2PZIA

Crystal structure of protein kinase pkng from mycobacterium tuberculosis in complex with tetrahydrobenzothiophene ax20017
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
677
structure length
654
Chain Sequence
GSHMLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase pknG
total genus 200
structure length 654
sequence length 677
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF16918 PknG_TPR Protein kinase G tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pziA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pziA02
1YVJA 4F6WA 3HECA 4XMOA 3AC2A 3I5NA 5TR6A 3HKOA 4UQYA 2RL5A 5J5TA 3II5A 1B38A 2VTJA 3MH0A 3QYZA 2QKRA 4I20A 3KN5A 4YLLA 5EG3A 3NRMA 3ZN3A 4ZJVA 4EHZA 4DHFA 2ONLA 4IFGA 2KCLA 2VAGA 3ZPJA 4D1XA 3FKOA 4EQMA 5I9VA 4J52A 4K8AA 1PYXA 4YZDA 5JRQA 2QO2A 3SGCA 3DBDA 3C1XA 4QTDA 4OBQA 2WMVA 4GG5A 5D0OD 2VTRA 2KATA 3KULA 3T9IA 4FVPA 4QYFA 3ZHEB 5KZIA 4JR7A 1FVVA 1QL6A 2UW7A 3BHYA 3A8WA 4O21A 2YWPA 3C4FA 2XRWA 3MIYA 3CC6A 5T68A 3E5AA 4MD8E 4C4EA 3ORLA 3BEGA 4EC9A 3U4WA 4HVGA 4U79A 2RFEA 2PULA 4XI0A 4CKJA 3LJ0A 1P4FA 2EXMA 2GDOA 4FMQA 4AN3A 4U07A 4A4XA 2BKZA 1YHSA 4Q5HA 5HGIA 2O3PA 2YM5A 5E91A 4D4VA 3EN7A 4BICA 3GEQA 4NIFA 3O8UA 3VBVA 2Z7RA 4FKRA 3I1AA 3DKOA 1JVPP 3KMWA 4CFUA 4F3VA 4BN1A 4ZEGA 2JITA 2AC3A 4EH5A 2UW9A 3U51A 4YPSA 4F65A 3CY2A 4G2FA 3LXLA 3CJFA 5AP5A 4S31A 2XEVA 5IA1A 2P33A 3QKLA 3G15A 3QCSA 3ASFA 2QVSE 4HGEA 3NLBA 3PG3A 4MCVA 4QTAA 4RJ7A 4XV3A 4V04A 2HWPA 3ORZA 4UMRA 3AS5A 3NUYA 2R64A 4QP4A 4V0GA 5HCYA 2ZJWA 5F4NA 4C37A 4WNFA 4P2KA 1XH5A 3SW4A 3PPZA 4AW0A 4BDCA 3QTSA 2CNVA 1QMZA 3JY0A 5HCXA 1XO2B 4M7IA 4K9YA 3PA4A 3HP2A 4IN3B 2WMXA 2IPXA 3N51A 4PMSA 4B99A 2V55A 5EX0A 2F7XE 4CG9A 5GJGA 3CEQA 3F2NA 4AW5A 2XBJA 4P90A 4FTTA 4HYSA 3CY3A 2E9PA 4GYIA 2DS1A 4MNEB 4HNIA 4OTDA 3RPRA 2RG5A 3ULQA 4HZSA 5AAEA 1LP4A 4EH8A 1CKJA 1MRYA 2YJSA 5FTQA 2C3KA 2PVKA 3LW0A 3UIMA 3FYJX 2YDJA 2YIRA 4MBIA 4IHPA 4EBWA 3ZRLA 2JIIA 4YU2A 1UNHA 3VUMA 4B0GA 4GA1A 4NT4A 1U46A 3F88A 4LOQA 4UV0A 5EOBA 3V5LA 1W82A 3ZO3A 4EQUA 5LJJA 3GU4A 4MX9A 4Z3VA 3HV4A 4EH4A 4JQ8A 2OH0E 3AGLA 3T9TA 3W2QA 4G3CA 4CD0A 2QOBA 3QQKA 4HGTA 3ZZEA 4GZ6A 3PPJA 1Q99A 5AUUA 2CLXA 2FB8A 2WTCA 5J1VA 2PUIA 4ZMFA 3N71A 4IX3A 4BT8A 4ACGA 3RGFA 3QTZA 4QQJA 2V7AA 3NUXA 4HNFA 3ASDA 4IX5A 2WMRA 2YJRA 3SA0A 2ZDUA 3E63A 4IM3A 4ASEA 4NKAA 3ZTXA 4JBPA 3RK5A 4RC3A 1OKZA 3WI6A 2W4JA 4PV0A 5BVWA 3O96A 3CSVA 2XGSA 2JKKA 5CI7A 3FLYA 2C47A 4NYEA 4KWPA 2PL2A 2FEZA 4FKIA 3W2OA 3PJ2A 5LWNA 4MWHA 4G2VA 4LI5A 3RWQA 3GU5A 4JVGA 4G26A 1OMWA 3JY9A 4F99A 1OL1A 1Q3DA 4I4FA 5A54A 4AE9A 2OW3A 3LQ5A 2PE1A 3MW1A 2CNUA 4AAAA 3TXOA 5JMSA 4F9WA 1MP8A 2ZV8A 4GUEA 1QPJA 3PUPA 4JHRA 3MV2B 1DI8A 1JNKA 2Y4UA 1MQ4A 2ITVA 5HBHA 3TN8A 4BTKA 5E8WA 1NA3A 3GZ1A 3BV3A 4P5QA 3FXWA 5IUIA 3RNIA 3TTIA 4E4MA 2XP2A 3A99A 4DFXE 3MJ2A 2QO7A 2FF4A 1R3CA 3FZ1A 4RWJA 4MQ2A 1KV1A 2Q0NA 3RM7A 3V5QA 5KJKA 4ZIMA 4YZNA 4KUJA 4AZTA 5H2UA 5HCZA 4L7FA 1Z9XA 4LM5A 3UDBA 1RDQE 1Q8WA 2Z7LA 4FKGA 2WOUA 2XM9A 3EQRA 3KULB 1OITA 3QX2A 5AP1A 5A6OA 3CKCA 1YDSE 5CWZA 3PTGA 5IZFA 2ITTA 4KBKA 1PF8A 4DCAA 3F66A 4YNEA 3TV4A 2FO7A 3NMUF 5IU2A 3R9AB 5K4IA 3M11A 4BIBA 3B2WA 3KK9A 3FE3A 3ACKA 4O6LA 3TV6A 5AP7A 1PKGA 2W1FA 4WT6A 3S4QA 2BFYA 1J91A 2B9IA 4MXZA 3FEGA 5FP5A 2R3OA 3PSBA 3S7BA 1U5RA 4FKUA 3ORTA 1PXJA 5I9YA 4WG5A 3CQUA 5AWMA 1G3NA 4GL9A 3Q9YA 4MD7E 3TKIA 3WARA 5A6CA 2F57A 2Z60A 1WVYA 3SOCA 4R1YA 3KL8A 4A7CA 3U6IA 3VQUA 3MGYA 3E64A 4BDFA 5CHEE 5IMEA 3MYGA 4XLVA 1FCHA 3QX4A 4UWBA 3OXLA 3TAXA 2YM7A 5LVOA 4OR5A 4HGSA 2EVAA 3QA0A 4GYGA 3VVHA 2YIXA 4H3QA 4BDGA 1IAHA 3RZFA 2WHBA 5HX6A 4AGCA 4NU1A 3UQGA 4Z16A 1UA2A 1K9AA 2W1HA 2YCSA 4WG4A 3UNJA 4BCPA 5HTCA 5HG9A 2AC5A 5DIZA 2W99B 3QDNA 3RM6A 4DT9A 2BRHA 4JBOA 4KINA 2GFCA 4M3QA 3IOKA 1BLXA 3A7FA 3QRTA 4Y73A 1NVSA 2JDTA 5AUWA 4FUXA 4MNEA 3ROYA 4CFWA 4OAVB 4F9CA 3ENHA 3H3CA 3COIA 4CV9A 4EH7A 4TWPA 3SHEA 2GFSA 2FSLX 5I9UA 5EX3A 4RIWB 3TNIA 4M13A 5I9WA 4LFIA 3V5WA 2HAKA 3PXQA 4FUYA 4EC8A 3F2RA 1SVEA 3G9LX 3S1HA 2CGWA 2WXVA 1HOWA 2PMNX 3NIZA 2A1AB 3LXNA 3DKGA 2R3GA 3WE8A 1PYEA 1YXXA 4V0GB 3VN9A 4ZP5A 2E2EA 3LFQA 3BGPA 5ANOA 2X2LA 3R2YA 4AGWA 2XIZA 5JT2A 4OT5A 2ACXA 4M69B 4ANNA 4FSMA 1ZYLA 3GC0A 4XOZA 2EXEA 4A06A 4E4NA 3LKUA 3R1YA 4NQ0A 1V0BA 2UZVA 2JKOA 5FRIA 3GW4A 3RMFA 5AV2A 3PIZA 3RTPA 5BX0A 4GT4A 4BGHA 4BWXA 5FGKA 5JFWA 3G9NA 5BVEA 4JDKA 4R7IA 3BX5A 5CY3A 1H1QA 3ROCA 5C1DA 3LMIA 5AR3A 2VTAA 3RINA 2X8IA 5CEOA 3Q4AB 2YERA 4BWRA 3ZSHA 3C9WA 3B8QA 3V5PA 4EOQA 3VUTA 2GNIA 5DN3A 5B7VA 3EL7A 2MHKA 4NUSA 3TJCA 4FTAA 5K4JA 2X8DA 2HXLA 4AUAA 1W8CA 3QQFA 3F6XA 5CENA 3NF1A 1RJBA 4MHAA 3EYHA 3D15A 4ZZMA 4M68A 5L2TA 3BWJA 3FXXA 4WNGA 3OTVA 3PE2A 4UMQA 4FG8A 4USEA 2VGXB 4IB0A 3VNTA 4ZMEA 3CQWA 2H8HA 3SQQA 3PXFA 1ZARA 1KT0A 2QOCA 3D5VA 1R0EA 5HVJA 3MVHA 3F3VA 5HI7A 2UZWE 3BHTA 2AYPA 4NTSA 3ZU7A 2R3HA 5A6NA 4J8EA 2XK3A 3LCTA 5LMKC 3QF9A 4XHKB 4CYIA 3KVXA 4EH2A 2Y6MA 1P2AA 4D2TA 4F6UA 3TZ8A 4NM5A 3ODZX 4U43A 3D5XA 4HYIA 2BROA 3NYNA 4FZFB 1QPCA 2V62A 3E3PA 4KKHA 1NVRA 2XK8A 3DQXA 3HL7A 1WBSA 1Y91A 4AWIA 4BIDA 4I6FA 1QPEA 1H0WA 3NX8A 3R0TA 1YI6A 3FZPA 4QMSA 4U80A 1G8SA 1XHAA 2R3NA 3BCEA 3CVQA 4XRLA 3LIJA 3NCZA 4EZ5A 4RT7A 2J0MB 1O6KA 3OW3A 2YA9A 4O0VA 5AAFA 2R3QA 3E87A 4J99A 3TUCA 4AGDA 3UGCA 3C13A 3WZEA 5F9EA 1FMOE 2PZ5A 2XNOA 4YLJA 2YN8A 5TE0A 4MXXA 4IZ7A 3FMDA 4CV8A 2W5BA 5ETAA 4H3PA 3FLNC 2UUEA 5M4FA 5H8GA 4L6QA 2XNEA 3BGZA 5M55A 4HCVA 4DFBA 1IEPA 3RJVA 3C4EA 1KE7A 4G9CA 4KIQA 4RVTA 4AGUA 5IQBA 2XIYA 3BLRA 5D9HA 2IW9A 3NZ0A 3NGAA 4FTNA 3BU5A 4YZMA 4FT9A 1JKTA 4O84A 4FG9A 2WPVA 3A8XA 3GU7A 3ODYX 2WTWA 4GA2A 3VJNA 3GC8A 4BZNA 3C4WA 3F2AA 4C4JA 5I5ZA 5KUPA 3RCJA 3EFLA 5IH6A 1UWHA 3TWJA 3TEIA 3LFEA 3Q15A 2OXYA 3FAAA 3ZM4A 5CVHA 3FMNA 3E8CA 2UZUE 2PZRA 3R1QA 4P4CA 4WKQA 3SLSA 3SRVB 2YACA 4XP3A 3QD0A 5EHOA 3IK3A 4WOVA 5DE2A 5FXQA 3R8UA 3WF9A 3U6JA 3FMKA 4I6HA 2HW6A 5DHJA 3RNYA 5AYWD 4KABA 2ETRA 4I3ZA 3RVGA 4FTRA 5D41A 3FMHA 3O7LD 4IAFA 5IDNA 5D7AA 3WZKA 3OC1A 5J9YA 2QNJA 5KMKA 5FTPA 3E7OA 4I5CA 3PJ3A 4PL3A 2J50A 1WBVA 3VUIA 4BHZA 4XG4A 5GNKA 5L6PA 4XG9A 3ZOSA 4EOJA 2IZSA 4X0MA 3BLHA 3WIGA 3C51A 1JSTA 4KAOA 2X9EA 3BU3A 2XEZA 1ZRZA 5FUTA 2EB2A 3AC4A 3EH9A 5CEMA 2OIBA 3MA6A 2X1NA 4ARKA 3QKKA 3P0MA 2LAVA 4W9WA 5IA2A 4JQEA 1LR4A 3I7BA 1PJKA 1FGKA 4ITJA 4BKJA 4BL1A 4LMUA 3QZIA 4RMZA 5K0KA 4X2JA 3SC1A 4D2PA 4X3FA 3JS2A 4BCGA 2VO0A 4X3JA 5K0XA 2WGJA 3MWUA 4FKTA 5EW8A 3P7CA 4JLCA 3TIZA 2DYLA 4ABNA 1BX6A 2WMBA 4RLLA 2GS6A 2VGYA 4L9IA 3KRLA 4E4LA 1REKA 3VJOA 5KBRA 4X6QC 4HGLA 3VRYA 4BZDA 3OEZA 2Z7QA 1G5SA 3GFWA 2WQBA 3I0QA 5E8VA 3HGKA 2A0CX 3MEKA 2JD5A 3WIKA 4UWCA 2JBPA 4QMMA 5LCJA 3R73A 4R3RA 5KHXA 3BIZA 4O7SA 2JLBA 1PMEA 4HOKA 4TXCA 1VYZA 2J6MA 3L9NA 4X6RA 3RPYA 4ITHA 2P4IA 3NYXA 4LQMA 4USFA 4D28A 4ONAA 4FSNA 3DJ6A 3F7ZA 3FLZA 4FSQA 4EOMA 2WELA 2V7OA 4FTCA 3GCVA 3S2PA 2VO3A 4NEUA 4NTTA 2UW4A 3AD5A 3CJGA 5AP6A 3R9NA 5IISA 3N4VA 3C50A 4AA4A 3AC5A 4R5YA 5HHWA 3KRXA 4PMTA 2HZNA 4XI9A 1EH4A 5EI2A 4C57A 4QTEA 1ZYCA 5GINE 4MAOA 1B6CB 2GHGA 2HZ0A 4GVJA 3UZPA 4DEHA 3R9OA 2O2UA 3OOMA 5LVLA 4KKGA 5DA3A 5GZ9A 4U5JA 4EHEA 3VBWA 2ZB1A 5CX9A 3PVGA 2QLUA 3QQUA 4CTBA 5CXZA 4WRSA 4YJUA 2UW3A 5JJTA 4R8QA 5AV3A 3FY0A 3O17A 4HZRA 3LJ2A 4FV8A 4C3FA 4UI9C 3VW8A 1YKRA 2GTMA 3ZH8A 5EFQA 3OXZA 3W55A 2CKQA 1YI4A 3G5DA 4G23A 3E62A 5FDXA 4GJ3A 4L68A 3UTOA 1OL5A 4F0FA 4LOOA 3OXIA 2XZSA 4PQNA 4JNWA 3JVRA 4IC8A 4AY6A 5HNGA 2XCKA 4L7SA 2ITOA 1X8BA 2OZAA 4ZXTA 4B7TA 5JJ6A 5E4HA 5C27A 3IPHA 5IEVA 3C4CA 5KKRB 3G6HA 1HH8A 2J0LA 3GUBA 5JQ8A 4RG9A 4FVRA 4DH1A 4FIHA 1YOJA 3UMXA 3OF0A 3DPKA 3E8EA 1E9HA 4XV9A 2PZIA 3F7WA 1SNXA 3UNZA 1ZWSA 3F3TA 3D0EA 4LUDA 3V3VA 3WZUA 1OKWA 2E9VA 4FIFA 4A07A 5IA4A 3IKAA 2X39A 3U54A 1PMVA 3UVPA 4O0YA 4FIIA 2UY1A 4APCA 3ZFYA 4N4SA 4RX5A 5JK3A 2FGIA 1CDKA 2QODA 4UMTA 3LFCA 4YJPA 3LY7A 2P0CA 4IDVA 5HNBA 1OKYA 4NCTA 5AR4A 2KC7A 2CGXA 3EQPA 4JJRA 3CIKA 4CZUA 5IEYA 5IUHA 4R78A 1K2PA 2IVSA 3PXKA 4L3PA 2QO9A 2YIYA 4EYJA 3MBLA 3NNVA 1WBOA 2O63A 4RA5A 3MFUA 3PJCA 4D55A 3NNXA 3BHVA 5CVFA 2VNWA 2BTRA 3B8RA 2UZBA 4QYGA 2R3LA 5KO1A 3NUSA 2RKUA 4JRNA 3Q60A 4OTPA 3RAHA 3TJDA 5CANA 4M67A 4YBKA 4O83A 2C6LA 3BQCA 3G51A 2LSVA 5AAGA 3QKMA 2Q7FA 4HORA 3UP7A 4ACMA 2OU7A 4LRMA 5IQDA 3QWPA 3SG9A 3CPCA 2WMUA 4O1PA 2BRBA 4DEBA 4GEOA 4CMUA 3OXFA 4AN9A 3SF4A 4WUAA 5JH6A 5BYZA 3DFCB 4ME2A 4GFOA 3HX4A 3O71A 4FTKA 4YJOA 5AP0A 2UWJG 3Q47B 2ITNA 3ZZWA 4IE9A 2QG5A 2Y8OA 4BYJA 4CFMA 3REPA 1OGUA 2ZVAA 4QP3A 3EKKA 4U45A 2R3FA 3RAWA 4GT3A 2NRUA 3KCKA 3DK3A 1UV5A 4YBJA 4XV2A 4JDJA 1DM2A 5JKGA 2BZJA 3TV7A 2XPIA 3G0EA 3UC3A 3R6XA 2VTSA 3UIXA 2C5YA 3FLQA 4DTKA 3FKLA 4OLIA 5JGBA 1H25A 3BYOA 5L2QA 2XNMA 2JBOA 3CP9A 2GS2A 4IIRA 4K77A 5ARFA 3BGQA 1F5QA 4BCFA 1U54B 4G1TA 3MS9A 3ZYAA 3PXZA 1OM1A 5BMMA 2G15A 4FYOA 5BVNA 3ZEPA 3K9IA 3URZA 1URWA 2WMAA 2CGVA 3QZHA 4FKPA 3N4UA 4FIJA 3NVKI 3MIAA 4KA3A 1ZY5A 4GCNA 5HQ8A 3BV2A 3O50A 4D5HA 3TCPA 3SKCA 4I6BA 4QTCA 2GMXA 3N4TA 4CFVA 3AMBA 3OMVA 4I0RA 5DT4A 3WZJA 4XOYA 5JGDA 3DAEA 3HUCA 4IAIA 5DBXA 2XIRA 3AXWA 4C02A 3BWFA 3MFSA 1M17A 4QP1A 5J79A 3OUKA 3MTLA 4O27B 4G3FA 4OTFA 3UC4A 1AQ1A 4FSTA 5IH5A 4AZSA 2HXQA 5M08A 4BTFA 4MXOA 3W16A 3MESA 5EM5A 4K2RA 4YUQA 4QMLA 3EB0A 5AV4A 4GK4A 4GZ3A 2ESMA 2QOOA 2ZDTA 2PUUA 2W9FB 2BIYA 1Q5KA 4FT0A 2HOGA 2IWIA 5ANEA 2UZDA 3QCQA 4PP7A 4DTAA 4M84A 1MUOA 2B52A 2SRCA 2X4FA 3BPRA 3UVQA 3CXWA 4H7XA 4NJ3A 3BEEA 4H05A 5LVMA 4O86A 3IO7A 4PDOA 4ZOGA 3OT3A 3WBLA 4CT1A 5JSMA 3RIBA 1CMKE 4E26A 5ICPA 3ELJA 3NW6A 2VGXA 4N3AA 3O8TA 3ZC6A 2VN9A 4JRVA 3L8VA 2QCSA 4EWHA 5LQFA 4KS7A 3ASGA 4DFUA 3EZVA 3SRVA 2JIUA 4J98A 3ZHPC 4YURA 4AOJA 4GKIA 1WAO1 2FSTX 5HX8A 4FYNA 4QMNA 4A9UA 2UY1B 3HA6A 4O0SA 3OTUA 1FBNA 4Q2AA 3OCTA 2H6DA 4FTLA 4FV7A 4G6NA 4J8DA 1Q3WA 2JFMA 2PL0A 4FVQA 4K1BA 4R7HA 2XK7A 4Y72A 4LV8A 1OPJA 4LGHA 4NM0A 5HE1A 2ERKA 4BRXA 5HBJA 3CK7A 4NSTA 1TVOA 2CJMA 2XRUA 5IQGA 3RAKA 5HIEA 5EHLA 4IVDA 3CVPA 3DAKA 4KBQA 4EWQA 2PY3A 1PXOA 2X81A 4WBBB 4KNBA 3W1FA 3OROA 3PE4A 4IH8A 4RFZA 2GNGA 3QC4A 2JDVA 3VO3A 4YHTA 3HDMA 3LM5A 4QD6A 3F5UA 4JBQA 3DT1A 4G3GA 1Q62A 3UIBA 3ZO1A 4EHVA 2CCIA 2X2MA 3FKNA 3GQIA 4OTRA 3V5TA 4NZWB 2VWUA 3QTRA 3HVCA 4NK9A 4AF3A 3TGOA 3PVWA 4JG8A 4XG6A 3LPBA 5DR2A 3A7JA 2R3MA 1E1VA 2YITA 4V05A 4F0GA 1KLXA 4JDHA 2W05A 4G25A 4O2ZA 3CD8A 4ZSAA 4BTAA 4DT8A 2LGCA 3QKYA 3QD4A 4ALVA 2XNPA 3L9LA 4HYHA 4FG7A 4KBCA 1J3HA 4ZSGA 4BCQA 4BDKA 4FR4A 4D0WA 1NY3A 2BDFA 2W9ZB 4KS8A 2WD1A 3I6UA 2G1TA 3MPTA 3LYAA 3EQIA 4ANBA 4BBMA 4EK8A 2BRNA 5CXHA 1YHVA 3QGWA 2GS7A 4Y95A 3OVVA 3DTCA 2ZOQA 5IQAA 4IB3A 3ZM9A 3MFRA 4PL5A 3S7DA 5C8NA 2QOFA 3ZDIA 4UI9J 2RG6A 2B1PA 4F7JA 1OIYA 2QI8A 1IA9A 3I81A 1BUHA 4KB8A 4XG2A 5EM8A 1IRKA 2IW8A 4O96A 1XH6A 2EU9A 2XH5A 3RK7A 3WF5A 4B94A 3LQ3A 5BQ0A 4QNAA 2YM3A 1SMHA 1ATPE 3LAUA 2I0HA 3E8NA 5GHVA 3KXGA 1KSWA 2UZTA 4F7SA 4U6RA 5JZNA 3EWHA 3QXPA 2C5VA 5ACBC 4A9SA 4GFGA 1ZYJA 3S00A 4FTOA 3EZRA 5AR8A 4E5AX 4FIGA 3Q4ZA 2XM8A 4FEQA 5HG8A 5KE0A 3U9CA 5DYJA 3TZMA 1FPUA 5C8MA 4ALUA 3MB7A 1H08A 3BELA 5CS6A 4UEUA 3LCDA 4C35A 4U0UA 2J51A 3ORMA 4PPAA 5FP6A 2WQMA 1U54A 3RBWA 1L3RE 5T3QA 4O0WA 2G2IA 3R30A 4X21A 2F9GA 3JR1A 1VZOA 4AW1A 4DH7A 3UPZA 5K5XA 2XGOA 5HD7A 3V04A 4CKIA 1SVGA 4YHFA 5AFVA 3EN9A 3HRBA 4PF4A 3HMPA 4TWOA 4QP9A 4DEEA 5AIKA 4RWLA 4ORKA 4BDHA 2UW5A 4QMWA 1Q8ZA 4Q9ZA 4X7QA 4EL9A 4CLIA 2JGZA 2YLFA 4IAZA 1ZYDA 2HZ4A 2XBAA 2YDIA 2W17A 5H8EA 3ZFXA 5FZQA 3IW5A 1GZNA 2X2KA 4TT7A 3G33A 2W1EA 3Q53A 4XP0A 3GBZA 4I24A 5DLSA 5LMAA 3RKBA 4CFNA 5M53A 3GCPA 4LOPA 2R3KA 3D7TB 1KWPA 2VNYA 3PZHA 4QPSA 2VTOA 1G8AA 4RVMA 4YJVA 3Q3BA 3LHJA 3C0HA 2DQ7X 5JFSA 3KB7A 2KCKA 1ZMUA 1WBNA 2OG8A 3PE1A 1UU9A 4LRKA 4CCBA 5HNIX 4IDTA 2F2UA 2ZV9A 4JR3A 3TIYA 3QUPA 3VBYA 3AT2A 3ID6C 2H96A 4GT5A 3Q32A 4K6ZA 3R28A 3R8PA 4B6LA 1OUYA 4QYYA 5A4TA 3A7IA 3Q4CA 4PDPA 4RJ5A 2W96B 3N9XA 3EQBA 4NFNA 2XYNA 4N39A 3I6WA 2UZEA 5CAOA 4HCTA 3FMMA 4D4RA 4FV5A 4GH2A 4E8AA 1M52A 3FFLA 3R9HA 3POZA 3ULZA 2GQSA 3UQFA 4FNWA 2F4JA 5ETCA 4EK3A 4KSPA 3VTYA 1ZXEA 1BI7A 2R5SA 3UYTA 2IF4A 3HV3A 3EYGA 2RFSA 4IAYA 4UB7A 4YNDA 3ASHA 4HOQA 2I0VA 4O7ZA 4J8FA 3U55A 3OW4A 5HU9A 3UO5A 5FZSA 3O48A 5EM6A 4WIHA 1OPLA 3P79A 4TYGA 5JGAA 2XCBA 3SXSA 2UV2A 4IEBA 1WBWA 4GV1A 5HTBA 4R3CA 5JEBA 4RWIA 2E2BA 4BI1A 1QZ2A 4GA0A 5BUEA 2WMQA 2X0GA 3KMUA 3UBDA 3MJ1A 3QHRA 1JQHA 3U8WA 4HVIA 3AS4A 1XH8A 3DOGA 3GCQA 4W4WA 5EDPA 3ZHEA 3EHAA 2BALA 2BPMA 3GOPA 5KJLA 4OTWA 4ZLZA 4BY9E 1P4OA 4PRJA 4JA9A 3CPBA 2XYUA 4AA5A 4BGQA 4GIIA 3VS5A 3UOLA 2Z2WA 3A4PA 5KNJA 1TJCA 4FL1A 1Q8YA 2CN5A 5KHWA 5M4UA 4IANA 5D7VA 2OSCA 2Y7JA 4QMTA 4XG7A 3DU8A 2F2CB 4I21A 5E8UA 5L6WL 2VWIA 4HJOA 5EYKA 5KKRC 4K0YA 3MH2A 3ORPA 4YP8A 3LFSA 2BRGA 3C4XA 3GCUA 4WO5A 3R7OA 2J4ZA 5IF1A 1PY5A 2VWWA 4IWQA 3UJGA 5EDQA 4IFCA 2FA2A 2ITQA 5DEWA 4ACCA 1OBGA 1PXLA 1AD5A 2BCJA 5FDPA 5I0BA 4IW0A 2NO3A 3VUHA 1YQJA 5JQ5A 3H30A 5CSPA 4U0ZA 4KIOA 2J0JA 2IZTA 4IC7A 4OTIA 3QZFA 4D2VA 4FNXA 5CNNA 4EK6A 4KSQA 4XG8A 2C0TA 4RJ3A 4IQ6A 3H4JA 5AV0A 3NYOA 4FTJA 2VWVA 2UVYA 4RGJA 2PVHA 1GNGA 3DB6A 4U44A 3CE3A 4EOPA 3VBTA 1ZZ2A 4JI9A 3D2KA 1KE9A 3EN6A 5KZ0A 2YIWA 4X2NA 1V1KA 3F3UA 3FC2A 4Y6WA 4EH3A 4JG6A 4DYMA 3UYSA 4ZS0A 4AZWA 4O1OA 4QP7A 4ZS4A 1GOLA 3EQCA 4RQKA 2YCQA 4I5MA 2P2HA 4GPKA 2VTIA 3ZLWA 4PNIA 5EI8A 3JYSA 4ANMA 4O0RA 1IAJA 3VUGA 3SW7A 4KIPA 2JIVA 5IEXA 5CZHA 3VS4A 4XJ0A 1J7LA 1RW8A 4M69A 1U4DA 4S33A 2BMCA 2R0UA 2VZ6A 4GIHA 4JDIA 5CF8A 5CU0A 2C6TA 3D9VA 3CLYA 2A2AA 4FZ6A 3LFBA 2PMIA 3HMMA 4GVAA 3RALA 3HEGA 5HOAA 4FV3A 4JQ7A 4ENYA 4FEXA 1NXKA 4C34A 2GSFA 2O0UA 5D10A 2IO6A 3AMYA 4IJPA 1BL7A 2R0IA 1IASA 3ZXZA 1U59A 4MXCA 5J5SA 1JLUE 4BKYA 4C4HA 1B89A 1KV2A 4APPA 3MTFA 5CAVA 2YABA 3Q4TA 4LV5A 5HE3A 4CMOA 2ERZE 3DDQA 2REIA 1XBBA 3Q4UA 3QALE 3R2BA 5CU2A 2PHKA 3PA5A 4CZYB 4EH9A 3K3JA 1XH9A 3D7TA 2I0YA 2WTDA 4IM2A 4PNKA 3H10A 2CHLA 3IW4A 3GC9A 5TT7A 5IQHA 2J2IB 3ORNA 4I5HA 1GIHA 4AIFA 2O65A 1KE5A 2R3JA 2ZMDA 3EQDA 3I5ZA 2H34A 3BBTB 3QCXA 3KKVA 4N70A 4EK5A 4YPDA 4FK3A 4YVOA 3ZUVA 4EOIA 4QNYA 3AOXA 1Z57A 3EIDA 1YXSA 2J5FA 3NUPA 2WEIA 4FL3A 4OTHA 2GHLA 3FSFA 3QWKA 5H8BA 4BCOA 5BVOA 5CVGA 1NA0A 3MY1A 4JIAA 5J7HA 5EQYA 5KJNA 5KMLA 4CQEA 3PIXA 3JXWA 4I4EA 1NVQA 3FMJA 3JPVA 4FODA 3AGMA 3IW6A 5EKNA 4LUEA 4U0IA 3O23A 3GFEA 1J7IA 3NPCA 1OL7A 3QTUA 4FI1A 4K33A 4H7YA 4H58A 3R01A 5TOZA 4RSSA 2QKWB 4S30A 3FMLA 5FBNC 4P7EA 2DWBA 3CS9A 4RIOA 3Q6WA 5C4LA 3C5UA 3CKWA 3T8OA 3A61A 4MK0A 5K3YA 4CKRA 5BPYA 2FSOX 4Y5HA 4EYMA 2B54A 4O22A 2VWXA 2XEYA 5CALA 2X7FA 2VTQA 4L01A 4BCMA 1UKIA 2HCKA 3KD7A 4GU9A 5FTOA 4KYOB 4TTHB 4U3ZA 1OKVA 3QTQA 4JT3A 4NIFB 4XH6A 2GU8A 2W4KA 3D14A 5DI1A 5ANIA 3RPSA 1M2RA 3SV0A 4CXAA 3TG1A 3T3VA 2QOQA 4G5PA 2W1CA 4J71A 4AS0A 5DT3A 3ZGQA 3F5GA 1H4LA 4JXFA 4D5KA 3QQJA 2QHMA 4JBVA 4EOKA 4Y85A 3OOGA 4AG8A 4HCUA 3R8ZA 3UUXA 4PWNA 2NRYA 4Q9SA 1SNUA 4QMOA 4GMYA 2WFYA 3KXXA 2HY0A 2YZAA 3DK6A 2R3RA 4G5JA 3O51A 4L45A 5DRBA 4CCUA 3QOUA 4RIXB 2XA4A 5BVKA 5CF4A 4NKSA 4RLKA 4V01A 4JX7A 2PSQA 4J8NA 3SD0A 3QYWA 4DLJA 3TZ9A 5CU3A 4U8ZA 2BILB 4J8MA 3V6RA 1OVEA 2PMOX 3PY3A 4QRCA 4B4LA 4FSUA 4BTBA 1GIIA 4G24A 1H27A 1R1WA 3DBQA 3P4KA 2P3GX 1WZYA 4GW8A 2DBAA 4FEWA 4JX3A 4RIXA 3C0IA 3D5WA 3ZSGA 4Q5EA 4HVDA 1J1CA 5IA0A 4F9AA 4IXPA 2BZHB 2WNTA 3FBVA 4UZDA 4I0TA 1TKIA 4AOTA 1H24A 5LCWC 5BVFA 3DZOA 3IG7A 4MWIA 2WMTA 3MY0A 4FSRA 4O38A 3R7YA 2W5AA 5HIBA 3R7EA 5A4LA 3KGAA 1I09A 1Y6AA 4FKJA 3BHHA 4DBNA 1GJOA 5KCVA 4RJ8A 3U9NA 3QL8A 2OK1A 4F9BA 3BI6A 2HZIA 4EEVA 4JL0A 5BT1A 1H28A 4D4YA 3LOKA 4HYUA 4XS2A 5AR7A 3ZDUA 2OLCA 1DS5A 1YXTA 4PUZA 4FEUA 4O0TA 4ANOA 4MH7A 4O7WA 1IA8A 3AC1A 3QTIA 3OG7A 5AUYA 3VHEA 3CCNA 3KMMA 4ANSA 4BGGA 3PP1A 3K3IA 3KS2A 4FV4A 4FKQA 3C4ZA 1UNGA 2X6EA 2LNIA 1M7QA 2PTKA 3RWPA 5ANGA 2E9OA 4O7TA 4U81A 2BR1A 4TL0A 4M8TA 2J9MA 2ONLC 3LFDA 3FMEA 3UOKA 5CAUA 4F1MA 4XLIA 2XKFA 3F69A 4UBAA 5CTPA 4IX6A 4J97A 4E4XA 4RX7A 3AT3A 4FOCA 3FP3A 4MEDA 4EOSA 4JG7A 2IZRA 2GQRA 4QP6A 5AIRA 3VS0A 4C4IA 3RO2A 5A46A 3UMWA 4CLJA 5CCLA 4G6OA 4E6CA 3O7LB 1REJA 2XCHA 4II5A 2RIOA 3P5KA 3HLLA 3C5IA 2BVAA 1XH7A 2I1MA 4YMJA 5BVDA 3ZFWA 1RE8A 4ZJJA 4ANLA 4BZOA 1CTPE 4UXLA 3Q04A 4QT1A 4UXQA 3CTJA 3OBJA 3R8MA 2Z02A 1OZ1A 3ANRA 4DGLC 4C59A 4E1ZA 3JUHA 3EKNA 4XUFA 1STCE 4I6QA 4K11A 4U04A 5FEEA 4X2KA 4C36A 4M66A 4TWNA 2IZUA 4TYHB 2R2PA 4AM9A 4TWCA 4MD9E 3CQEA 3P23A 2Y4IB 2X8EA 5HZNA 4TZRA 4AZFA 4ZZNA 2FUMA 4YTCA 3E3BX 2GW1A 5AUXA 2QLQA 4FV1A 3FUPA 3UQCA 5FT9A 2PE0A 4EJ7A 4C3RA 3OWJA 2VX0A 5EDRA 3S7FA 3ZCLA 3P78A 3DLZA 4ACDA 4BVUA 3KVWA 3P7BA 4OGRA 4RA4A 4ZTHA 4EQFA 2WIHA 3TL8A 1A48A 4ID7A 4GYWA 3CD3A 4NL0A 4A9TA 1UNLA 2WTKC 3COHA 5EYCA 4D58A 2CDZA 3AD6A 4H1MA 1OPKA 4E73A 3QFVA 4MBLA 2AVPA 3ZRKA 4GJ2A 1R39A 4DGGA 4DINA 5TKDA 3MA5A 4BWPA 3MSSA 5FG8A 4XIFA 4DE4A 2IVVA 2QOIA 2QFCA 2EWAA 3NUUA 3PRFA 4OBOA 4WSYA 4AOIA 1PC2A 3LMHA 3FWQA 3OCGA 3QTWA 2JC6A 3EN5A 3I79A 3Q52A 2GNLA 2UW0A 3D7ZA 2XJ0A 3VIDA 2I0EA 3R7VA 3WF7A 5EI6A 1T46A 3FZTA 3OP5A 4G3DA 4CT2A 4DEAA 1J7UA 4YJSA 3W32A 3QU0A 2QQ7A 4AZVA 5BUIA 3ACJA 3OWPA 4JAIA 4AXAA 3D4QA 4AACA 4F7NA 5A7DB 3DJ5A 4XV1A 3TKHA 4L3JA 3R9RA 4HOSA 2XJ2A 4UALA 4MVFA 3CKBA 3RKVA 3POOA 4CEGA 5IQEA 4RFYA 4G34A 1LPUA 2E9UA 3M1SA 4L43A 5CSHA 5LWMA 3QRIA 5HEZA 5CT0A 4BDJA 3TKUA 3LVPA 5M51A 4Z7HA 2VTMA 3RHXA 3OD6X 4IZYA 4W9XA 5LVNA 3LZBA 3FI8A 1H8FA 2Z8CA 2WKMA 2BHEA 3FLSA 5AV1A 3VTXA 3ZUTA 5L8KA 1APME 1BYGA 4FZAB 2PPQA 5DEYA 3KXMA 4BTMA 5M72A 2OZOA 2KTYA 3AC3A 5G6VA 2QR8A 2QU5A 3L1SA 3OY1A 5F94A 5FM3A 3U3WA 2LSUA 4GG7A 1Y8MA 5CEPA 3D5UA 4FSWA 3R00A 3HYMB 5EOLA 3OUNB 3IGGA 5GZ8A 2YQ8A 3TG5A 4F4PA 5L2SA 2FYSA 4C4GA 5M4CA 2ITYA 2XIKA 4UMPA 3H9OA 4DFYA 1NW1A 1P5EA 1PMNA 3DK7A 2ONDA 5JFXA 1OIQA 1ZMVA 1YXUA 3OY3A 5CT7A 3CK8A 4YJTA 3PXRA 4EOOA 4X2FA 2W1GA 3UVRA 4CTCA 2OIDA 2QC6A 1FOTA 5EYDA 2PVLA 3IECA 4BDAA 3UZTA 4BHNA 2J90A 4QMXA 4XP2A 4WUNA 4W9RA 5A4EA 3P08A 3W2SA 4BCJA 4YTIA 5AM7A 1PXKA 2WQOA 1YRPA 5EM7A 4BCKA 5L2WA 2C1BA 4CNHA 4YTFA 4U41A 4C7TA 3QWVA 3UO6A 4FTMA 2OJGA 4TN6A 4ASDA 4UWYA 1UU7A 3H0YA 2X7OA 2C0OA 3FLWA 4J96A 2VGOA 5HI2A 4I92A 3OHTA 4BCNA 3GCSA 2VQ2A 2VO6A 3TACA 1OL6A 3DQWA 5ARGA 4LRJA 1WAKA 4M15A 4UZHA 5ACKA 1YI3A 3TNPC 3I7CA 4YZCA 1UWJA 2OF4A 4LL5A 4DG2E 3R02A 5KBQA 1GY3A 2X7GA 1XWSA 4AW2A 4OTQA 2YDKA 4FOBA 3ETAA 2CCHA 3VS6A 3EL8A 3RHKA 3G2FA 5L4QA 3ORIA 5HKMA 2HENA 3SXFA 1M2PA 4FGBA 3ALOA 5DPVA 4ASXA 2VSNA 2X6DA 3FQSA 1BL6A 4PDYA 2XCCA 4PTEA 3NYVA 1ZU2A 3FQHA 4R77A 4AN2A 1MRUA 3RPVA 4TKSA 4ZZOA 4R5SA 1HCKA 4ASZA 2R7BA 2FI7A 2YM8A 2OZAB 1ND4A 1H00A 4YSJA 3LCSA 4I2WA 3E88A 3MV3B 5DRDA 3H9FA 3DDPA 3W2RA 4BFMA 5D1JA 3GB2A 3MN3A 4IACA 4EQCA 4HW7A 4N5CA 3MKRA 5LCWJ 2ZM4A 2B9FA 5HIDA 4MKCA 4RZVA 2ITUA 4F7LA 4LGGA 2OJIA 2VUWA 1W84A 4PX6A 5E1SA 5TF9A 3VQHA 1RQQA 5KMIA 4DEGA 3OFMA 5HVYA 4ZTMA 4BC6A 2FVDA 1YWRA 1FQ1B 1WBPA 5J7BA 2A27A 4OAUC 3UQ3A 4KRDA 4F6SA 3W2PA 1W83A 2HW7A 1XBAA 2P2IA 4IWDA 3P1AA 2R5TA 3DGKA 3PRIA 5A4CA 1E96B 1NZNA 3U6HA 5J9LA 2OF2A 1TQIA 3HMOA 5G04J 4A9YA 4XRJA 3TNQB 4YGAA 2GHMA 4OT6A 2XK6A 2CGUA 4ITIA 3EQGA 5DR9A 1UVRA 3ULIA 3ET7A 4APOA 5JZJA 4QMQA 3QUEA 1M2QA 4EBVA 3Q5MA 4FX3A 3QWJA 4E6DA 2PUNA 4C8BA 2UVZA 3UOHA 4MF0A 5BUJA 4JAJA 3OCBA 5E7RA 1Y8YA 3MVLA 1ZOEA 3O0GA 2YLEA 3IW7A 2XK9A 2XNNA 4A4OA 2PU8A 2B9JA 5IQIA 4FTIA 3E4BA 5IA5A 3VS2A 3Q5IA 4Y46A 2C68A 4L3LA 3U4UA 2I6HA 2NPQA 3ORKA 5I4NA 3PDNA 3DXPA 3UPXA 4KBAA 4IWPA 4FKVA 4FC0A 2CPKE 2FBNA 5HD4A 3CTHA 2EB3A 4YVQC 3THBA 2CSNA 1CSNA 4QMZA 5CSXA 2QHNA 3NNWA 3MA3A 4PY1A 4D2WA 3BYSA 5FQDC 2JAMA 5AX3A 3AD4A 2CN8A 5AA9A 5D11A 4QQ5A 5CSWA 1UU3A 4M14A 2JLDA 4M0ZA 3TUBA 3PVUA 4KKEA 1OECA 3R1NA 1J1BA 1ERKA 1YW2A 1S9IA 5EYMA 3WZDA 1SVHA 2V22A 3KFAA 4X3FB 5EK7A 4LYNA 1Y6BA 5J1WA 2QOKA 3OXTA 1KT1A 3EFKA 4PPCA 5HO7A 4O82A 3TI1A 4DG0E 3PP0A 1A9UA 4CG8A 2VWYA 4A4LA 4BBEA 2YWVA 4XCUA 5FXSA 4UX9A 1KUTA 4TYIA 3Q9XA 2VSYA 4AY5A 5AP3A 3VUDA 5H9BA 2O8YA 4O0UA 4CFFA 3ZS5A 2YCFA 3RO3A 5HICA 4AP7A 1H1SA 3ZC5A 5FLFA 3GVUA 3E8DA 1ZLTA 4L53A 5BNJA 5IH4A 3CK9A 4YO4A 3PLAE 2OOEA 3QLFA 1H26A 3BE9A 2OFUA 3GYZA 3GU8A 3VWAA 4XYFA 2XS0A 3WILA 5LVPA 3WOWA 3TG4A 4UQZA 3QLGA 2UW6A 2XNGA 3COMA 1OIRA 3R63A 3KU2A 3VBQA 3OXGA 4I22A 5GIOE 4ZSJA 2WPAA 3NIEA 4Y8DA 2ZV2A 3A60A 3DKCA 1L8TA 2WAJA 3R22A 1Q41A 3RPOA 4E20A 2FSMX 1SZMA 1PMUA 2UZNA 3K2LA 3KEXA 4O0XA 4U3YA 4ZTQA 4C2VA 2HWOA 4FNZA 2YEXA 1ZMWA 3DBFA 3FI4A 4FT7A 3W33A 4GYYA 3B2TA 4DH8A 2JDSA 5DOSA 4PL4A 5L2IA 2BUGA 3R21A 3PY1A 2VTPA 3F9NA 1PHKA 3GI3A 3HMNA 4CQGA 5DBKA 5EW9A 4YJNA 2C3JA 2W1IA 4RC4A 5FWKK 3FY2A 2XNBA 3KAEA 4GZ5A 3O8PA 5CEQA 3S7JA 3VUKA 2WQNA 1H1RA 2FO0A 2YM6A 3R71A 2RGPA 3V8WA 4O6FA 3TNHA 5GJFA 3QCYA 1YWNA 2C5NA 3FI3A 1ZBPA 3R9DA 5E1EA 2OBJA 1OI9A 2WTJA 4UYNA 3RZBA 4U9AA 5M56A 4O81A 4DF3A 2ZYBA 4W4XA 2H9VA 5ETIA 1Q8TA 4UMUA 3PWDA 4LL0A 3MY5A 3NAYA 2GCDA 4I23A 4YO6A 4CRSA 3LPZA 5IUGA 4RJ6A 2BDJA 4DN5A 5M06A 4DH3A 2C0LA 2BZIB 1TQPA 4X3FC 4QMUA 5H3QA 3D94A 2KCVA 5B0XA 2GNHA 3F82A 5F1ZA 2RFDA 2OJ9A 2PMLX 4OW8A 3RCDA 3O2MA 3TDVA 1H1PA 1MRVA 1S9JA 3P86A 1DI9A 3VRZA 2P55A 4M97A 1O6LA 1JKSA 2W0JA 4FKOA 2X9FA 2VTHA 3Q9WA 3EFJA 4U7ZA 3VHKA 4BB4A 5J9ZA 3FHRA 3OT8A 4QTBA 4O7YA 5AM6A 3BYMA 4K18A 5ANJA 2UW8A 3PSDA 4L52A 1GAGA 3F61A 3GNIB 2O64A 4BT9A 2A4LA 3DB8A 4JL9A 2C1AA 3NNUA 4RG0A 5C9CA 5E8ZA 3R04A 3QC9A 2Y4TA 4FSYA 4Z7GA 5F20A 3EMGA 3ZRMA 3NUNA 5AUTA 2OI4X 1UU8A 1ELWA 1ZY4A 3UG1A 5JFVA 3NUAA 1AGWA 4ZSEA 1O9UA 2ETKA 2E9NA 3HNGA 3HUBA 3WYYA 1UKHA 4TW9A 2NP8A 2O5KA 4O7LA 2R3PA 1R0PA 4GSBA 3PJ8A 2W1DA 3ZBXA 1PXNA 2C6DA 2AUHA 3KCFA 4RX9A 3UP2A 3CBLA 3ZEWA 2FH9A 5FBOA 2V5QA 5M09A 4WA9A 2XJ1A 3ZO4A 4CMTA 3GENA 3TT0A 4AFJA 3PPKA 3QA8A 4E7WA 4C3PA 4QO9A 4RVKA 3H0ZA 4DGOA 3SVVA 2BFXA 4PMMA 3A62A 1VR2A 4QMYA 2WB8A 4ZTLA 5FD2A 4AA0A 4RIYB 4XEYA 4DGMA 3FL4A 3ALNA 3M42A 4BI2A 1W98A 4IB1A 4BTJA 5B2LA 2HK5A 4G9RA 5HO8A 5KMNA 3K54A 4P5ZA 4EUTA 3IW8A 4FKLA 3GP0A 2QD9A 3ERKA 4MF1A 4G1WA 4QYHA 3E7VA 1WMKA 3FZOA 2CLQA 1GZKA 2XF0A 4ZY6A 3V8SA 3MB6A 4C0TA 3HV6A 3GQLA 3NVMB 4RIYA 2B4SB 4LMNA 4CFXA 4U97A 4WNEA 3DXNA 4E5BA 3CR0A 2R4BA 1JSVA 4L42A 3W18A 4G3EA 4F08A 3IDBA 3NCGA 4UI9K 5FJYA 3VF9A 3D2IA 3WF6A 5M57A 4YC6A 3FDNA 5EHYA 5BYYA 3EDTB 5A3XA 3DNEA 3LLTA 2RF9A 2WTVA 3VBXA 2PYWA 3QQHA 3R7UA 3P9JA 3ITZA 3BLQA 3PA3A 4IMYA 4XBRA 2J0KA 2VTTA 2EUFB 4EORA 3MI9A 3KN6A 1OUKA 4KIKB 3S95A 3QRKA 3ZXTA 3S0OA 3RU0A 2YZLA 2CKPA 4GUBA 2ZV7A 4GKHA 1PXMA 5BYLA 4F63A 1A06A 4H39A 2HELA 2NNWB 2YHVA 1M7NA 2X4ZA 3I4BA 5AP4A 5CSVA 3QD3A 1M14A 3V6SA 3VS1A 2PVRA 2Y9QA 1IHGA 2VWZA 3IQ7A 5AUZA 1DAYA 2C0IA 1H01A 3DLSA 1WVXA 3BEAA 2OGVA 2C30A 3AG9A 4D1ZA 4L8MA 2WU6A 3W10A 2CKEA 3EQHA 3GU6A 4NM7A 5J87A 3IOPA 4ALWA 3GT8A 3PYYA 5G05J 1CM8A 3OCSA 2F7EE 3F5PA 4FZDB 4LEUA 2VX1A 3LFNA 3PY0A 3QTXA 4FKSA 1WFCA 2RSVA 2BTSA 3Q9ZA 4ZTRA 1HZ4A 4J1RA 2YFXA 1NA7A 2WMWA 3CGOA 3H9RA 2ITWA 1IR3A 2GNJA 3FZSA 5D12A 1ELRA 3DZQA 4XNEA 3F3ZA 1GZ8A 4ZJIA 3A2CA 5HG7A 4AE6A 5ANKA 1JAMA 2QR7A 4BYIA 3FV8A 5BNWA 5FZRA 2PVFA 3KXZA 4FF8A 5A9UA 4W4VA 2ZAZA 4FBXA 4B8LA 4BF2A 3Q2MA 3G90X 4ERKA 5C4KA 4YR8A 4O91A 4O6EA 4XX9A 3BHUA 3DKFA 4Y5QA 1OB3A 1JKKA 4FV0A 3M2WA 4L44A 1CKPA 1H1WA 4DFLA 3OBGA 5LMKA 3KK8A 1A17A 2VTNA 3OWLA 5EW3A 5IDPA 3NS9A 4JA7A 3RP9A 4AT4A 5GIPE 4A1SA 2VTLA 5C01A 3V01A 3BE2A 2VGPA 5KJMA 2Z7SA 5IMXA 4EZ3A 4BWKA 1PRYA 3MVJA 2OH4A 5L8LA 4HPTE 4NWMA 4IZ5A 3VAPA 3QBNA 2QURA 5C26A 2J7TA 5AR5A 5LCKA 4N2QA 5EQPA 2RFNA 2VU3A 3ZLXA 4FIEA 1QCFA 2PE2A 2ZMCA 3EOCA 3LE6A 4FNYA 2J5EA 4R3PA 1Q24A 2YAAA 1SM2A 1U5QA 4EZ7A 3KRRA 3LCOA 4IWOA 5CYIA 2OFVA 1OIUA 1HCLA 3L8XA 1ZOGA 3D83A 1XH4A 3HP5A 3LY9A 2HR2A 3LCAA 4ANQA 4O7NA 4WRGA 3BRBA 5L6OA 4S32A 4DG3E 3MVMA 4U40A 4F09A 3TUDA 5E9EA 2L6JA 1Q8UA 3MPMA 5CZIA 2WO6A 5EKOA 5IA3A 5LXMA 1KE8A 5HLNA 1VYWA 1YOLA 4W8DA 3CGFA 3CKXA 1WM5A 4WSQA 4BIEA 1JPAA 4IAAA 3MDYA 2VD5A 4HVSA 3JYAA 1URCA 4C33A 2J9QA 4N3CA 2IVTA 1YHWA 3FPMA 3L8SA 1LEZA 2XIXA 2BZKB 3FQEA 3OWKA 3Q6UA 2B0QA 4DTBA 2C5XA 4QQTA 2CNQA 2PUPA 3KREA 3UODA 2QOLA 2Y4IC 3BYVA 4GS6A 5E8SA 5HO6A 3QAME 3RJCA 3P7AA 5G04C 3IDCA 2C5OA 5EKQD 4DA5A 2QONA 3KC3A 5AMNA 4QP8A 3SG8A 3PZEA 3FHIA 2ZB0A 3DBEA 4RG6A 1JSUA 1Z5MA 2CKOA 3G0FA 1ZOHA 2JKMA 4CVAA 2B9HA 2OKRA 3KRWA 4IB5A 3NEWA 2VRXA 4A9RA 4EKKA 3I60A 5CU4A 3A7HA 5DH3A 3R8VA 3T3UA 4ZLYA 3IEGA 4KD1A 4RQVA 4Y6CA 3LFAA 2IW6A 4DBXA 2C6OA 3K5UA 3W8QA 3VS3A 2WOTA 2VWBA 4D2SA 1VJYA 4FV6A 4LGDA 4QMPA 5KMJA 4CGVA 4F64A 2GQGA 1OUVA 4QPAA 2I40A 3HV7A 3U87A 4R7BA 2YM4A 5AJQA 4DGNA 4TNDA 5FXRA 4KXKB 4F1OA 5CASA 2WTIA 5M4IA 3PE3A 4FE2A 4I94A 2BKKA 4IVBA 3PIYA 4NJDA 4FTUA 3DA6A 2ETMA 2WU7A 2XUUA 2QU6A 2OICA 2XMYA 4IVAA 4ZTNA 3LM0A 4WHZA 3HA8A 4GU6A 5I9ZA 3HYHA 3PG1A 4N6ZA 4TNBA 3FL5A 4RPVA 5AX9A 4NW6A 2UVXA 3DFAA 4F9YA 4BDIA 2HIWA 3QWWA 1FINA 2Y4PA 3DV3A 2JEDA 4R6VA 3W2CA 5LMBA 2WMSA 4XBUA 3OS3A 4U42A 1YXVA 1NT2A 5EH0A 5CQUA 2R3IA 5EQEA 3R1SA 1BI8A 4IADA 5CF5A 4NW5A 3CTQA 5L8JA 3ZLYA 4GK2A 4IJ9A 4PMPA 1JKLA 3ZMMA 4DFZE 1XR1A 5BW8C 3LXKA 4WUYA 2JFLA 2XKDA 3AMAA 2V0DA 3SZ7A 3AC8A 3HRCA 2EXCX 3ENMA 3HV5A 4NCTC 2C6EA 4RX8A 1FMKA 5DGZA 3Q2JA 3QHWA 5ANDA 1YOMA 5CCMA 3NAXA 5E8YA 1W3BA 1QPDA 1WCCA 4F70A 5AADA 3DNDA 1KE6A 3AT4A 2UZOA 5E8TA 4D1SA 3CEKA 3QGYA 4FTQA 5K9IA 4C2WA 5C8KA 4Z9LA 4RVLA 4E5WA 4ZY5A 2HY81 1XQZA 1YDTE 5CF6A 2Y0AA 4M0YA 3KXHA 4MBJA 4WNDA 5CNOA 5JRSA 5D0QD 1IYGA 2F7ZE 2XVDA 4QYEA 4TYHA 3CVNA 3ZUUA 3AS8A 3CV0A 3ZO2A 4KRCA 1WBTA 5HE2A 2C6IA 1CKIA 2BAKA 4O2PA 4RWKA 5CAQA 5K5NA 2IVUA 4OUCA 2PZYA 3OEFX 4IM0A 4YC3A 4IAKA 4MTAA 5TO8A 3S3IA 1YDRE 4FV9A 3V8TA 4UN0C 3UOJA 1SYKA 4U0SA 2BAJA 3FJQE 5CEIA 4MQ1A 5A4QA 4UY9A 2PQNA 4YC8A 4FA2A 4CRLA 3IS5A 3HMIA 2JDOA 3KRJA 3VF8A 3ATSA 3TDWA 1Q97A 2I6LA 2G01A 4S34A 3TTJA 2ITXA 4BR3A 5DMZA 5CQWA 3DS6A 3FZRA 5F95A 3R83A 4BKZA 3RK9A 2GNFA 4GFMA 3SDJA 2BUJA 1P5QA 3BU6A 1PW2A 3MH1A 2C0MA 4PP9A 4UYAA 3WF8A 5JN2A 4QQCA 3ZLSA 4I17A 1LEWA 4QP2A 3ZFMA 2OJJA 2BIKB 5HG5A 2PVYA 4DC2A 4EKLA 3F5XA 1PKDA 5I3OA 4B9DA 4E6AA 2JDRA 5G05C 2YCRA 4BDBA 4BCIA 4NM3A 2OIQA 5AEPA 1R78A 4DAWA 2ZM3A 2VV9A 2PZPA 4EUUA 3QQGA 4H3BA 4TPTA 4ZTSA 5DIAA 3WXXA 1LUFA 1H0VA 1K3AA 2PVMA 2Y6OA 4USDA 4DH5A 4CDRA 4O7RA 4PPBA 4QOXA 3G6GA 5FEQA 4FKWA 3PJ1A 3VULA 4AQCA 2VO7A 4D4SA 3NW7A 5AP2A 4AX8A 4FL2A 4AZEA 3NDMA 4RIWA 3ZONA 4JIKA 4HOUA 5LOHA 2W5HA 3Q49B 4RJ4A 3BBWA 2IFUA 2PVNA 3NR9A 4YZ9A 3LMGA 3QXOA 4E6QA 1XBCA 3I0OA 1QQEA 3Q96A 4BBFA 3UPVA 4DLIA 2WEVA 3RAIA 4J0UA 3FSKA 5IQFA 3L9PA 4LG4A 3A7GA 2OJFE 3C0GA 4X2GA 3PSCA 4OBPA 5HORA 3Q5ZA 4D9TA 3C7QA 4S2ZA 2WTKB 3JVSA 4H1JA 2ZM1A 5DFPA 5AR2A 3ZBFA 2XB7A 3BQRA 3KY2A 5E92A 3ATTA 4I41A 4WD5A 2J0IA 2PVJA 3MV5A 4GRBA 4M12A 4IZAA 4TY1A 3SXRA 3LY8A 3UZRA 3MPAA 3GXLA 3ESKA 5HBEA 3K5VA 4ZY4A 1OBDA 4I1ZA 1JBPE 4BDEA 3QZGA 1PXIA 5HVKA 4DEDA 1MQBA 3R7IA 4JS8A 3EJ1A 4CGWA 3EN4A 4KIKA 4PDSA 2I7QA 2A19B 4FV2A 4YLKA 3VC4A 1F3MC 4CYJA 4IX4A 4ZLOA 3LFFA 2CMWA 5ITAA 3CVLA 4I9CA 2GTNA 4G6LA 4RFMA 4C62A 5M44A 2NC9A 4G17A 3TNWA 4TYEA 4FT3A 4D0XA 4RBLA 2B53A 2VX3A 4YNOA 5G1XA 3PLSA 5KMMA 4HPUE 4I0SA 3FYKX 4EK4A 2ITPA 4D9UA 5B2KA 2HYZA 1F0QA 3UIUA 2V5FA 5J8IA 2YISA 3WE4A 4C4FA 2PK9A 4EOLA 5CAPA 4FICA 3LKMA 2B55A 1OL2A 4QMVA 2Q83A 4FSZA 4W8EA 1I44A 4YZBA 4GYOA 1IG1A 3QQLA 4C38A 3IONA 3KQ7A 4PTGA 2GPHA 2QOHA 3U4TA 4NRHB 4DITA 4WBOA 1YA0A 2YHCA 5DVRA 1P14A 1WVWA 2UZLA 3GGFA 1W7HA 1ZZLA 4G16A 5DNRA 1Y57A 4BI0A 3GC7A 3KXNA 3UE4A 3TM0A 5HLWA 4WNMA 2C69A 5E8XA 2DUVA 2IJMA 3IDPA 4MXAA 5GJDA 5IPJA 3DXQA 3BZ3A 4C58A 5GZAA 2W06A 4PTCA 4XG3A 2HO1A 3WYXA 2C2LA 4EH6A 1GZOA 4F1TA 3W8LA 3PXYA 1KOAA 5HTIA 1BMKA 5KX8A 5HQ0A 5ETFA 3L9MA 4DCEA 2KULA 1XKKA 4I9EA 2QG7A 4FEVA 2WZJA 4EI4A 3UNKA 2WQHA 4FZ7A 3AQVA 3HDNA 1E1XA 3EFWA 4DFNA 2C3LA 2IG7A 3HAVA 4O7VA 3ZSIA 3DY7A 4EJNA 1ZAOA 5CI6A 1TQMA 2R7IA 5L3AA 3LXPA 4WNKA 4RC2A 2P58C 1JWHA 3DTWA 3FI2A 4N6YA 2G2HA 2C4GA 2F49A 5J95A 2VYIA 3QD2B 2R9SA 5FM2A 4ENXA 3IGOA 1Q4LA 4RZWA 4MXYA 5DT0A 1FGIA 4YJQA 4N2SA 5IQCA 2XKCA 4RRVA 3BYUA 4BDDA 2OXDA 4ZAUA 2BDWA 4J95A 5CLPA 1BKXA 2BRMA 3PVBA 3A4OX 4YHJA 2C3IB 3MH3A 5AUVA 4C61A 5DWRA 3FXZA 3DCVA 4N57A 4G31A 3HRFA 4WNOA 3QRUA 4L46A 4NH1A 3PFQA 5CEKA 2W4OA 3HZTA 4FGRA 1B39A 3R8LA 3SX9A 5I9XA 5E90A 3E93A 2BHHA 2OWBA 4I93A 1PXPA 1FVRA 4J53A 4R1VA 3KF4A 5AA8A 4OTGA 1V0OA 4YSMA 5T6KA 4TRLA 4BCHA 1Y8GA 5HE0A 3FWVA 2W7XA 5C03A 2WIPA 3SOAA 4WNPA 4YTHA 4ZSLA 1FVTA 4B8MA 2W1ZA 3GZ2A 5JJ7A 3QUDA 3PWYA 4UQXA 4MYGA 5B2MA 5FTGA 4GCJA 5IG1A 4HOTA 2OXXA 3HAMA 3ORXA 4CZTA 4EHGA 1JOWB 4Y83A 4MNFA 3KA0A 5C1QB 5HU3A 1DAWA 2BAQA 4NFMA 5I3RA 3MFTA 3VW6A 4TYJA 4AT3A 4ERWA 4N3BA 3NW5A 4I2ZA 3QRJA 2XK4A 4IBMA 1XNFA 1T45A 2HYYA 1H07A 4QPMA 2XGMA 4I1AA 4E93A 4L00A 3NWWA 5LARA 4D2RA 3VS7A 4HVHA 1ZYSA 3DAJA 4H36A 3KF7A 4ACHA 2ITZA 2G2FA 4J7BA 4AT5A 3TZ7A 4WG3A 4GK3A 4EONA 2YIQA 2WQEA 4Z55A 3LCKA 4GCOA 1O6YA 3SAYA 2JKQA 3BKBA 2C6MA 3F3WA 4W4YA 4CGAA 4AU8A 5FEDA 2JAVA 5HLPA 3UO4A 3RI1A 2PWLA 1Q61A 1KOBA 2YAKA 4DEIA 5M07A 1YWVA 3L8PA 3PDTA 3R7GA 4L67A 4I5PA 1HXIA 2PQRA 2Q0BA 3ANQA 4E3CA 1GIJA 5KMOA 4ZK5A 3UG2A 5DG5A 4F0IA 5CU6A 2OO8X 4IVCA 3E92A 1W0XC 2IN6A 3NSZA 4N0SA 2B7AA 5DR6A 3FC1X 3V51A 3V5JA 5A14A 1V0PA 3COKA 4FT5A 3DJ7A 3LQ8A 3OZ6A 2C6KA 5HESA 4FK6A 3DBCA 3LJ1A 4YJRA 2G9XA 4CSVA 1VEBA 5BMSA 3LLAA 3EQFA 1XJDA 4AFEA 3FPQA 2XKEA 5IKWA 4JOAA 3GOKA
chains in the Genus database with same CATH superfamily
1YVJA 4XMOA 3AC2A 5J5TA 1B38A 5EG3A 3NRMA 4ZJVA 2KCLA 4O4BB 3W0OA 3ZW3A 3EHNA 4EQMA 5I9VA 4A3VA 3DBDA 3C1XA 4OBQA 2VTRA 4QYFA 3ZHEB 5KZIA 1FVVA 3A8WA 2YWPA 3BEGA 4AAYA 2EXMA 3CVNA 4Q5HA 2YM5A 4NIFA 3O8UA 3I1AA 3DKOA 4BN1A 2JITA 3U51A 5AP5A 4AOFA 4NURA 3NLBA 3PG3A 4UMRA 4EBAA 1XH5A 4K0RA 2WMNA 3PA4A 3FTVA 2WMXA 4OVUA 3BL7A 2V55A 4CG9A 2X6FA 3F2NA 4A63B 4HYSA 4HNIA 3RPRA 1LP4A 4EH8A 2OEVA 4MBIA 4IHPA 3ZRLA 1UNHA 4B0GA 4UV0A 3ZO3A 5ANLA 4Z3VA 1OCCE 4CT4A 3AGLA 4CD0A 2CLXA 2WTCA 4IX3A 4BT8A 4ACGA 3QTZA 3NUXA 4IX5A 2WMRA 1H2TC 3SA0A 2ZDUA 4ASEA 4U8YD 4PV0A 3CSVA 2XGSA 4LV7A 5CI7A 2C47A 4KWPA 4BETA 2PL2A 4MWHA 3RWQA 3GU5A 3TJPA 4JVGA 1OL1A 4AAAA 3TXOA 1QPJA 3PUPA 3GZ1A 3ZYLA 3BV3A 3TTIA 3MJ2A 2FF4A 1R3CA 2Q0NA 3IKOB 1RDQE 3CKCA 2WOUA 2XM9A 3EQRA 3KULB 1OITA 3QX2A 4O4EA 3BQOA 2ITTA 1PF8A 3TV4A 3NMUF 5K4IA 5AP7A 4MXZA 2QYJA 1PXJA 5I9YA 3TKIA 5A6CA 2F57A 2Z60A 1WVYA 4FRFA 3KL8A 1S0PA 4XLVA 3JXJA 4UWBA 4OR5A 2EVAA 3ASNE 3UQGA 4DLQA 4Z16A 1UA2A 4WG4A 4JHJA 2YCSA 5BXOA 2AC5A 3RM6A 4JBOA 2I1KA 3QRTA 1NVSA 3VLDA 4F9CA 4M13A 5I9WA 3V5WA 1SVEA 3S2AA 2A1AB 3LXNA 3DKGA 3DSVA 1PYEA 4V0GB 3VN9A 2XIZA 2ACXA 4DHIB 4FSMA 1H6KA 4E4NA 2JKOA 5FRIA 4GT4A 3FU0A 1H1QA 4I6GA 5C1DA 3B8QA 2GNIA 5DN3A 5B7VA 4DI3A 2J09A 3EL7A 4NUSA 3TJCA 3FEXA 3QQFA 3F6XA 5FQ8A 3D15A 3BWJA 3FXXA 4WNGA 3OTVA 4UMQA 3SQQA 1KT0A 1R0EA 3F3VA 3BHTA 4J8EA 5LMKC 4EH2A 4F6UA 3ODZX 4UUCA 3NYNA 2DWZA 2V62A 3DQXA 3HL7A 4BIDA 4U80A 3W9GA 4XRLA 3NCZA 1O6KA 5AAFA 2R3QA 3UGCA 3WZEA 1FMOE 4H3PA 2UUEA 4KMOA 5IQBA 4KIQA 4G9CA 3BLRA 2IW9A 4FTNA 3BU5A 4FT9A 2WPVA 4BZNA 3F2AA 5IH6A 3Q15A 3UT7A 3ISMC 4WKQA 4R7BA 3SLSA 4XP3A 3U6JA 4WOVA 2HW6A 4EECA 5IDNA 3PJ3A 2J50A 4BHZA 2VSXE 5IA2A 1PJKA 4ITJA 4X3FA 4MBGA 4X3JA 5EW8A 4JLCA 1BX6A 2WMBA 2GS6A 4HGLA 3MEKA 1W2CA 5KHXA 3BIZA 1S64A 1PMEA 4HOKA 1VYZA 2J6MA 3L9NA 2P4IA 3F7ZA 4EOMA 4HRNA 2V7OA 1OCRE 3HDXA 4R5YA 3KRXA 4C57A 1QBQA 3R9OA 4DX2A 4G11A 4HZRA 3LJ2A 5EFQA 4QEBA 4G23A 1LF8A 3UTOA 1OL5A 4LOOA 4AY6A 4L7SA 4CCAA 4DH1A 4FIHA 3DBSA 3E8EA 1E9HA 3UNZA 1SNXA 3D0EA 3IKAA 2X39A 1PMVA 4APCA 4RX5A 4YJPA 2P0CA 2HM8A 1OKYA 4NCTA 5ENSD 2WQ7A 5AARA 5IUHA 1K2PA 3R9MA 4FJVA 3NNXA 2BTRA 2UZBA 5KO1A 3NUSA 4JRNA 3TJDA 5CANA 3BQCA 3G51A 2LSVA 5AAGA 3UP7A 4O1PA 5JH6A 5BYZA 4ME2A 3O71A 3ZZWA 4IE9A 2QG5A 4BYJA 3REPA 4QP3A 5JKGA 2BZJA 3UC3A 4DTKA 3FKLA 4OLIA 5L2QA 5BMMA 5BVNA 1URWA 3N4UA 2CGVA 4FKPA 3EHQA 4FIJA 3SKCA 4I6BA 3N4TA 3AMBA 3OMVA 3HUCA 4IAIA 5DBXA 4C02A 5J79A 4G3FA 4OTFA 1AQ1A 5IH5A 2HXQA 3ZRHA 4MXOA 3MESA 3EB0A 5AV4A 2QOOA 2BIYA 4FT0A 5ANEA 3QCQA 4DTAA 4M84A 4H7XA 4O86A 4ZOGA 3CHMA 3RIBA 1CMKE 3ELJA 3NW6A 3ASGA 4KS7A 3ZHPC 4YURA 4O0SA 1FBNA 3OCTA 3UM3A 1Q3WA 2JFMA 2PL0A 4NM0A 4LGHA 4BRXA 3CK7A 4JD2G 3SBSA 1TVOA 5HIEA 4IVDA 4KBQA 2EINE 2GNGA 3QC4A 1G3NB 3QTRA 3HVCA 4NK9A 3PVWA 4XG6A 3LPBA 2R3MA 1H19A 4BTAA 3CD8A 3CVUA 3QKYA 3L9LA 2XAOA 4FG7A 2BDFA 4KS8A 3MPTA 3EQIA 4BBMA 3QGWA 3OVVA 3ZM9A 4IB3A 2ILRA 5C8NA 5B1BE 4F7JA 1BUHA 4KB8A 2L6BA 3WF5A 4HRMB 3LAUA 4F7SA 4E5AX 5DYJA 3Q4ZA 3U9CA 1IQRA 5C8MA 3MB7A 3E37A 2WQMA 4QQIA 1U54A 4O0WA 2F9GA 4J8YA 5HD7A 3V04A 5AFVA 4AP2A 4RVBA 1MJ0A 3BLAA 4ORKA 3AU4A 3U66A 4XP0A 4TT7A 3G33A 3RKBA 3Q53A 3GBZA 1GW6A 2R3KA 4QPSA 1G8AA 4YJVA 3Q3BA 3LHJA 3C0HA 5JFSA 1ZMUA 1WBNA 2OG8A 3PE1A 4LRKA 4CCBA 3VBYA 3AT2A 4ANVA 4K6ZA 5A4TA 3Q4CA 2UZEA 4HCTA 4E8AA 1N4SA 2GQSA 4J7WA 1ST4A 4KSPA 1BI7A 4IAYA 4YNDA 3OW4A 5FZSA 4CDMA 5EM6A 4WIHA 1OPLA 4RWIA 2E2BA 4BI1A 1QZ2A 4GA0A 5BUEA 3MJ1A 4HVIA 1JQHA 3GCQA 3DOGA 4W4WA 4ZLZA 4BY9E 3CPBA 2XYUA 5LP0A 4AA5A 3P5JC 4BGQA 2AW6A 5KNJA 4FL1A 3MYVA 5KHWA 1RW2A 2Y7JA 2F2CB 5EYKA 3ORPA 3R7OA 2BRGA 4WO5A 2J4ZA 4IWQA 5EDQA 4IFCA 2ITQA 1PXLA 5I0BA 2NO3A 4KIOA 3NOCD 2IZTA 3QZFA 4D2VA 4B8AA 4F78A 4RGJA 3KIOC 1GNGA 3DB6A 4JI9A 5KZ0A 3B7BA 3F3UA 4GMLA 3WG7E 3VUGA 3TMOA 3VS4A 4XJ0A 4WWOA 4M69A 1BU9A 2BMCA 2R0UA 4GIHA 4JDIA 5CF8A 5CU0A 3HEGA 4ENYA 4C34A 2GSFA 2O0UA 1BL7A 3MTFA 4WAFA 4HLLA 2P9PG 3Q4TA 2REIA 1XBBA 2PHKA 3K3JA 3D7TA 4PNKA 2CHLA 3GC9A 3ZU7B 4I5HA 4AIFA 2CFZA 3EQDA 3BBTB 2B0OE 2WEIA 2GHLA 5BVOA 3MY1A 4JIAA 5KMLA 3JXWA 3GFEA 1OL7A 3Q78A 4H58A 4LNBA 3R01A 5TOZA 3APDA 3FMLA 4P7EA 3CS9A 4HFGA 3Q6WA 3T8OA 3A61A 4CKRA 3TL5A 2FSOX 2X7FA 4L01A 4GU9A 4TTHB 4NIFB 3D14A 3ZYMA 4CXAA 3VONA 2W1CA 4AS0A 5DT3A 3F5GA 3PNTB 4AG8A 3KXXA 5DRBA 3VTYA 3O51A 4RIXB 2XA4A 5CF4A 2PMOX 4FSUA 1GIIA 1R1WA 2P3GX 4JX3A 3C0IA 3ZSGA 3FTSA 4F9AA 3FBVA 4I0TA 2F37A 1H24A 3JCKC 2WMTA 2W5AA 5A4LA 3W0SA 1SZAA 3CGHA 5BT1A 4D4YA 3ZDUA 4ANOA 3AC1A 3VHEA 3KMMA 4BGGA 1XGWA 2LNIA 2PTKA 2WXJA 3E33A 4U81A 3BUAA 4M8TA 3LFDA 4XLIA 2XKFA 4IX6A 4J97A 4RX7A 3FP3A 4EOSA 4AV7A 3UMWA 1MX6A 4E6CA 3O7LB 1REJA 2XCHA 1XH7A 5BVDA 1RE8A 4ANLA 5BV0A 2Z02A 3JUHA 4XUFA 4AXCA 2IZUA 4AM9A 3CQEA 4FULA 3UDTA 3P23A 2X8EA 5HZNA 4AZFA 4FV1A 4C3RA 4BVUA 1X81A 3CD3A 4NL0A 4A9TA 5EYCA 5E75A 3QFVA 1G8JA 3MA5A 4GJ2A 5FG8A 3RRMB 2IVVA 4WSYA 3OCGA 3QTWA 3TWWA 3EN5A 4F1SA 2UW0A 3WF7A 3FZTA 4DEAA 5BUIA 4AACA 3DJ5A 1LPUA 3M1SA 4FHKA 2PNNA 3QRIA 5HEZA 3OD6X 3LZBA 2WKMA 5AQ7A 2BHEA 3FLSA 5AV1A 3ZUTA 5L8KA 1APME 1BYGA 5DEYA 4BTMA 5M72A 2OZOA 3AC3A 5G6VA 2CHWA 3L1SA 1E7UA 5CEPA 3D5UA 3R00A 3HYMB 3TG5A 5L2SA 5M4CA 1S70B 3DK7A 1PMNA 1JUQA 1OIQA 4EOOA 4X2FA 2W1GA 4CTCA 1FOTA 2X6HA 2IQCA 4QMXA 4WUNA 4YTIA 5AM7A 1PXKA 5L2WA 4CNHA 4U41A 3QWVA 4FTMA 4ASDA 4I92A 3OHTA 1OL6A 5ARGA 3TNPC 4DG2E 4JPSA 3EL8A 3CLJA 4HQDA 4DK5A 3UMVA 2XCCA 4PTEA 1ZU2A 3FQHA 4AN2A 4R5SA 4ASZA 2YM8A 4I2WA 3E88A 2WXMA 4NIKA 5DRDA 4FLBA 3GB2A 4IACA 2B9FA 5HIDA 4F7LA 3I4RB 2ITUA 2OJIA 3C3OA 5E1SA 5KMIA 4GTRA 4ZTMA 1KZPA 5KCMA 1WBPA 5J7BA 4DFZE 3UINC 1E96B 1JPLA 3HXCA 5G04J 4XRJA 2CGUA 1DVPA 4QMQA 3QUEA 4EBVA 4PS3A 5BUJA 2YLEA 4A4OA 2XNNA 5IQIA 4Y46A 3U4UA 2I6HA 2NPQA 5I4NA 3UPXA 4IWPA 4FC0A 2CSNA 4QMZA 4V3IA 4DPRA 4HLEA 3NNWA 3MA3A 3BYSA 5D11A 4QQ5A 3TUBA 3PVUA 3R1NA 1S9IA 4X3FB 5HO7A 1HG2A 3PP0A 2VWYA 2YWVA 1PY1A 4AP7A 3W9FA 5FLFA 3E8DA 5IH4A 3QLFA 1H26A 2OFUA 2LAIA 3GYZA 3VWAA 1OGYA 2XNGA 3R63A 3VBQA 5E76A 1Q41A 4ZTQA 5L2IA 4PL4A 3R21A 2VTPA 3F9NA 3GI3A 4YJNA 2W1IA 5FWKK 4K5CA 2WQNA 3V8WA 4LCTA 3QCYA 3FI3A 1ZBPA 2OBJA 2WTJA 5M56A 4W4XA 2RG8A 2H9VA 1Q8TA 4UMUA 4LL0A 3MY5A 2GCDA 2BDJA 2C0LA 4I6EA 5H3QA 1TYQG 2GNHA 4L9PA 5F1ZA 2PMLX 4OW8A 3RCDA 3O2MA 1S9JA 1DI9A 2P55A 4M97A 1O1TA 3EFJA 2OEWA 3BYMA 1GAGA 3DB8A 5C9CA 2Y4TA 1ELWA 1AGWA 2E9NA 3CVXA 2NP8A 4FC8A 3UDZA 5EILA 2AUHA 4LNUD 3KCFA 3ZEWA 3B7RL 2V5QA 3GENA 3T5VA 3QA8A 3PZ4A 4E7WA 4QO9A 4PMMA 4ZTLA 4BTJA 2HK5A 4G9RA 5KMNA 3IW8A 4FKLA 3GP0A 2QD9A 4MF1A 2IOSA 4G1WA 3E7VA 1WMKA 3V8SA 2CLQA 1GZKA 2XF0A 3MB6A 4XKCA 3UM2A 4RIYA 4CFXA 4U97A 4WNEA 1N94A 3IDBA 4YC6A 4CYMD 3EDTB 3ITZA 3BLQA 4EORA 3MI9A 3PVLA 4GKHA 4HBDA 4H39A 2YHVA 1M7NA 3VS1A 1M14A 2Y9QA 3IQ7A 5AUZA 1DAYA 3PZDA 4D1ZA 4NM7A 2F7EE 3QTXA 1HZ4A 2BTSA 2ITWA 2GNJA 3FZSA 5D12A 4W4VA 2ZAZA 5C4KA 4O91A 3BHUA 3M2WA 5LMKA 2VTNA 5EW3A 1ZB1A 3NS9A 4AT4A 2VGPA 5KJMA 5IMXA 1K3ZD 4HPTE 4XX5A 2GGFA 3MX3A 3QBNA 4N2QA 2RFNA 2VU3A 2PE2A 2OFVA 4GTSA 1XH4A 4CDNA 3LY9A 5AJDA 4S32A 4DG3E 4U40A 3TUDA 4A3TA 3ML1A 5EKOA 1YOLA 1JPAA 3JYAA 1URCA 2V5QC 3L8SA 1LEZA 2B0QA 2J8SD 3UODA 3BYVA 5HO6A 3QAME 2WVIA 5G04C 3IDCA 4C0MA 5AMNA 4RG6A 1JSUA 3G0FA 4IB5A 2VRXA 3A7HA 3T3UA 4ZLYA 3V2OA 3IEGA 4OYSA 3LFAA 3K5UA 3VS3A 4D2SA 4RSYA 3QK0A 5CASA 4I94A 3DA6A 2XUUA 2QU6A 4APFA 4GU6A 2R59A 3SFXA 3HYHA 3FL5A 4RPVA 3SNXA 4NW6A 3DFAA 4BDIA 2HIWA 3DV3A 5LMBA 3OS3A 5EH0A 3CSTA 5EQEA 3UM1A 1BI8A 4IADA 4GK2A 3ZMMA 1XR1A 3LXKA 3PUKA 2XKDA 2V0DA 1KPSB 3HV5A 3B13A 5DGZA 3Q2JA 5ANDA 1SA5A 3NAXA 1W3BA 1QPDA 5AADA 3DNDA 3UX4A 4FTQA 3QGYA 1TN7A 4CZ2D 4RVLA 4E5WA 1XQZA 4M0YA 1IYGA 4QYEA 3AS8A 3CV0A 4KRCA 2BAKA 5CAQA 5K5NA 2PZYA 1YDRE 3V8TA 3UOJA 5CEIA 4MQ1A 5A4QA 2PQNA 1Q97A 4S34A 2G01A 5DMZA 3FZRA 2GNFA 3SDJA 1P5QA 5JN2A 3ZFMA 2OJJA 4DC2A 4EKLA 3F5XA 1PKDA 2YCRA 4BDBA 4BCIA 2H6FA 4NM3A 3ML9A 2OIQA 5AEPA 1R78A 4JMQA 2PZPA 5DIAA 3O4ZA 1H0VA 1K3AA 2Y6OA 4RQIA 3EIJA 4Q69A 4GAAA 3PJ1A 2VO7A 3NW7A 1HF8A 4RJ4A 3BBWA 3QXOA 3I0OA 3Q96A 3UPVA 3FSKA 1FVHA 5HS0A 3PSCA 4OBPA 2Y3AA 5AR2A 3BQRA 3KY2A 4WD5A 2J0IA 3MV5A 3SXRA 3MPAA 3GXLA 5HBEA 4ZY4A 4I1ZA 1JBPE 4BDEA 3W0NA 3ABME 4KIKA 4FV2A 4YLKA 4CYJA 4IX4A 5ITAA 3LFFA 2CMWA 4I9CA 2GTNA 5M44A 4EONA 4YNOA 4EK4A 5ITZF 5B2KA 3UIUA 4QMVA 4FSZA 4YZBA 2BTDA 1IG1A 3QQLA 4PTGA 2UZLA 3GGFA 5DNRA 4BI0A 3KXNA 5HLWA 2IJMA 3BZ3A 2W06A 1GZOA 2DYRE 3PXYA 1BMKA 4EI4A 4FZ7A 3AQVA 1TZDA 3EFWA 3ZSIA 4EJNA 5CI6A 1MYOA 4WNKA 3SI5A 3FI2A 2C4GA 2R9SA 1Q4LA 4MXYA 2LO6A 3PUJA 5IQCA 3BYUA 2DIWA 5CLPA 1BKXA 4WNOA 3QRUA 3HZTA 4FGRA 1B39A 3SX9A 2V8SE 5AA8A 4OTGA 4TRLA 5HE0A 3FWVA 4WNPA 4B8MA 2W1ZA 3PWYA 4MYGA 3PRZA 4Y83A 5HU3A 4ERWA 1ZYSA 5G55A 2ITZA 4J7BA 4GK3A 1Z5SC 4Z55A 4GCOA 3SAYA 3KSQA 3F3WA 2V0PA 5FEDA 2ZXWE 3RI1A 2PWLA 2BKGA 3R7GA 4L67A 4I5PA 1N11A 4F0IA 4IVCA 3E92A 1W0XC 3NSZA 5DR6A 3FC1X 2RFAA 3DJ7A 1N0RA 2C6KA 4CSVA 2G9XA 3EQFA 5IKWA 4JOAA 3II5A 2CHXA 3J5QB 2QKRA 4YLLA 5EIDA 3ZN3A 4DHFA 4IFGA 4D1XA 4JC8A 4ILGA 4K8AA 4FVPA 2WXGA 4O21A 3QC1A 4IYPA 2XRWA 3CC6A 4C4EA 2PULA 4DLOA 2GDOA 3C3QA 4U07A 4A4XA 5HGIA 1YHSA 1V54E 4BICA 2Z7RA 4J6IA 4EH5A 2GRRB 2UW9A 4F65A 4YPSA 3LXLA 2XEVA 2P33A 3QCSA 4RJ7A 4QTAA 4V04A 2R64A 4QP4A 4V0GA 2ZJWA 5F4NA 2VTBA 2XPZA 4I6JA 4BDCA 2CNVA 5HCXA 4M7IA 3TWUA 2IPXA 3N51A 2WMOA 4PMSA 4ZFHA 2F7XE 5GJGA 4AW5A 4P90A 4FTTA 5IA4A 3CY3A 2DS1A 3UIMA 2PVKA 4EBWA 3VUMA 3V5LA 4EQUA 3B7SA 3GU4A 3W2QA 4G3CA 3ZZEA 4HGTA 5AUUA 3N71A 3ASDA 2A4ZA 5BV3A 4RC3A 1OKZA 3WI6A 2W4JA 2XARA 5BVWA 3W2OA 3DXMG 1OMWA 4F99A 1Q3DA 4AE9A 2PE1A 5JMSA 4GUEA 4G8KA 1DI8A 2ITVA 4P5QA 2QY7A 4E4MA 3A99A 4DFXE 3AJIA 4GPMA 4RWJA 1JCQA 4ZIMA 4YZNA 4AZTA 5HCZA 4L7FA 1JCSA 1Z9XA 4LM5A 5AP1A 5CWZA 3PTGA 4KBKA 4UWFA 4DCAA 4YNEA 2VSOE 2IOLA 3B2WA 3FEGA 1U5RA 3ORTA 5AWMA 1G3NA 4R1YA 5D2MC 3U6IA 3VQUA 3E64A 3TAXA 3MZLB 4M7CA 3QA0A 2YIXA 4BDGA 1IAHA 4GTVA 4AGCA 5HTCA 5DIZA 4KINA 2GFCA 3A7FA 4FUXA 4MNEA 1TNBA 3COIA 3SHEA 3IHVA 3NQPA 2CGWA 4NACA 2R3GA 3WE8A 2E2EA 5ANOA 4L2LA 4M69B 3GC0A 4WWPA 2EXEA 4A06A 3R1YA 1OWLA 2BEDA 4PDXA 4BGHA 5JFWA 5CY3A 1UN8A 3LMIA 3G2VA 2YERA 4BWRA 2X8DA 4AUAA 4OVVA 3NF1A 4MHAA 3APCA 2WB2A 4M68A 5L2TA 3PE2A 4IB0A 3VNTA 2H8HA 1TEZA 2UZWE 2R3HA 3L22A 4UWHA 1P2AA 4D2TA 3TZ8A 1QPCA 1NVRA 2XK8A 4AWIA 1WBSA 1QPEA 1H0WA 3NX8A 3R0TA 3CVQA 3LIJA 4EZ5A 2J0MB 3OW3A 2YA9A 2X0OA 3E87A 4J99A 3ZKJA 2PZ5A 2YN8A 4MXXA 4IZ7A 3D9OA 3FMDA 4CV8A 5H8GA 2XNEA 1KE7A 4RVTA 2XIYA 3NZ0A 4YZMA 4O84A 4FG9A 4GA2A 3EFLA 1UWHA 3LFEA 3FMNA 3E8CA 2UZUE 3R1QA 3SRVB 2YACA 3R8UA 3QD0A 3AG1E 2XALA 4I6HA 5DHJA 4KABA 4I3ZA 3RVGA 3FMHA 3O7LD 5J9YA 2QNJA 1TN6A 3VUIA 3IBEA 4XG4A 3ZOSA 4GMJA 4X0MA 3BLHA 3WIGA 3C51A 3FHEA 2X9EA 3BU3A 1ZRZA 3AC4A 5CEMA 2OIBA 3DSUA 2X1NA 4ARKA 2LAVA 1LR4A 3I7BA 1FGKA 4LMUA 2VO0A 2WGJA 3EHRA 4ABNA 3KRLA 5FQ4A 4E4LA 5KBRA 3C72A 2Z7QA 2WQBA 3FUIA 2A0CX 3WIKA 2JBPA 4O7SA 4TXCA 3RPYA 4ITHA 4D28A 4FSNA 3FLZA 4FSQA 3ULYA 4NEUA 3AD5A 3R9NA 5IISA 4AVXA 4XI9A 5EI2A 4QTEA 1B6CB 2GHGA 2HZ0A 3LDZA 5GZ9A 3PVGA 3DEPA 4WRSA 4AXHA 5JJTA 3L54A 3OTNA 5IY5E 5AV3A 3FY0A 4C3FA 2CKQA 1YI4A 5FDXA 3OXIA 2XZSA 4JNWA 3JVRA 5HNGA 3F6QA 4YDWA 2ITOA 1HH8A 2J0LA 4RG9A 1YOJA 3UMXA 2R17C 2PZIA 4LUDA 1OKWA 2E9VA 4FIFA 3T9KA 3ZEFA 5JK3A 4JJRA 3EQPA 3CIKA 2IVSA 2YIYA 1WBOA 4D55A 2VNWA 4QYGA 2RKUA 4O83A 3MKQB 4ACMA 2OU7A 3CPCA 2BRBA 4DEBA 4WUAA 4O60A 4GFOA 3HX4A 3Q47B 5AENA 4CFMA 2R3FA 2X6IA 4GT3A 2NRUA 1UV5A 3TV7A 2XPIA 3R6XA 2VTSA 3FLQA 5JGBA 4IIRA 5ARFA 2GS2A 4K77A 1U54B 3ZYAA 1OM1A 3ZEPA 3FU3A 3K9IA<