2PZ0A

Crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
239
structure length
239
Chain Sequence
KTLVIAHRGDSKNVPENTIAAFKRAMELGADGIELDVQLTKDGHLVVIHDETVDRTTNGEGFVKDFTLEEIKKLDAGIKFGEKFAGERIPTLYEVFELIGDKDFLVNIEIKSGIVLYPGIEEKLIKAIKEYNFEERVIISSFNHYSLRDVKKMAPHLKIGLLYQCGLVEPWHMALRMEAYSLHPFYFNIIPELVEGCKKNGVKLFPWTVDRKEDMERMIKAGVDGIITDDPETLINLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of glycerophosphodiester phosphodiesterase (GDPD) from Thermoanaerobacter tengcongensis, a metal ion-dependent enzyme: insight into the catalytic mechanism.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase
total genus 88
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 2pz0A00
3EA1A 3QVQA 3RLGA 4OECA 3CH0A 1DJWA 4QJ3B 4QJ5B 4QJ4B 2PLCA 1DJZA 1DJHA 2PZ0A 2ZKMX 5T9BG 3QR0A 3QR1A 3KS5A 3V18A 3OHMB 2OTDA 1QATA 1DJIA 4I8YA 3PTDA 4I90A 4F2UA 3V16A 2O55A 3EA3A 3I10A 4I9TA 4GNKB 3EA2A 3H4XA 2OR2A 5T91A 4I9JA 4RW3A 1XX1A 1GYMA 1PTDA 3RLHA 1T6MA 2PTDA 1ZCCA 4F2BA 1VD6A 1QASA 1DJXA 1O1ZA 3H4WA 4I9MA 1T8QA 3NO3A 1DJYA 4PTDA 4R7OA 6PTDA 2P76A 4Q6XA 2F9RA 2OOGA 5PTDA 1V8EA 4RW5A 1AODA 1DJGA 2FJUB 4RV3A 5T9CE 7PTDA 4F2TA 1PTGA 1YDYA 3V1HA 3L12A 2ISDA 3KS6A 4S3GA 3MZ2A
chains in the Genus database with same CATH superfamily
2QMJA 1P43A 1PBGA 4IGMA 3IJIA 1X8CA 4IMGA 3ZQ9A 2TYSA 2OCZA 5ABTA 4ZSUA 3KBJA 1HKVA 2FYMA 3SSJA 2ZRWA 4QJ4B 5E9AA 1TQXA 1OGBA 3L21A 3M5VA 1BTMA 5CGTA 2VX4A 4AX6A 4W87A 2GK1B 4KQNA 3CH9A 1OGGA 1F4AA 2XFFA 3W7NA 4RPQA 1CGYA 3PWIA 1AH0A 1I0DA 5A6LA 1VBUA 1X6NA 4IUGA 3DFYA 2VEGA 5D9MA 3W1AA 1YPXA 1FDYA 4JQAA 7CGTA 1JL8A 1KRBC 4GX9A 3VNJA 1JI1A 4P7LA 4X0VA 3V35A 3CO4A 4OT7A 4XKYA 4Z2GA 1OYCA 2AKZA 1E15A 4XAGA 3VKKA 3N04A 4FS9A 2D1ZA 2VCBA 3FEQA 1ZBWA 5CZTA 2WSPA 2OZ0A 2ATMA 4MY9A 1IE7C 2ZUTA 4IPNB 5C2XA 4FP1A 4FXRA 1M9HA 2J7EA 4D6FA 4CUCA 4WK9A 3GZAA 4LEFA 3L4XA 3W2LA 3V5FA 3CLWA 1ELSA 1H7WA 2FTYA 5JQ9A 4WOQA 1W6TA 2PZ0A 2XYLA 2CLMA 1VLIA 2ZKMX 1V6WA 3T2QA 3WMBA 5A6JA 2Z1SA 5D03A 3BK0A 5A3HA 4ZE4A 3B8VA 5FESA 3EXRA 4O1DA 2WMIA 3RRXA 3KL3A 4NJKA 4E2VA 1EP3A 4TVCA 5AVHA 4Z1YA 4F8XA 1T99A 1O4UA 1W5MA 4JTKA 2HV5A 3VZXA 5FF0A 4FNUA 4MKSA 2VI0A 1XP3A 4FOUA 4HMCA 4O0QA 4ZO7A 5JH1A 1CLKA 1T5AA 1LORA 3GRIA 3VOFA 2R9RA 1RR2A 2D3LA 2WKJA 3PJWA 3SDOA 3TYDA 5EPDA 2B81A 4YCOA 1KKOA 3ZR6A 2WLZA 3GDMA 4JTUA 3UNDA 4HIBA 3S0CA 5I24A 4PMUA 1EEXA 2WBGA 1K7XA 4ATLA 4J7RA 3OVGA 5I00A 2YA0A 3MS8A 1HG3A 1P0BA 1KTCA 3ID7A 4EP8C 2VYOA 2YXOA 2G4FA 3TTSA 1LCOA 4B91A 1LWJA 4R9XA 4QJ5B 1JUKA 2Q3OA 1LQ0A 3AS1A 1NEYA 1SO4A 1XXXA 8A3HA 1KM2A 4PTWA 5DRIA 3UJ2A 2GVLA 3OBEA 4NILA 3VOHA 3EWDA 5JXQA 4HNLA 3EDEA 3KS5A 3RFAA 1GQJA 3HN3A 1GOMA 2HSAA 2GSHA 1QXLA 4XKMA 4GCXA 1OCQA 2IQDA 2H90A 1SJCA 3U4AA 3AXXA 3G2GA 2CESA 1VJZA 1KCZA 2AQWA 2WZIA 5BW6A 3C4UA 1QPKA 3W07A 4A2RA 2CBIA 5HQLA 3LV5A 3RPMA 2JF6A 3IS4A 1I2NA 5D09A 3VIFA 2HE5A 5DCBA 5FF3A 4B5SA 5D8ZA 3VD9A 1JEZA 3K8MA 4YNGA 4BEQA 4NNBA 5F1VA 2QJHA 3DGRA 4ATDA 2XGBA 3OG3A 3SCTA 2WWCA 2IKJA 1P6BA 1UP3A 3KTSA 3MSGA 5CJNA 1H11A 1H7OA 4P2VA 1B54A 2PD5A 3RPDA 1S39A 4PUKA 3VU2A 5EMUA 3BAYA 1Y0EA 4ZXLA 4CU8A 4V1XA 4OZOA 1AUSL 2A3AA 3S5YA 1LP6A 3ZMRA 1NAL1 3VNLA 4QJ3B 1OG6A 3SECA 5LNVA 3LHTA 1MQPA 4ZQNA 1F7BA 5FD0A 1QBBA 4HPJA 4QHRA 1UR8A 1V3IA 3S2CA 1WUFA 3DI0A 3NPUA 3RX3A 1UA3A 5KZMA 5LIWX 5CSRA 1B3WA 2YGYA 2YW3A 3M16A 1FHDA 1TCDA 1W31A 1VAHA 4JX5A 5F7UA 2NUYA 2OSWA 1XYMA 3VZYA 3QZ6A 1FWRA 5LNSA 2J9XA 3ZVHA 4XVEA 5EMYA 3WDHA 3MKKA 1F76A 5I23A 1XINA 1E72M 1JJKA 4RW3A 4HCHA 1UKOA 2XSBA 1UMYA 1ME7A 5C0QA 3N6HA 2DZWA 3SN0A 2WSRA 1BXBA 1IXQA 4LC6A 3WDRA 2WW5A 4ZOAA 4D1JA 3SSZA 3I6TA 2CLOA 2VRQA 3PC0A 3P7YA 4RNFA 1N55A 1W91A 3EOUA 4B5UA 1FWCC 4Q7NA 1VFSA 1C90A 4V28A 3O6CA 1GT8A 2ISDA 2I57A 2VDGA 3KTXA 2PDJA 3WLOA 4DYKA 2OT1A 3RLUA 3QYQA 4N4PA 4GO8A 2Y85A 3QZEA 3AMCA 4GXPA 4Y2WA 4MWAC 5A8OA 3M6DA 2BXZA 3JUGA 1A5LC 2BY2A 3I3DA 2PCQA 4IX2A 1KB3A 5HWJA 4UMAA 5CKSA 4TU1A 3QQ0A 3E2QA 1SZNA 1IIHA 3L4VA 2XZ7A 1EB3A 1G5AA 2HS6A 1LOQA 2XN1A 1RBLA 1UR1A 3LOTA 5M1TA 3SY8A 2PU0A 5K9DA 4HZMA 3HMJG 2FPYA 2CFFA 4GI8A 1PXGA 3B8WA 1SU5A 3C2FA 4QR6A 1W1ZA 3CZEA 2HK0A 4XAPA 5HQMA 3WH6A 2DU2A 3QV8A 4ASTA 4HCLA 3QQ1A 1NFBA 3EWCA 2F7FA 2R24A 3MI3A 1KQYA 2YB1A 3ABQA 2V0TA 2CXGA 3R7MA 3HG4A 4KWSA 7REQA 9CGTA 4LH8A 4IPPA 4QXIA 4NG3A 3MZNA 1TO3A 3LTYA 3CB8A 3K2GA 3L4TA 4NAEB 2VMFA 1ONWA 2PDBA 3P84A 5H8UA 3NDOA 1Z41A 3W7RA 1E6QM 1VFOA 4LBRA 3THQA 4UIOA 5KTLA 1PSCA 3K8LA 3NOYA 5HDRA 1WXZA 4DF1A 3ZVIA 3ARXA 3WF1A 1SM9A 1HQTA 4XSLA 2O4MA 4H9XA 1VEMA 1N2VA 2HJPA 2Z2BA 4AYGA 2YLAA 1JG9A 3GVRA 3OJGA 2QCGA 1A5AA 1LWHA 1RPKA 3E0VA 3C0LA 4HU4A 4QISA 3W84A 4CD6A 2OGYA 3SR7A 3FJ6A 3W83A 5EBUA 2PC8A 1J79A 1KBIA 4WR3A 4BI6A 2Z1XA 4XBJA 1ZP3A 3RCNA 4HBKA 2VQTA 2F6XA 3NOEA 1W9PA 2QDGA 2YPIA 4FSAA 1S2WA 3TFCA 1P6WA 1ZJHA 3N14A 1EXPA 2GDVA 3HG2A 5HATA 4FLRA 4B5XA 1GW9A 1LDCA 3EPOA 1DV7A 3ZXWA 2R94A 5E6ZA 4EE9A 4AEEA 1YBQB 2PURA 3FA4A 1FHVA 4PMRA 5GNZA 4H3DA 3SO7A 5A5WA 4QDMA 3TE9A 4GI6A 2X0SA 4CCEA 2QCFA 1ZHAA 2P0OA 1QNPA 1SZEA 1BYBA 4F2UA 3MDWA 2VELA 1GWJA 3WQ8A 3K4WA 1H0IA 2QNEA 1DWFM 1RHCA 4QG6A 3BOFA 4G5DA 3DECA 4BF9A 1EBHA 3REQB 3JRKA 4IG2B 1QOQA 3BCFA 3VMPA 1RA5A 3CAQA 4U10A 1V02E 2FZNA 1C8QA 1ZCCA 2BY1A 4LNCA 1XQKA 3O2LA 3WLRA 1T96A 4NI8A 2GGHA 3ZJ7A 3OIXA 1SFLA 4DN1A 1OCNA 1FRBA 3UXDA 5I09A 4LUTA 3F5JA 3GG7A 2NXHA 1XS2A 3IRSA 4DM1A 4AZ6A 3TWBA 3RM9A 3B0UX 4PCFA 2VDHA 4W93A 2PZNA 3GTHA 1O7AA 1EO5A 4G56A 4WLCA 2OU4A 1UZDA 3MJYA 4DNHA 1FBAA 4D6GA 1H5YA 1K4HA 3P6LA 3Q65A 4JIPA 3P14A 4DUVA 1FWJC 1ZNNA 4BJHA 1SFSA 1AG1O 2CZFA 2EBNA 3PUOA 4DBWA 4NL1A 1DPMA 4HKPA 3UCQA 1HGYA 1Q5MA 3WNPA 1W2VA 4FA3A 1HKKA 3HPXA 5IOBA 1OINA 3B06A 3MI6A 1XC6A 1U5VA 1E3XA 4QS5A 5DXXA 4NZ1A 2ZXAA 4M56A 3WL1A 2PDPA 4DY1A 1NIUA 2WQPA 2ADAA 3SBFA 4S38A 4XG1A 1XH0A 3WDJA 2D0GA 4GIRA 3EWZA 4M1RA 3GXTA 3VC6A 2GOKA 2NUXA 4K8GA 2Y89A 1JYVA 1OC5A 1A5OC 2YCKX 2PDQA 3N6QA 2NV1A 1Q65A 4ADSA 1PJ9A 1QT1A 3RILA 1QHOA 3P8IA 2E40A 4MWAD 3F1QA 2VDIA 4QAWA 3UY8A 5DBTA 4HSNA 3SCSA 3VUSA 5ABFB 1IXOA 3CT7A 1DWAM 4DAFA 4GY0A 4IIEA 3BGJA 4IMDA 1JXKA 4PRTA 1R2SA 2HVMA 4TMCA 1J4EA 3CZLA 5KETA 5D2YA 4WY0B 1I9CB 4LCQA 2ZA2A 3CBWA 2BGNE 1XPGA 3PN8A 2PODA 3P81A 3DIPA 3IGUA 5EBAA 2Y5EA 3TMLA 3VI2A 3S5SA 4E8CA 4PYSA 3EOEA 2WSYA 5E0KA 4OUIA 1B1YA 4WJ8A 1WDSA 1XIIA 1E6XM 3QMSA 4M7TA 4MF4A 1NWRA 2FPVA 1KXTA 3BLPX 4U28A 4V2XA 5BU9A 3N3MA 1H51A 3KZSA 5D2TA 4HNOA 4XBSA 3UZZA 1M41A 5G1YA 1GVQA 4DPQA 1ZALA 3F5KA 1E6SM 5CPOA 2YBUA 4REQA 3PZOA 1H1YA 1RK5A 3VTRA 1E0VA 3NFUA 2E4TA 1BAGA 5LYRA 1TPDA 2OR2A 3UVAA 2NVDA 3T40A 1TG7A 4LUSA 3YPIA 1GJUA 1A5SA 1WAUA 1DJXA 4Q7IA 5I78A 1CIUA 1HKWA 3UWUA 2E6FA 2CZVA 2BY3A 2I5QA 1R38A 2ZZ4A 4PMJA 4JDYA 3AS0A 3PY2A 1QW7A 3KBMA 3F2CA 4R7OA 2OXNA 2W63A 2PSNA 3DFHA 4AZBA 2OG9A 2B7OA 3F03K 2NX3A 3NL5A 5FJIA 2WVSA 4GWEA 2JKPA 3CYVA 2IPFA 3MUXA 4LTSA 1L6GA 3DU0A 5C2CA 4DBDA 4DBEA 1M7PA 3BG5A 3PZGA 1K8CA 2ZZ5A 5E6YA 4RE3A 4CLMA 4N02A 1W54A 3W71A 4XD6A 3HJEA 3BGAA 1EA9C 4ZVJA 3KP0A 3NQMA 3QBUA 2PBOA 1GCYA 4HNTA 3KRUA 1WXYA 2PDXA 3DUGA 2Y62A 2XFWA 3IIXA 1TJRA 4Q3MA 5REQB 5CAHA 1GOWA 1Z42A 3W85A 5HBFA 1AW1A 2Z28A 3WQFA 1VB9A 2PCEA 2BGSA 1E1CB 3W23A 3WG6A 4I90A 1XUUA 2QCDB 3SGZA 1L6SA 4V15A 3L4WA 4RZ6A 1GZGA 1LOSA 4XSMA 4LX4A 4C6NA 1V0MA 1U22A 1X6LA 2G50A 3SAZA 1GEQA 2ZRUA 4GE8A 1MMFA 4BEUA 1F4HA 2ZWYA 4OU1A 4LT9A 2Y4SA 4DM2A 2GQ9A 1KV8A 3R11A 3O8AA 3WBYA 4NASA 1RD5A 3RPTA 4A3HA 3PPCA 3UEQA 3PM6A 4UFIA 3T78A 4UUIA 3L4ZA 2ZA1A 2UBPC 4M3PA 1XL9A 4PTMA 5H6HA 1JDDA 2V9DA 1KTNA 2J8TA 1L6FA 4Q8NA 4XTDA 3URBA 2BVYA 3FJNA 2C1HA 2DPEA 3KCLA 3AI0A 3CZJA 3LGGA 4IMAA 3C0QA 4ZFCA 1YDYA 3VPLA 3BV4A 3TW6A 1FXPA 2CLIA 4O52A 3PSVA 2TMDA 1XLJA 3BUVA 2V5DA 2VZUA 8XIMA 2D24A 1DHKA 3GC2A 4DF0A 2DUXA 4KFOA 4BWLC 1JF5A 3FGCB 1JQXA 1PB0A 2W66A 3R0KA 1I1XA 1XLBA 3SCUA 3W88A 4Y9MA 4NNCA 1AJ0A 1E73M 1XUZA 4RLIA 3U6WA 3GYEA 3DBPA 1YEYA 1F9CA 3PS7A 1E6ZA 1QPRA 4PMNA 3B9EA 4BCEA 4LSBA 3CNYA 4QITA 4QQUA 2J66A 1CXEA 3W37A 3XIMA 2J6VA 1BWLA 3WF2A 3GLCA 2VRKA 3QOMA 3G1XA 1FQ0A 3B8SA 2VGFA 3H2OA 3CQIA 3STFA 5CEWA 1PHWA 3O15A 5AZ1A 4DZHA 3MUY1 5C70A 1GONA 1TPB1 3GW3A 3WUGA 3BJSA 4KS0A 3NZQA 3MMUA 4FHAA 3GNOA 3V75A 3NL2A 4E4UA 3RAOA 4Q6XA 4ZQPA 5PTDA 1P5BA 3KWXA 3EB4A 1TX2A 2J9ZA 4I3GA 3NR0A 4LWWA 1WXJA 3LB0A 1JFXA 2INZA 2QLYA 4L9YA 3W1QA 4HZ7A 3LPFA 2QDEA 1RA0A 5DMYA 2QEZA 4M19A 3O6DA 4S3GA 3AWNA 3IIPA 3GDKA 4JQ3A 3I7QA 3R79A 1A47A 4MFEA 1FTXA 1JZ7A 3KVMA 3ZLHA 1NH6A 2ZXBA 3RX2A 2OOFA 5JBFA 3S6OA 4AVNA 3SFKA 3G22A 4DBUA 2UY2A 1XIFA 2YDQA 1OIMA 2ATSA 3CGTA 3KLLA 3EWWA 2J47A 2R1NA 4JQ4A 1R9XA 4AIOA 3BWWA 2WM0A 3U8GA 4GJJA 1H61A 5LHEA 1QHZA 3PPGA 4C6BA 4DXXA 3TH6A 2ASHA 1OGSA 1XCXA 5D4YA 2FGZA 1SSDA 4YMZA 2QF7A 5IHRA 1EJWC 1TYGA 4ZB2A 1K9FA 4Y8EA 4EWND 4GMEA 4WZHA 3CUZA 3AIWA 2WZEA 3LXAA 2XIJA 3ARRA 3A3XA 3BAXA 1RH9A 4G1KA 2A7RA 3OQ8A 4XZMX 1D3GA 3U2ZA 1LRQA 3TN4A 3OYXA 1AH3A 3A9BA 2V5KA 2HVOA 1VYSX 2F6UA 4FNPA 1FP9A 4PFHA 3A3HA 3E2SA 3M0IA 4U2YA 4NAFA 1N8WA 3CQKA 3GNRA 1KR1A 3ITGA 4E6MA 5A8GA 4QLLA 3UR8A 4KW2A 1O5XA 5EGRA 5FEXA 3R1ZA 4L5ZA 1MFVA 3HA1A 4UQCA 3RLVA 3TSBA 3KOWA 3W27A 3FOKA 1PDZA 3B8IA 2GGJA 3WLNA 2YCLA 1IEXA 1T8XA 3USZA 5A94A 3SJNA 4QCFA 4G6CA 2H3BA 1EC8A 3PPFA 4QRNA 4ADTA 2E9BA 2ZDRA 1NP2A 2EPNA 3MCOA 1JDFA 1RJRA 2EG8A 3DG7A 1DORA 4EOUA 4MWAB 3EYPA 4DUXA 3C0SA 4H6QA 3PHAA 1OEPA 1PO9A 3VCRA 4A35A 5D02A 4MYXA 4EAMA 2GGEA 1FFQA 4AZIA 4IUOA 4W7VA 3UJSA 2I7GA 4ZOEA 2OOGA 4XIAA 1JDEA 4IGHA 5HNUA 1YXYA 2J88A 4L1XA 4XV0A 4GRSA 3NZRA 4AD3A 1RBOB 1EGZA 4IQDA 1LYXA 2EGZA 3G24A 3BZGA 1XRSA 2EKGA 2DORA 3LCHA 3G3DA 3GU9A 3IPWA 4C7GA 1UQZA 4GACA 4PODA 3PBUA 2DUZA 2HNEA 3CQ0A 4CQ8A 1TSIA 3THCA 3GHRA 4F9JA 3AU2A 3FXYA 4X0NA 1KFWA 1CXFA 4YVVA 4FIRA 3W1UA 2BVTA 4O1BA 1E9ZB 4PEKA 3AS3A 3H2AA 3G3MA 3VIGA 5FACA 3CZKA 4KRTA 1OFPA 3MWCA 1JCNA 4ZFMA 3AUJA 5I02A 4C7FA 4JX6A 1DOSA 4B16A 1ECQA 7A3HA 2ZTJA 5AHIA 1UHVA 2ZZ6A 4K6AA 4ZO6A 2WYSA 4B5WA 2BXVA 4M7SA 1J11A 2E68A 2JKEA 2BHYA 2VURA 2Y61A 2CHNA 4AMAA 3NQCA 4AY8A 4C7DA 1DWHM 3PULA 3KL0A 1HUVA 1XRFA 2POZA 4XIMA 1OZMA 1U5JA 5A6KA 3IV8A 3B40A 4HPXA 4DJEA 4J28A 3LNMA 5DELA 1KGWA 5M3WA 1PL9A 3CV7A 3GNDA 1T7LA 1CB2A 1KM6A 1WA3A 2XTKA 4HGXA 4JHZA 1FFRA 3DHPA 4KEUA 3WK3A 2ZOXA 1MUCA 3E2RA 4ADUA 1EUAA 3UESA 5DY3A 4NXKA 4YTQA 4JAWA 2GDUA 1XKYA 1TTQA 4HK7A 2PWUA 2DZXA 4JYEA 4X3ZA 3GKAA 3KDNA 4GJIA 1OX4A 3VIKA 3GW0A 4CVUA 3NM1A 1JIBA 4H01A 3NXFA 3ECQA 4IICA 1KRCC 4JKMA 2D2OA 1W1A1 3L4YA 1WV2A 4PMZA 3AMGA 1WOAA 1EIXA 5AYBA 3PUDA 4GIAA 2E09A 3O6YX 1Q6GA 4GYPC 4O8RA 4UZSA 1EDQA 4YTRA 2C0HA 1W5QA 2BOFX 4PL2A 2DEPA 1ALDA 4N6EA 3W1PA 3DFNA 5AYXA 4O13A 3MKCA 2DZTA 3WY1A 4D6CA 1F07A 1XSIA 2CEQA 2ZX8A 1O95A 3VVGA 1XKJA 4IWWA 1VS1A 3P2VA 1UZ1A 3WK2A 4N9BA 3G1YA 2J4GA 2XN2A 2PA6A 1QWGA 3UA4A 1BRLB 1BSIA 3PG8A 5K7JA 2NQZA 1DJGA 2EF9A 1HX0A 2PWFA 4QG8A 1C91A 5M03A 3K46A 5K4ZA 2XIOA 4QIUA 1XDLA 4ZOCA 1UD3A 1WPCA 4C1LA 1ME8A 3W7PA 3HQNA 3NCOA 4MB5A 3IIZA 1YIXA 2X1SA 1W32A 4N6FA 2E6DA 3S1VA 4JTHA 3DZ1A 4IMFA 3DH7A 4JGDA 1BQCA 2TPSA 4Y9NA 3FYYA 3C2RA 2F61A 1GTEA 3AWOA 1G7UA 3CS2A 2QAFA 3P60A 4L1GA 4DWSA 4PBFA 3UXAA 3FCPA 2OLSA 5HPCA 2OWXA 3WNMA 4TX9A 2R1MA 2ZUVA 1UMLA 4JFVA 4LW7A 5IXEA 2IUZA 2DZPA 3WBAA 1VEOA 3ARSA 4JNZA 4JX4A 1L6YA 1KXHA 1GVIA 2IPGA 1PTDA 4P7RA 3DGBA 5I06A 2R1KA 2QXWA 4X9YA 5CGQA 4ERAA 3LPOA 1MUWA 5TBOA 2PDMA 4ZENA 1VRDA 5E0CA 3FLUA 3TQVA 1BYAA 1A80A 4H4IA 1U83A 2ISFA 5IDIA 1LROA 2J79A 1PAMA 3OO2A 4WHBA 2E1WA 3DFQA 5G4EA 1UH3A 2RH9A 3W7LA 4A29A 4GO9A 4KCTA 3NPXA 4H9ZA 3OYZA 4RNJA 3OP2A 3TYZA 4A3RA 3CPGA 1QWKA 3W7OA 2VWSA 2PMQA 1NJJA 4F0RA 1ZUAX 3H55A 4Z2KA 1A5BA 3JU2A 1DXEA 1MW2A 4FX7A 4EK7A 4IFOA 4X2PA 4Y9OA 3G1HA 4F9DA 2CBJA 5KITA 1YXDA 3GX9A 1YX1A 3NQEA 2ACSA 1UJPA 1GVSA 7TAAA 1V3MA 3OGSA 2PDUA 1GOKA 2ZRZA 5D8WA 4QX4A 3KBVA 3T1GA 3LHYA 3GUGA 3ZLFA 4JTIA 2BVWA 2Q8XA 3CK5A 1PEZA 1W56A 1FOBA 2QYGA 4XD5A 3EDFA 1V3KA 3UWWA 3W53A 3BLFA 3OZYA 3B03A 1RY0A 3EX2A 1R3SA 4IOTA 1LRNA 1XSJA 4B3ZA 1QR7A 4DHGA 4GY7A 2I14A 1TWSA 4QBXA 2OSYA 3T4CA 4R7WA 1K77A 2G3MA 4PUWA 4LAKA 2QV5A 1Q4NX 3RCYA 3TXZA 1E9YB 3KDOA 2VVSA 4PRWA 1W3TA 1KLYA 4FR6A 3AXKA 1XYLA 1KXQA 3M41A 2REQA 3MO7A 4PULA 3CO8A 4GQQA 3QFWA 4J40A 4I6VA 5F2LA 1Z8AA 4OOZA 1FHLA 3UERA 3E74A 4MNKA 1HKIA 3WQ5A 3N18A 4AX7A 1V79A 1KXVA 3Q2DA 3SRFA 2OMAA 4HYVA 3QW4B 1VFMA 3HGJA 3UU0A 3FSTA 1S2TA 1QK0A 3C5QA 4RXGA 4U5KA 1VH7A 3H12A 2PDYA 4FPSA 3UP8A 4NXSA 5C9ZA 3GVWA 1FKXA 3W7GA 3N29A 4NX5A 4DNMA 4UWMA 4KESA 2GJXA 3AS2A 5DQPA 2BZNA 3OIHA 5A6TC 1A3HA 1OFBA 1V3JA 1BD0A 1MQQA 2QW5A 3Q94A 4DO7A 1Q2RA 3AOFA 4I7WA 1U30A 3WBWA 1US3A 1O94A 3CV1A 1P4CA 3L4UA 3CHVA 1YTDA 4US5A 1HJUA 1IWBA 5F1UA 2YBTA 3WD2A 5A8QA 4PMYA 5G2WA 2C8NA 1EPXA 4EPBC 1A0DA 2GYIA 4H9VA 5K3VA 3FIGA 4HA3A 3KWSA 6CGTA 3LI1A 3V4BA 1GNXA 3SADA 3L0GA 2RAGA 4GI9A 1SO5A 3RK8A 4KF1A 1G94A 5A6SA 1OFQA 1FWSA 1UH4A 3CQJA 3OU8A 3W2JA 5D30A 3AZTA 3CH0A 5D9OA 1PZ2A 1UR9A 3KEHA 3LI0A 4X9SA 1OT1A 4HU3A 3AO0A 4XK2A 3W00A 2X8RA 1KM0A 4GBDA 4TR9A 3S2MA 5RUBA 5FOOA 5A6BA 2OTDA 5GNXA 1DHPA 1ZLPA 1ZJBA 5F4SA 3R43A 5LNWA 2QHAA 6REQA 2IKGA 3NO1A 5J8LA 3LBCA 3WH5A 3UVIA 5DX7A 3VX0A 2CPUA 2YFOA 4KWVA 5K4XA 4P8VA 2OQYA 3AZRA 1KW1A 3C2OA 3HPFA 2BNJA 4ENLA 2Y7FA 2YCJA 4FLOA 1Z7AA 4JTGA 5LNUA 3LN3A 3WLKX 1Q8JA 4YHEA 3CUXA 3OZPA 3M7WA 2QGYA 4W88A 1XJBA 1FCVA 3NGFA 4MDOA 3ZT6A 1CXLA 2QUVA 3DYPA 3BL3A 5FJOA 4ICMA 3SUTA 3LX9A 3HOJA 4O54A 4LF2A 4IMEA 4S2CA 3UW6A 5H2ZA 1SJAA 2XFYA 4JQ1A 1KBBA 2WVVA 4ZZ9A 2Y2WA 3PBMA 3L2LA 1UA7A 4O1EA 4GK8A 4B4HA 3OGVA 1TWZA 2WJZA 1WKYA 1WP6A 3IACA 1ZB5A 2WPBA 4H2HA 4H9MA 4JCMA 4ROQA 3WUBA 2J27A 4HK5A 4S23A 3ZS4A 1MXSA 2WAGA 3VILA 2X1UA 2NXGA 5FSEC 4AXKA 1DKWA 3EDKA 4AZCA 1Q4WA 3GXMA 1VJSA 4GY1A 4QTGA 3BQ5A 1GKRA 1BQGA 3H21A 3MB9A 4EACA 2I9EA 1P48A 4HD5A 1RY8A 3PJUA 4WD0A 3GH4A 1CLXA 4UTFA 4KWWA 1Q6FA 3M0XA 4HHHA 4R53A 5LHFA 4HNUA 2QT3A 2Y8UA 1YDOA 3WLIA 2JALA 1WO2A 3UXKA 1DL3A 3THDA 1LBMA 5HJXA 2VCCA 3IJLA 3L65A 1RD6A 4R9OA 1SPQA 2D69A 1F6YA 4E5TA 1DQUA 4NYYA 2Q6ZA 1UWRA 1YPFA 3N12A 4FMVA 1QHPA 2ON3A 3RHGA 2XU2A 4MUZA 2YL9A 3RMEA 1GOXA 4MIMA 1UD6A 3MVIA 2VR4A 3IJQA 1TPEA 1P0EA 1SUXA 1TFVA 5A2AA 5I3FA 1R47A 1JNEA 2RDWA 2WO5A 3O0FA 1W1VA 5E09A 2A6LA 4QS6A 1HF6A 4LB4A 3F4WA 2R1PA 2CXEA 3MTWA 4GZ7A 4GH1A 4B5NA 4FNRA 4KRUA 2DZSA 2ISWA 5FEZA 2E77A 5IBXA 3K1GA 1ZQ5A 3WH7A 4YWSA 3B97A 3M0ZA 4ORMA 4AQLA 1JDAA 2OJPA 4UTTA 3FW6A 1QNSA 1T0OA 3W72A 2OB3A 5GJPA 4AVFA 1TZ7A 2O55A 3S9ZA 1M7OA 3TLLA 1XBZA 4PCTA 4UQDA 3NTYA 1EBGA 4EPKA 3FXGA 3WLTA 3GG0A 2VZOA 4ZCWA 1T41A 3W38A 4KRZA 5DEZA 1UIPA 4NUWA 4QEEA 2PTDA 5A95A 5F2GA 1FWDC 3GFYA 3Q37A 4LVAA 1PKLA 1YLVA 4JIIX 4QSFA 4PUJA 3E49A 5A8MA 2IPJA 4Z0JA 1Q8AA 1YDNA 1J5TA 4TX8A 1RCXB 1KFCA 4RL3A 3DFTA 4LAMA 3EWUA 5H8PA 4Q22A 1TX0A 1XLDA 4KH2A 3S2LA 1LBFA 3TCSA 3GVVA 3R13A 3U3HA 4LYKA 4HN4A 2GDQA 3JS3A 3PJTA 2PLKA 3SZ8A 3QY8A 3V1HA 1RVKA 1TELA 1G4SA 2A3CA 2B7NA 4A8NA 3BJFA 3DCPA 1LL4A 4PMDA 4K39A 1B3VA 3M43A 2ZRYA 2CERA 3KHJA 4KIRA 5H8MA 2VCAA 2BASA 4TIMA 2DIEA 2FH6A 2CKRA 1M53A 1HGWA 5BMWA 4M1BA 1QFEA 1HO4A 4OBTA 4F0SA 2RJHA 5CPTA 3HFTA 4L4OA 3CJPA 4CCZA 4UFHA 4ZMGA 1Z48A 3P74A 5I6SA 2AMXA 1GOQA 3W7IA 3AHZA 4DZAA 1O12A 4F66A 3RRAA 4C6PA 1QBAA 1Q66A 3L68A 2H9AA 3GG8A 1K6AA 2B31A 2PC4A 4FLQA 3HJZA 4B2DA 4F2BA 5AKQA 2G97A 1XD0A 3TAKA 1Q6LA 2XH7A 1HTIA 3HG5A 4LVDA 3MP5A 2BMBA 5FA5A 1JD9A 3RXZA 3EKGA 4HA4A 4ZODA 1FWEC 1QOPA 2D2GA 1ICSA 1V8EA 3EOSA 4J3UA 3BCJA 3HURA 2PB1A 2A6NA 3PZMA 2FJUB 3GTNA 2JE8A 1RQHA 1C8YA 3G0UA 3C3NA 4HYRA 3NYDA 4L80A 4TTGA 5GNYA 2KZHA 1R3QA 1EIBA 1B9BA 2CLHA 1JPIA 1J6PA 3S46A 4Q8QA 1S2VA 1F8MA 2C79A 3WJWA 3IUIA 3AFBA 3CMGA 1EF2A 4NJIA 3QJAA 1DEDA 4R88A 2PF8A 1CZ1A 4IPIA 2VR2A 1AA1B 1FUYA 3DBNA 4N2YA 3ANVA 4UMBA 2GQ8A 5KINA 3FS2A 3R6IA 2AQOA 2WC3A 3CZGA 4NSBA 2H8XA 4MY1A 3NPWA 1VKFA 5JU6A 3EWYA 3GDRA 4JL1A 1TQJA 1W5NA 3PK7A 4UC5A 3BANA 5I3GA 1JPMA 1EEPA 3HV9A 3AIBA 4LUYA 1V3LA 4W9TA 5CLWA 2V63A 1MVYA 1TUXA 1VCGA 1UIOA 2QULA 3UF9A 1R8LA 2QCEA 2OPJA 5HUOA 5D2XA 5U7SA 1ZTVA 4JPGA 4PL1A 3VIJA 1I60A 4IM4A 4E3VA 3W70A 4GYJA 3A4AA 1TWIA 1CI1A 1A49A 2FZDA 1FXQA 1UCWA 3PZIA 3WLLA 5FL1A 1V93A 5I07A 1GZ1A 4DYJA 2J77A 1EXBA 2FZ9A 4Z0SA 5K9CA 2WPGA 2FLIA 3STPA 5G2IA 3SCVA 1KBLA 1J0HA 5I3KA 1K4GA 1DYSA 3B8TA 1QW9A 1QMLA 4XB3A 4C6OA 1W1IE 3GTXA 1WKFA 1IGWA 2GJNA 1QI4A 5AYIA 1O5QA 5BXPA 3P62A 4HJFA 2VX5A 3H26A 1KM5A 1W1PA 1D8WA 4TVUA 1EDTA 3ZR5A 2W6RA 4GINA 2BLEA 3GFZA 4YS1A 4F3HA 2H3DA 5HWMA 3WH8A 5GJNA 3T09A 3WMLA 1REQB 2RDUA 3FVDA 1V5XA 3CV2A 2VD8A 1JZ3A 4GX8A 3T2PA 1KM4A 3W7EA 3QYSA 3AIRA 1TE6A 4KEVA 4DQWA 5LIUX 2VWTA 4YVXA 3CB3A 3AYSA 2YR1A 4LANA 3QHMA 1TWWA 2ZZ3A 5TAOA 1K7FA 3VD5A 2X0HA 4OUEA 4RNIA 5T26A 3NL3A 1O68A 1OADA 5CC5A 4M81A 1VYPX 1PV8A 1B9ZA 1NY1A 3HQ1A 1CBGA 3BG9A 4KWOA 1E6NA 1TJ1A 1AODA 4S3JA 2UV8G 1UWSA 2GUYA 4RV3A 2OZTA 3UXLA 3W7CA 2GK1A 2OLHA 4CD4A 3SY5A 3IUHA 4M0XA 3MCMA 3VD4A 3C8NA 1VC4A 2PWHA 5JBEA 2J78A 3P67A 3SI9A 1VPXA 3RM4A 3GNPA 3TTOA 1J5SA 4AEFA 4Q4QA 2DJXA 3VGBA 4FNTA 3QMTA 4TX6A 3WDIA 5JH2A 1JAKA 2YXXA 2DVUA 1OSEA 3W7KA 1ZBKA 2VZTA 1XW8A 2GSJA 2X0YA 2D22A 2QF8A 4WRHA 4L61A 3VOIA 3QPYA 1KKRA 6ENLA 3WNLA 7ODCA 3G0XA 2ZVIA 4KMQA 5AC4A 5EA9A 5C9RA 3UG4A 6A3HA 4EXQA 3MMTA 2QCNA 4GYFA 1R46A 1VGAA 1GW1A 3C86A 1GG0A 2WHKA 2DSKA 1OG0A 2XIMA 3CU2A 1WBHA 4EKJA 2V30A 1XD1A 4HTBA 4R85A 4FALA 2WCGA 4ICNA 1PKYA 3G8RA 4KBXA 1ZAIA 3WN6A 4PUNA 3NO5A 1JCJA 2WKLA 4TQTA 3E38A 4UTJA 3M5ZA 2PTZA 4MTVA 2E8ZA 2C1IA 1OVDA 1YYAA 3C56A 1BVNP 3NAVA 4O16A 4ZXOA 2F8QA 5HJYA 3OVPA 1PYMA 3W6YA 3M0MA 1UKPA 5DMNA 4AH7A 1WZKA 3FK4A 4J27A 5IM51 4UQBA 5LXXA 3G1DA 1NWUA 3UNTA 2Y6ZA 3LXBA 1AMKA 2A0NA 3VNZA 3D46A 5J5RA 5KMYA 2O9TA 5EMMA 2GVEA 1EJSC 2L5HA 5AOUA 4QCEA 4AY1A 4NZ5A 4IJCA 5A6AA 4AZHA 2MNRA 4ML9A 1SFTA 2ISSA 2ZCGA 5IDZA 3PF3A 4ZQCA 2RJGA 3CMJA 1DVJA 3GC5A 1I2OA 1IT7A 2I9UA 4H8NA 3OZOA 1UP0A 2DVXA 4DO6A 4R33A 1TPVA 1EX1A 4YL2A 1XH2A 3U2CA 4Z1DA 3VGHA 4KFPA 1MW1A 3WFZA 4QLKA 1GKQA 5I7GA 9RUBA 2HMCA 4H83A 1KA9F 1S2AA 4GQGA 1IR1A 3K8KA 1A3XA 4O14A 3IK4A 3B9OA 1FHUA 4DB7A 1H49A 4FXSA 1S5NA 4YWIA 2TRSA 2V2HA 3LPPA 2Z27A 2YCIX 1R2TA 5E70A 4M82A 5HR6A 2FGBA 4RX0A 4WKHA 1QNVA 1LBLA 1EJXC 2X1RA 2E8YA 1XYBA 2ZXQA 2FHFA 3AIEA 3EWBX 4C6JA 2Z7GA 3N25A 3QC0A 5HK4A 1R87A 4PUEA 4YTTA 4LJ3A 3MBFA 1OYBA 3E2VA 1UPPA 3LQLA 1RCQA 1NF0A 4L4LA 1I0BA 3ZFHA 3E9AA 2E28A 3GC4A 3DC8A 1DXIA 4QG9A 4Q8UA 4F0KA 4YLWA 2Z6JA 3PTDA 3NZPA 2CWXA 1WCGA 3VDAA 2PBGA 3UR7A 1Y65A 1IGSA 1YKWA 4K68A 3T2OA 3IV3A 4PTNA 5ECUA 2GZXA 4MLJA 2Y24A 3NM3A 3PUGA 5HPOA 2VR5A 1OF8A 1M04A 3AHXA 2V69A 3A3WA 1EC9A 4GUHA 5FCZA 1OC7A 5A2BA 4AWSA 4AVOA 2DZBA 2CZEA 2F2HA 1TZZA 4IFRA 3S5OA 2ACQA 3LNPA 3B9NA 3L9CA 3STEA 2VC9A 3UWVA 3W22A 1FWTA 4DUOA 5JVLA 1MXGA 5D33A 1IWAA 1H0GA 5L9FA 1K9DA 3TAOA 1V3HA 4DI8A 1ZRQA 2W3ZA 1QNOA 3DHUA 3COTA 5AY7A 5B80A 3GWQA 2XZ9A 1OZQA 3J7HA 1W17A 3PZQA 1UUMA 2FTWA 1XF0A 3TJXA 3IIVA 1MFUA 3R0DA 4M6PA 5FF4A 3E12A 3L7RA 2W27A 3LHWA 5MF5A 3PUEA 2FVLA 5D32A 1E1FA 2Y88A 1X6UA 3VIMA 3VX1A 1NQ6A 3ENLA 1VCFA 3ABSA 4OE7A 4UFMA 2CZ5A 4ZTXA 2WNNA 3WF0A 4NQ1A 3MV11 2Q8ZA 1CGUA 3W01A 2ZVRA 3IGSA 1GEHA 3JZEA 2HVNA 5DO8A 2OZ3A 3HM7A 1HO1A 1TPC1 1VBRA 4D71A 1B4EA 4CNPA 6PTDA 2NSXA 2ZE0A 1UOZA 2C0AA 4AWTA 2P10A 1OCJA 1XR2A 1KO0A 2E3ZA 3NQGA 4LNYA 3B9DA 4D8LA 4H41A 4ZQMA 4JTLA 3CWNA 2O4QA 3F2DA 1SW7A 4S3KA 3BE7A 3G1VA 3WNOA 3LV6A 3RYSA 3ITYA 2J74A 4YXGA 3TCEA 3W26A 1WB0A 2QCLA 2HK1A 4C6EA 4HQVA 4DJFA 3G1AA 1QCWA 2A7NA 3ATYA 2W91A 2G5WA 2Y7DA 1DJZA 2AAMA 1KV5A 3N4AA 4ZQOA 5LIYX 4HZ8A 1A4LA 4IMCA 4E8DA 4AMCA 4ERGA 2NQHA 4EX4A 5IHSA 1F73A 3RITA 3BW2A 3VNMA 1E43A 1GQIA 1WZMA 4D2JA 2BWGA 2PDCA 3VDBA 5LIXX 1X1NA 2CW6A 1S38A 2G41A 2YIHA 4B3KA 1E0WA 4F0HA 3LTPA 1CPUA 3K4AA 3ABRA 3PPHA 3OEXA 1ITUA 4XD4A 3KM8A 3NVTA 1P1MA 2ZUWA 3H53A 2D23A 5D2VA 3B04A 5CZSA 2UY4A 3TNBA 1EA0A 1UC4A 1NOWA 3F5LA 3JZUA 1ZENA 3TEVA 5H1WA 2V8ZA 4HN8A 1NU5A 1BSLA 2Y8KA 2DV0A 1B2YA 3T08A 2Z25A 1TWDA 2YXGA 5TD4A 5FJPA 3MUIA 3OW1A 2R8WA 4DWSB 2EEXA 4NAEA 3SIMA 1G1YA 1S1RA 4GNVA 4FF7A 1HW6A 2EPMX 2LLEA 4MYAA 4FAMA 4LFYA 3GTIA 4TV5A 2BODX 4HMEA 2Z2UA 3U7VA 2WXDM 3M4HA 2YZ5A 2ZXDA 4IIGA 3RNDA 2VZSA 3WO8A 3WD0A 3WFAA 4O18A 3B8DA 2I56A 2XM2A 3UWQA 5K2ZA 3WUEA 1K7EA 1LF1A 3U57A 3AQUA 4B4FA 1S2CA 1U1UA 4U2ZA 3IK2A 2WJDA 1ONXA 3CV6A 3V1PA 6ALDA 2ALRA 1XBYA 3GVGA 2QJGA 1DIKA 2PDFA 2E0PA 3MI2A 1LT7A 2J62A 4H6RA 1TV5A 1K9TA 4JR5A 4MGGA 2BOGX 2EJAA 2EPHA 2GJPA 2VTFA 4DAIA 4UTIA 1H7NA 1XQLA 6TAAA 2XGIA 1S2UA 2XIIA 2BHUA 4D8AA 1JGIA 2AKMA 2HE8A 3ELFA 1HL9A 4PBEA 4C6KA 2NVAA 3L5LA 4MM1A 4HTYA 1S3HA 4BHYA 5LGZA 2P50A 4RK8A 1J2BA 4LAZA 3R89A 1UD5A 2Y5SA 3A47A 2YYTA 1TCMA 3BAKA 4AWEA 2PLMA 3MMWA 4K2SA 2GQAA 4DZ5A 2X41A 2E5CA 3TROA 3W0KA 4HVXA 3WD1A 4LRSA 4GHRA 3TW9A 3WQPA 4XZNX 3AU6A 3IEBA 2QUMA 1J10A 1XLFA 3RCMA 3BLOA 4Y9PA 3LRKA 3HQPA 3UBPC 3O3RA 1D3HA 2W0UA 4NRSA 2ZBTA 1F6KA 3ZWTA 4AEOA 4AHOA 3MHUA 1TREA 2IS7A 3REQA 2C18A 1I8JA 3TN6A 3VOGA 1KCLA 3MUAA 3KBSA 1V08A 3URNA 3T0DA 4PE8A 4Y8FA 1ICPA 1AMYA 1XYCA 2CU0A 1ODUA 1JZ8A 1WBJA 3APGA 4IL0A 2ZUMA 1F61A 2BB0A 1GKPA 1ISZA 4RDWA 1RALA 2QVHA 4R3UA 2ESCA 2QS8A 2NW0A 2NV2A 5DF0A 4OOUA 3I10A 1LOLA 4AHPA 2R1LA 3EA2A 4DVOA 3R4IA 2WHJA 1ZY9A 3VGGA 1XBXA 3O63A 4GH3A 3MC5A 4JN6A 2NX1A 2VEIA 3LQGA 3M0KA 4LY4A 3O7UA 1OQFA 5HA7A 3LMYA 3QC3A 3H2NA 4AYSA 1V4YA 4LC8A 3VGEA 3M0JA 1F3XA 1UW9A 3Q4DA 3QF0A 4IZGA 2DVTA 1XLEA 2GWGA 1OF6A 3WFLA 3QKEA 1EYEA 3LEPA 4OJYA 4PEEA 1NWTA 5FAGA 4O1CA 3SCQA 3GFXA 5ABEA 2QJNA 4CNOA 3GS6A 1TRIA 4MKNA 3CIWA 4TO8A 1MO0A 1PE1A 2XVKA 2OVLA 1V6YA 5K9XA 2HXTA 5AVNA 5CJMA 3S47A 2VC5A 3FN9A 5FEWA 1TJ0A 2P1FA 1UZ4A 4N9EA 3R8GA 4AWUA 4B90A 3R0UA 3W86A 3IRDA 2A85A 3V5CA 3CT2A 1DJHA 4RE4A 3ALFA 3EXSA 3ARTA 1J0JA 2HISA 3E3HA 3UWEA 3VO0A 3QR3A 4U31A 2A3BA 4XX6A 1Q7ZA 1OT2A 3CPUA 1UD4A 2PDKA 3RMJA 3TW7A 5AHFA 3T55A 1Q6CA 2FB2A 5ABFA 1PWMA 1UWAA 1XGDA 4XZHA 2UZ9A 2QPXA 1VBGA 3CZ8A 1QAPA 4A3YA 3ANUA 1ADDA 3SGUA 1SW3A 4IF2A 3QGVA 3IANA 4D6EA 4WY0A 1C29A 1P7TB 2ZYFA 5A2CA 3DAQA 1DJYA 4UCFA 1Q7MA 1YE4A 2E25A 4BF7A 3WQCA 4E0CA 5C2GA 4JICA 5CSSA 3ZYZA 4CQDA 1M03A 4C6MA 1J8VA 2WMGA 4CN1A 5AHEA 3O6AA 4C6DA 3T0BA 2X30A 1FCBA 2OQHA 3DYOA 3PNZA 2PS2A 1XIDA 2ZQ0A 1RQBA 3QY7A 4A3QA 1VRXA 2QJMA 3NDYA 2RFGA 4PB4A 4J5NA 4C65A 4EAYA 1PKNA 7ENLA 5HMSA 5CJ5A 1LL6A 2PUZA 2Q09A 4IFKB 4GKLA 2OGJA 4CVWA 1L8NA 3N2OA 4FO4A 3TYBA 5D05A 1QJWA 1B3OA 3ANYA 3UJEA 1K6WA 4A8LA 4JYDA 4AD4A 2IW0A 4Q4KA 3SEPA 1KGXA 2JBMA 4IH3A 1BVWA 4MUPA 4BQ3A 3GTFA 4Q8MA 1SYTA 4P8WA 4BKNA 4Z2HA 3HQOA 4AG0A 2C71A 4IIHA 3LERA 4J3ZA 4JL2A 2I5GA 1WDRA 1AH4A 1L2UA 1A5MC 3DG3A 2WVVB 3G1RA 1JR1A 1GG1A 3B9AA 3GBEA 4OBRA 2G37A 1PTAA 3UZ5A 2OLAA 3TV8A 9XIMA 1C3FA 1S5TA 1UUOA 1PZ1A 1Y7VA 3R94A 4W85A 2G3FA 1FA2A 2QPUA 5LGXA 3TKFA 2VX6A 5CCZA 3G8EA 5REQA 4AZCB 4GISA 3ARVA 4WDXA 3A21A 1NVMA 3H2FA 5FJJA 2BDQA 3GK0A 1E1CA 1JYNA 2QCDA 3VGFA 1VFFA 5AN7A 2YLLA 3ORWA 1EYWA 1K9EA 2FQIA 3O05A 2ZDSA 1R5YA 2NVCA 3F4DA 3IJ7A 4B9ZA 3GZ3A 1CW2A 1K03A 4NP7A 4M6VA 1YADA 2A5HA 4GGHA 4AD1A 4H00A 2DSVA 1EP1A 5DXYA 4PC8A 1CGTA 3MO4A 3EGJA 1SR9A 4ZB5A 4NYUA 1IV8A 3G77A 2DT3A 1TMQA 1H7XA 1T40A 4FNSA 4A3UA 1WDDA 4LOCA 2Z2AA 3GU2A 2X7VA 1LG1A 2FGLA 1KCKA 4WQ6A 2ZRVA 2PAJA 4AU0A 2ZZ2A 1W8SA 3N19B 3TP4A 1R2RA 3B8UA 4LUJA 2PDIA 1F5ZA 3N4FA 3AIVA 2JIWA 4JFUA 4AIBA 3WH9A 1R85A 3N4EA 4XISA 4PSRA 3R2GA 3EEZA 3RO6A 3STCA 1X1ZA 2X05A 2EHHA 4GIEA 3NO3A 3AHVA 3WDPP 4M24A 2PTYA 1LLZA 1MRQA 4AZ7A 1J96A 1DIDA 1A5UA 1QO5A 1ICQA 1UD8A 3LHZA 1GOOA 2NQJA 4UTKA 4GKTA 4NJJA 1OK6A 3D3FA 1POJA 2NQ5A 3WLJA 2J7CA 3HO8A 1BF2A 1I45A 3T0TA 4X22A 3ES8A 1Q85A 4EIVA 4XTIA 1JVNA 4BA0A 4FF5A 2VXNA 3UR2A 3WJSA 1LJYA 2XN0A 3CUJA 3BTNA 3WZ0E 3S9YA 3LCIA 1Q6RA 1EFZA 4S3EA 1CXKA 2CLLA 3MKVA 2AL2B 2BVDA 1X7IA 3GUWA 3H7RA 2VC6A 1CWYA 3QR0A 2Z29A 3LCLA 4EANA 2GUBA 2CIPA 4LAOA 4C6CA 5E93A 1VENA 3MUZ1 5FAJA 1H4PA 3UXIA 3CHEA 4F79A 3WMSA 1UUQA 5D04C 3TA6A 2JQXA 1UWIA 2WHLA 4ZO8A 3A12A 3MU7A 4WEVX 1BWVA 3N1AA 4BI5A 1W37A 3BVJA 4NY2A 1S3TC 2OYMA 3MY9A 1ISYA 3NQVA 4CQCA 3ITVA 2DT0A 3N9KA 2I5IA 3II1A 4NZFA 3KCJA 7XIMA 2VX7A 1AQ0A 1RXOB 3B0PA 2PWDA 2BG5A 3L23A 3WNKA 4Q33A 4UTHA 3HPAA 1CENA 3PZVA 2BTMA 1E4NA 3AYVA 4WDTA 3ZT7A 3S1UA 4FXJA 2WQDA 4YTUA 3LENA 3AC0A 2WMFA 1PTGA 1DIOA 3WJYA 4J4KA 2CLPA 1DWIM 1OYAA 1GYLA 4GQRA 1VCVA 1O66A 4GZIA 1RPXA 1E0TA 4E3TA 1ESWA 3DHDA 3L5AA 3M44A 2WSQA 4AIEA 2GL5A 4ZO9A 1HJSA 3F4NA 2PLCA 3NQDA 4LVFA 3VKJA 2O9RA 1MRAA 4GNJA 1FWGC 1K02A 5DBUA 2VENA 4UB9A 3T81A 2BGQA 3VIOA 4H8HA 3H54A 5BXSA 1AQFA 2FJKA 4J2PA 3Q45A 4UR8A 1IEVA 3V16A 1CXHA 1GGOA 4OBSA 2GVYA 3BLKA 1ZL1A 1KTBA 1UWTA 1VFHA 4ACZB 3HPZA 3N2TA 4HA1A 3ZM8A 2R91A 2SFPA 4GC4A 4M6QA 2QUUA 4DLFA 2VJXA 4V33A 4WVXA 4O10A 4G7EB 1EHNA 1VD6A 5EYWA 1TTJA 1VHNA 2G96A 4CU7A 1BKHA 3RR1A 4PN2A 1AJZA 1B0IA 2ACRA 1T8QA 1ENUA 3AICA 1IEWA 1VQTA 4DXKA 3NYZA 1B30A 1OC6A 4QGCA 1I75A 5ECVA 1E51A 5HQEA 4XZWA 5DFAA 4JTSA 2VP8A 5CC3A 2PWEA 4NT0A 1ZCOA 3TJIA 4I8DA 3VNDA 4ZR8A 3K30A 2OEKA 3WSUA 3N15A 1JD7A 1V7AA 1XIEA 2EO7A 4RV8A 3W1XA 3RLGA 4DZIA 3I65A 4UFLA 1C93A 3VCNA 3TR9A 3ITTA 4NX0A 3N9SA 3NQ7A 4FIQA 3OZMA 4L7ZA 3D6NA 1ZJAA 4AB4A 1VLWA 4Z08A 4AF0B 4MWAA 4ZEPA 1M01A 1NWSA 4CU6A 2BXYA 4HHLA 1BPLB 3UG8A 1GPWA 3QR1A 1HJQA 2IQ0A 2DIJA 4K8EA 3TYCA 4Q32A 3AXHA 5EMJA 2XVNA 5BRQA 4Z1CA 5HANA 5EMKA 2XIQA 2PU1A 3GG1A 3S83A 2FHBA 3RJXA 1TA3B 2G8ZA 5CZJA 1W0MA 4E8GA 1KR0A 4QJ1A 2GOUA 3T9PA 2PEVA 3UG5A 4K36A 5CPMA 2WMKA 1RJQA 4JTAA 1CDGA 1TKKA 3QXBA 2XIBA 1IYXA 1VFUA 3TJ4A 3I7SA 1CLVA 1KWGA 2WWDA 5I3DA 2C7FA 4F40A 4DYEA 1BYCA 4YTSA 1U5HA 4QE1A 2VOMA 4OTKA 3P80A 1TE1A 2IMRA 4UCGA 3WDQA 5BXRA 1PX3A 1GK8A 3ONBA 2QZRA 2ABAA 3PSWA 2Z1BA 3APYA 1LRTA 5AC7A 3MV01 4GA8A 1EGVA 2QR6A 1J0YA 2WB5A 1DWGM 4O4VA 3PTMA 5HXMA 3LLFA 3UZJA 4H7VA 2DUAA 4Z2IA 4C1NB 3VFCA 2V3FA 3M7SA 4AFYA 1H62A 1JF6A 4JIQA 3LU2A 3DC0A 1EH9A 1YHTA 3N73A 5IFTA 2WVUA 1QDSA 3UGRA 3VM7A 3FDKA 2PDLA 1OBAA 1NOFA 3VD3A 4WIWA 2VFEA 4GCAA 4J9JA 4PZVA 3WF3A 3FKRA 2WOQA 4Y96A 3RLHA 3MSRA 1H09A 3VXGA 3SUSA 4LCRA 1EL3A 3BAJA 4MOZA 1JRBA 4P61A 3M9YA 2ZADA 3AUOA 3SRKA 3VINA 1BXCA 3TYEA 2AAAA 1CT5A 3QV6A 3CWOX 2ZTKA 2RHGA 3E96A 1I6NA 2FKPA 4KT2A 4Q8PA 1WKEA 3KBNA 3PBVA 3OTRA 1LUCB 2YZRA 4HNNA 4W86A 3ALGA 4GLEA 1HKJA 3CEUA 3HGOA 1MXDA 2XUCA 4O57A 3BLEA 1EDGA 3TONA 5HNNA 2WJFA 1DIEA 3VE9A 1FWNA 4J3XA 5GVJA 1BXNA 4ZQRA 3WENA 3B3DA 1HVQA 1KQZA 3SCNA 1B4KA 1CB7B 3ERPA 4JKKA 5GPRA 1Z6KA 1RQEA 1NARA 3WIJA 1XLAA 4UTWC 5MKGA 3V7PA 2O7SA 3I3BA 1EPVA 5HNRA 1Z69A 2VO5A 3EDJA 3SIZA 1Q7QA 1V0LA 1BRLA 4ORIA 5I79A 1F3EA 3KBWA 1VFLA 3S1WA 4D72A 1JPKA 4MZ1A 3CL6A 2D0HA 4A21A 2PF0A 4PTVA 5G4HC 3LD5A 4YPJA 4HT3A 1UBSA 3PTQA 3E0WA 2WZHA 3T44A 1ONEA 3BSGA 3ZWSA 5HINA 4FNQA 3P5ZA 4B9YA 3T42A 3FEMA 1BHGA 1Y5WA 1S46A 5CPLA 1GQNA 1KNWA 3NQ8A 4K7YA 4C5ZA 1D7KA 3N3TA 1RP9A 3GHSA 1V0KA 3LSCA 2UWFA 4HB7A 4MHBA 2MANA 1OABA 1G4PA 1AFSA 4UZUA 5TF0A 1AK5A 4O0KA 2HROA 4JQ2A 1WUEA 3HV8A 1WDPA 1YDVA 2EPOA 3LY0A 1TIMA 2DIKA 2DSZA 1XGZA 4LYPA 3UYCA 2FZBA 3WNNA 2E67A 4A6GA 4FXFA 5EL1A 4MZ8A 1R3VA 1RZMA 4HMDA 5G1MA 1GQKA 4Z17A 3M5YA 1TTIA 3LUTA 2ZX6A 4PCNA 2P0IA 1J01A 4PBGA 3FFSA 4XZ9A 2C91A 4BQ5A 1J9YA 3KFTA 2C16A 3H24A 4FOKA 5FIPA 2GPTA 3DG6A 3ARUA 3UFYA 4A05A 3NSNA 4TVDA 3U5YA 4MPQA 3QSRA 3SW6A 4A22A 4XAYA 1VZWA 1QNRA 4HNCA 4JYFA 4CQBA 2QCCA 4OVXA 2JKAA 2XGZA 3EPNA 1CGWA 2E5DA 4K8HA 3LZ5A 1KGUA 2X09A 3BJTA 2PDWA 3PB0A 2J8GA 3GDBA 2ZC8A 1MEHA 4LYQA 1A53A 2OKOA 1UOKA 4WY0F 2O9OA 1W9XA 1NOUA 2Z26A 4PSPA 3FVMA 2R6OA 4FZIA 4F48A 3U2OA 4NZCA 1GYNA 1KM3A 1XLHA 5C71A 3OQEA 3KS6A 2XPKA 1WAWA 1KRMA 4PR4A 1DJWA 1VIZA 3TFXA 1XPYA 4S1FA 3SCOA 1DXFA 4MADA 1K8XA 3GXPA 2YL6A 4KCVA 3N2BA 1JCYA 4Q8WA 1XI3A 2WVTA 3OA3A 2RDTA 3U0HA 1R9ZA 1QOXA 2YOCA 4QE4A 3O0KA 3V0TA 2Z0IA 4WJEA 4NVTA 5D9NA 3AYTA 3SURA 4O1AA 1ODZA 3LCWA 1QVBA 2DW6A 3TA9A 2P3ZA 1US2A 1OHLA 2PP1A 5CGMA 3FA5A 3L2IA 4XZIA 1JCTA 4CD7A 1H63A 1IZKA 1GHRA 1DQWA 4LXFA 4MJMA 1EGMA 1M65A 3AAMA 3W1LA 3BDKA 4NIRA 4GI4A 4RCXA 3TX9A 1SR0A 2YA1A 1MI3A 3ARYA 1XLMA 4RDZA 4E2DA 2XG9A 3TLQA 4QQ3A 5CZKA 2Q8LA 3SN1A 3VIIA 3VK5A 3SGGA 1ADSA 2V3DA 1PS9A 2TSYA 1S5MA 3RGTA 2VGIA 1E71M 3NQBA 3LRLA 4C6IA 4JDBA 3DFPA 3MUCA 3QLLA 4ZOBA 4P7NA 3CQHA 2J25A 3TN5A 4XKYB 4H9YA 4Y9AA 1R3TA 4JY8A 3QM3A 1AW2A 5IRPA 2BP1A 3WQ6A 3TJLA 3QQWA 3C52A 1SSGA 2FFIA 1F3TA 3DFSA 3RR4A 4R34A 4FI4A 5G4WA 3EOOA 2INEA 2VUYA 5A8NA 2EXOA 4JNYA 3P3BA 4TMBA 1BTCA 1M7XA 3O07A 1MNZA 1MQRA 1HL8A 3M46A 4PA8A 4D6IA 1UKTA 4MAVA 1XV8A 1OB0A 3NUKA 5C8BB 3QPZA 4PCPA 1HFBA 3BICA 4X61A 1M5WA 3V3WA 3V0UA 4PB3A 4N4QA 1E70M 2WMHA 3LLXA 3ZJ8A 3PAJA 4JEQA 1V6TA 3KVKA 3ME3A 3P5YA 1IIGA 5DT5A 3TZNA 2WMIB 4L6HA 3PTKA 2QIIA 2XWEA 1XG4A 3ARQA 2AGKA 3CM4A 4RNHA 2G95A 4PUMA 4ZA0A 4AW7A 5JMUA 4H7ZA 5BOFA 2QCMA 1DE5A 1NELA 3NGJA 1RBAA 3ARWA 5FJUA 2J8FA 1U33A 4ZL1A 4L4MA 2DH2A 4POCA 1XWYA 1BGAA 4FEZA 2V82A 1QPOA 4BI7A 3W02A 1GOIA 3SRDA 3I7RA 4DIAA 2A4AA 3LA4A 4BWLA 3VABA 5AC5A 1S5VA 1GQLA 1KBKA 1J18A 1GJPA 2A21A 3LZ3A 4HOXA 1UR4A 3QLDA 1IQ8A 3UY7A 3KP1A 3E02A 2IPWA 2OFJA 4LB3A 3ICJA 3W29A 1VBJA 4GYKA 4DF2A 4W7WA 2J24A 1YQ2A 4UOJA 4PMVA 3ITLA 5HMDA 3EBVA 5KEZA 3BAIA 4ACYA 2ABBA 4KCUA 4TV6A 1VHCA 4CNTA 1I4NA 3JR2A 1M68A 1HP5A 3L2MA 3EEGA 3JVAA 3B4UA 1UKQA 3N17A 2X7WA 1XIMA 1J6OA 4MB1A 3NVDA 2C14A 1JI2A 2PP0A 5CQ1A 1IT8A 1TVNA 2EKCA 3L67A 3R25A 1X97A 4O19A 3QEZA 2XVPA 1IF2A 2VC7A 1JAEA 1G9HA 4AIUA 2PRMA 3UGVA 2WC7A 4RR4A 1D8CA 1H7PA 2E6AA 1A5KC 2QQ6A 3DFOA 3EMZA 3TC6A 4WF7A 3QOKA 1M1BA 3SUUA 4BFAA 3E0FA 1EKOA 3A13A 1QNQA 4DXVA 3AISA 1DJQA 3AXIA 4UTMA 1TV4A 3NSMA 2FPTA 3F2BA 3NEVA 1AD4A 1RLCL 3LRMA 2VEPA 1WDQA 5D38A 5IFPA 4Q8TA 3H22A 1K8ZA 1ISXA 4QROA 4JS3A 3B0XA 5E0FA 3UZYA 4ECLA 5CC7A 3TTYA 5BYWA 3HU7A 2V6AA 3B05A 3N9RA 5EMLA 2V3EA 4HSOA 2Y0FA 1ME9A 2VD9A 3GNNA 5CG0A 3W1RA 1G69A 3LBMA 4U3CA 4G9PA 4Q4SA 1IEIA 3E5PA 4UTWA 4TTUA 3W75A 3R10A 1TPWA 1OFEA 1J0ZA 2NWSA 1AD1A 1QPQA 3LCGA 2PDGA 1LQ2A 3HMCA 3WQDA 1LG2A 1M3UA 1QO2A 3KTCA 4JHMA 2OWWA 3MSDA 4IT1A 3SJ3A 4EXBA 1W3NA 2VT0A 2PLJA 4O50A 1H3GA 1L9WA 4PTDA 3MMDA 4QDWA 3W7HA 2Y1HA 5ABGA 5DCEA 4AC1X 4RW5A 3AJXA 2PPGA 3ZVHB 2TODA 4P8XA 4UTUA 3N6JA 2O56A 3UG3A 4BQ2A 1AZ2A 3HFYA 4LAUA 1SGJA 4MMWA 4W8BA 4DBSA 2P5NA 3TWAA 2WKGA 1R7AA 3N13A 3IUDA 4RKAA 1JNDA 3QVQA 4CNSA 3WKZA 3CHFA 3MDUA 5LNRA 3L5MA 1DTNA 4NU7A 2J13A 4LY8A 4L6DA 3W9ZA 3BAWA 1U1HA 3NURA 3QN3A 3W81A 1XFBA 3LGEA 2FZ8A 2IXVA 3AXMA 2Y70A 1OX5A 5DRCA 5J04A 5BRPA 1JCMP 1XLGA 5EU9A 4ONVA 4GPNA 4Q4OA 1DJIA 3NWRA 2DY3A 3GKFA 4WKFA 4JTQA 3M6YA 3IWPA 3AROA 2W92A 3UWZA 3QRHA 1IR2A 3W7QA 2G4JA 5BU6A 3HB9A 2XHYA 4NZ4A 3AMDA 4C6FA 4GVIA 1W9UA 1FP8A 2HDJA 3H2EA 3IIOA 5U4NA 3EB2A 1XIBA 4D1IA 5C9WA 2NT1A 2JK2A 2FVMA 1W8GA 5TNVA 4X2RA 4HPGA 1UQYA 5E5CA 4LF1A 3MA8A 4M29A 5HJLA 3BH4A 1W3KA 2DZAA 4HU0A 2DW7A 1XCFA 3FA3A 4LS1A 3QKZA 1N8FA 1OM0A 3VNIA 1ONRA 5KZ6A 1YTKA 1YNYA 3TTEA 3IARA 1ZAJA 4MJ2A 4PUUA 2QJJA 1POKA 3SCPA 2KAUC 4E4PA 4JXCA 2EG7A 3W2KA 3BXWA 4UFJA 3HBLA 2A3HA 1KFBA 3INPA 4FR1A 4O12A 3EX1A 3HGSA 3BLIA 3NZGA 4M8UA 5CAKA 1V0NA 4K3ZA 4F0LA 3OGRA 1WX0A 4XO7A 2VZVA 2QJIA 4C5YA 3CL7A 3W2UA 3E1F1 1PCWA 3EAUA 1KM1A 2A7PA 4LRTA 3O1NA 1XIJA 1XM3A 1MDRA 2PE4A 2PRHA 3GIPA 1UBPC 3DKJA 3UR5A 1WOBA 1XRVA 3EDDA 3DEQA 3SY1A 4BY3A 4BQ4A 1X38A 3UCDA 1EZ2A 1X8FA 1JZ2A 1UJQA 2PRLA 3VC5A 4E38A 3KOFA 4HPHA 3GH5A 2OSXA 5LA0A 4QAIA 2VFHA 1V51A 4GC3A 3TC3A 1SMAA 2DH3A 3SCRA 1L6WA 7REQB 2GGGA 3WQVA 4W89A 3WYZA 1NQKA 3MPGA 4JFWA 3GR4A 4O8AA 3BOLA 4IISA 4PRRA 3VMOA 5AECA 2WM1A 1OCBA 1CXIA 3WQEA 4L9ZA 1EOKA 3NQFA 4CD8A 2E5BA 3S9IA 1EJUC 1R86A 3VZZA 2XJ7A 2YA2A 3WJZA 4DJEC 3F4CA 5DY2A 3DERA 3H2MA 3WEMA 1RV8A 5XIAA 2HPMA 2PFHA 3CWHA 2V68A 4WXZA 3VOJA 3I68A 3WQWA 2DGAA 1EQPA 1OD8A 4FX8A 3ZOAA 3BW3A 1X96A 2D3NA 1R7OA 1NFGA 2QMKA 4MB3A 3BLDA 1V77A 2B0MA 3KVLA 1C8XA 3LK6A 2J7DA 5LZLA 1Q6DA 3W6MA 4GABA 3GQYA 4DPPA 4CGTA 1V6VA 1PHQA 1HJXA 1H60A 2A2IA 4CCCA 1YTEA 4NHVA 1TV8A 3VFLA 4JD4A 3CUGA 2OX4A 2NSOA 1GVRA 1OY0A 4LS2A 4YN5A 4GYPA 1H1NA 1UP2A 3U9IA 1HJWA 4YYCA 4IQLA 2V2DA 5MHBA 2V5JA 4S3CA 4LU0A 3S8HA 4WXYA 1JCXA 2QUNA 3P82A 3T4WA 5C55A 4ES4A 1XCWA 1AQHA 2P8BA 5CBIA 3UT0A 3VAVA 2QIWA 2O0TA 4BS0A 4GVHA 2VQUA 4NRRA 1U2YA 3MP3A 3M0LA 3TNOA 8CGTA 1AW5A 3URAA 4D8ZA 2IQTA 4RXFA 2JIEA 4UTLA 2NLYA 2EPLX 1AQMA 3EKLA 4CN6A 2P76A 1FWIC 4LALA 3UQNA 3ZSSA 2A79A 1WNOA 1P1XA 5FEPA 4LVBA 4HK6A 2RDXA 3OA5A 3HZ3A 5F2IA 3QGKC 1DWJM 2VVNA 2OKTA 2D0FA 5T9CE 3V36A 1J0IA 4CEXC 2YB4A 3TQKA 1REQA 4ICCX 1JPHA 2X1IA 3E6EA 1ZFJA 3TYAA 4ALDA 4HPNA 3CAWA 4H8UA 5LKYA 1XLIA 1SO6A 3APTA 4LUTB 4KEZA 1Q45A 1O60A 4WSJA 3E0IA 3IVSA 1WZAA 5T9BG 1TR1A 2AQVA 2GUUA 1C9WA 3C3UA 4GFIA 4K37A 5H91A 4CN4A 4DWSC 1P0DA 1DTUA 2PWVA 3LPGA 2W67A 3K4DA 4LPCA 1RSCA 1VFTA 1ITQA 1FWBC 4JNMA 4WKAA 4EPDC 2HTMA 3K5XA 3VCCA 2OT0A 4IPLA 2CITA 2P8CA 4M5PA 3ZZ1A 3GY1A 2I17A 4E4FA 3GBDA 4B5VA 2ACUA 4XBKA 4NZ3A 4XAFA 2Z24A 3S1XA 2DZUA 1FWWA 1UR0A 3KCOA 1BYDA 5FF2A 4I6KA 3QV9A 4LEQA 1JZ5A 4AAJA 4WX2A 1LWIA 3WQOA 3S6DA 3GDLA 1NTHA 1JRCA 3OHIA 3WQ4A 5BOOA 4HA0A 5ENLA 1E0XA 1VYRA 1F6PA 2NUWA 2NXIA 3PVFA 4PMOA 2X16A 1UROA 1THFD 2Z4GA 2ZZ1A 4L4PA 1EC7A 4RPPA 3LLDA 4JFTA 2XDFA 2DJLA 5AHMA 1CGXA 3VKBA 1HZYA 3GXFA 1XGEA 2CBVA 3KLKA 3KRSA 3CPRA 3R8RA 1MZHA 5BZAA 3FYPA 1GVFA 1CEOA 1TR9A 2ZA3A 4QNWA 1ZPTA 2WK2A 1ZJIA 3CTLA 4Z42C 2GSEA 3O16A 4GQBA 2DQXA 1F3WA 1X98A 5HOSA 2CYGA 4AY7A 3EX4A 3W74A 4Z2LA 2W79A 1Y8BA 3WJXA 1JUEA 4RUBA 2OYKA 1E1EA 4I5XA 2ZICA 4W84A 3MHGA 3B0VC 3P8JA 4F4RA 1ZGDA 4RE2A 2HBVA 3GO2A 1I2PA 2V3GA 4GVGA 3WLMA 3ZJKA 3BZJA 2HCVA 3TUUA 1V02A 1C92A 1Z44A 3R8HA 1PIIA 4B3LA 4KWUA 1ZBCA 3W2NA 4UQ9A 4J3TA 4UOZA 4GG9A 1UASA 4AC7C 1H7RA 4IXHA 3NQ6A 3U2EA 4L64A 3GDTA 3CHDA 4AD2A 1XRTA 3S1GA 1RUSA 2IKIA 4C60A 4NNAA 3VNYA 2ZRXA 2ALDA 4H9UA 1TIWA 1RP8A 4KKXA 3CAVA 4REQB 3W1NA 1UD2A 4AHQA 1EF3A 5JIWA 3BSHA 2C1GA 5FI8A 4IP5A 4P7QA 4WDUA 3T7VA 3RO8A 3UYIA 4LUSB 1GPFA 4M6UA 1HT6A 3HGRA 1MYRA 4A4AA 4IP7A 4RZBA 3VOCA 1JQVA 5C9XA 3AHYA 5I2UA 1E5NA 2OELA 4H2CA 1MNSA 4IL2A 1PIFA 3W82A 2GJRA 5CG7A 1FDJA 3WD4A 1ITXA 4O4WA 2NQLA 4O0ZA 2NQ9A 3Q58A 3UJRA 3KL5A 4HCDA 2W4XA 3TOPA 2BHZA 4JTEA 5F2MA 2FZMA 4W5UA 4DJED 1M6JA 1QK2A 1ITCA 4C6QA 1TPFA 3M47A 2WNQA 4UFKA 1KC7A 2NX9A 3QPEA 1D9EA 4JTFA 2I1OA 3GNXA 4XWUA 3WLHA 4I7VA 1K70A 2WHMA 4QM1A 1S5WA 3S42A 1R0MA 2OYLA 3QY6A 1F05A 3RJYA 1J12A 4UR9A 3NA8A 1LTDA 3QV7A 1T6MA 3LXCA 1H50A 1HL2A 4ZTYA 3SRHA 3TSDA 3FJ4A 1BKSA 1ZAHA 3KVJA 3OLIA 1L8PA 3A24A 4Y7EA 5G1TA 3HPSA 4XUGA 2QGHA 1EX5A 2JGQA 3VM5A 4GUJA 4PUDA 4MY8A 4K1WA 2XSAA 3KHDA 1IXPA 3UD6A 5CBBA 4WJXA 1VPYA 2R14A 3MQTA 5LSMA 3GB6A 4JTDA 3M0YA 4N9CA 5C7VA 3I4EA 1EUNA 4V27A 4PMXA 1XIHA 3CUHA 5L6UA 1EWDA 3USBA 4KPLA 1VIWA 1KFJA 3SM0A 3VNKA 5HUPA 4UXDA 4L6OA 4PMQA 4AXNA 4Y6GA 4S3FA 3I3EA 4K1GA 2QV4A 5C54A 1ECEA 1NFPA 3QFEA 4W7UA 3VUPA 1BEUA 2AOSA 1RJPA 2YBVA 2Y8VA 3ZR4A 5HNTA 2CLKA 2PGEA 5JBDA 5DCDA 1HN1A 3SUWA 3E0LA 3PFMA 5DLCA 4AZGA 2W61A 3VD7A 4C6LA 2P3EA 4IPJA 4LCSA 4C1KA 5T8GA 3QSTA 3CUFA 2OODA 2BFGA 4GXMA 3H8AA 5DMMA 3LM7A 2Z00A 4DO5A 3C0JA 2EAWA 4ML4A 2G3IA 1XYFA 2WANA 5CBJA 5JUVA 4GZJA 1TJPA 4OHQA 3XINA 2A3LA 2ZX7A 4WDWA 3H2CA 2V67A 4JKLA 1FH8A 3U4FA 4IIFA 2V38A 2AMGA 2VFDA 2GFTA 4DWSD 1X39A 3KUMA 1ML1A 4QFUA 2J7GA 1EWEA 1XHGA 1Q2SA 3NIYA 3BO9A 4AUBA 3G5EA 3AMLA 3G0SA 2QDDA 1SZRA 3A23A 3TU9A 2INFA 2Y5JA 4J1OA 1NDZA 1AJ2A 5BRBA 4MNLA 5C6MA 2V2CA 2C15A 1JDCA 1EJVC 3TR2A 4DJDC 3VYLA 2DT1A 3GYCA 3QH2A 3RDKA 3MBDA 1B31A 3B4YA 2WNWA 1XLCA 4PGLA 3RU6A 3VKAA 3EKZA 1LT8A 2VGBA 4DUWA 3W1TA 3P93A 1UWUA 1G0CA 2ZC1A 2FDMA 2PWGA 2F6KA 4UNKA 1Z3NA 4PTXA 1Z32X 3W7JA 2GGIA 4K38A 5FJRA 3URQA 1F8IA 3B0YA 1O6IA 3TC7A 1JCLA 1E4LA 4C90A 1QI2A 4OV9A 4GNKB 2FMOA 1W3HA 5LA1A 3GH7A 3W87A 2WSKA 3UZXA 3UZWA 1XX1A 2FTPA 4JFSA 3W2MA 4J3WA 8RUCA 3TZFA 1H41A 3FYOA 1TMHA 4LBSA 3QTPA 2ZIDA 4TXEA 4P5UA 3DI1A 2PTXA 2XWDA 2F84A 4J35A 5F4XA 2DSUA 1PPIA 3DN5A 2GQ3A 3RF9A 1B3XA 2Z6IA 1TPUA 1XSKA 3D0CA 1UB3A 3OVQA 2F9RA 1MWOA 4X60A 3MVTA 1QTWA 1TB3A 3OPSA 1EQCA 3WQGA 4AISA 1H2JA 4I5UA 3TK7A 5I03A 3CAKA 4A8IA 5A1AA 1F2JA 5MKGB 2QCHA 4BZYA 2CETA 3L12A 4JHOA 1XG3A 2OQLA 3IVTA 3VE7A 1LLOA 3EA1A 3KOXA 1TPH1 1JZ6A 4NJHA 3F4VA 4JBRA 1O5KA 1PX4A 2VHLA 4RZ5A 1SO3A 1SVDA 3MYOA 5BOEA 2ZE3A 2HBXA 3MW7A 3I4KA 4DWDA 2FHCA 2PGWA 8TIMA 5EFDA 5IBXC 1EJTC 2BS9A 3NNTA 3KRZA 4F0MA 3NSXA 4ZGYA 1IWPA 2CC0A 1A0EA 1W2PA 3KOZA 4QDPA 2D2HA 4UTTC 2Y63A 4MSSA 2QPSA 5BROA 2A3EA 1GTHA 4R27A 1I2QA 5CSYA 2C19A 4NAFB 3WBXA 7TIMA 2VFFA 1N7KA 5ABHA 1C7TA 3DX5A 1EOMA 2J7HA 3T8QA 2VUNA 4D6HA 5HR7A 4XZBA 3R58A 2ANUA 4Q8OA 1E9IA 1QU4A 1ISVA 2V5CA 2YCLB 4HOZA 2OWCA 2UY3A 4U5IA 5I0DA 4JY9A 1VR6A 7PTDA 2YFNA 3OBAA 3VDCA 4XD3A 3TTQA 1OFOA 3L0NA 2Y7EA 3K1DA 4OECA 4MJ4A 2FDSA 2E1DA 3W6LA 1OD0A 2ZUSA 4S2BA 3D47A 1QPNA 1UYQA 5CPNA 4N0RA 2C13A 5GJMA 4MLRA 1G6CA 3FX4A 3E5BA 4US5D 1FX6A 3A6OA 2YDSA 4OQVA 4YCPA 3L66A 3U7BA 4QNEA 5EB8A 1BGGA 1KFLA 4A2SA 1A3WA 5TQLA 3PANA 1PVNA 4LYRA 3WLSA 5D37A 1OFDA 5XIMA 3BMWA 1Z89A 4GGBA 3FKKA 1D2KA 4GUGA 4IIDA 2VOTA 3V5OA 1FH9A 1WZLA 2B7QA 2D2JA 5HAOA 4MNMA 3POHA 3MANA 3PBWA 1GHSA 4IJRA 3ITCA 2DSWA 1TV2A 1E6RA 3CL8A 1G4TA 3DESA 5A6BD 4NF7A 4WSHA 1XIGA 5FKYA 4YHGA 2VFIA 1K1DA 3FDGA 1FCUA 3KZPA 5FF7A 3RUBL 1GVOA 2ZUNA 1B5TA 1MZRA 3AIQA 1FH7A 2YKKA 2YL5A 3BQ6A 2YDRA 1Y5VA 1JZ4A 2Z1KA 3W76A 2EG6A 3ITOA 1V6UA 3W25A 3OLDA 2PD9A 1OJXA 3LYEA 5CH9A 1XICA 6XIMA 3CTTA 3PBGA 1GVEA 3BSMA 2W9MA 3CLMA 5KZDA 2CKSA 5LXEA 1NDVA 4MVAA 3WX7A 4MJZA 3WBEA 5AC6A 3BURA 5I5RA 2WNZA 3PWGA 2XM1A 3M07A 1EZWA 4XUYA 3UCCA 4CCDA 2EQDA 4W8LA 5AHLA 4HSHA 1NP0A 4HHMA 1DP0A 4GJ1A 4B5TA 2X40A 1RVGA 2XH0A 4IXXA 2CBUA 2O7QA 4GUFA 4IIBA 1SZGA 4JZ5A 1FY6A 4H8VA 4L65A 4GUIA 3A5VA 3XISA 1MSSA 4CQ9A 4NKCA 2VNCA 5BWAA 3OG2A 1IT0A 1QW8A 4QEHA 4DJDD 3VGDA 4LS0A 3BV7A 1Q63A 4H7CA 1OX4B 1SQ7A 3R5EA 1BF6A 2PTWA 1C7SA 1I1WA 2POTA 3T8LA 4HNVA 4GFSA 1B57A 3DOPA 3GAYA 1LQAA 1IXNA 5XINA 3T0AA 4KGLA 2NV9A 4HOWA 2OO6A 3D5HA 3UPBA 3FHAA 1HVXA 1E40A 4M51A 5LIKX 1YW1A 3H7VA 3SFWA 2WCSA 1PYFA 2BSLA 1LM1A 1UKSA 3SUVA 3AJ7A 2FIQA 3RG6A 2RGMA 1VPQA 4R7JA 1GJWA 3PZ9A 3FY1A 4JTTA 1B90A 1O5RA 4MG4A 5G5IA 2X1TA 1KWKA 3QTGA 3A64A 2VEMA 3SCWA 2WMJA 5GQBA 1G67A 1PX8A 3P61A 2AL1A 1SW0A 1NSJA 2FVKA 4AD5A 3TXVA 4I5RA 4I9AA 3WF4A 4OGZA 2HZGA 4JTJA 1OWQA 2PI6A 3BLLA 1P7TA 3NG3A 1F74A 3OHMB 1HXJA 1Q13A 1GORA 1UR3M 4Q6JA 3DENA 3NQ2A 1QI3A 4QP0A 2JF7A 2I16A 2XSXA 2FFCA 4HP5A 1TTPA 4H1ZA 1C8VA 2CLEA 1XH1A 3WEOA 3NPVA 1IZJA 3MT1A 2OZ8A 1NM9A 3GIQA 3H4XA 5I3IA 1MDLA 3GXNA 4OIFA 1PIGA 1TV3A 4X63A 1AZ1A 3WUFA 3LSBA 1YRRA 3S2JA 5BWFA 4EF9A 1UH2A 1W1YA 2R82A 5SWUA 2O92A 1IZCA 4L1WA 3MWAA 1W9VA 2FB3A 2H6RA 2CHOA 3U48A 4JTCA 1YE6A 2QUTA 4S3BA 4ZB0A 2CLFA 5C7HA 3RIKA 1IEQA 1FWFC 5E9XA 4M80A 3TIMA 5FJTA 3LTSA 4IFKA 3EB3A 5AC8A 3BMVA 3KOYA 1O1HA 5CZ0A 1ZS2A 1E5JA 1Y5XA 2MUCA 1WYIA 4HHPA 1QI0A 1ZP4A 2NT0A 2PDHA 2QVNA 1DBTA 1SJBA 2ICSA 3OVRA 3GM8A 5HWNA 3NEHA 1JYXA 4RJEA 1PZ3A 1E55A 1W9DM 3PBYA 1R3WA 3MHFA 2AGTA 4YYFA 3VMNA 4IGNA 4TUFA 4PH6A 2G0WA 3FAXA 3GVQA 4P7OA 2GLKA 5M5DA 2VEFA 3IJ9A 1QRQA 3LS9A 4DLMA 4UMCA 3A4WA 3OODA 4LV9A 3O06A 2RGLA 3PB2A 3BPWA 3KW3A 2WC4A 1N82A 4P8UA 4DJDA 2HRWA 3CUIA 4URIA 2D20A 3CMFA 2H8ZA 4GZEA 3EX6A 3GR8A 3S3GA 3ES7A 1TZ9A 4B92A 1DQXA 1B3YA 4AD0A 3QW3A 4O15A 4FLSA 1QUMA 3IAPA 2WZTA 1YBQA 4QLJA 3VDHA 3NDZA 2X2GA 4OV4A 1OFAA 2KX9A 3DKLA 2DQWA 3M1ZA 3UPMA 1KFEA 4Z1BA 1WE5A 5CC6A 3N2MA 4IHCA 2ONEA 3P0WA 3NJ3A 1FDZA 1FKWA 4KGJA 1TUFA 4EVZA 3MCNA 5A6MA 3LGDA 4W4QA 1RAKA 3UJFA 3W1MA 1J0KA 1PCKA 1VF8A 3OOQA 4GD0A 3TVAA 1W3IA 1B3ZA 2ZUUA 2ISVA 4ROPA 4NI3A 3I6RA 3PNUA 1MEWA 2PDNA 2Z1WA 4N42A 3RM8A 2YW4A 4RDVA 4ZSTA 3NQAA 1V6XA 4IG2A 5DT7A 3HTWA 4XZLX 2QAPA 3EOLA 1UR2A 1KLZA 2IKHA 4FB7A 5B7YA 3HIJA 3M64A 3TSMA 2GVGA 3MZ2A 2XVLA 2OEMA 3QZAA 4CKQA 4KIEA 2W5FA 4ATWA 5EKYA 1CCWB 3P0XA 5CLTA 4Q4MA 4B2DD 3T6CA 2ZX9A 3A4JA 2BOEX 2RKXA 5DN1A 3S5ZA 4N9DA 3IJDA 1XDJA 4NZJA 1UPMB 4Z2JA 4IX0A 3MYPA 1EJRC 2REQB 4BR1A 4I8YA 1BVZA 4C91A 2DT2A 3LMZA 2QDHA 2HS8A 3DXIA 4JIHA 3HG3A 2PP3A 2GJLA 3M0VA 2DZVA 2ZX5A 3H70A 3IAQA 3NXLA 3L0KA 3K13A 1E6PA 2G3NA 1E4MM 1NDYA 2B7PA 2JEPA 5M2FX 2UY5A 3GU1A 3W4RA 4CD5A 3H4WA 1QI5A 1TV7A 2OX1A 1BG4A 2E9LA 3BARA 3DHFA 1E9LA 3C6CA 3ARZA 1CNVA 1VEPA 4D6DA 4HYWA 4OFCA 1R6WA 2AL2A 5FL0A 3QMRA 2ZWZA 1TVLA 3ABOA 3SN4A 1HNYA 1IHIA 3UWYA 5EFFA 3CIVA 2CWNA 3S4TA 2GJXB 1LL7A 5C9UA 4XO6A 2J75A 2VM8A 2YSWA 3VDGA 4U33A 5BNKA 3SQMA 4CNUA 1E3ZA 4DEFA 3RX4A 4PCSA 4EPEC 3ONCA 1JULA 4ILSA 4OKDA 3ZJ6A 3KAOA 4MPKA 3PZNA 3AHTA 3HF3A 4XVDA 4WGXA 3CASA 3JW7A 3CYJA 5M17A 1BLIA 4LV4A 5KSWA 3BW4A 4YVPA 3I6EA 1YMYA 3V18A 3N2XA 1U1JA 4DO4A 1DJNA 2VEKA 4EF8A 4MWAE 2WBKA 4GQ0A 3OB8A 3BC9A 3UPWA 4E2OA 4E2BA 4TOQA 1SZFA 4G1NA 1JFHA 1UWQA 3EZ4A 2NWRA 2NZLA 2YJQA 9XIAA 4BK9A 1HJVA 1J93A 3LHVA 4LUIA 3SQLA 3A9IA 1GZJA 4MZYA 4IQJA 3WLPA 1GYMA 4IJBA 1K8YA 3T0CA 1A0CA 5BCAA 3UA3A 2CCRA 2QKFA 1G7VA 1CECA 4LVGA 2V81A 1SJDA 4HZ6A 1SMDA 1OIFA 2NLIA 1AVAA 3EXTA 1JGMA 3TMQA 3FHQA 5HMEA 4RE0A 3GIYA 6REQB 1ZBVA 4G8TA 4KFNA 1P0NA