2PZGA

Minimal human cftr first nucleotide binding domain as a monomer
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
225
structure length
223
Chain Sequence
TEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNPDFSSKLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 72
structure length 223
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzgA00
2VP6A 4YMWA 2XXAB 3O8CA 5DI3A 3FKSA 5E7MA 1X1SA 4GI7A 1YR7A 4PTLA 1S3GA 3QEJA 2A5GA 3EA5A 4DEYA 3BIFA 1OF1A 4N0DA 3WP0A 4F91B 4BLOA 2PJRA 4TT3D 5EZ6B 1HV8A 3FOZA 2QAGA 2O8BB 3BH6A 4B35A 1SXJB 1XXHA 1IOZA 1NL3A 1N3BA 2GVZC 2BBWA 4JBXA 2ECKA 2F43A 3MUFA 4TSFD 3CWZA 3VR5A 2O8EB 2FFAA 2CE2X 3PUZA 4I1VA 3R9XA 1NVVQ 3GFOA 4I99A 1S8FA 1YZGA 2W6JA 2WICA 2GZAA 4I81A 1R8SA 4M9QA 3KXKA 1Z0AA 2ZYVX 4LJ5A 4RFVA 2KBFA 2P5SA 2AWOA 1Z0KA 3QI2A 4HYYA 5EE0A 1I2DA 2FF7A 1G17A 1XEFA 3B82A 1E2IA 2H18A 2CJWA 4C0QC 2REBA 2RGAA 3CLVA 3GJ0A 3LBIA 1E2MA 4MYCA 821PA 1WXQA 4B47A 1E1RD 4M1WA 4A4DA 1E99A 4BEJA 2QROA 1I4DD 3C5CA 3K8YA 4P31A 3TGPA 1E9RA 5KSZA 2HUPA 2HXYA 1NSTA 1E98A 2L0XA 1GDDA 4LPKA 4DCNA 1AS0A 2NZJA 3GLIE 4JVLA 4D26A 1OIVA 3RS2A 2GCPA 4E07A 1YRAA 1T0HB 2XNDD 3T61A 1T9HA 2WOOA 4DSUA 3VKGA 2J7KA 4JLPA 4KAXA 4MH0R 1IXSB 2J3EA 2FJUA 2ZSBA 1GRRA 3GLFE 4TN1A 3AVXA 1RRFA 3DMNA 2P3SA 4OI0A 3QXSA 2ZU0C 2RGDA 4EIWA 5C4MA 3X1WA 4TMTA 4ASUD 4KHZA 3AVQA 2FZLA 3OAAD 1OYYA 2AWNA 2J0UB 3NXSA 4JJZA 1W4AA 4BZQA 2XZLA 1Y63A 3R7WB 2R9VA 3QXXA 4QNMA 1AKEA 3U3JA 1P7CA 4BQSA 1G9XA 3W3ZB 3GD7A 3IUYA 4LHXA 2R6AA 1QRAA 3PUWA 4Z1MA 3QEOA 2G6BA 2QM7A 4A0RA 1ZAKA 4PAOA 3EPHA 4QG7A 3I72A 4RCYA 2NO0A 4PR0A 3S1AA 4QFMA 1NLFA 2OXCA 4XVQA 3EPJA 1T91A 5HE8A 4PANA 3GEIA 1KJZA 1Q1EA 1QDEA 2REOA 1QVAA 4KFTA 3AGQA 4PPGA 1TTTA 3T15A 1KK2A 1DAMA 1OFTA 2P6NA 5DO9A 2CNWD 3AGPA 621PA 5HPYB 1U8YA 3CR8A 3DKPA 4HAWA 4EJSA 1Z0IA 1TUEA 2YOGA 4C0AC 1DTSA 1E1QA 2VA8A 2YHSA 3I73A 5SZHB 3AKEA 4MKGA 3TQCA 4Q02A 5CM9C 1D2MA 4CYMA 1E9FA 4P33A 3THYB 3M0EA 2BC9A 4EPVA 1YE8A 1AN0A 3U3OA 1NIJA 1Q21A 4MQBA 2GJKA 2V6JA 3EW9A 1CP2A 2IYUA 2JLRA 2PH1A 2HEIA 2CCKA 2CLCX 1HH4A 4EUNA 1E9SA 2OFXA 1AS3A 4FD2A 4TQAA 1M7HA 4XJXA 3L0PA 1KK1A 1FW6A 2FE4A 2JLWA 2IS1A 1X8KA 2DWOA 2IXFA 4QJ4A 5FI0B 3EZ7A 3CPHA 3QNUA 4TT3A 1RC8A 4HUTA 4HSEA 2C9YA 1F48A 5G3YA 4LGMA 2FFHA 2YOFA 2FZ4A 3NDBB 1VMAA 3Q5DA 1OXVA 4OL0A 4G5GA 2P65A 4RZ2A 1ZW6A 5EE9A 1GP2A 4P4SA 5SZIA 2GKSA 2F9MA 2QUZA 4TYPA 5CLLA 4C0BA 3K1JA 3AKDA 1OYWA 1II9A 3AB3A 4WOPA 1S4QA 2QAGB 5FH9A 1FL9A 5J4VA 4NYMQ 3BGWA 4RCZA 2P2LA 3FYHA 1HA3A 2NPIA 4M1KA 3EPKA 4M21A 1DEKA 2B8WA 3KFXA 1K8RA 2AN9A 2ZM5A 3C15C 3FPAA 5L3SA 1SZPA 3BRWD 4ZIRA 3SYNA 1CULC 1MO3A 2J7PA 3HU3A 4GRAA 4TTQA 5KDOA 2G9NA 4AYTA 2QTVB 5L3VA 3THWB 1EFRA 2VSFA 1P2TA 2VHJA 3OFND 4B3GA 1CS4C 4JLVA 1OKKA 4NONA 2F1RA 3SS8A 4DUGA 5EP4A 2J41A 1QHHB 2Q3MA 3C4JA 4MITA 1DAKA 4HB3A 2GJSA 2ZRMA 1AS2A 1FMJA 5FR1A 1FFHA 3WP1B 1JBKA 1P3JA 4XWKA 2V3CC 1CLUA 4GOJA 4PSVA 1TQDA 1TU4A 1P6XA 5DI9A 2PMKA 1G291 4KXFB 4P3YA 2OILA 4OQMA 4DUGD 1LV7A 2X1VA 4CZ2A 4YONB 3LA6A 2XTMA 1OH6A 2RMKA 1U99A 3TRFA 1F2UB 2YOHA 3CKLA 1Q12A 3KJGA 4DSTA 4LWZA 3NIBA 1ZRHA 3EXAA 5J40A 1E2EA 1T5IA 4ERNA 5B57C 3IIJA 121PA 3IPYA 5AWFC 3GLHB 3FWYA 2HXSA 4IFEA 3I61A 3NBXX 1WBDA 3UMSA 5F98A 3ADCA 2V1UA 4B48A 3QUSA 1GILA 2OV2A 3ZVLA 3V4FA 4EPXA 4UNQA 4YQFA 1J7KA 1XEXA 1H8HD 3A1SA 1TL7C 1CJMA 1P75A 1WRBA 4KO8A 2W00A 1G7TA 2ZANA 1XMJA 1U90A 2BCGY 2XNDA 3LWNA 4B76A 5AUPB 1NNEA 2IA5A 1UBGA 3CNNA 4L15A 2F55A 4ESVA 5LD2B 4AWXA 1VKJA 4Q48A 1KO1A 5E95A 2DB3A 2BV3A 4NP6A 1HT2E 4Q21A 2PT7A 1JXOA 1R5BA 1WDTA 2N1BA 2GTPA 2ODWA 4Q9HA 5E3HA 3LW8A 3TW4A 4NH0A 2W0MA 5JBQA 4BLRA 4EFLA 3NC0C 1SVLA 5TXGA 4OJQA 1IN8A 1N6PA 4V03A 1JPJA 2QMEA 4YLGA 3WYAA 1F2TA 1N6LA 3MCAA 2QE7D 4WXRA 2VL7A 1YRBA 1KOFA 1PLJA 1MRSA 1J70A 2GZHA 4M4SA 4U7DA 2BOVA 4EJSB 2WV9A 1NP6A 4PAMA 3TW8B 1EFUA 1RJ9A 3FFAA 3UANA 2IHYA 4G01B 2XTZA 4BLTA 5J4HA 2Z4SA 4R9UC 5KSOA 2KWIA 4DZZA 1H65A 2ZS9A 3THXA 2F1JA 2FFBA 5EE5B 1G64A 4LJ9A 5BW8A 4IOLA 1KDPA 4DDTA 3NHAA 3DOEA 3AF3A 4NKRA 2F9LA 1W4RA 1E2FA 4X8HA 1KZ7B 1CRQA 3KX2A 3Q3JB 5FI1B 1IY1A 4OI2A 5FL7A 1FMLA 5E7IA 4AKHA 2OSBA 2XEXA 1R0ZA 5B30A 1LW7A 2IYZA 4XIGS 1E32A 1G20E 1F5NA 1XZPA 3ZZUA 3WBKA 3U3KA 1U98A 3I32A 3NEYA 1ZUIA 1ELOA 1G8YA 3HR8A 4LRWA 2H57A 3RWMB 2MSEB 4ZDIA 2BBOA 3UG7A 1FTSA 3QIAA 3I3SR 2F1IA 3OHMA 4G0NA 2GILA 3L82B 3GFPA 2HYDA 3PG5A 3MLEA 3WBJA 3VAAA 4R98A 3AKYA 5CLQA 1HY3A 2VHTA 1II8A 3SNHA 4G3XA 3ZLJA 1YKSA 3GLGA 3K9GA 1R8QA 3HDTA 1JJ7A 1LF0A 1W0JA 5D3MA 4MYHA 2ZUBA 4JL8A 2BIFA 2YZ2A 3CH4B 1ZJ6A 2VYFA 4Q1CA 4BFUA 2I1QA 4ESHA 1KDRA 1VCMA 2GEUA 1XPRA 1MR3F 2WMOB 3CNLA 3ZIAA 4DT1A 5C1BA 1KAOA 4CEHA 1NI3A 2SHKA 4RVCA 1MOZA 5CYOA 1OLOA 2FU5C 1KDTA 2ZROA 4P0TA 5JJKA 4D4KA 2CL6X 3EWSA 3GFTA 5EE1A 5FTNA 5BN3A 1QBKC 5CB8A 5FBRB 3I5YA 3VKWA 2CVHA 4L9SA 2W0SA 5HKKA 4XH9B 2PJZA 3PQCA 2P0EA 2ZJ2A 3EZ9A 4OI1A 1DAEA 5BQ5A 1WMSA 5CB6A 4LYHA 4URZR 4CF7A 2Q0HA 4LHWA 4PC1A 5HKKD 2OZEA 5EXPA 5JECA 3O8DA 1S9DA 4YC7A 2IEZA 2QTFA 4QJ3A 1EGAA 2P6RA 1ZIOA 3P4XA 4RFSB 3C16C 4JT2A 1H8HA 2DWPA 3EPLA 3EASA 4TSFA 3NH9A 5TDHA 3IDQA 3PV0A 4DVGA 1OHHD 3AVUA 2V9PA 1VIAA 1DAIA 4U00A 1W36B 2GNOA 3KTAB 4NZYA 3EIEA 4TYYA 4A2QA 3FHTA 4LC1A 5FL3A 4JVNA 2GJAA 3QF7A 5HCNA 3TLXA 2WJGA 2CXXA 4HAUA 5IT5A 5IDVA 5KOYA 4KJZA 4DDWA 5TB5A 4CGZA 3QKSB 3WNBA 2IYWA 2QMUA 2XX3A 3K09A 1TPZA 1ZD8A 2ZU6A 4CEIA 3KKQA 2QU8A 1ZC4A 1F3OA 1ONBA 1E2JA 5GJCA 4MRVA 3WNDA 4NL4H 2B92A 4V0OA 5KPJA 2EYQA 2H17A 3IIKA 1E0AA 1Q44A 3ZD7A 3AVWA 2WWIA 1GUAA 3T34A 2V8OA 3PR1A 1E4YA 4RD4A 3REGA 2CLDX 3TR5A 2CEAA 3QVVA 4DLUA 2QY9A 2OAQ1 4BFXA 3CONA 3W5JA 1OKKD 4QNRA 1FNMA 1IXRC 4B2LA 5JSZA 1A82A 3RC3A 2FV8A 3PCRB 4DDUA 1ZIPA 2C9OA 3TJZA 4HAZA 3K53A 1X8JA 3ETLA 1GKIA 1JALA 2LKCA 4IOMA 2DY1A 5KNCA 3M6AA 4UXJA 2OCYC 4I1UA 3T35A 4WBSA 3GLGB 3OE7D 3A36A 2AD5A 2WJJA 2AHOA 4IEIA 1T3LA 1TAGA 2YWFA 1G41A 2I4IA 1N5JA 1E2GA 4ZI3A 2PLRA 3IPXA 3RC8A 3BS4A 4IOKA 3B60A 5KNBA 4BFYA 1KAGA 1JR3E 1X3SA 5GJVC 1DELA 1S1CA 4IEEA 5KYKA 4BASA 4Q4AA 4NPHA 4Q1EA 2YNMA 2FPLA 2Y8EA 2ZEJA 1YZKA 3AEZA 1KI8A 4XVUA 4C7OB 2GJ9A 3GLHE 3GLIA 2IF0A 3FE2A 3OIUA 4DLRA 1G1MA 1KK0A 2GK7A 2EFCB 3BJIC 2ZRCA 4F4JA 5JI2E 2JASA 1J8MF 3RABA 3NWJA 3UWKA 1LNZA 4LJ4A 2QRNA 2ZPTX 2JIZA 1E9BA 2OESA 1KI1A 3D6TB 4JKYA 2FSFA 3KKOA 2YINC 1IJEA 3FKSD 3H0KA 5CK5A 1M34E 2VIIA 1ZNWA 3E70C 2WBLC 4QBHA 3H1TA 4OQXA 4TMXA 4DDVA 1RVDA 1VG8A 2ZR9A 1SKYB 1KI6B 1Q20A 3CB4A 2R44A 3KJIA 4A0HA 1BMFA 3THOA 4B73A 4B71A 1XTIA 3KXIA 2AXNA 3UATA 1LF5A 3IKJA 3PXGA 1OIXA 4TLCA 3ZQJA 4DB4A 2QQ0A 2IWRA 3B1VA 1UKEA 1E0KA 5LPNA 2ONJA 5IRCD 2IK8A 4BE7B 1DVRA 1OFUX 2J0UA 1P60A 2WWWA 1UBCA 4EFNA 2QPTA 5EXSA 3FHCB 4MKFA 2AL7A 2QAJA 3LDAA 3CM0A 3K0SA 1G6HA 1NJGA 3OEHD 3EZ6A 5F9HA 1L8QA 3KJEA 3VX4A 3CW2A 521PA 3RSLA 4NCIA 2HV8A 1HEIA 1CRPA 1VIYA 1ZP6A 2IC5A 5FOTA 1OHHA 2IYYA 1GSIA 4ILEA 1C4OA 4EPRA 4FINA 4MGKR 4BFVA 2WSMA 3D8BA 4JVMA 4MKIA 1CJVC 2ZAMA 1D8TA 1P4SA 5FUVA 1ZUHA 4W5JA 3TVTA 1ZU4A 4D81A 5AUNB 1WA5A 1Z63A 4FIDA 1YZUA 5J5CA 3EZ2A 3W6PA 6Q21A 1GTVA 1BH2A 3L8ZA 1P2VA 4TQ9A 5B58C 1GWNA 1SULA 3HPRA 3K09C 4LJYA 3IEUA 5TY0A 3IGFA 1XEWX 4F7WA 5DISB 3G5UA 5K8LA 3KKMA 5LDDC 2VLIA 3FKQA 3QY0A 1N0VC 3MWYW 4PO9A 3EIHA 3QG1A 2GA8A 5AJXA 1W36C 1G8PA 2A9KA 2ZRDA 4IOJA 1WBBA 5JEEA 3TQFA 1T3SA 3ICEA 2B8TA 3C8UA 1IBRA 2CHGA 3G0HA 4B6EA 4TYWA 1ZYUA 4NYJR 2BEJA 3R9WA 3DZDA 3GLFA 1P61B 4KLNA 2FG5A 2Z5FA 2O52A 1IN6A 2DCUA 1PJRA 4MUBA 1RKBA 2VF8A 4ZCMA 5KDDA 2FEMA 4FMBB 3HPQA 2ZRGA 3ND8A 3T5DA 4GT1A 2QZ4A 2A5DA 1RZ3A 2IW3A 2O8DA 3VU9B 1Z47A 2PEYA 2XXAA 2FSIA 3K0AA 4IVQA 2NO7A 5DI3B 4TLDA 2QMOA 1OPXA 3ASYA 1EFCA 3FDIA 3SC3A 2B7CA 1ZINA 4C2UA 5G3ZA 1JAIA 5JWHA 2WPDD 1YZTA 3TSWA 3A58B 3U7EB 3EIQA 1UF9A 4B44A 3TNFA 1AQUA 1U9IA 2UZ3A 4AYWA 2QT1A 3BC1A 1NIPA 1NN1A 3DL0A 2QE7A 3X1XA 2O8EA 3A6PC 4NYIQ 1R0XA 3T1QA 2BWJA 3D31A 1FX0A 2HT6A 4ZKEA 1D2NA 1NG9A 1XD8A 2DFTA 3IBGA 4BZXA 2Q21A 1BYUA 1N6RA 4JZKA 1M7GA 3CIOA 4Q4JA 3D7MA 5TARA 3ZS8A 1MABA 1U8ZA 4AKGA 1YZNA 4OK5A 1KZGB 1E2KA 4JLKA 2ZJ5A 4HZUA 2QSYA 3TAUA 2NIPA 4IFBA 4UNSA 5JWOA 2C99A 4RZ3A 5A0FA 1SKQA 2QGZA 2BEKA 4G5QA 2K5UA 3JZAA 4JS0A 1OXXK 3MGCA 4LUCA 1BMFD 4P4TA 1VTKA 2ZQ5A 3ASZA 1AM4D 721PA 1DO0A 1I4TD 5J4LA 4QM7A 4Q9KA 1OB5A 3I62A 1XCMA 3NVAA 2PZFA 2WWYA 4DLVA 4Q1DA 5BN5A 2W2XA 2PLFA 3C5HA 5JJIA 4Q19A 4Q7MB 2P67A 1E2PA 3AVYA 4H1UA 1DADA 1NBMD 3OE7A 2YVUA 1UFQA 2WJYA 3LVRE 2FSGA 4ZPXA 1UEJA 4HAXA 2NMVA 2FX3A 5FTJA 1ZMXA 3U60B 3BBPA 1U81A 4C0SA 2NO1A 3ZJYA 4TMZA 5KDLA 3WMEA 5JZVA 4DLSA 2ZAOA 4I4LA 4US1R 1KI9A 1F2TB 2N46A 3F8TA 3OZXA 4KBFA 3J81k 3JZMA 3LX5A 3UKDA 3K0CC 3GQBA 3K9HA 1JR6A 3FFBA 2RHMA 1R5OA 5F2EA 3UMRA 3KUDA 1P2SA 4MDEA 3FMFA 2G83A 2WPDA 3P26A 4GOKA 4CRWB 1P9WA 2OBNA 1N5KA 4US2R 2XJ9A 1EFRD 5C4GB 4A82A 2J87A 3E1SA 1XBTA 4GSYA 2AK2A 2E87A 1KI4A 2BDTA 1AKYA 4LY6A 1OE0A 3B8HA 2VO1A 1VG9B 5HTKA 4IXNA 4KITB 1ESNA 5A4JA 2EWWA 4DLTA 4ACAA 3VHXA 4A0FA 3A1VA 4OHVA 3KFVA 4XTRA 5IHPA 4O3MA 4LBYA 4A9AA 1E4VA 2ZJOA 1VYUA 4L16A 4PZYA 5DLQC 2G0NA 3MRSA 2OCAA 4F4CA 1BIFA 3BD9A 3AF1A 4N3NA 1UBFA 1Z6TA 3CWQA 5IF9A 5FBVB 1Z29A 1G5PA 3LRPA 2GEVA 2KSQA 1AZSC 1W4CA 3QPWA 4JSYA 1RFLA 1ZBDA 4BFWA 2JLXA 2XSZA 2BMEA 5TVKA 2C03A 3GJ6A 5CDFA 3UWOA 1TEXA 3U4QA 2G0TA 1TADA 3L0IB 2IYQA 4HLQB 1CJUC 2WM9B 3SQXA 4OHYA 4URWR 1YZLA 2OE2A 4A2WA 4R71A 1GKYA 2XITA 4TLAA 4IVRA 4N0EA 2BHRA 2V55B 1C1YA 2IX3A 5F3WB 5G53C 1Q1ZA 4E22A 2ZRIA 1RJ9B 1QHNA 4UNPA 4PAQA 4OKSA 4DCUA 4EDHA 3DMDA 2IUTA 3V4RA 3NEJA 2ERXA 4TL9A 5FOVA 3B2EA 4IDOA 3SI7A 4QXAA 2OHFA 2HYIC 2WJIA 2ATVA 4KYUA 1D6JA 4LOAA 3K0AB 1II0A 4LBVA 4HI0E 2C77A 4I1SA 1J8YF 1ZU5A 1LB1B 4QBGB 4EPTA 1GRQA 1DPFA 4POAA 4Z54A 3T1TA 3ICQB 2VTKA 4Q03A 2C96A 1OH5A 3VR6A 3LBNA 1P72A 4V0NA 3IIMA 1NY6A 1KIMA 1E0SA 2BM1A 2VSXA 4NU0A 1UPTA 2ODBA 3VR1A 4PHHA 3SOPA 3IILA 4F38A 4C2TA 4D80A 1HTWA 5HZKA 1UKZA 3AF0A 1GG2A 1N6HA 1OT3A 3O8BA 4NMMA 4MUAA 4LZZA 2HCJB 3KXLA 2KB0A 2F1HA 3SN6A 2OM2A 3LY5A 2FPMA 3VFDA 5CJ2A 4MRSA 4Q01A 1S0UA 1L4UA 2JAQA 1SVSA 1US8A 2W6ID 3DHWC 3ZS9A 2OO7A 1OFHA 3RDPA 1G8GA 4UXHA 3HWSA 1KGDA 5KUTA 2JGNA 1NLYA 4A0GA 2BMDA 3C7KA 1M74A 5JMTA 5TV2A 3SEAA 1COWA 4V0KA 1DE0A 3SZRA 4LV6A 2A5YB 4KODA 3GJ4A 4AKEA 4GL2A 1E69A 4DIDA 1S2MA 4RZXA 2ZJAA 1CKEA 5FTLA 3EAQA 1L4YA 3TVDA 1Z83A 2ODNA 4H9GA 2OBMA 3F3YA 1HT1E 3TH5A 5AJWA 1G21E 4B32A 2WVJA 4WZ6A 1ZD1A 2DHRA 1DARA 1DG1G 4P4UA 3LFUA 1VHTA 2AKAB 2JLQA 4JMPA 1B23P 4JYCA 2YWHA 1ZNZA 3FB4A 1R10A 1WCV1 3B7GA 4HAYA 4PHFA 3WMGA 1FNNA 3VNUA 3ECCA 1KKLA 2FNAA 2WWFA 1E1QD 3B6EA 1FP7A 2C04A 2ZI4A 4RZUA 4B3DA 2ZYWX 1Z06A 4JLJA 1SXJD 3QPVA 3T1OA 3VR3A 4D4JA 5C18A 2OLJA 4UJ3A 5AR1A 3BERA 2ZI3A 4LHYA 3WMFA 2IBMA 4S2EA 4E09A 5KSYA 1Z22A 2ZETA 3NHBA 3U3RA 4MKHA 2FEOA 2A2ZA 3N2IA 1VCIA 4C0LA 1ZM9A 2EVWX 2IS6A 3QENA 5DHAA 3IQXA 4KYIB 4M9ZA 3KUCA 1JB1A 4FMCB 4M0LA 3DZ8A 4LHZA 2F3RA 3EX7C 1W47A 3FVQA 4RD2A 4Q4LA 3H4MA 1XD2A 1ZNXA 4QBIA 2ZRNA 1Z3IX 1X6VA 3RSOA 2C98A 4EFMA 2ORWA 1GOTA 2GF9A 2Z43A 2DWQA 4QGAA 1CJTC 5ELXA 2MMCA 4U5XA 1FX0B 1JECA 4XWOA 1E0JA 2O8CB 3RHFA 1D9XA 4LJ6A 3LXXA 2XOKA 1NN3A 1WQ1R 4K8OA 3UPUA 1PLKA 1G19A 2VBCA 5DYIA 1FOEB 4ZCIA 1Y3AA 1R0YA 3KQUA 1MKYA 2BMJA 3CRW1 4P4SB 5DIFA 4LYAA 1NKTA 1COWD 4AG5A 2NOAA 2VPPA 2QRZA 3RANA 4B3XA 3AF2A 2X77A 2ZRLA 1KI7A 2GXQA 4PXAA 5GVRA 1G3UA 2WMNB 2WKQA 3X1YA 3BFVA 3HJNA 4NCKA 1W5TA 4BFTA 1LS1A 1Z5ZA 4RD6A 3THWA 2QP4A 1ANKA 4WW0A 1QHYA 1XCPA 1US8B 2RAPA 3DDCA 3SJCA 3QG5A 2O8BA 2QQEA 2YWEA 1U0HC 2JATA 3DEFA 1XB2A 4HDCA 5LD2C 2FA9A 1XU4A 4WZAE 3MSXA 4DSNA 1XEXB 1IAQA 1KJWA 2RGCA 4M1YA 4V02A 2ZUDA 1YQTA 2ZYTX 4PO1A 4K81B 4Q9JA 3X1ZA 3BOSA 4DCTA 2XZOA 1J90A 1EWRA 4KU4A 1E2DA 1QHSA 4MDFA 2ERYA 1SXJC 1K5DA 2JLUA 1XCGB 5AJYA 2REXB 2VQSA 1SXJE 4PQYA 3WYGA 1CR2A 5CITA 2JLYA 1F60A 2NGRA 2ZRHA 3GLHA 1Z8FA 2ZRBA 1XTRA 3L0SA 2GCOB 5FUWA 2GJ8A 4LBZA 2VH5R 2A78A 2J5XA 4TYQA 1XMVA 2IYXA 2JEOA 3BB3A 2ANCA 1NKSA 3LXRA 2Q3HA 1UDXA 2FGJA 1SVMA 4EPWA 5FOXA 3ZYCA 1PLLA 4RFSA 1JR3A 2H5EA 4FI3C 2ZR7A 3CPEA 4LSGA 2GESA 1Z0DA 3DM5A 1XF9A 2F7SA 3MJHA 4PPFA 2VF7A 5KO2A 2H92A 2VP9A 4BRWA 4OI4A 3R9IA 1N5IA 2AFHE 4JYBA 4AD8A 4YXWD 2F6RA 3K70B 4NBSA 3B9PA 4ZCLA 2FMXA 2QM8A 1V43A 5DN6D 4D0LB 1BKDR 2HLDD 1GL6A 2NZ8A 2MMGA 3B13B 3B1XA 1MO4A 3DM9B 3BWDD 4HEJA 3SJAA 3CRQA 3AV0B 1RRPA 2IYVA 3SBEA 3KQHA 5HZHA 1Q3TA 2JCSA 1XWIA 2G1JA 4LK2A 2JDID 1K5GA 1NN5A 4DLWA 1UEIA 2MSDB 2ZE8A 3H86A 4JLMA 1E2NA 1EK0A 1XTSA 4PHTA 4KFUA 1CTQA 2OFWA 4AK9A 4LV5B 5LB4A 4PQRA 4BFZA 1O87A 2C78A 4DHEA 2Z6VA 2VP0A 4P32A 3L8YA 2DFLA 2R6GA 4RKEA 5CK4A 4TYNA 3CNOA 3SBDA 3P32A 1HURA 2JJ2A 3OEHA 3PEUA 4GMDA 3I5XA 2BBSA 1VCOA 1VPLA 1EX7A 3QSYA 2WSSA 2ZUCA 4Q1FA 3RWOA 1U0JA 1KSJA 2OFOA 4N1AA 1KSHA 4IVPA 1EXMA 4TQUS 1FUUA 2KI5A 3F0TA 3PUYA 1YHNA 5L3QA 1IONA 4HZUB 4AKIA 1Z28A 5FBQB 4UJ5A 5JSZB 1G3RA 4JJKA 5IK2A 1VDZA 1VYVA 3A1TA 3THXB 3RLFA 5E4FA 2ZRPA 4JLDA 3LNCA 2CL7X 1E94E 1XD2B 4CEJB 2JLZA 1E9EA 1S1MA 2FFQA 1EFHA 1XMSA 3ZZTA 1OJLA 2ZI6A 4HLCA 2AK3A 2OAP1 1O3YA 3IO5A 1GAJA 1DOAA 1NVWQ 3ZIAD 2ZR0A 4C0JA 2C5LA 2XB2A 3NBYC 2ZYUX 4M22A 5ANRB 1W46A 3Q9LA 4Q4JB 5FOUA 5FPYA 1F6BA 5EE3A 4HLUC 1IHUA 4DLYA 2ODEA 2GXUA 3KDSE 1X86B 5JLJA 3TUJC 4C7OA 1SQ5A 2WAYA 1E6CA 5JS7A 5DN6A 1A2BA 2KBEA 2FOLA 3GLIB 5CIQA 1JEDA 4V0ME 3JVVA 1PZNA 4QGGA 4Q1BA 2WWXA 1DO2A 3QKRB 1QZXA 4HUQB 3TKLA 4PFSA 3X1DA 3KB2A 4KBGA 2QSZA 3A1WA 1T0JB 4MRNA 2O5VA 2HT1A 2RGEA 4GNKA 5GJBA 4KSCA 4ZDJA 2QORA 1YZQA 4C4PA 3FTQA 5FBWB 1T3HA 4X8MA 4CT4B 4LBWA 3GPLA 4LYFA 1TF2A 1CXZA 4XSGA 1EESA 1UM8A 2PZGA 3B1YA 1CU1A 3SE0A 4AY2A 1YU9A 1HQCA 3WXMA 4LJAA 1CR0A 1GNRA 4ZV4A 1M1YE 3SHWA 1ZC3A 3VQTA 1TF5A 2HLDA 2ZS7A 3A4LA 1RRCA 2PEZA 1RYHA 2UVQA 2GBLA 3CH5A 4G5RA 4CT5A 4PZLA 2QI9C 2W6IA 5F9FA 4A92A 2VSOA 3EZFA 3NG1A 1PVOA 1A4RA 3DVLA 1R6BX 2D06A 2Z4RA 3AQ4A 4XD7A 4ABYA 1ZNYA 1SGWA 2QL6A 2WWGA 5BWMA 4A6PA 3RVBA 2B6HA 2ZE6A 3E5HA 4D4LA 3IEVA 2FDCA 2FWRA 2HDNB 4IRUB 3MWLA 4B2PA 2XOKD 2ZE7A 2BCJQ 1SVKA 3TBKA 3NBFA 4URXR 2GAAA 2NO6A 1KJYA 2B21A 3SJZA 4Q47A 2YC4C 3TK1A 1QVRA 2YYZA 4BECA 2RHDA 1RYFA 5KHOC 1XPOA 5G40A 3KTAA 1NBME 1TEVA 1NJFA 1WF3A 2YWGA 1GNPA 1GZSA 3UIEA 4AC9A 3NDPA 1W4BA 2PL3A 2CK3A 2P6UA 4US0R 3CX7A 3EG5A 1KHTA 1NVUQ 1XEWY 1KI3A 4DCVA 1OSNA 4PPNA 2RB4A 1AIPA 4BPBA 1M6NA 3ADDA 2PT5A 3CRMA 1N6IA 4A15A 4D25A 1E2QA 3RAPR 1XFAA 3VR2A 3SDZA 5KPDA 1DAFA 4RJLA 1SXJA 1XXHB 1QF9A 4R2IA 4OJKA 4WVFA 3RS5A 5CIWA 2VRWA 3GEHA 4FCWA 3P4YA 4NDZA 5FTKA 1H8ED 3WNCA 4JLNA 1VHLA 2CE7A 1IM2A 2ZS8A 1XJ0A 2IYSA 1DAHA 2D7CA 2GEDA 3IQWA 3E2IA 2QAGC 3FHOA 2CLSA 3GP8A 1JQJC 2XSZD 3LQRA 3PEYA 4Q5IA 3U4QB 2CK3D 2EWVA 2XAUA 1MH1A 2QPAA 4F92B 3W6NA 3CRRA 4I1OA 2D62A 4NYJQ 3OFNA 3BB1A 4OYHA 3HP1A 2ZE5A 2RGBA 3TUZC 2CBZA 3L0OA 3QKRA 1E9CA 5L8VA 4TMKA 5EXXA 4U02A 5CYPA 5GVSA 5L3SB 1NSFA 2VP4A 1KI2A 2CMKA 3UK6A 1CF4A 4DCSA 2IEYA 4AURA 2QPOA 1ZD9A 3RS0A 2V54A 3W5IA 4Q66C 1W48A 2QA5A 4KLZA 4A36A 4MRRA 3QE0A 1IN5A 4AG6A 1Q3HA 2FGKA 4Q4HA 2XB4A 3B1ZA 4Q7KA 1Q1BA 1ZM2A 1NMXA 3A4MA 2LWIA 1MRNA 3LO5A 4JLBA 4M9SA 4J0QA 2PX3A 2WJHA 1XX6A 1Z6XA 4KVGA 1P2UA 2X19A 1GIAA 3CZPA 4FCVA 3CF6R 3DPUA 1E9DA 2HJVA 3VR4A 1P9RA 4GBMA 3HU1A 3PUXA 4M9XA 3WHLA 2CJWB 3RRNA 2GXAA 3ADBA 3W34A 3KQNA 4YMVA 4ARZA 3O8RA 2BJWA 4QRHA 5DHFA 3OESA 2J1LA 4TMWA 3GJ8A 2C2HA 5FTMA 2ZI7A 4DSOA 4IDQA 1JAHA 3LAWA 3Q7QA 1CIPA 2GBLC 4GZMA 4JL6A 3TSOA 4DEXA 4S35A 5DSZA 3U61B 1ETUA 2GXSA 4K46A 1VECA 1W2HA 4NYIR 3TSZA 4BWYA 2CL0X 1G18A 2QEQA 1LY1A 3KB1A 3Q7PA 2ZSDA 4BUJA 3EWAA 1CR4A 4GZLA 4URVR 4R7ZA 3RNLA 1K6MA 4TZ6A 4E5UA 5AUQA 2GRJA 4KFSA 3T06B 3D3QA 5JI3E 1FQJA 5B64A 4TMVA 3OEEA 4AI6A 1Q0UA 2ZJ8A 2OEPA 1CBUA 1RRGA 2I1VB 2GVDC 4OHWA 4Z8YA 5JWRA 1OXSC 1Z08A 3QKSA 3N2EA 3TAHA 5HCIA 1BO6A 5H70A 3NC1C 1U8AA 4FWIB 1JI0A 4D0NA 4HAVA 2AKYA 2AXPA 3AUYA 4HB2A 1UKYA 3U5ZB 1J99A 3IO3A 2H8KA 2QT0A 2IL1A 2BMFA 2QBYA 1XTJA 1XTQA 1XRJA 3PIRA 3ONWA 1GNQA 2BJVA 2IHBA 4XSHA 1G3QA 2QG6A 221PA 1TNDA 3CF2A 3GLFB 5IK2D 5J4YA 1GKUB 3Q72A 1ZM4A 4RKFA 3RS3A 4CW7A 2ZRKA 3VNVA 3QKTA 1KO4A 4NYMR 1L2TA 1N6KA 2RH5A 4LV8B 1H8EA 1RPZA 2FN4A 2UKDA 4YMSA 1UBEA 1KNQA 5GJWC 3VX3A 3P1JA 3REFA 4ITRC 2G88A 4Q7JB 1T8TA 1LFDB 5FFMA 3PEVA 5JHHB 2QENA 2CHVA 2GCNA 1G7CA 1TF7A 4ASUA 4DRZA 2QP3A 3RS4A 2RGXA 4JIMA 2LKDA 2OUKA 1KMQA 2F43B 2JJ8A 3QBVA 2WOJA 3B1WA 4FN5A 1TX4B 3LBHA 5EJEA 3U44A 3WRYC 4FMDF 3MD0A 1TU3A 2A30A 4QOSA 3BFXA 1Z07A 3VTKA 1HE8B 3C41J 2GWHA 1SKYE 1IQPA 3L2OB 4Q00A 1RIFA 1AGRA 4D82A 5FPSA 2OG2A 5EP1A 2JJ1A 5AUOB 1G5RA 3DKVA 3ZVNA 4X8OA 1QHHA 4EKDA 1E1RA 1XXHE 2ZREA 3MAAC 2D4HA 3CRVA 2E1RA 2RKOA 4QM6A 2IXEA 4PSAA 8OHMA 4PC2A 1SVWA 5EP3A 3W9YA 2ZSAA 2XTNA 1T6NA 3WHKA 1SVOA 1A2KC 5EP2A 3KZ1E 3EC1A 4O2LA 3AM1A 2ZRJA 4A8JC 1F2UA 2DPXA 2JJ2D 5C46F 1ZM3A 3RYTC 3RRMA 1I4LD 3K9LA 1IXZA 2CDNA 3GJ7A 4DT1B 5JJLA 4IKEA 2H1LA 4C0KA 1GVNB 4YMUA 1CR1A 3VHLB 3H84A 3M4YA 1D2EA 2ASEA 3OF5A 2FPKA 1NN0A 3B85A 1FPMA 2CCGA 3GMTA 3U2QA 1IY2A 2VP2A 3P27A 3CR7A 3CX8A 3B5JA 5FPHA 1OIWA 2JLVA 4GMXA 3CUEF 1XD9A 1P9NA 2ONKA 3DO6A 1G5TA 1WB9A 4IDHA 4G1UC 4C30A 1MV5A 3I8SA 3S1AB 2R65A 3EA0A 3CO5A 4FW9A 2R8RA 1GFIA 2ZJZA 3QF4A 5DE3A 2ZJBA 1C9KA 1FP6A 2PX0A 3U6KA 4RD3A 4C9BA 1D5CA 2Q9CA 2E9SA 1G7SA 2VHUA 2WZQA 1OB2A 1U9IC 1W49A 2QNRA 2Z0MA 2NO9A 3IHLA 2X2FA 2EW1A 5UKDA 2WKPA 2EYUA 1QG4A 4QHYA 3OIVA 5HE9A 1W0KA 1YR6A 4H1VA 1NVVR 1Q22A 4O2RA 3T5GA 1TUIA 3U3MA 4GFDA 3ND9A 4PX9A 2W2VA 1QHXA 3AH8A 1CJKC 4PQFA 5FBLB 3SYLA 2ZVQX 3V00A 2WTUA 1YJ5A 2ZI9A 2VHCA 4TLBA 3THYA 2EFEB 2GAOA 2XZPA 4Y0VA 1EX6A 1XJCA 4B2IA 3F5FA 3PITA 4LPSA 4B3FX 2JIZD 1XTKA 4IXMA 4WA7A 2A5FA 3U7HB 3NH6A 5LB2A 5L3QB 4L9WA 3ZVRA 4LX0A 1W2GA 4CVNA 1PUJA 1G8HA 2GZDA 4XTCS 1Z6GA 3QXHA 4XVRA 1DG3A 1Q1QA 2BM0A 2WKRA 1QG2A 1UADA 2WIBA 2XJ4A 3AVPA 1NY5A 2R2AA 4HB0A 3HU2A 4DJTA 1TQ4A 1I2MA 3KQLA 1LTQA 4LJ7A 4MYUA 4L8GA 2D2EA 2R6CA 3GCGA 4B74A 2IUSA 4XD7D 2DYKA 4RD1A 1W7AA 2V4ZA 3A37A 5EUQB 3ZD6A 1AZTA 1E2HA 4LYJA 4F93B 3NKVA 2BBTA 2EU8A 2MSCB 1HYQA 2ZIAA 2HF8A 4BEBA 4OHXA 5L3RA 2ORVA 4Q1AA 3BXZA 1PV4A 3WY9A 5K8IA 2OT3B 1Z0FA 2F3TA 3B78A 3KQKA 3BK7A 5DNYB 4A6XA 2CNWA 4M2LA 3QJYA 1Z2AA 4PZZA 5FPTA 2CHQA 3LLMA 5HR5A 5CJPA 3BH7A 1FQKA 2OBLA 4ZKDA 1N0WA 3K0CA 2HF9A 4Q18A 2G1KA 4YDSA 5BXQC 5AJZA 4G5OA 3BB4A 3PEWA 2VP5A 5DYGA 1FZQA 4Z51A 4MYTA 4LJ8A 4QGFA 4A8JB 1N6OA 2ZITA 4ZDWA 2W58A 2OXRA 4IJMA 1N0UA 4PC3A 1BS1A 1XMIA 4ZIRB 1IN4A 3R8FA 2R6DA 1AQYA 3U44B 3KL4A 4JL5A 5KNDA 3VU9A 2RCNA 5EZ5A 2W83A 2YC2C 3MMPA 2J46A 1SHZA 2BVNA 3QXJA 2GHIA 1DAGA 1GL7A 4A8JA 3W6OA 2VEDA 5KU1A 4TTPA 2PCJA 4AIIA 1T4GA 4KI0A 2PZEA 2BKEA 4QL3A 3OIYA 1G3MA 3QF4B 2Q6TA 3SQWA 1YVDA 5K8UA 4HB4A 4ON9A 5JS8A 4CEHB 3GJ5A 3U7GA 4O0MA 5K8TA 1X8LA 2C95A 3Q85A 2R6FA 2ZSFA 3H2YA 4M8NE 1KYIA 2D7DA 4DWJA 5JCZA 4OQFA 1NMZA 3K0FB 4M1TA 4HLDA 1OV4A 4W7SA 4HUQA 2JDIA 3TR0A 1JQLB 4JSTA 4B43A 3ZVMA 4TL8A 3GJ3A 3W3AA 5D3QA 4UXIA 2PMDA 3AVTA 5DGXA 4JBWA 3W8RA 1LVGA 4FCTA 4FMDB 4RSGA 2FH5B 5EQTA 1UKVY 3Q5EA 1SVIA 4BLQA 1KO5A 4DIEA 2I3BA 3A8TA 3FMOB 1IY0A 1LS6A 1HQYE 2WWHA 1GM5A 4TL6A 2GCOA 2KE5A 5CDFE 3QQ5A 4HZIA 3BFKA 1JR3D 5EUMA 1U94A 4QKQA 3EARA 1FTNA 5J47A 1UJ2A 4C3ZA 3IBYA 1KK3A 1ZVQA 1TMKA 1W1WA 4BRUA 2QBYB 2IYTA 5J4KA 3R20A 3MWJA 4AYXA 1MO5A 2O8DB 4UKDA 3KKPA 3BORA 2IYRA 2J9RA 2KJQA 2V7QA 4PPQA 1TQ2A 1KTVA 3A4NA 3O47A 3A1UA 3AP3A 1KO7A 3VMFA 4QBFA 5JRZA 1E79A 1X1RA 2RGNC 5FPKA 2O0JA 1T8UA 1KSGA 2EFHB 2H16A 3RS7A 3AVOA 4Z8XA 3UXMA 4URUR 2IT1A 5JCPA 5KTYA 4ACBA 4D0GA 3V9PA 4FWTA 1N2CE 3QBTA 3UMFA 1KKMA 1OH7A 1VYTA 3LVQE 5SZKB 3G82C 3KKNA 1NF3A 2J0VA 1KMHA 3CX6A 3HR7A 3M1IA 4B33A 3U6BA 4DBLC 3QPUA 5FOWA 4PHGA 4D6PA 2X2EA 1JJVA 4QGHA 5JFGA 1D9ZA 5FUXA 2C8VA 2TMKA 2ATXA 4DXAA 3MFYA 1M2OB 2NPFA 3OAAA 3DOFA 5FL7D 3KJHA 3CZQA 2P5TB 3I4LA 4ZO4A 3MG9A 3SU8A 1KNXA 2JJ1D 5SZJA 3VKHA 4MRPA 3HYTA 2A5JA 2H7VA 4O25A 3SFVA 1R2QA 1A1VA 1ESMA 4CEJA 4Q4AB 1J2JA 4B3CA 1XJQA 4OQNA 1P5ZB 1T5LA 3U7FB 3LX8A 2OCPA 3K0EA 3GLGE 1CEEA 4C0HA 1G3IA 3GEEA 4W9MC 1BOFA 4V0MA 4YDHB 4CDGA 1MABB 1P73A 2GDJA 2ZVPX 4ARZB 3EC2A 4NCJA 1AGPA 1NLZA 1UAAA 1R5NA 3FMPB 2IS2A 5H1YA 2ZI5A 1XNJA 2ANBA 4UNRA 3K0FA 4D4MA 4HDOB 5C2JB 4PO8A 3K70C 5BYJA 2G3YA 1DS6A 1HUQA 3SR0A 1NMYA 2WJVA 2IS4A 1N6NA 2B7BA 1E3MA 1XP8A 1NG1A 3I1FA 3WRXC 1E96A 4QC2A 2YV5A 2JA1A 4NCNA 421PA 3QXCA 4BGDA 2PBRA 2ZSEA 1WE2A 1RE0A 1PUIA 4KVAA 3R7WA 5BN4A 2UZIR 3SJBA 3RRZA 2NTYC 4XWAA 3QOFA 1R0WA 3WYFA 4DB2A 1E9AA 3TUIC 1M8PA 4PC7A 4LC0A 1JEEA 4B3BA 1S96A 3I92A 1G7RA 4JBYA 4NCHA 4ZDKA 4XOIA 1P62B 3BAFA 3PVSA 4TLEA 1GITA 1SHKA 1YR9A 1BYIA 1V5WA 2DFKB 4A1FA 4MGIR 5CM8B 5EXTA 4JT4A 1N25A 1VCNA 4JLAA 4OHZA 5TMPA 3SFZA 3W90A 3AP1A 4FXPA 1OXUA 1W36D 1E79D 4CEIB 3LD9A 2PCLA 2A3RA 4IDPA 1VG0B 2ZTSA 1OFIA 4GPTA 4BZPA 4EQ6A 4F4IA 1AJEA 4HDQB 1AA9A 2IWHA 1KDOA 2BKUA 4MGYR 1N5LA 1OH8A 1W44A 4IW3B 2V7QD 1KY3A 3ZH9B 1L7VC 3PFIA 2J7PD 4GDFA 1XPUA 4LI0A 4OBEA 1W5SA 4EAQA 4Y0AA 4BLPA 2DFNA 3X2SA 2GF0A 4WIAA 1GRNA 4LDJA 1ZUNB 3HYRA 4IDNA 4WAUA 2EQBA 2OLKA 3UG6A 4NHOA 5JEDA 1ZCBA 2YJTD 4HATA 4L5BA 2R62A 2AD1A 3ADKA 2CCJA 1JXMA 1VG1A 2ZRFA 2V6IA 3N70A 5LBIA 1G4UR 4EPYA 4MGZR 2W2TA 2QN6A 2C9CA 4UNNA 1IN7A 3NBZC 4FMCF 1AK2A 4NTZA 4ZI2A 5B2ZA 5FR2A 3K70D 2V1XA 1XDBA 5FOSA 3W8NA 4G5SA 4TTRA 4E03A 5AK0A 3N5CA 4KV9A 4B75A 2GK6A 4NE2A 2IUUA 4DC9A 4KCGA 1XZQA 2D74A 1JNYA 1S3SA 4V0LA 4A2PA 2J0QA 1QHIA 1Z2CA 3T1VA 4DKXA 4CIDA 1MO6A 3ZGXA 5FUYA 3P20A 4B34A 3ZZ0A 2DR3A 4OK3A 2O8FB 2J0SA 1U2RA 3BE4A 2NQ2C 5P21A 2WIAA 4LCBA 1G8FA 2AX4A 1Z6AA 4Z1MD 3AP2A 1EFTA 2ZRAA 4L4UA 1A5TA 4WXPA 1WP9A 1A7JA 2Q9AA 2XNSA 4WZBE 1YR8A 1KSFX 1FUKA 2G77B 3LQQA 4QHSA 4W5WA 4GP6A 4TZ0A 1GL9B 3CBQA 3NTUA 4TL7A 3RRYA 3I8XA 4HLUA 3TIFA 1RW4A 1HE1C 3SYKA 4BLSA 2HCBA 5H8WA 2ORIA 2RGNA 5D3MB 5H68A 3AKCA 5DH9A 4OK6A 3AVVA 4KFRA 3PENA 2Q9BA 2Z83A 5GADl 1MT0A 2O8CA 1UDWA 3MJRA 2Q3FA 4Q9LA 1ZCAA 2QMHA 2O0HA 2LCFA 2QP9X 2AFIE 1B0UA 3LW7A 4Q7LA 5M04A 4EJSC 3GJXC 1KI6A 2DBYA 5JRJA 3T12A 4RD0A 2QTHA 4Q4HB 3AUXA 2OCBA 3K9NA 3PJRA 4JLOA 3OIWA 1S9HA 2ZXUA 2J45A 1KO8A 3LV8A 4Q9IA 4X8LA 5KSPA 1OXTA 2JLSA 1Z6YA 2QGNA 4M1MA 1ZM7A 3SHFA 4RY2A 2CVFA 3BH0A 1JPNA 1NRJB 4JKIA 2EFGA 2J59A 4BFSA 2RGGA 1II8B 3IHWA 3R8CA 3ZQ6A 1EWQA 2VHQA 1NBMA 5BYKA 3C14C 5JHGB 3TMKA 4YXWA 3FMIA 4DLXA 4LHVA 4MA4A 2IXGA 2W6JD 3MWKA 1Q57A 2ZJYA 2D2FA 2N42A 2WSSD 4GP7A 4KSBA 4D2IA 4TWZA 4QJ5A 1QHGA 3FGNA 3CPJB 2IYLD 4JVSB 5G41A 5A5GA 3QVUA 1U0LA 3JVUA 4M53A 2YKGA 3LLUA 1R7RA 1KY2A 1Z0JA 4M1OA 3L43A 3LH5A 4OQLA 3B9QA 3ZDQA 3CF0A 3AF4A 1TQ6A 4IHQA 2O0KA 2X8AA 4II7A 1EG7A 4R2HA 3PUVA 2XGJA 2WHXA 3TE6A 1G6OA 2D3WA 2FSHA 3OEED 1IJFA 4GOXA 5E7JA 2IF2A 2GETA 1W0JD 4PSKA 1G4AE 3QKUA 4M1SA 1KMHB 1DBSA 1R4AA 4UQOA 4DLZA 1W0KD 1OW3B 4YMTA 4QHTA 4EQ6B 4B6FA 4W5HA 2EFDB 4PC6A 1NVXQ 2O8FA 1M7BA 3Q8XB 4URYR 1E2LA 2AR7A 1ODFA 2A7QA 2WAXA 2NG1A 1G16A 5AJVB 2HJGA
chains in the Genus database with same CATH superfamily
3HDVA 2VP6A 3QX3A 3O8CA 2V97A 1SVNA 1XK6A 2P3OA 1HKUA 4G84A 5DI3A 3HE3A 5E7MA 5IBCA 4U1RA 1YR7A 1T2DA 2JFZA 1GSAA 3TLGA 2LUOA 5T57A 1OGJA 1OTHA 4RV4A 4BE4A 4EGCB 2H2HA 1RM0A 1TVCA 3G49A 4JJ8A 2WJ3A 3RFUA 2VRNA 3IVXA 3BIFA 3OZCA 2I67A 3QWBA 4ZYVA 1V7QA 2XWSA 2I71A 4RV9A 3WP0A 4F8JA 5I9LA 4IJWA 4X6XA 5EZ6B 1F4VA 3P9PA 2O8BB 1JDSA 1SB8A 1V2HE 5LZ7A 3DFUA 4OLBA 5JC1A 1IOZA 4FT2A 3C98A 3SVZA 3DVRX 3BD7A 2JIPA 3HJRA 1B6RA 2ECKA 2F43A 3ZTWA 5TIIA 3ZGZA 3L7MA 3PUZA 2RGYA 1HRDA 3WGYA 4V1CA 4CTMA 4I99A 3FCXA 5DULA 3UUEA 3F6PA 1NOKA 1S8FA 1YZGA 1BAPA 3UCFA 3DAGA 4CTOA 1ULUA 2KBFA 3OPQA 3VVBA 1K97A 2X3FA 4YX9A 2Q3BA 1M1YA 3LQKA 1GQYA 4CI0B 2PFSA 1K2VN 2CJWA 2FSSA 2HA7A 2REBA 4OLAA 4MYCA 2VNJA 4P38A 2CLFB 5K0NA 821PA 1ZZEA 3KQYA 1E1RD 1W6UA 1P0PA 4HRVA 4JBGA 4A4DA 5BSKA 1AUVA 3SXJA 1YNSA 3U31A 2PSFA 5BN4B 4D79A 3AM3A 1NYQA 3WNVA 4A8PA 2I80A 2BONA 2CVZA 5KSZA 2FR0A 3ILVA 2HUPA 4QDUA 2ZXFA 4KWCA 5EUCA 3VH4A 1TD1A 2ZYGA 2NM0A 2XRFA 4D26A 2JGJA 3QXGA 1BHO1 2FQQA 3WO1A 2DR2A 4EI7A 2RH9B 3EMKA 3C4VA 1T9HA 4DSUA 4AZTA 2BTOA 1M2FA 1TUBB 4MH0R 4EUKA 1IXSB 3OFVA 2J3EA 2XECA 5CBKA 2X4LA 2OZKA 1H9CA 2G71A 2ZIGA 2VDJA 4JYMA 3WLIA 1RRFA 3DMNA 2P3SA 3A0RB 2EJBA 3QXSA 4I8DA 3TTYA 4EIWA 5C4MA 4TMTA 4CKZA 4KHZA 5GPBA 1PFWA 2EX1A 1J42A 1LSJA 1RD4A 3O38A 3EG9A 1UXJA 3PXEA 3Q3VA 4LTNA 1Y63A 2R1UA 2VI5A 3UMJA 2R9VA 4D0RA 5FUQA 3WLHA 2JVIA 3TL2A 1P7CA 3REQB 4GOLD 3RTBA 1IEVA 4M8SA 1T1GA 1X92A 2R6AA 1EXNA 3EFHA 4LHXA 4BNDB 3CVJA 2Z8ZA 4BNLA 2VF2A 5C0OE 1RYBA 3UC9A 3R8XA 2F3UA 1PS0A 1SG0A 2GNAA 4A91A 5KINB 3EPHA 1GUYA 1PEAA 4X84A 3LIIA 2HIMA 4PR0A 4D7AA 4Z7OB 4PCVA 2E82A 4DR1B 4Q9DA 3ZIDA 2BFWA 4XVQA 2OXCA 3GQVA 3EPJA 3NHYA 2G7ZA 4OH1A 3WGOA 3AO0B 4DCCA 4KVFA 1CUWA 3GEIA 3ROMA 3VUEA 2AXEA 5K0ZA 2ZUTA 3SYRA 3AR6A 4CDRA 2WILA 3K9FC 4KNWA 3ZDCA 2YZ7A 1BX0A 3PDIB 1OFTA 1QKKA 5DO9A 3AGPA 5K8VA 2QU7A 3GC6A 3K05A 3HUDA 4RGBA 3CR8A 4GXQA 3VVMA 3IKMB 1GYQA 1JVBA 2JI9A 4P84A 3L4BC 2FPWA 2YOGA 4E88A 3QLEA 2PL9A 1STOA 4F2HA 4MKGA 2PUBA 5IAAA 3TQCA 2XMDA 1D2MA 2EJVA 1E9FA 3QVJA 4P33A 3THYB 3M0EA 2BC9A 4EPVA 4JJAA 3M89A 1AN0A 1PZGA 1Q21A 1UQUA 2GJKA 2I87A 3QVKA 3ZCRA 1K8ZB 2PHZA 3BWBA 3GDGA 3PFBA 4TMFA 1SA0B 3ASVA 3ROFA 2HEIA 3VDXA 4OUKX 4EO9A 4RTOA 1K4KA 3HCCA 3DE7X 1CUCA 4JITA 4F45A 4JKOA 2F9FA 2I3GA 4HTAA 1XNGA 5F77A 1DGQA 3ACDA 2HJRA 3LQ2A 1AS3A 4IGEA 3WLRA 2XOEA 3LP5A 4R3NA 5KWEA 3NS7A 3ZHZA 5KVSA 1ATIA 4JEHA 1KK1A 4EI9A 1NXPA 3KK0A 2D0OB 3IEXA 3MTDA 3WKEA 4KXXA 3FYSA 2IS1A 2JI6A 3GH3A 4QJ4A 2P9BA 2R2GA 1IBKB 1TCBA 4PHCA 4TT3A 1UL1X 1Y33E 5JYDA 3Q7RA 1CSEE 4X6YA 3LLVA 1CF9A 2D2VA 3U13A 1S4MA 1HKHA 5K01A 2PDAA 5G0UA 1VMAA 2XAAA 4ZZIA 4NU5A 3HG7A 4ZYTA 1CJBA 2XE4A 1LPMA 4OOEA 4R2MA 4GIBA 5J23A 4MVXA 1CEQA 1RPAA 1EYZA 1XLVA 1ZW6A 2IW1A 2MINB 5A4FS 5EE9A 3WB0A 4AO6A 5IXSA 2GKSA 2H29A 3L05A 2MYNA 2G06A 3AF6A 1NYLA 1EU1A 2XODA 3RG8A 4C0BA 1PKXA 3PS9A 1VBFA 3DPSA 3H7AA 3EVGA 4JI5B 1TO2E 4BCCA 5J4VA 5FH9A 1DQYA 3ABRB 4RLQA 4RCZA 2P2LA 3FYHA 4M1KA 1JGTA 4HGOA 4M21A 5CH3A 2WUVA 2JFGA 3L8MA 3E22B 3KFXA 2AN9A 3C15C 4BB0A 5FFFA 1LWNA 2Z30A 3N8KA 1IUPA 3SYNA 4KGVA 3VTZA 1MO3A 2J7PA 4BBJA 4Q6BA 4FE4A 3FRIA 3IMFA 3OLWA 4MQ4A 4OCZA 4J4TA 4WNCA 5KDOA 1EFRA 3PLNA 1T43A 1NXTA 1YC5A 4HGYA 4YJHA 2Q4TA 1GEEA 2DETA 2O0LA 4LF4B 3EVDA 4B2YA 1IXKA 2IHTA 1M1YB 1SXPA 4NULA 1QHHB 3C4JA 3G8DA 1U2GC 1DAKA 1U7UA 1SCJA 4MYRA 1C8KA 2ZRMA 1RLTA 1CV2A 1FMJA 3PPIA 4PPNA 3BXGA 5K5EA 2V3CC 4MR7B 1O6BA 1CLUA 1VZ3A 3QVWA 4KQ2A 1TQDA 5DI9A 3BIJA 4KXFB 4EJFA 1H6DA 1WHSB 2GCIA 4OQMA 4JP2A 5FWDA 5EWMA 4YONB 3LA6A 3SIPA 3VYUB 1U99A 3W2TA 1F2UB 1Q12A 3OCCA 3KJGA 3GRZA 1P91A 3KTFA 4RXMA 2CKMA 3I8OA 3NIBA 3ZCXA 5BRAA 1UC4B 3G17A 5J40A 2DPLA 5B57C 1PQUA 3DB2A 3TDMA 3VYWA 121PA 4ZT6A 3I61A 1GR1A 3BWEA 3KZNA 1GZ6A 3ADCA 2XVZA 3IAM1 1WZ2A 1QRRA 1UBNA 1Y1QA 1YB7A 3R5KA 3EGVA 4F2GA 4BC0A 1PTJA 3ZVLA 5L3ZA 4EPXA 3UT5B 2FWNA 5G4LA 1J7KA 1IWPB 1U0GA 4MMYB 2A9RA 1TL7C 2VUUA 4ZVPA 4YREA 4BEWA 4LQLA 2Q6LA 3ZX4A 4C6TA 2XNDA 1MX9A 2BCGY 3ESBA 3EVFA 3MWEB 4ZYUA 4MS3A 2V7EA 4GH5A 4W82A 5T64A 4LKOA 3DOOA 4XR4A 3BEDA 4ESVA 1ISSA 1UUFA 1DWOA 1KO1A 5E95A 3ZV5A 3ZKWA 3QOXA 4BNNA 3H6HA 4NP6A 1GYPA 2WVGA 4P7KA 4R9NA 1E3DA 4MCJA 4H7EA 2M6KA 4Q21A 4DJJA 4Q9HA 2N1BA 2IU0A 2GTPA 2XDWA 4NHEA 1KZYC 3LW8A 3E3MA 1UWVA 4UEOA 1FC0A 4ZAVA 4G09A 2W0MA 4FR5A 1IHXA 4GRIA 5JBQA 1V1JA 4EFLA 4DSAA 5FOQA 1IZ0A 1UQTA 2YTZA 3D4IA 5IDQA 3JSAA 1V96A 1QH1A 4GLJA 1IN8A 2CLMB 4FYJA 4V03A 1RWOA 3C7AA 4QT0A 3JQPA 1EJ0A 5A0TA 3EVCA 3AY7A 3INRA 1X7WB 2QDXA 1EZZA 4FEAA 4I3HA 2VL7A 1YRBA 1V3VA 1KJJA 4X93A 4L8WB 4YALA 4ZOLF 2H9IA 3ZQKA 4YT4A 4OXRA 2BDEA 4UBIA 2GZHA 4WLEA 2GZSA 4XCXA 4D9CA 1Q17A 2BOVA 2C4KA 2ETXA 2WT4A 4JJ4A 3SQOA 2PRSA 3I6MA 1T6BY 4Q24A 1EFUA 3FFAA 1J20A 3HKDA 2IHYA 5LBUA 3BMCA 3S5UA 3RFVA 3UANA 2AR9A 5KSOA 2F1JA 2FFBA 4REQB 2Z5VA 1G64A 3TEJA 3GT7A 4OUDB 2FWMX 2IJGX 2PS1A 3DOEA 4HTFA 4ITVA 2F9LA 1E2FA 4KNVA 5B1IA 2AI2A 4AWAA 5DZSA 4OMDA 3OZBA 1IY1A 1EQUA 3TW8A 5FL7A 2C4MA 3FOAA 4AKHA 2OSBA 1LNSA 4BJ5A 1PK8A 2IYZA 4N6NA 5ALGA 1TK3A 2X3YA 2XT6A 1E32A 3NEPX 5A2GA 1F5NA 1XZPA 3R44A 1O6FA 1U11A 4ZRNA 3CSSA 3U3KA 1W75A 3RJTA 4MEAA 1XZHA 4XM0A 1CWUA 2YNMC 1ZUIA 3RG2A 1G8YA 4BO4A 3HR8A 1B7GO 4UOQA 4CLOA 4CLRA 5IKMA 3RWMB 2YNMD 2MSEB 1JKFA 2FP3A 3GLVA 4GR9A 4LYGA 5F4BA 3ZHTA 2GN0A 5BWLA 4FJ2A 3RFFA 3OTHA 5A0VA 4WQMA 3OP4A 1NC1A 5F7ZA 3WBJA 2B37A 1KYXA 3VAAA 3LIPA 4FT4A 5BVGA 5CLQA 1B00A 1HY3A 3C5VA 3D6VA 1XHEA 2DCMA 3EXHA 2C0CA 4R6WA 3W3AD 1GTRA 3ZLJA 1Z74A 3GLGA 3KSBC 1NX9A 2AEEA 4Y2HA 2ZBPA 3HB0A 1RE1A 4BKOA 4MYHA 3GRKA 2P6MA 4OA8A 2BIFA 4PYQA 1ZJ6A 2VYFA 3EZLA 4Q1CA 4OJTA 3NUZA 5LMUB 5DCLA 4ESHA 2GEUA 4M87A 3ZIAA 1QIIA 2Z2YA 4DT1A 2Y1KA 3CINA 3N2KA 4KLCA 4RA6B 2CL6X 5T7BA 2YFQA 3C4QA 3VC1A 5L40A 1EWTA 4Q34A 4EW6A 3Q88A 3ICOA 3S70A 4CWAA 4L9SA 2AJ8A 1W6RA 1L1RA 3HMQA 2W0SA 4G81A 3HRKA 1HYBA 4XH9B 4BNJA 1U7PA 3Q8WA 3PQCA 3ZBPA 3ZY4A 4F85A 2WD7A 1I7DA 4RPJA 1Z68A 4LYHA 2Q0HA 4KIFA 4BFCA 4D99A 4MV4A 1L7AA 1BU5A 3L0CA 2REQA 5H5JA 3FOEC 4LIPD 1L5MA 2EKBA 2QTFA 3W9BA 1J2TA 4G23A 4HX5A 1ZIOA 4Y2GA 4LRXA 5KAMA 1KKUA 1YVPA 4OGGA 4ZO9A 5L7YA 1EIZA 5ESWA 3WA7A 3IDQA 1Q83A 3PV0A 1OHHD 5DW3A 3WK7A 1AE1A 3KKZA 4XDGA 4XYMA 5AI5A 3JS5A 3GIWA 4TM8A 1VIAA 1DAIA 5A06A 1W36B 2Q29A 3INTA 4NZYA 3G9UA 3ZD9A 4BKMA 1RHQA 1DOZA 1OZHA 5CR9A 1C4WA 3V8EA 2WJGA 4QUBA 3JARB 5IDVA 2Z5GA 1E3WA 1UINA 4KJZA 1VL0A 1F7UA 1Q1GA 2VHYA 4N5DA 2HA4A 1SG6A 1U7OA 3K09A 1ZD8A 4EA6A 1ESEA 4PO3X 3KKQA 1LC3A 2QU8A 3BCUA 1E2JA 5GJCA 4NL4H 6GPBA 1KZ4A 1AO0A 4JCOA 4R05A 1FDUA 3GJSA 4WASA 3ZD7A 1VJTA 2WWIA 3Q3IA 3D7KA 3K32A 1E4YA 3VNAA 9ABPA 2AN3A 1ZH4A 3UXEA 3GA7A 1NJ2A 4FFMA 2CLDX 4YAUA 2J32A 1MHTA 3TR5A 2OAQ1 4BFXA 3AL0C 3W5JA 5LQSA 5EMMA 3BVPA 1A9TA 3FYDA 3IEIA 1IXRC 4QNRA 3KWJA 1XCLA 4B82A 5IYZA 3ONVA 1KQNA 2I4TA 4ZT2A 2YASA 4HAZA 1X15A 3RAFC 3BBLA 2V7TA 1J24A 3EUEA 1QSGA 1GKIA 2X0JA 4H4EA 3V2GA 1JALA 1CDDA 1EFKA 3I05A 3QKWA 3T35A 1WG8A 4WBSA 3GLGB 2AD5A 4E5PA 3UJDA 1SNYA 2IY8A 1TAGA 4JHXA 2IOHA 4FDVA 4JC0A 4IIBA 4ZI3A 1F14A 3RC8A 2ACVA 2CDBA 4IOKA 4PEVA 1E3QA 1KAGA 2PA3A 5LC1A 2PUGA 2R11A 2NUBA 3ERCA 3E5MA 3O9VA 4JB2A 3HDQA 1S1CA 4JQZA 3EDMA 2VUIB 2X9GA 1KJ8A 1JIUA 2VOEA 1GGNA 3RTDA 1SXGA 4CLDA 2PFKA 2Y8EA 4PYRA 5LQUA 3TQQA 1NONA 5BV7A 1J56A 5DHPA 4YAWA 3GLHE 3SIWA 3QEMB 3HBLA 1TQHA 3OIUA 2ZP1A 4DLRA 5F4ZA 3W3AH 1ZGCA 3Q1KA 2O23A 3BJIC 2ZRCA 3PC7A 5H02A 4WY8A 3DDSA 2JASA 5F23A 4OHBA 1SR8A 1G98A 2GYVA 3LX4A 4BUCA 5DNUA 5E6SA 1BFUA 1ZVVA 3OCZA 2JIZA 1E9BA 2EKPA 1T5TA 2RSLA 3CG0A 3D6TB 4RPIA 4YV7A 1CYEA 3C3XA 1U3CA 2YINC 5I48A 1Z88A 3IH5A 3MT0A 3FCOA 5ICGA 3FKSD 3H0KA 5CK5A 4A3SA 2VIIA 1ZNWA 1T0IA 1IB0A 2DFDA 2WBLC 3BCRA 4KE8A 4IGIA 4O2BF 2RKBA 4TMXA 1KJ9A 1RVDA 2Y0PA 2AT1A 2M32A 2ZR9A 3MJEA 4OHFA 3VU8A 3CB4A 1OYVA 3ENKA 2R44A 1J07A 1MB3A 3HKCA 3KJIA 1AQJA 4YUVA 1NVMB 1TIKA 3NASA 2V6MA 3UFXB 3WICA 4ETWA 1FDTA 4WLFA 5JXJA 1C7FA 2IU6A 5K09A 1NP7A 5FCDA 3PXGA 1KARA 1USVA 1O0CA 4Q3DA 1E20A 2OZLB 2M9MA 4FLMA 4WFJA 4MAMA 2FW1A 2QQ0A 5JQWA 3KZMA 1DEAA 1UKEA 3FPFA 1E0KA 3KU1A 2R00C 3PWZA 4MKXA 3ZWCA 3EMBA 2W9XA 4KYTA 2NXNA 2J0UA 3DWFA 1O97C 4YP6A 1ZQ9A 1VSUA 1ZVKA 3OX1A 1XIVA 2V59A 4ZT5A 1PFKA 3K0SA 3GV0A 5F9HA 1L8QA 4FEEA 1WB5A 3KJFA 4XDZA 1I2BA 5JJCA 2A0UA 3GDFA 3IV9A 3MWDA 2HV8A 1EE2A 1RM4A 4OBBA 3ZZMA 4BKQA 3R5TA 4ILEA 1GSIA 4OMUA 1YFKA 2JGLA 3ELBA 5LM3A 1VLJA 3O0DA 3HVUA 4N5LA 1I3MA 3CUSA 3X1JA 4MGKR 3BDIA 2YMMA 4KQCA 4Z0HO 3EMDA 3OQHA 5CBPA 4GUAA 1PKEA 2YDYA 3WL3A 1ZUHA 3B1KA 1WA5A 3FVRA 5J1TB 5AUNB 2FN8A 1O95C 2G17A 3BJZA 3EZ2A 3W6PA 5CVTA 6Q21A 1BH2A 1NBEA 4KB5A 1J0EA 4E7PA 3FUTA 1O58A 3KALA 4G26A 1IUOA 3CJTA 1SCDA 1ML4A 1MQ8B 1QG6A 1W4ZA 3HFGA 3IEUA 4F7WA 1A50B 1IH8A 5DISB 1C0KA 1IMJA 3G5UA 4MPJA 5K8LA 2FW0A 2VLIA 4HGPA 1HOTA 1R0LA 2GF2A 1ZL0A 2O2HA 4UUPA 4RIGA 2GLUA 2PT9A 1GKLA 3QG1A 5LMZA 5AJXA 4R1MA 1G8PA 2A9KA 3JARA 4IOJA 5AM0A 1CF2O 3TQFA 4B40A 1VPWA 2B8TA 3ICEA 2UUOA 2CHGA 2VZ0A 4B6EA 1ZYUA 2ORYA 1CDZA 1C30A 3GLFA 1YCGA 2ORED 1AUOA 3ZGVA 1KH1A 4KLNA 4ZI7F 4F5EA 2NTVA 2H4XA 2O52A 3QPAA 1Q7TA 1MC4A 2JAUA 1PJRA 2WAOA 1MJNA 3F5QA 3ZYZA 2EGUA 3A3PA 4GG1A 4HXYA 2VF8A 4F6CA 2DXIA 5A7FA 3WK8A 3C8ZA 3TYXA 1TA0A 2ES4A 2VNHA 4XFJA 1FNSA 4N03A 3ND8A 1LKZA 4PYNA 3P9IA 3AHJA 3QIVA 5KYUA 1A69A 2IEGA 1FVFA 2QZ4A 2WUGA 2NV6A 2O8VA 4U8GA 4O63O 3D2AA 5DGHA 5BSVA 3SD7A 5A2QA 2HQSA 1CFZA 1UXHA 3KJQA 3N6RA 1E7RA 4UULA 2GO1A 5DNVA 4F7DA 4FKMA 2FSIA 1ICIA 1I5OA 4GLOA 3ASYA 5DI3B 1WXWA 2IZ6A 1DXOA 2B61A 1QYWA 1LC0A 1W94A 1ZXXA 2HSDA 4O25A 4DIFA 1JAIA 2NTEA 5ERGB 2ACKA 4RK6A 3T54A 1LK0A 2W71A 4IBOA 1GPKA 1NV9A 3EIQA 3MW8A 4XZ3A 3T9CA 4AYWA 1DDIA 3MVEA 5EKUA 2FSVA 1NIPA 3I12A 1ZUWA 3U7JA 4BFLA 1R0XA 3MT7A 2D13A 1FX0A 4I50F 4QBKA 2GM4A 1FU4A 4M7PA 2CF6A 2E7ZA 1D2NA 3GEGA 3OFJA 3G02A 3ZV6A 1USGA 4W5OA 3DZCA 2I4RA 3JYNA 1MAVA 4GZ6A 4MWDA 4BZXA 3A32A 5EZYB 5JAOA 2HY7A 2OB1A 2J6HA 4D4IA 1BYUA 3V32A 2K2QB 3UYKA 4HEQA 3ROEA 1JPUA 4F4HA 3P9KA 3KE8A 3W1EA 4PSDA 1MABA 5HIIA 4AKGA 1YZNA 4QREA 1KZGB 3NBQA 1E2KA 2XWJI 4JLKA 2ZJ5A 1ZGHA 4HZUA 3BMNB 5YASA 1BE6A 1XQYA 2AUNA 2QSYA 3KYDB 3TAUA 4A1OA 1WV1A 2R66A 1RHRA 1NWCA 4O33A 5IARA 5JWOA 2C99A 3CW8X 4KUHA 4JGIA 2QGZA 2BEKA 3ZTTA 4C4SA 3FZEA 3JZAA 4JS0A 4H6XA 5ECWA 3QE4A 1AN9A 4DANA 1JJBA 2Z3VA 1FXWF 3UGTA 1IN1A 1ZK1A 5E1BA 5CCBA 2Y1DA 1VTKA 4C0XA 5D6OA 4G85A 1I4TD 4QM7A 3UB3A 4GOMD 4QTYA 1XCMA 5I4IA 2PZFA 2WWYA 1MLDA 4Q1DA 5BN5A 5JJIA 4DV7B 1CETA 4Q19A 3GLUA 4YCAA 4Q7MB 2P67A 3PFKA 3RIMA 1IZ9A 4H1UA 2Q99A 3I6YA 2I3ZA 5CCXA 1QV6A 2DT8A 2P78A 2W98A 1QO0A 1YRHA 2YVUA 2BFFA 3KTOA 4HQKA 3ANYB 3W77A 2FSGA 4YHHB 2B2NA 2NU8A 4YBRA 1XHFA 2Q1YA 2P1DA 1HDXA 3TZLA 4AL4A 1ZMXA 1WZEA 5JV5A 2IOFA 3AJ8A 4D44A 1EDDA 2NO1A 4TMZA 1V3QE 4B5LA 2ONZA 5BW4A 4YJ2A 1WP4A 2WWTA 5JZVA 2QB5A 2QYHA 4US1R 3JQAB 1F2TB 1PZMA 2N46A 4P2GA 5J2TF 1EFAA 2XBMA 2WT8A 3K9HA 2R85A 1YBVA 4J76A 3DQZA 4JYAB 3E8XA 3JPWA 4LA4A 2W37A 4DA8A 2Y77A 4RZUA 2W8BA 3UMRA 2HPVA 3PYMA 2G83A 1ZIYA 4MHOA 1KE2A 1CUHA 4BMDA 3OWXA 3SZMA 2QRJA 4N4AA 3ZOKA 1EFRD 1TMGE 4RADA 1QFJA 4J6EA 4A82A 5TPWA 4RGQA 1H94A 1JG6A 3HACA 4F71A 3GF4A 2YMQA 2YQ4A 3GIDA 3N74A 1L5LA 3SHTA 4C5BA 1KI4A 1Z4MA 2BDTA 2IVFA 2PS3A 3DTVD 4BQRA 3VOBA 3OZVA 1QH8B 3IBFA 2Q2VA 2YN2A 2VO1A 3V8PA 3WAGA 4X1KB 1Y3HA 4IXNA 4X1YA 1YD7A 1QS0A 5ALDA 3H1GA 3BZUA 3U1VA 1FUEA 4ACAA 4YDQA 1P4HA 3A1VA 3GAAA 1SIOA 4O4HA 4U0KA 5IHPA 5GZ3A 5JDIC 4O3MA 4M3NA 4Q3AA 4AZVA 3OJLA 3NXKA 3ZY6A 1DC6A 2YIMA 4EG1A 3L4JA 3D8RA 3ZCSA 3LCVB 4X91A 1X9IA 1Z6TA 2I76A 2B5OA 4NEGA 3RREA 1WOMA 1Z4OA 4OM7A 4IV0A 4MVCA 3DE1X 5FEMA 3TR6A 2G9ZA 3LRPA 1QMPA 4RPLA 3EN0A 1AZSC 1W4CA 4D3YA 2JLXA 4EITA 2XSZA 3ESAA 1T4CA 2C03A 3PXXA 1JLHA 4CLXA 4TV9F 5FWXA 1DBPA 2QLBA 4HD8A 4NIMA 1C3LA 4DVJA 1YCDA 3WLOA 3UGJA 3I6IA 3U4QA 2A35A 3L0IB 2VCHA 3BG5A 5EZYA 1Q11A 1U5BB 3Q7SA 2B6NA 1QIJA 5B7PA 1L6RA 1B74A 3DBLA 3F3KA 4OHYA 5ICCA 2K7ZA 1YZLA 3RHTA 4R71A 1RQLA 1GKYA 2RK3A 4CCSA 4TLAA 3AINA 3C74A 2IX3A 4BIIA 1K66A 5BNFA 3ZPXA 5A1JA 5CFRA 2ZRIA 3AL3A 3LQ1A 4JEIA 1RJ9B 1QHNA 3NIDB 1ENOA 1PL7A 4WCFA 4A5SA 4DGQA 2C5FA 3DZIA 5FF9A 5KHAA 4KQXA 5I8WA 3R3XA 3CLKA 3OQIA 2ERXA 4CQLB 2VTBB 1D0IA 1Z0ZA 2D4AA 4IDOA 4FFSA 1QH0A 4MA0A 2OHFA 3G7SA 3TLAA 2HYIC 1O95A 1W1IA 2WJIA 4KYUA 1V4VA 2CVQA 3DVQX 1FLNA 1XNRB 1D6JA 3WB1A 1PL6A 3GGGA 4X3CA 1BA2A 3D3NA 3G5TA 3KSDO 1Z18A 2ODPA 3QVXA 4LBVA 3HXPA 4RHXA 1W52X 2E18A 1FYFA 5AT1A 1J8YF 1J1ZA 4QBGB 2Y4NA 3ZHBA 3UB2A 4EPTA 6NULA 1DPFA 4POAA 1LZLA 3VR3D 2JK1A 4LF6B 3F9RA 1X7GA 5DCUA 1ENPA 1G66A 2E2WA 2O3JA 3OSUA 4Q03A 2WA2A 4CKWA 1PNRA 4DMKA 4CN8A 1B16A 2K7FA 1LVHA 4GUDA 4WN9B 4QSHA 1KIMA 1O0SA 4XGQA 1JIIA 3CSUA 1Q1AA 2VSXA 1UPTA 4IZHA 3VR1A 3PXUA 4R01A 1MXFA 4NBWA 4K6HA 1TU0A 1T0BA 1VBMA 4JR0A 5CNIA 2B30A 3UV3A 5HZKA 5AVXA 5JAPA 4R2LA 1E5DA 2IHKA 1WQ3A 4L4YA 3U56A 5K8CA 3F6BX 1YOBA 3O8BA 4KN8A 3ZWAA 2HCJB 1O5TA 3KXLA 3QUBA 4N8SA 1D4ZA 1OA1A 2EQ5A 2F1HA 4QQRA 3SN6A 1KQFA 1KL7A 3TZBA 2ZULA 3GLRA 4DMMA 3L9XA 3SX0A 1CE8A 3DFZA 5JCJD 2RJOA 4Q01A 1UH5A 3UAWA 5HKLA 2FK7A 2W6ID 5GZ6A 2ZWAA 3BMXA 4CMIA 3TTSA 3OTIA 1BN7A 2WMYA 3WWPA 1E4EB 1JLLB 1KJIA 3BSYA 1PG0A 3M7IA 4J1TC 1M6YA 4W8GA 2DULA 4QDTA 4V3CA 3HGTA 4JA0A 1N8SA 4S0XA 2XVXA 4NAHA 3WB2A 1RXVA 1O8CA 2HLPA 1AURA 2WWVD 5E6UA 1NLYA 1IL0A 2O57A 1QQAA 1EUZA 3R4CA 3ENWA 2OQIA 2AOUA 2WY2D 1M74A 2O14A 4PG7A 3RTGA 3W1VA 4MCIA 1JR2A 3ESXA 4LJLA 3T6KA 5M7EA 1XQ1A 4CUZA 2O4UX 4MV9A 3O21A 3BKXA 3KNZA 4LV6A 5INTA 2FPXA 4AKEA 10MHA 3RYFB 1PWEA 4PZCA 3DDHA 1XZGA 4G2TA 1S2MA 5FTLA 4YFYA 1E62A 2DLDA 3TVDA 1UAGA 4JP1A 1M6HA 3COSA 3G0BA 3R24A 1KOGA 5PNTA 2QLMA 3WWCA 3EDYA 2H48A 3I9OA 3TH5A 1DB3A 1M9NA 2QXUA 1RHKA 1V48A 1ZD1A 5A4MS 1QR6A 3Q0IA 2AVNA 4BNYA 5I8PA 2ZT5A 3OM0A 2C92A 2HCTA 4XLLA 4BNIA 5EJ8A 1W35A 2IITA 4DR7B 2YWHA 1RQXA 1ZNZA 3FB4A 3B7GA 4PHFA 5IEJA 1U4OA 2E4AA 5H7XA 3W8FA 3WMGA 1FNNA 1JT9A 3ECCA 2FNAA 3PRYA 4B6RA 5IZCC 4F06A 3FGPA 3N2NA 3HO6A 3B6EA 2V7XA 1BSVA 2C5SA 1ADYA 2CVPA 4MQFA 4AMYA 1Z06A 1PQWA 4JLJA 2GFQA 5AM4A 4DOMA 3QPVA 5C18A 3IAAA 4D4JA 1GKKA 4L7QA 4G65A 4M1ZA 3MQFA 2VUSA 3UMCA 1IBCA 4S2EA 3TCNA 4E09A 3LPMA 4N18A 1ULAA 2XBLA 4IIGA 2A2ZA 4FILA 4II3A 4C0LA 2P2NA 2FPGB 3STHA 2GAFA 3L79A 5DASA 4KE6A 1GNVA 3ID6C 1IE3A 1G1AA 4J0DA 5EJIA 1N33B 2XUKA 3KUCA 4A0QA 2YBEA 4X45A 4J2HA 5TEVA 2H7CA 2IYEA 2ATCA 1HL7A 2ID7A 2JI8A 4FOSA 3A0UA 3UK2A 4RD2A 4Q4LA 1DEXA 3GR6A 1XD2A 2G4VA 2ZRNA 3SM3A 3P96A 1Z3IX 1WTCA 2WABA 4PR3A 5C51B 2ZT6A 3AR5A 3MK31 1H0SA 5JNWA 3DXZA 1GOTA 1U0SY 2GF9A 4IH9A 4MV0A 4EOGA 1JECA 1ISRA 3CZ5A 3Q7IA 3LYAA 4XX0B 1JRLA 5CDHA 4J16C 5CFZA 3WJ2A 5KIAA 2AR0A 4V0SA 4JEMA 1C7ZA 3LFTA 1ID1A 1RBQA 3NWPA 2VBCA 1I3OA 2P77A 5KC9A 4UU0A 1BDMA 1ZGGA 5KX5A 4QOHA 3KQUA 1V37A 3QWIA 5DIFA 4KPYA 4A7PA 2J9YB 2ZJ1A 1Y37A 4V1CB 3PC8A 4I55B 1J2UA 3FDXA 1NP3A 4AG5A 2NOAA 3RANA 2QRZA 4UATA 4WEOA 1NVAA 2X77A 2ZRLA 1DQRA 4MLCA 2GXQA 4CLHA 4KQFA 2FB9A 5GVRA 1P4AA 3U4IA 4G0VA 3WC4A 1U2DC 4J7XA 1MD9A 3EOBI 2ZJFA 3HJFA 3LDFA 4G1FA 2FWJA 3JPYA 1LS1A 1G60A 1BEZA 1LTKA 1SD5A 4YI3A 4F96A 4ENRA 3OIDA 3ROPA 3THWA 4WW0A 3CLUC 2LVBA 1XCPA 1AB5A 2O8BA 3HDHA 4WN3A 1JLRA 2QQEA 2PMFA 1U0HC 3C3CA 3DEFA 1XB2A 4LDNA 4GYWA 4RACA 5IVDA 1JKJA 1X94A 3TX6A 1HMPA 3RQIA 3E7DA 4NZMA 1XU4A 4N5MA 3RB8A 1XEXB 1I4OA 1KJWA 2HBZA 4HRXA 4QPJC 3DONA 4Q93A 3MLBA 1YHZA 4DLBA 3RS9A 1HZJA 2OXTA 3I9MA 4P6VF 4IWNA 3H3FA 4QXMA 1QQ6A 1ZISA 2PXHA 1MC1A 1GUBA 3DDZX 2ERYA 1MU0A 3CH7A 1FRFS 3IKLA 2FN7A 1K5DA 2BHSA 4WZBB 1ZSNA 1R0KA 1YJ8A 4Z9AA 5K2OA 2VQSA 4CUJA 4HO1X 2I4OA 4M37A 4R1LA 2D1FA 3WYGA 1U1FA 1KVSA 2XCQA 5BPHA 1F60A 1LI7A 2OOKA 3DP9A 3H17A 3RROA 3NX4A 2MDTA 4MVJG 3GLHA 1Z8FA 3EGEA 4ZVVA 4Z4FA 5MHTA 4AF8A 1N2CB 1H1LB 1WXFA 2GJ8A 4LBZA 4AZWA 3A10A 2O19A 1KP2A 2VH5R 3LRTA 2A78A 2BRUC 2J5XA 5H3LA 5TT1A 1N2ZA 1NGSA 1B6GA 2XB6A 1JA1A 2JEOA 4F86A 3MMSA 3VJRA 2YWDA 5K4GA 2SKDA 2FGJA 4EPWA 4IUYA 2WR8A 3ZYCA 1Y42X 1PLLA 5HFAA 3CIFA 2H5EA 1RYEA 2ZR7A 2X1MA 1P4RA 1Z7GA 4X3OA 1RLOA 4W1QA 3FYUC 2F7SA 5JD5A 1VP9A 1DJNA 2H92A 3AY6A 8ABPA 3R9IA 4JYBA 4PLWA 1T2NA 4YXWD 2ONCA 2F6RA 3K70B 3ZHUA 5EJ4A 3UPTA 4NBSA 3B9PA 3ANXA 3BHMA 5DN6D 5EPUA 1BKDR 2MMGA 1GL6A 1I7PA 2C8LA 1YQGA 2NZ8A 3DM9B 3OZSA 3QHAA 4Z49A 4QG3A 3CRQA 1NBIA 4NK5A 3JQDA 4MV1A 3ZJTA 4ETNA 1RRPA 4Y2UA 1DRKA 1A1SA 1KMCA 1Q3TA 1UMCA 4LK2A 4RLFA 5TQ2A 3FZNA 2JDID 4WBNB 4HFNA 4DLWA 1M2JA 1UEIA 2MSDB 1T36A 3M1LA 3H86A 3ORHA 3EPPA 4FSDA 4FNOA 4LMBA 4MUJA 1C0LA 4WLOA 5EZSA 1XTSA 4CODB 2V58A 1FRVA 1MGOA 3VDMA 1AUXA 1CTQA 1UEXC 2OFWA 2WINI 5BUSA 2I54A 3R6TA 4LISA 1SHTX 4NBVA 1TMOA 2C78A 2ZSUA 5AI4A 3ZCQA 2BI8A 1RABA 4DHEA 1WEHA 4P32A 4NZPA 3WG9A 3CNOA 1N8KA 3SBDA 3L46A 5AKEA 4X94A 2GZRA 4MUKA 1O89A 1GGFA 3DAHA 3P19A 4GMDA 4ND7A 2XCIA 2HQRA 3D6UA 3DXYA 3UTDA 4ZVKA 4COOA 2WSSA 2ZUCA 4Q1FA 3I1JA 4H7FA 4IIYA 3RWOA 3CVYA 1J5EB 4GKVA 5EIFA 4K6MA 1SB9A 5AVOA 3BN3A 4PYMA 1KSHA 4IVPA 4TQUS 2OHVA 1JS1X 3F0TA 5TJ9A 3WLKX 5GGYA 3I5UA 1Z28A 4UJ5A 1WMDA 5IK2A 3W5CA 2NZWA 4HDMA 5EFZA 3KXDA 1S2GA 1TZCA 2HH9A 5CURA 4I3GA 1TM2A 2AEJA 4JVOA 1Z5UA 3LNCA 1XD2B 1QRUA 1VKRA 3MYRA 3GUVA 1BG6A 3A1FA 4NCXA 3NCTA 5BNZA 4TWRA 3FBTA 1EFHA 1RXUA 1XMSA 2D5LA 3FWHA 1D2RA 3FWPA 4O4IB 5IVPA 2AK3A 3FSRA 3JD1A 2GEKA 1WXHA 1GAJA 1NA5A 2Z1NA 5A4DA 1V8BA 5HG0A 5KMGB 2I29A 2C5LA 1BVUA 5GQSA 2XB2A 1BEEA 3ZEAA 4XX0A 1YZVA 2FPIB 3NBYC 5AIAA 3BILA 1I7NA 1QORA 3EWIA 2WZDA 4Q4JB 2P41A 2PWYA 2X5NA 4HLUC 4MUXA 1NHWA 5FTWA 4Y6RA 2FMUA 2OFFA 3KDSE 2EP7A 3TUJC 2ZWVA 3AY0A 2WAYA 2ZT8A 3ZH2A 1FLAA 3IUNA 5AKYA 3VR6H 3ZV3A 2KBEA 5CIQA 1JEDA 2HO5A 4UTPA 1LDYA 3A1CA 3JVVA 5IFLA 2OO5A 4QGGA 3QKRB 3IHTA 4HOYA 4P98A 5DLDA 5JNSA 1Z8NA 3GVCA 3PFFA 1CUGA 4EG4A 3L41A 3KB2A 4KBGA 2Y6UA 3IQDB 3DZHA 1C7IA 3IVRA 3PVCA 1UKBA 3I04A 4GNKA 5GJBA 1Z75A 5FRDA 2NAFA 1DIRA 1GTG1 4HN9A 1WB4A 3MT8A 1YZQA 5FPPA 2OXIA 3K4QA 3WWEA 4C4PA 4CT4B 2WHRA 3D4NA 2DBQA 3GARA 4N49A 1OX5A 2GH1A 1E1YA 4DMUB 1UM8A 2C1EA 3B1YA 3EK2A 5JAZA 1EESA 3SE0A