4A 4RE4A 4L4LA 1ECQA 4PCPA 1GYLA 4GQ0A 4HCDA 5F7UA 2X42A 4ZXOA 4UBPC 3H55A 3T08A 2O56A 3ZJ7A 3H2NA 3IAQA 3VGDA 4W89A 1FXPA 3WX7A 3AYTA 4B5WA 1M7JA 1CENA 5GQBA 3CWHA 3HB9A 2V0TA 3F5LA 3WF2A 4YHEA 4DXKA 5CGQA 1WBJA 4CD6A 2HMCA 2PDXA 4HNNA 1TFVA 4FO4A 3TTQA 4Q4MA 3PVFA 3COTA 4XO7A 4G9PA 1Q6DA 2HWGA 2ZVRA 1C29A 1KRBC 3U3HA 2JIWA 4GJIA 3QQ1A 4ILSA 2ZQ0A 4AWTA 3P60A 4B2DA 1OB0A 1F4HA 4WHBA 1C90A 3H7UA 4Z0JA 1XRFA 2QCHA 1O1HA 4LYQA 4CVUA 4JIHA 4HCHA 1GZJA 1H7XA 2OT0A 4J2MA 2WPBA 3MP5A 3THUA 4PRRA 3C8FA 4OJYA 5I78A 3Q45A 4W5UA 2CLOA 2D24A 1LLOA 2IQTA 3NQMA 1HGYA 3GR8A 3L4XA 3N2CA 1ISWA 3BARA 4PUJA 4YVVA 4ZSUA 2VVSA 1W91A 1PKNA 4KWUA 3OG2A 1EBGA 2XYLA 4ZCWA 3T81A 3L65A 5D03A 2GZXA 4KGJA 3LBMA 3W00A 4D72A 1US0A 4AHOA 2BY2A 4JR5A 1TWZA 2PDCA 3EPNA 2EPNA 4L6DA 2O9PA 1GK8A 5FKYA 3SUSA 5C9XA 3TSBA 4J3ZA 3AZSA 3ZIZA 2CHRA 5F4WA 2BHYA 1TA3B 4XZHA 3UVIA 4I9AA 5LIWX 3WH7A 4G1NA 2CLHA 3R11A 4DQWA 3T7VA 4KWSA 2YB4A 1S2UA 2DSVA 3I3DA 3PTMA 4M1BA 3D46A 3N4FA 3GDMA 2X1UA 2VOMA 1POJA 2QUVA 3Q37A 4EXBA 4AZ6A 4FHAA 2ZIDA 5HXMA 5D2TA 5F2LA 4GVIA 2EPHA 3OTRA 4CGTA 1OYBA 5JQ9A 3T05A 3W02A 2JEQA 3BLIA 4Q32A 1H0GA 2X2YA 1SZGA 3CZJA 4P8WA 5HJXA 3GAKA 3O1NA 1VF8A 4HOWA 5TD4A 3LBCA 4HPXA 1V8EA 4M19A 4W87A 3MMWA 4Z2GA 3VD9A 2Y7EA 1OX4B 4V1XA 5I02A 5LHFA 4AU0A 3VOJA 1E5JA 3QGAC 1NF0A 4GUJA 4ES4A 4AXKA 5HJLA 1PX4A 4NZ4A 4JIQA 4NL1A 3CHVA 1BWVA 1XD1A 1YDNA 3CV2A 2WSYA 2VZSA 4JFSA 4K6AA 4P7OA 3E0LA 4UR9A 1UA7A 3VGFA 2FTPA 4GX9A 4UOZA 3B0XA 3IUDA 3TK7A 1CYGA 4BQ5A 1BSIA 2QGHA 1Z3NA 4WLCA 2DUZA 3WK1A 2ZE0A 4LYRA 4WCJA 4LW7A 1KQYA 2C18A 3M0IA 2Z29A 1PEZA 2VQUA 1RCOB 4D6FA 3GBEA 1K6WA 1PHQA 1JR1A 1UW9A 3EWUA 3WQCA 4DWSD 4Z17A 2H6RA 3LUTA 3MSGA 4ZQNA 1RJRA 4JX6A 2Q8XA 4NG3A 3IACA 1E0VA 1JXKA 2G37A 1WBHA 2BHZA 2RDTA 3NQAA 5GVJA 1GOIA 1VFSA 4O50A 1SZRA 3P5YA 3WQPA 5CGTA 1KBLA 3NQFA 3RIKA 4NZJA 3B8SA 3MDUA 3GNXA 1D8CA 3QXBA 1KFCA 5A3HA 4JIRA 3W1QA 4JTJA 3N13A 5CBIA 1G4SA 3I65A 2CW6A 2TODA 2WC3A 3O0KA 1QNOA 2XVKA 1AJ2A 1S3TC 2WLZA 3L4VA 3ANVA 4BWLA 5AHMA 3WBWA 2G96A 1RY8A 2DU2A 1ZBWA 3R8GA 4E6MA 2F2HA 1EEXA 2VL4A 2EQDA 1M01A 1WCGA 3I6TA 1V3LA 2FMOA 4JPGA 4WJ8A 5I00A 4P7NA 4E8GA 3IRDA 3H4XA 1ZY9A 4Y9NA 5BWFA 1V02A 3QLDA 3OG3A 1UQZA 1EXBA 1XPGA 3LHWA 4Y2WA 1QI5A 3AYRA 1PJ9A 3UWZA 3N34A 4NYYA 4PR4A 1XSIA 3ZJ8A 4K1WA 3DFSA 1FHVA 1E0XA 1UBPC 3VCNA 1OK6A 1PUDA 3W83A 3BMVA 4DEFA 4DO4A 4LU0A 5A1AA 3AHXA 4TMBA 4W84A 1XRSA 1RAKA 4HNVA 2ZX6A 3V0UA 5T26A 1B3WA 1CCWB 3N6HA 3H53A 1H50A 2CKRA 3VX1A 4DUVA 3DGRA 1GWJA 5FAGA 3NOYA 3HQPA 5HNRA 3CHDA 3L21A 1K4HA 4A35A 3QPEA 5J8LA 1GKQA 3WBXA 3TWBA 3LLFA 4UMCA 4A2SA 4Q22A 2ZICA 1FH9A 1OFDA 3UG3A 2GGGA 3APYA 4GH3A 1JYNA 2PGFA 2D73A 4NZCA 2DZVA 2E4TA 1KW1A 2H8XA 3OO2A 2PE4A 2BXYA 4AEFA 2GSEA 4F0KA 4DI8A 2BY3A 2WO5A 1XW8A 1TCMA 3WH5A 4P2VA 2Z0IA 3QV7A 5HATA 1R87A 4KEZA 4ZOEA 4NAFA 3W86A 4PCSA 3DFHA 3DEQA 3R10A 1O12A 4BEUA 3WQ4A 3MUZ1 2QJGA 3OVPA 5DX7A 3GUGA 2P5NA 3F4WA 2W67A 3C0SA 3KZPA 3LV6A 3UPMA 4JYFA 1OC7A 3L12A 3T55A 2Y24A 3SCVA 4AB4A 1CX9A 3PP7A 4QG9A 1FX6A 4FPSA 1IEXA 1HJWA 3KRSA 4HKPA 2FTYA 1XLBA 5C71A 1QHOA 4Y9AA 1VFHA 1B4EA 1MZRA 2AQWA 5U7SA 5BXTA 2X0SA 2GGHA 1MWOA 1W9VA 3KHDA 3P80A 3WY1A 4HCLA 4X22A 4W9TA 2G5WA 4P8XA 4CQCA 1QAPA 1IXPA 5DT5A 4F79A 1WZAA 2YBUA 3ARSA 1RLDA 1TJ2A 1OFBA 1EPXA 1SYTA 3QY8A 5ABFA 3PUGA 4Q8VA 4IQJA 1W54A 3A24A 3KS5A 1XYZA 1XLEA 1Y5WA 1LZOA 6ENLA 2YYUA 4A29A 2OGJA 3GDLA 5I2UA 3H23A 4UNIA 4KKXA 4JQ2A 1XUZA 1D7FA 1LROA 4EWJA 4LYPA 3EB2A 5D05A 5A8PA 4PFHA 3BURA 1DIDA 3JZUA 1OQFA 4NNBA 3EKZA 3S1UA 3PZQA 3GB6A 3NFUA 1LOLA 2QNEA 2WCAA 3UZ5A 3N3TA 5L6UA 1OINA 2OZ8A 3G18A 2NXGA 4H19A 1CLKA 3C2RA 2ZZ4A 5K4ZA 5XINA 1VPXA 2EG8A 1ISXA 2F6UA 1ZCOA 3VFCA 2QDDA 2FDSA 1BKHA 1KWGA 3LA4A 2O9TA 4U33A 4JTTA 4AZBA 2FGBA 2Z7GA 4K8HA 9XIMA 1OYCA 3UJEA 5A5WA 4GI9A 6XIAA 2R1NA 4GNKB 1B9BA 1M6JA 2WZTA 3VNDA 2HBVA 3ZJKA 1LJYA 1LBMA 4AX6A 2QJNA 3VYLA 2YXXA 4GQGA 2PTWA 1QR7A 3PBYA 4N6EA 3OIHA 4XVEA 5HUPA 4BY3A 4NZ1A 5I3DA 5TF0A 5A2AA 4FLOA 3W6YA 3RPMA 3O6AA 4F0LA 3W24A 3TX9A 2ACUA 2XM1A 1AQHA 3A64A 1PYFA 4ZVJA 3DCPA 3IIPA 1C91A 1J93A 3DG3A 1J0IA 1S5MA 1PKMA 2RJHA 2YCEA 3M0LA 2VYOA 5BYWA 4Y8FA 1S2VA 1QPQA 3N2OA 3VNLA 2OLHA 1FFRA 4URIA 4XISA 1XC6A 3SADA 2Q02A 3ES8A 1GYMA 5IDZA 1WV2A 4ONVA 2HVOA 1Y0EA 5TAOA 3N2MA 1ESWA 1DIEA 1HL9A 3PG9A 1V3HA 1FWCC 1SR0A 2NZLA 3K5XA 4QCFA 3PK7A