2PZIA

Crystal structure of protein kinase pkng from mycobacterium tuberculosis in complex with tetrahydrobenzothiophene ax20017
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
677
structure length
654
Chain Sequence
GSHMLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase pknG
total genus 200
structure length 654
sequence length 677
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF16918 PknG_TPR Protein kinase G tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pziA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pziA02
3CBLA 5GZ9A 3V5WA 3AOXA 4GZ6A 1H0WA 3VUHA 2X8EA 5FTQA 3R7YA 3JR1A 4RX5A 2F2UA 4YZCA 1T45A 4YURA 4WOVA 2PULA 3ALNA 3O23A 4IHPA 4F1MA 4F64A 1NVRA 5M55A 4ZZNA 3E87A 3R2BA 3TTJA 1ZARA 4E5AX 1OUVA 4F9AA 3FZPA 3EQPA 1W98A 5JFXA 4EONA 5M4UA 1KV1A 3CJGA 5KHWA 4N3CA 2OZOA 1TQPA 4RLLA 2R3JA 3BIZA 4FKQA 2C0MA 4GYWA 2BTRA 5ANJA 4WG4A 5D7VA 3EQBA 3PY1A 4WNMA 4Y85A 3VRZA 3A60A 3ZO1A 1Y6BA 5K5XA 2FO7A 2W06A 5EFQA 4BBEA 5M4CA 3HP5A 3HMNA 4DT8A 3EQIA 4FTLA 3E8EA 4NH1A 3A7IA 5AYWD 3QCQA 4EHVA 2C0OA 4NK9A 4U79A 4NM7A 4RRVA 4D9UA 1ZYLA 4ZTHA 3QC9A 1UKIA 4RVKA 3OW3A 3S1HA 3OVVA 3P23A 1YWNA 4M97A 4O91A 4YZBA 3FXWA 3QXOA 2VWZA 3DQWA 3DK3A 4CT2A 4QTEA 3LZBA 4J0UA 4YJQA 3MVHA 5CYIA 4EOQA 4HW7A 5JQ8A 4R3CA 4O82A 3UIXA 2G2HA 2UZVA 1ZOEA 4J1RA 4DG0E 4QP7A 5DEYA 3HAMA 3EDTB 2P55A 2A0CX 1WCCA 5JZNA 3PP0A 4APCA 2PUPA 3U55A 1REKA 3IOKA 3OHTA 4MBLA 3VQUA 2QHMA 3PSDA 4FBXA 5IH4A 2XCBA 4I92A 4LRMA 2QQ7A 5CF4A 4I2WA 1DM2A 3QDNA 4AAAA 5LVNA 3OXLA 3MI9A 5BVNA 4FTUA 4KKEA 4M0YA 4YNEA 2W5BA 4RBLA 3MVJA 2A19B 2BRMA 5CU0A 4C2VA 3NDMA 1CKJA 3OUNB 1HCLA 4CNHA 4FTIA 4WNDA 3DXPA 4YC6A 2R7IA 2WU7A 2VNYA 3A7HA 2C5XA 1LUFA 3QTZA 4M14A 5AUXA 5LMBA 1FCHA 3D2KA 3T9IA 4FSTA 4I24A 4IFCA 1M14A 4YZDA 3LXNA 4QNYA 3F3TA 3ZRKA 4HNIA 4EK5A 4FIIA 5CI6A 4NJDA 1EH4A 4EH7A 2IZTA 2CCHA 2PHKA 2XGMA 3F2NA 4FI1A 3M42A 5L6PA 2XKCA 2IN6A 2R0IA 5TR6A 3LFDA 1ELWA 4MKCA 5CU4A 2GDOA 5ETIA 5KNJA 3C4CA 5E1SA 4CYIA 3LFFA 4LFIA 4FGRA 5D41A 3MYGA 4PTCA 5E8TA 3VRYA 4PUZA 3DZQA 4FTNA 4H7XA 3EKKA 3GNIB 1O6LA 3BQCA 4XG2A 4UQYA 3KVXA 4KAOA 4ZZMA 4A1SA 3DA6A 4FKGA 3RGFA 3R9OA 4N3BA 3FYKX 3EHAA 3PJ2A 5A4EA 2YDJA 5IKWA 4O83A 2IG7A 1FQ1B 2VWUA 4EOKA 4CFFA 4XRJA 3HEGA 2VGXA 3DQXA 4QTCA 2BALA 4FX3A 4YJOA 2ZB1A 3ZLXA 3MW1A 4MVFA 4CCUA 4C4GA 2ZV9A 3VW6A 4AN9A 2HY81 3RHXA 3BHYA 1XH7A 2OI4X 2GNIA 4LI5A 2V22A 2E9NA 1DI9A 3B8RA 3BGZA 4X3FC 3BX5A 2OZAB 4B4LA 2HO1A 2UZUE 3A7JA 4O0WA 4GH2A 5L2IA 2CLXA 3MFSA 2YDKA 2QHNA 2QLQA 4XX9A 3G51A 3Q04A 5I9VA 4APPA 2XCCA 3LCSA 3KC3A 4FE2A 3VO3A 1LEZA 2IW9A 2YCFA 1XR1A 4IDTA 4CV8A 3UQFA 1H8FA 5LXMA 1J91A 1GIIA 3G33A 3LQ8A 4Q2AA 4I3ZA 4RZWA 4QMNA 2OIDA 4FEXA 4DA5A 2PUNA 3EZRA 3DFCB 4E3CA 4F9CA 4BZDA 4F9YA 1M7QA 3JYSA 2HXQA 4O86A 1WBVA 3CQEA 4C58A 3NMUF 2X9EA 5ETCA 5IH6A 2W1FA 4G25A 1BLXA 4BTMA 4C33A 4R1VA 3PE3A 5C4KA 5HKMA 2PY3A 3TWJA 3Q4CA 5AA9A 2C6KA 4JHRA 3HVCA 5A4TA 5DT0A 3RU0A 4MWIA 3T9TA 2GW1A 2JLDA 2PVMA 1Q8UA 3TDVA 4LGHA 4XI0A 2JDTA 4QP4A 3DAKA 2WQHA 3WF7A 3SVVA 4CG9A 4K33A 2B53A 5A4QA 4BTFA 3HECA 3TCPA 4GA1A 2XVDA 1XO2B 4MXZA 4IB0A 4RLKA 3UZTA 4CRSA 4ORKA 3NUXA 3W33A 4RWIA 1ATPE 4MNEB 4JL0A 3KREA 4GK4A 3KXMA 1UA2A 4YJSA 3E7VA 5D9HA 4DH5A 4OTGA 5HBHA 3FZTA 4IB3A 4U7ZA 4MCVA 4BCNA 3W8QA 1WMKA 3MY5A 4F63A 2FB8A 3NUAA 4FSWA 5HE1A 3CEKA 2KULA 3ASGA 5M09A 3EWHA 3SKCA 1U54B 4H3PA 3E88A 5IEVA 1KE7A 2XF0A 5CF8A 3LY7A 5JH6A 2V5FA 4GRBA 2PE0A 4E7WA 4GYYA 5FM2A 2JAMA 1AQ1A 4QRCA 4QTBA 4S32A 5CY3A 5AADA 1H4LA 4WT6A 2UZWE 1GIHA 3GU8A 4IWPA 3CK7A 1ZWSA 3QBNA 2R3FA 3FI4A 3W2QA 4O2PA 2J2IB 3QX2A 3OCGA 3FMLA 2B9JA 5CVHA 3VC4A 4C4EA 3HYMB 2QR7A 3TZ8A 4DC2A 2P2HA 4FNZA 4P7EA 3GC7A 2QFCA 4U81A 1H00A 3EB0A 3ENMA 2AVPA 3IEGA 4G2FA 4RWJA 1L8TA 2YLEA 3QUPA 4UXQA 3VF8A 3GQLA 5KMJA 4R3PA 1OMWA 3A99A 3FHRA 4YPSA 3GU6A 4LOOA 4ANQA 3AMAA 4NM3A 2UZDA 5EYKA 3FYJX 4ZK5A 5CNNA 3QD0A 5B0XA 2CNQA 5C4LA 3CD8A 4B94A 4FEUA 4TYEA 3SLSA 3QCSA 4FYNA 4GMYA 3D9VA 4EBWA 3VUIA 1R78A 3D83A 1YQJA 2UW8A 3SXFA 4EK6A 2VO6A 1CM8A 1H0VA 3QQKA 2RFNA 5AM6A 5JKGA 2WMRA 4UV0A 2G2FA 4WKQA 4LOPA 3AT2A 5GINE 2OWBA 3FMKA 2I7QA 3FC1X 3FMJA 2VTOA 2VNWA 5KMNA 3BBWA 3C0IA 4NFMA 5E90A 4TRLA 4YU2A 3O7LB 1V0OA 4IC8A 4MH7A 4RGJA 5CEMA 3UOKA 4FKTA 5A6OA 2FEZA 2ONDA 4JNWA 5KKRB 1IA9A 3D15A 4DGGA 2QOQA 2FSOX 3DKFA 3OTVA 2C5YA 2QKWB 5EM8A 2X7GA 3HUCA 4F99A 1M2PA 4PNIA 4HOSA 1PRYA 3GOPA 4TKSA 2WU6A 2R64A 3PXRA 2PMIA 2J0KA 2QU6A 3KN5A 2L6JA 2BMCA 3Q4UA 3VS6A 4ZY5A 1PXLA 2ITUA 3AD5A 3HKOA 3RWPA 5AEPA 3GBZA 1I09A 1M2RA 2X6DA 3BGPA 5AR4A 4ZS4A 1KOAA 3QYWA 3DJ6A 3RTPA 3R02A 3R1NA 5AV1A 3RAIA 4HVHA 5D7AA 3O2MA 4F1OA 3OXZA 4NM5A 1YDSE 5AIRA 5F20A 4FV4A 3OXIA 4KBAA 5AUVA 4DH8A 5HTIA 2ONLA 1JSTA 4R77A 5LQFA 2LSUA 5J8IA 3G0EA 4RVMA 4ZLZA 4TWPA 5EOLA 5LMAA 5IMEA 2UVZA 2C1AA 3AS5A 3AGMA 2UZLA 1IR3A 2UY1A 2AUHA 4UZDA 4OTIA 5EG3A 3LJ0A 4BN1A 2X81A 3VUGA 4CVAA 2ZJWA 4DFBA 4F4PA 1Z57A 4GT4A 4WG3A 4G6LA 5EYDA 2FSTX 5JN2A 1PXKA 1QCFA 3FMMA 3QTXA 5CCLA 1YOMA 4PF4A 5F95A 4AZVA 4X2KA 2R4BA 5FQDC 3VUTA 4CZUA 3RKVA 1Q3DA 2UV2A 4GS6A 4OTFA 2Y0AA 1R1WA 2WQMA 5H8EA 3N71A 2Q83A 1JKLA 2X8DA 5JEBA 3FV8A 5HTBA 5CWZA 5ITAA 1H1WA 3HUBA 4GV1A 3R8ZA 5HCXA 3BPRA 4FODA 4ERKA 4GYOA 2O2UA 3KY2A 2W1CA 2XEVA 3PY0A 3QUDA 2Z60A 3F7WA 4O2ZA 3UE4A 2XRUA 4NIFA 1Q61A 4YLKA 4G31A 5AP7A 1NXKA 5T68A 4WG5A 1ZOHA 3DTWA 5AUWA 5JK3A 3E4BA 2XCKA 3OXFA 5ETAA 1IEPA 4FIFA 5E8VA 4IWQA 5E8XA 4BWXA 2GNHA 3LHJA 3O71A 3PE4A 4NCTA 4GL9A 3FAAA 4MD9E 4Z55A 3H0ZA 5I3RA 4Z9LA 4IFGA 2GFSA 4QPSA 3LFAA 5HNGA 4EL9A 3GCVA 1AGWA 4M84A 4PP9A 4ZSGA 4EUTA 2QKRA 3F82A 5AR3A 5EQPA 4KNBA 3AQVA 4FKWA 4A4XA 3R1YA 3RNYA 3EH9A 3LCDA 3ZUVA 3K54A 2VX1A 4JDHA 4WD5A 5JMSA 5H2UA 5HQ0A 5T3QA 4W8EA 2C6DA 4I4EA 3EL8A 5C01A 1Y8GA 3NAXA 4YO4A 3NAYA 3E3PA 5HLNA 3LMIA 1QL6A 4U42A 5BYLA 3U4WA 3ATSA 1GY3A 3BLRA 3HRBA 2YIYA 5HE0A 3E64A 5AP4A 3LE6A 3K3IA 5HO7A 5IA3A 2OXDA 4EQCA 5AM7A 4XG3A 4YBKA 3FWVA 4U0UA 3UIMA 3ENHA 3WF8A 3ORLA 5CALA 4K1BA 4ZTRA 1G8SA 4AS0A 3L9LA 4C4FA 5AP3A 4C4IA 1KUTA 2PE1A 2H34A 4CKIA 5AUZA 4DH3A 5CF6A 1P5QA 4BVUA 3EFWA 3E8DA 3BELA 1HZ4A 2RG5A 2XNNA 2GNJA 4FTJA 4QO9A 4PMSA 4BIBA 4XBUA 2XK7A 3RAKA 3R83A 2PSQA 3MSSA 2XRWA 5FXQA 1VYZA 3EN9A 2C30A 1FVTA 4DITA 1OPLA 5EW9A 4BB4A 5CEKA 5IMXA 3GZ1A 1ZBPA 4U41A 3RALA 2O64A 4FZ7A 3K9IA 5KE0A 5H3QA 2J5EA 3C4XA 4FIGA 3R9HA 4A4LA 2WTJA 4WRGA 4CV9A 2ZMCA 4EKLA 1Y91A 3NYXA 3QYZA 4YTHA 3V01A 3VHKA 3G9NA 4IB1A 2QO2A 4UZHA 1ZYDA 4D2TA 5GZAA 4IEBA 3KK9A 4L43A 4N70A 2W1DA 3WF9A 5FZSA 5KMIA 3QALE 4OTQA 5BVEA 3BYOA 2I40A 2X4ZA 2VWYA 3OEZA 1Q3WA 1PXNA 1ZAOA 2J5FA 4I0SA 4LL0A 4XCUA 3A62A 3VS3A 2Y4UA 4C3FA 3COMA 2C3IB 2BILB 1IHGA 3SC1A 1M52A 4S31A 2XJ2A 1FINA 5HESA 3ZHEB 1YHSA 2KTYA 5CAQA 4QMXA 4FT5A 2VGOA 4W9WA 4A9RA 4JS8A 2Q7FA 4UQXA 4MD7E 3ORIA 2F7EE 2XYUA 3ZSGA 1MRVA 2R3MA 4TZRA 2YCQA 4AU8A 4C34A 5M56A 4QOXA 3EQHA 2R3IA 3IECA 3Q9YA 4OUCA 3LVPA 5GJFA 2A1AB 4DLJA 2KCLA 2R0UA 1MP8A 5CEPA 5ARGA 3QHWA 2CSNA 2XKFA 5FM3A 1E1XA 5G04C 2Q0BA 5CENA 2XJ1A 3AS8A 4NJ3A 4YJNA 3BRBA 4PTEA 3RK7A 3WIGA 4EKKA 3PDNA 5G05C 3OG7A 4UMQA 3FWQA 2WTCA 4FKRA 4CSVA 4IQ6A 3BE2A 3LY8A 2JKQA 3QWKA 3S7DA 4GKHA 2AC5A 1LEWA 2V55A 3DB6A 5L8JA 5KMOA 4XMOA 1JWHA 4FTAA 4GG5A 5G05J 4HZSA 4M15A 2XIKA 2XNEA 3ORXA 2QOFA 4GJ3A 2G15A 5IA1A 4IAIA 5JRSA 2LNIA 4Y6CA 1GIJA 3DV3A 4QYFA 4V04A 5K5NA 4I4FA 4A7CA 4MX9A 4I5CA 3UODA 4FZDB 4UWCA 4XV3A 2LGCA 4JT3A 4Y73A 2BKZA 3DBEA 4RWKA 2VO3A 2UW7A 5ANKA 1YXSA 4N57A 4QP1A 3ZSHA 1TQIA 3Q2MA 2QC6A 3GCSA 4HCVA 4N39A 3WIKA 3SGCA 5M57A 4CDRA 2ETRA 4X0MA 4J8NA 4KBCA 5AV0A 3RJCA 1BI8A 2PU8A 3TKHA 5AAGA 1PYXA 5CT7A 4QMWA 4RJ6A 4NEUA 3MPAA 4WIHA 4O38A 3BLHA 1UU8A 5A7DB 4DTKA 2OIBA 4RIOA 4RSSA 3QQFA 2WOTA 4IZ7A 3PZEA 3FKOA 3GI3A 4FA2A 2KCKA 2VO0A 4A9UA 4V0GB 2QOHA 5EH0A 1Q4LA 4XLIA 3MTLA 1UU7A 2HZNA 4N5CA 4FV8A 1FMOE 4G17A 5IQIA 4J98A 5FG8A 4HVDA 2GTMA 4F0GA 3VBYA 4I6HA 4O7SA 3IQ7A 4PWNA 1ZY4A 3HV5A 4AT4A 5BUEA 5K4JA 3LQ3A 1MQ4A 1X8BA 5ARFA 4O7RA 5FJYA 3VJNA 4UBAA 1P4OA 4FUYA 2RSVA 1UNGA 3AGLA 2KC7A 3UG1A 1YDTE 4WUNA 2Q0NA 3MBLA 5BNWA 5FWKK 2J7TA 3H9RA 5IA5A 4WSQA 3FFLA 4NU1A 3Q5ZA 3KKVA 4C38A 2B54A 2VTNA 2FH9A 2W7XA 4G1WA 2OH0E 3NYNA 4RVLA 4C3RA 1G3NA 4NKSA 2BFYA 3LFNA 3PPJA 3VS1A 2IVVA 4GIIA 4NSTA 4QQTA 3CVNA 5EHOA 2R5TA 5AJQA 3NRMA 4DFYA 2OOEA 1PMUA 2BR1A 3C0HA 3UBDA 5IA0A 3QD4A 2ERZE 4BCOA 2REIA 1TKIA 5A4CA 5C1QB 3M11A 4IJPA 3CKXA 4IX3A 3O96A 1U4DA 3UDBA 1Q41A 1GJOA 3NUSA 4BCGA 1RQQA 2HWOA 2EB3A 3QA0A 2VWIA 2VZ6A 3UO4A 5C8NA 5JFWA 4XYFA 4CD0A 4GVAA 5I9ZA 2UVYA 2Y8OA 2VWXA 3UZRA 4FEQA 2F2CB 3VBWA 5LCWJ 3U9NA 2HR2A 2YABA 4FKIA 4H3BA 3ZFXA 5B2MA 1B6CB 4W4XA 5CQUA 2DS1A 3O8PA 1FGKA 2F9GA 4GCJA 5HBJA 4EOPA 1JLUE 5GHVA 3Q9ZA 3W2RA 5JT2A 1XBCA 2Y4TA 4FT3A 3L1SA 1ZOGA 5HG7A 3LYAA 3HMIA 3R7OA 4KBQA 3TUDA 4MXXA 3SA0A 2UWJG 3D4QA 4IBMA 4AFJA 4OT6A 2C2LA 3IK3A 5AV4A 3FEGA 5DEWA 4QMVA 1YDRE 4UYAA 3TUCA 4MTAA 4XG4A 4BDDA 3F88A 3GFEA 2OJGA 3PXKA 5E8ZA 4B8LA 5KJLA 3U8WA 3MEKA 3IDCA 1SNUA 1ZU2A 1TJCA 5FZQA 4HVSA 5HIEA 1QMZA 4KRDA 4X6RA 3PXQA 4YHJA 1DI8A 4I6FA 4BDIA 3JUHA 1OB3A 3RHKA 4JQ7A 3WBLA 4LOQA 3FXZA 3AS4A 3NPCA 3TXOA 3ACJA 1H24A 1SNXA 4U9AA 3GXLA 5B7VA 2WIPA 1YHVA 1JSVA 3CE3A 4R1YA 4ZJIA 4BI2A 4FNXA 4UX9A 4HOUA 4HYHA 4EH8A 4PMPA 2OGVA 3PYYA 2XP2A 4XHKB 2ITWA 4EOOA 2V0DA 4FTTA 4GPKA 5KX8A 1FVVA 1GZNA 5IUHA 3ANRA 3DXQA 3V6RA 2CKOA 1KV2A 4DEGA 5FRIA 4LGDA 5L6OA 2VTAA 2OLCA 4M68A 3KRRA 4RJ8A 2PVLA 2OK1A 3BGQA 3FHIA 2QNJA 4JOAA 5DVRA 2CGUA 4BTJA 3E8NA 2FBNA 3EFJA 3EMGA 2V7OA 3V5JA 4FTMA 5JSMA 3UVQA 2UY1B 3GCQA 3GCPA 3OF0A 3U54A 4UXLA 2YCSA 1W83A 4JG7A 5IF1A 2YAKA 3FMHA 4LG4A 2ZAZA 1PXJA 1UWHA 5EI2A 5HI2A 1YOLA 4CT1A 3F6XA 4DGNA 5IA4A 2R7BA 5I3OA 3OP5A 5DIAA 2YQ8A 2BHHA 5FGKA 4U3ZA 2HOGA 1S9IA 3BHTA 3EN5A 1PYEA 2J90A 3MWUA 3F3VA 3H30A 4L8MA 4S30A 3KVWA 3OWPA 4BI1A 2F7ZE 4U44A 4AIFA 3H4JA 5HICA 5BMSA 3R9NA 3JPVA 1Q97A 4K11A 2JKOA 1KT0A 1XH5A 4RVTA 1PMEA 3HZTA 3OWJA 1OL1A 3MH1A 3V5QA 4BCIA 4FIJA 2OSCA 3Q6UA 3F5XA 4XIFA 5CCMA 4AZSA 3W2PA 3T8OA 5IEXA 4IADA 4W9XA 1UU3A 3UIUA 4D4YA 1GNGA 4WHZA 4PQNA 2ITNA 2JFMA 2VQ2A 2UUEA 3GT8A 3FKLA 3IW7A 2RFEA 5CT0A 3HNGA 2VSYA 3QD3A 2X4FA 2KCVA 3D5XA 1TQMA 4IXPA 5AWMA 3ZO4A 1UV5A 2XNGA 4ASZA 5H8GA 3TACA 5IG1A 3G5DA 3TDWA 2XEZA 4RX9A 4KIOA 4HGTA 3NNXA 4MBIA 1YKRA 4XUFA 3ZBFA 2VD5A 4QD6A 4TT7A 2IVTA 3DB8A 1Q8WA 3Q4TA 3QWPA 4QQJA 3UC3A 5JJ7A 4E6AA 1Q8TA 4XEYA 4JG8A 2J50A 2JBPA 2PZRA 2GU8A 3EQFA 4S34A 4XRLA 3SXSA 2W05A 5CEOA 5L2QA 5M53A 3IGGA 3MH2A 2VTRA 4DGMA 4EWHA 3L9PA 4W9RA 4M0ZA 3FBVA 4V01A 3D0EA 3UIBA 3C4FA 4QMMA 4QMTA 5KMKA 4IM2A 1ZXEA 2EXCX 4M12A 2J51A 5KBRA 4DAWA 3VS2A 4N2SA 2Z02A 1BI7A 2P33A 5LCKA 3MY1A 3OCSA 3VNTA 1WM5A 2C4GA 2R3QA 2XM8A 4ACGA 5HIBA 3DFAA 2ESMA 4FG7A 3ZRLA 5EX3A 2X9FA 2DYLA 3OOGA 3PIZA 4BFMA 4ME2A 3Q32A 4HYIA 1BL7A 4PRJA 1NZNA 2W4KA 5E4HA 2ITVA 4QNAA 2JKMA 3O51A 4JAJA 2PL2A 4RJ5A 1V0BA 3RPSA 1BX6A 2R3KA 4FVQA 2BDJA 5L2SA 5IZFA 1ND4A 4YC8A 4O0UA 4UI9J 1E9HA 3ETAA 3EYGA 2HYYA 3HRCA 1W3BA 3SV0A 4FZFB 2R2PA 4YZNA 2EVAA 1GOLA 3EN4A 5HVYA 3RP9A 4R6VA 3QWVA 2A27A 2XKEA 3GCUA 1H1PA 3C5UA 3O17A 4ANOA 4AZTA 5M51A 4TW9A 3SD0A 4W4WA 3KA0A 4GIHA 4NIFB 3LPZA 2JFLA 1ZZ2A 2UZBA 2XCHA 3LLAA 3DGKA 4J7BA 3P7AA 2QD9A 3ZBXA 2YN8A 3SG8A 2WD1A 3F2RA 3ID6C 5J1WA 3LFSA 1U5QA 2EB2A 2PVRA 4UYNA 3AMYA 3SOCA 4ANBA 4IC7A 1IA8A 4L46A 3UO6A 5AUUA 2CNUA 3K3JA 3D7TB 5KO1A 3TJDA 3DJ5A 4U3YA 3NZ0A 4D1XA 4FV3A 3WI6A 2XUUA 3F3UA 4AT5A 2WQOA 2C6IA 3UC4A 3I0QA 4DGLC 3OEFX 5CI7A 4KUJA 4EOLA 5KJKA 1SVHA 3OC1A 4HCTA 4MXAA 3COKA 4EH4A 1WBWA 4USEA 1MQBA 5LMKA 3CIKA 3ZO2A 3F5UA 2CKEA 4JA9A 5C26A 3QZHA 3AT4A 3ZHEA 4O7LA 3U9CA 4N3AA 4QYHA 4GYIA 2BKKA 4UWYA 2C3KA 4PX6A 3RK5A 5AA8A 3PJCA 4ZIMA 5HD7A 4KIKB 5AR7A 4HVIA 4DTBA 3CEQA 4H39A 5HGIA 3RWQA 3QF9A 3V04A 3QLFA 3QRKA 3N4UA 1FPUA 3D5VA 5IISA 4H36A 3IPHA 5JFSA 3WYYA 4XOZA 4G3EA 3KU2A 4I6QA 2WQBA 1H01A 4RA4A 1WBNA 4BWRA 3AC4A 4YMJA 4DTAA 3K2LA 3QHRA 2YIWA 3BHVA 2YM8A 4LUEA 5I9WA 2YDIA 3TZ7A 4O7TA 4IZYA 2JDRA 5CQWA 3U4TA 3DK7A 3E3BX 4BBMA 4IW0A 1BMKA 3NX8A 4XV1A 4B0GA 3TZ9A 4DH1A 4FIEA 4C02A 4QP9A 4ZLYA 3ORMA 5I9XA 1E96B 1MUOA 2C3LA 4QTDA 5GJGA 4BR3A 3RCJA 4FVRA 4I22A 4IVAA 3RK9A 3TG1A 4QMQA 4I17A 1OBDA 4ZJVA 4IB5A 4ZTMA 5KJMA 2YJSA 3LKUA 3NUPA 4P2KA 3R9RA 3ACKA 3ALOA 2IZRA 1JKKA 3QRUA 3CD3A 1UU9A 1YI4A 4OGRA 4USDA 5EOBA 3WARA 4EHGA 4EC8A 2J0MB 2JGZA 2VX3A 3P78A 4MNFA 5L3AA 2E9PA 2QR8A 4RX8A 5IQAA 5CAVA 2WMAA 4ANLA 1F0QA 5AX3A 4FZ6A 4Y72A 4D4SA 5A3XA 5DFPA 4I5HA 4NW5A 2W1GA 2QOLA 2XA4A 4AA0A 2WMVA 1B39A 3GUBA 4L3LA 2OJIA 2WTWA 3MV3B 3P7BA 5EM7A 5HCYA 5J1VA 3N51A 4ABNA 2E2EA 1XH8A 3REPA 4AGUA 3MN3A 3PWDA 2GQRA 4BT9A 3DNEA 3MJ2A 4PL4A 4PTGA 3IW4A 4LGGA 4O7NA 4K18A 5AP2A 2GMXA 2Y7JA 5DH3A 4ZOGA 3ZXZA 2YA9A 3NNWA 2VTTA 4FZAB 2NRYA 3MS9A 3SXRA 4AM9A 4AQCA 1QPEA 3GC0A 3V51A 4NL0A 5J9LA 3ORKA 4EI4A 5DYJA 1ZLTA 4OW8A 4BDBA 4BY9E 3HDMA 2CCIA 3EZVA 3LFCA 4PP7A 4L45A 2ZM1A 4U5JA 5A6NA 4AW5A 4YJRA 4JR7A 4RQKA 2CDZA 4H7YA 3NR9A 4E4MA 1WAKA 5FDXA 3VW8A 3D5WA 4U6RA 1IAHA 4YPDA 4DGOA 5EI6A 4CMTA 3GEQA 5C8MA 4BDFA 3QTWA 4CLIA 5CXHA 5C27A 1CSNA 4EOMA 3MA3A 4YLJA 1OVEA 3HRFA 2ZOQA 3Q5IA 4KIQA 2AYPA 5BVDA 4H58A 3WF6A 3AD4A 3N9XA 3TEIA 5DPVA 4LYNA 3DLZA 4D0WA 3EQDA 3SQQA 1OPKA 2ZDUA 3U6IA 4MD8E 4QPAA 3PG3A 1YXVA 3R9DA 1QZ2A 2PVKA 4JBQA 4JX3A 3WOWA 3R22A 4CMOA 4M69A 5GJDA 4EH6A 4HOTA 2QO9A 2BCJA 4QMPA 4AN2A 3GU5A 3NW6A 4D2PA 4EOIA 2R9SA 3VJOA 3SF4A 3Q5MA 2RIOA 3PXYA 3LY9A 4X3JA 1PXIA 4I6BA 3LCOA 2CHLA 3IW5A 4LV5A 2QURA 3PFQA 2WGJA 5HVKA 4KS8A 3TNQB 2WFYA 1STCE 3R7IA 4A06A 3IDPA 4FMQA 1KE5A 3GQIA 3LCAA 3DBFA 2W17A 4BCHA 3DAJA 2VTQA 3H9FA 3CJFA 4FKVA 2QOIA 4FTQA 4WRSA 3PSBA 1YXXA 3G9LX 5IPJA 4BGGA 3CTJA 5CSPA 5G6VA 4YNDA 1P5EA 2J9MA 4TXCA 3GP0A 4IMYA 4EEVA 2BIYA 3V8SA 1KWPA 4KXKB 3FLWA 3KRWA 3WZUA 4XBRA 3OZ6A 5FTPA 3Q49B 5GNKA 4CQEA 2A2AA 3PVUA 2IZUA 2RF9A 3HA6A 3PXFA 4MEDA 2ACXA 3LLTA 1YA0A 3DT1A 4C3PA 1H26A 4OTPA 1FMKA 4FG8A 2JDSA 4FSYA 4YJVA 5K3YA 5HU9A 4E73A 4G26A 3Q6WA 4WUYA 4GYGA 2YISA 2UW0A 1CTPE 3EOCA 3I60A 3CY3A 1XH9A 2HXLA 5CASA 4QT1A 2XK4A 4L3JA 2QCSA 3R7VA 2FF4A 1YXUA 2WAJA 4F6UA 2W4JA 1OL5A 1H27A 2A4LA 2JITA 3I0OA 4ZY6A 4JDKA 5HOAA 3EFKA 3RZFA 3KEXA 2XBJA 2J4ZA 1V1KA 4EK4A 4JBOA 5IUGA 3GOKA 3LCKA 3I5ZA 4FSQA 3RVGA 4QYGA 5B2LA 3ZC5A 2YWPA 2BFXA 4FKSA 2YFXA 3DDPA 3FE3A 4U43A 2OXXA 3BI6A 3MGYA 2BIKB 4AF3A 4HPTE 4G3FA 4FSNA 4J8MA 4I1AA 3WZJA 3P9JA 4IAZA 3IDBA 3FLSA 4Q5HA 3ZEWA 2VWVA 3ZCLA 3LIJA 4UALA 1Y57A 2WMXA 3P08A 3P86A 3QFVA 4NWMA 4RG0A 4E26A 1PF8A 4MAOA 4O0SA 5AR8A 4BDHA 4RC3A 2B9IA 1OZ1A 4WBOA 2J0JA 4H1JA 2F57A 5KZIA 4DG2E 4YNOA 5KHXA 3R2YA 4K0YA 5FXSA 2WIHA 4F6SA 5K9IA 4E5WA 4EJNA 2PZPA 3C9WA 2Z7LA 2PE2A 2OICA 2VU3A 5D0OD 2NRUA 3HAVA 2JDVA 3OROA 4J53A 2YAAA 2BUJA 3TKUA 2OXYA 4GT3A 5JGAA 3BKBA 4NT4A 3PIXA 4B7TA 3AMBA 4GCOA 3NWWA 4O6FA 2JDOA 4EYMA 2ITXA 4M66A 5A46A 1LR4A 2WMTA 3DY7A 3TIYA 3ASHA 4M7IA 5CSVA 3KGAA 3V5LA 4Q9ZA 4GCNA 1RDQE 5FXRA 3A61A 5KJNA 4CZYB 4U45A 3KCFA 3R00A 2VRXA 4Q9SA 2VSNA 4E5BA 2WELA 4FEWA 4OAUC 4M3QA 4FL2A 2UZOA 4FV0A 4DH7A 2OKRA 2WB8A 2XM9A 2ZM3A 3ZFMA 4BCKA 5KUPA 3Q15A 3L8VA 4BTBA 4FOBA 2R3HA 4ZP5A 2WHBA 4JAIA 4QMUA 3P0MA 3BQRA 1KE6A 4WA9A 4AFEA 5EYCA 5FP5A 3UP2A 1M2QA 2QLUA 3UP7A 3VBTA 4G5PA 3VS7A 3MFTA 4FSUA 4I9CA 4L44A 4WNEA 2YM6A 4BIDA 4IM0A 4HVGA 4GU9A 2ZV8A 4TWCA 2IJMA 1H08A 2P4IA 5EW8A 4IAYA 4BDAA 4NTSA 3U51A 3FY2A 2R3RA 3N4TA 3PA4A 3KFAA 4JL9A 4AACA 5DBKA 3EN6A 3PG1A 3QWJA 4QMLA 5FBOA 2VTLA 4O27B 4WNOA 1JOWB 3GGFA 4JVGA 3FZSA 2RGPA 5FT9A 1Q5KA 3QGYA 4JIKA 4AW1A 5DIZA 2JIUA 2RFDA 3KAEA 5LMKC 4J8DA 1REJA 4J52A 2HW7A 3ULIA 3VUMA 5M4FA 4ITHA 4O6EA 3KULB 3LM5A 2YCRA 3D94A 4E4XA 5GIPE 3TUBA 3TGOA 2JBOA 4RJ7A 3FY0A 3NVMB 1YW2A 3E8CA 1W84A 3NLBA 3QTQA 2PK9A 2QOBA 5AP6A 4MWHA 3EYHA 5ANDA 4A4OA 2C6LA 5HO6A 3VBVA 4BF2A 4F0FA 1ZYJA 3KULA 3DU8A 4AUAA 3L8XA 3AC2A 5M06A 4O0VA 3S0OA 5J87A 1R3CA 4I0TA 3TV6A 2ITTA 3MY0A 4ENXA 3W10A 3A4OX 1TVOA 4OBOA 4BGQA 4YC3A 3P1AA 3QC4A 4FT0A 4U80A 4II5A 2E9OA 2FSMX 4MK0A 2RKUA 4BCJA 2W5HA 3OXGA 1WVXA 1OKZA 1P4FA 1OL7A 2R3NA 5LCWC 3LFQA 3KF4A 4RX7A 2YZAA 4KINA 4QP8A 3C4ZA 5AV3A 2ZMDA 5CSXA 1SVEA 2LAVA 2BAQA 2VO7A 3D7TA 3JS2A 2XJ0A 4LV8A 4BC6A 4PNKA 4OR5A 5IA2A 4FK6A 4F65A 4C35A 4F3VA 1HOWA 2RG6A 5F94A 4DBXA 3R63A 3EJ1A 2YIQA 3ZZWA 4FV1A 4ITIA 5FEEA 3KXGA 1OBGA 5IQBA 3V5TA 3KRLA 3OUKA 3EN7A 3HX4A 4C36A 2IO6A 4UMRA 1WBPA 4Y5QA 2JD5A 2R3PA 2VX0A 4GA0A 3I4BA 3GU4A 3VS0A 2CN8A 1FGIA 4TN6A 5BPYA 3TV7A 3BU3A 5IDPA 2R5SA 3PLAE 2CN5A 4RWLA 4XG6A 3P79A 2PTKA 4ALWA 1O9UA 3ZLWA 5M44A 3QAME 3UVRA 4UI9C 4XI9A 4W4VA 5HG8A 2UZTA 3A2CA 3Q52A 2WMWA 4E1ZA 4BRXA 4KS7A 1ZYCA 4CFNA 4L3PA 4BWPA 1WBOA 3QUEA 5A9UA 3OT8A 4DHFA 4FT9A 2W9FB 3S7BA 3DZOA 1UWJA 5CTPA 1OKYA 4OTHA 5AP5A 3ZZEA 5HNIX 3QD2B 2XK8A 2QI8A 4D0XA 3FC2A 1R39A 1WBTA 5JRQA 3KD7A 1BL6A 3FL5A 4QP6A 5TE0A 2PUIA 3LMGA 4PMMA 3P5KA 5AX9A 2VV9A 4JLCA 3KS2A 1H1SA 2R3LA 2X2MA 4KA3A 1Y8MA 4HOQA 4IZ5A 3OY3A 2XEYA 3CY2A 4I20A 3NEWA 1KOBA 5D10A 5E8WA 1K3AA 3CS9A 3OBGA 3QTRA 3O8UA 5HLPA 4DEEA 4RG6A 1U46A 5A6CA 5JZJA 4A9SA 1NA0A 2C1BA 3UQ3A 3QCXA 3OXTA 1QPCA 4JQ8A 4CMUA 5I9YA 1UKHA 3V3VA 2I6LA 2XS0A 3RBWA 3S4QA 4J8FA 3QGWA 3FLNC 2ZDTA 4G3CA 2QVSE 3LXPA 4N4SA 2J9QA 4WBBB 1J1CA 4DBNA 3R6XA 2XK6A 5HD4A 3UOJA 3CSVA 2W0JA 3IS5A 5BYYA 3QRTA 2IW8A 4GSBA 3LPBA 1Q62A 1PMNA 2IPXA 5IDNA 2FVDA 2V62A 3I5NA 5LVMA 4CYJA 3AC1A 5AR5A 5BVWA 3FPMA 4FKUA 4AN3A 1PC2A 2R3GA 5M07A 3BWJA 4S2ZA 3ZRMA 4NFNA 1S9JA 4YO6A 4YJUA 3R7UA 5JFVA 2I1MA 2MHKA 3SZ7A 2O63A 5E8SA 3S3IA 4NKAA 4AA4A 1YWRA 5J7BA 5F4NA 3PJ3A 5HVJA 4U0SA 3FZOA 2DUVA 1NVQA 5A4LA 4EH2A 1YWVA 2X8IA 3RNIA 5A14A 4EQFA 5FP6A 3WZDA 4E6QA 3F7ZA 2C6MA 2XYNA 2P0CA 1WVYA 4BHZA 2B0QA 4CTCA 3ZHPC 3NVKI 1JNKA 4YTFA 4Y6WA 5DI1A 2C6EA 2EXEA 4RFYA 4CFVA 4PDYA 4UMTA 1APME 3MFRA 3ZEPA 1ELRA 2BDWA 1DAYA 2H6DA 2OFVA 2Z2WA 5TT7A 4Z16A 4YHFA 4IAKA 1YI3A 2PQRA 3RO3A 4O21A 4ZTQA 2W96B 3C50A 3MPTA 4AA5A 3JY9A 3R04A 2XNBA 4FTKA 4D4RA 3O7LD 3SRVA 3ULZA 2YM7A 5KBQA 4IX5A 4KIPA 1NY3A 3FLZA 4FK3A 1BUHA 3VAPA 3KK8A 4D58A 3LKMA 3N4VA 4JA7A 5BUIA 4FT7A 3BYMA 3II5A 3MPMA 1CMKE 4YZ9A 3W2CA 4A9YA 4CRLA 5DGZA 3GW4A 5JQ5A 4EC9A 3PUPA 3ROYA 3ZH8A 3NUYA 5DBXA 2Z7RA 1PXOA 4I21A 3U6JA 3FSKA 3ORNA 4NM0A 5TOZA 5CEQA 4L53A 2WMUA 4ZXTA 5EM6A 5LOHA 2H8HA 1Q8YA 2GCDA 2ZV7A 3AT3A 1SVGA 4AZWA 4E4LA 5C8KA 4S33A 2YZLA 1OPJA 3V5PA 5E1EA 4G3GA 1XBAA 4JI9A 4F7LA 2HY0A 3RMFA 4ASXA 1P14A 4RJ4A 4EUUA 4MQ1A 2QO7A 3QTUA 3BEAA 4O0YA 2E2BA 1W0XC 4F7JA 1OM1A 2RFSA 3LQ5A 5M72A 5L2TA 2ITQA 1W7HA 1IG1A 3QQUA 4GK2A 2DBAA 4CLJA 4QP2A 3OMVA 2F4JA 3LM0A 2CMWA 3RINA 3EQCA 5GZ8A 5J79A 5IEYA 2BAJA 2PVNA 1VEBA 2UW3A 3PA5A 2UZNA 3E62A 4U8ZA 3TTIA 4F6WA 5LCJA 2WOUA 5ETFA 2I0VA 2WNTA 4BTAA 1PXPA 2PZIA 2VTPA 4L68A 5HQ8A 2ZV2A 5HO8A 3TL8A 3Q9XA 1FOTA 2BAKA 3FL4A 1YXTA 3POOA 4N6YA 3H9OA 4ZTNA 2XKDA 2J6MA 2XNMA 2OH4A 3IO7A 1GZOA 3RAHA 1ZMVA 3HL7A 2GHLA 4CFUA 3NYOA 4RFZA 3HP2A 4EQMA 4IDVA 4EZ7A 4D5KA 2Z7SA 3BHHA 3ZXTA 2CPKE 3BU6A 4TL0A 1U5RA 3QZGA 2C5OA 2UVXA 4BCMA 1QPJA 2HIWA 3PTGA 4P90A 5HCZA 4ZSAA 5CSWA 3S7FA 2B52A 1M7NA 2F49A 3B2TA 4KRCA 2CNVA 4ACHA 3HLLA 3F3ZA 3CTQA 1KT1A 3R8MA 1W8CA 4OAVB 4W4YA 4NUSA 4X3FB 5CAOA 2V7AA 4FTRA 5AP0A 5EDRA 4ZSEA 3KMMA 3QKYA 3PVBA 3R30A 2XIRA 4XP3A 3VF9A 3ZN3A 2JEDA 2CJMA 2BTSA 3FSFA 3TI1A 4L00A 4X3FA 1K2PA 4OTRA 3QRIA 4BYIA 2UZEA 4GA2A 3NNVA 2XIZA 3GZ2A 3LOKA 4TNBA 4RIWB 4GUBA 2WPVA 4BCQA 1FVRA 4TWNA 4X2GA 5E9EA 2YJRA 5TO8A 5BX0A 3GFWA 4EH9A 4WNPA 3UNJA 2WTDA 4QPMA 4QYEA 5IQFA 4C7TA 2HW6A 4KSQA 4O0TA 2Y4IB 1B38A 3BWFA 1QPDA 2B4SB 3LXKA 4Y95A 1T46A 3UVPA 4BHNA 5DR9A 3QRJA 4GU6A 4GVJA 1KSWA 2H96A 3Q47B 3QKMA 5FBNC 3R71A 3K5UA 3CXWA 4TPTA 3MKRA 5JJ6A 3F2AA 4HZRA 2PVHA 2EUFB 3NW5A 4RJ3A 3ESKA 3SW4A 1BKXA 2GS6A 3TJCA 2GHGA 4JRVA 4CCBA 1J1BA 5A54A 2WQEA 4EH5A 2Y4PA 2FGIA 3TKIA 4X2NA 4L52A 2OG8A 3I1AA 2VYIA 4FSZA 1R0PA 5CNOA 2X0GA 5K0KA 1OIRA 4M67A 4YP8A 3FLQA 3Q53A 1H1RA 4E6CA 1XH6A 1CDKA 2PUUA 3R28A 2NPQA 1MRUA 2QODA 4KD1A 2BRBA 2ITYA 4RG9A 5HBEA 4OTDA 4F0IA 5M4IA 1ZZLA 3PSCA 3R9AB 2W99B 3DAEA 4ZZOA 3OS3A 5BVKA 2Y6MA 5JJTA 1K9AA 2HAKA 3MA5A 3I7BA 4JQEA 1SZMA 2G01A 2O8YA 3DKCA 4GT5A 4XG7A 3BCEA 3FMEA 3UYSA 3C51A 4EJ7A 4NW6A 4BI0A 3FPQA 3F5PA 3KB7A 5IQCA 4FKPA 3HV7A 4AE6A 4GZ5A 2UW5A 4BWKA 3CC6A 3MH3A 4MF0A 3KCKA 2RL5A 3C5IA 1PY5A 5CAUA 3O0GA 3PVGA 4HNFA 1XH4A 3Q3BA 5FD2A 1WFCA 1NA3A 1NA7A 5H8BA 4LEUA 4Y46A 3R8UA 3L8SA 2JIIA 4ITJA 2Z8CA 4LL5A 2V5QA 3C1XA 3PA3A 5DR2A 4D4VA 4YSMA 3ZFWA 2BPMA 3HMMA 1OUYA 3HGKA 2VTMA 5EHYA 5JGBA 2FO0A 2YWVA 3OW4A 4JIAA 4QMOA 2BZIB 2XGOA 3TG5A 1Y6AA 2PZ5A 3MVLA 4CFXA 5IQHA 3E93A 2W5AA 4MXOA 4BKJA 4UEUA 2X39A 4RFMA 5FLFA 3JXWA 1BYGA 4FYOA 5M08A 2DQ7X 4F9BA 4ARKA 3F9NA 2W1EA 3AG9A 4XP2A 2G9XA 4AZEA 3ZLYA 5EKQD 3ZC6A 4NCTC 3LMHA 1IASA 4FL3A 5CZHA 2GQGA 2ERKA 2Y4IC 3ZDIA 4BIEA 5I5ZA 2BDFA 3V8WA 3ZOSA 4LMUA 4BTKA 4FV6A 4PL5A 2NNWB 2I6HA 4HCUA 3UUXA 3QWWA 3COHA 2YLFA 1OECA 4I94A 3ZS5A 4EK3A 4G23A 1FBNA 1JAMA 3POZA 5AR2A 5HU3A 2C5VA 5JGDA 5DOSA 4E93A 4X2FA 3I79A 4DEBA 1B89A 4DEAA 4G6NA 1ZYSA 4GUEA 4GG7A 5TKDA 5FEQA 5ANEA 4K8AA 3UPXA 4TYIA 5C1DA 4R7IA 4BL1A 2OF2A 3FP3A 5AMNA 2WMQA 4N0SA 3CLYA 4O7WA 3B2WA 2BZKB 4I0RA 3RJVA 3UG2A 3R1SA 4CGVA 2VWWA 2J0IA 2BRNA 4XV2A 4YHTA 3FZ1A 5LVLA 3MTFA 5HIDA 5CEIA 2KATA 4U0ZA 2OO8X 3KQ7A 3QQGA 4AXAA 5DHJA 2X6EA 4I1ZA 4D5HA 4WNKA 3LJ1A 4JX7A 3KN6A 3ZM9A 4NZWB 4ANSA 3UTOA 4NRHB 4CKJA 3MDYA 2YACA 5E8YA 3UZPA 2ONLC 3BYUA 4DN5A 3TG4A 4X2JA 4ZJJA 4P5QA 3QTIA 2PMNX 1Q8ZA 1ERKA 2YIRA 5DE2A 1SM2A 4QMYA 5K4IA 3QOUA 4O81A 1RE8A 4M69B 5EYMA 1OKWA 3BBTB 3PRIA 4DT9A 5EDPA 5HG5A 3CQUA 3WE4A 5DRBA 1KLXA 2QU5A 2XB7A 3R8VA 5CU2A 4G24A 1ZY5A 2UW4A 3B8QA 4H05A 1F5QA 3FZRA 3LFEA 5ANOA 2G2IA 3KRXA 3MFUA 4FF8A 4Z7GA 3FMDA 1O6KA 3C4WA 3C0GA 3I6UA 2ZM4A 4DEDA 2IW6A 1H28A 5LARA 3O48A 4DFXE 4QQ5A 4PY1A 4BKYA 5L8LA 3O50A 4RC2A 4EWQA 3IW6A 2VGPA 4V0GA 4C0TA 1A9UA 2FYSA 4XV9A 1MRYA 3ZYAA 2JIVA 3CGFA 4CKRA 1QQEA 4XS2A 3Q60A 3RPOA 3H0YA 4IAAA 2I0YA 4PPBA 5CU3A 3RI1A 4G16A 3QQJA 3L9MA 3WE8A 3RM6A 3ZUUA 1PHKA 2C0TA 3TAXA 4RIYB 4JBVA 4MF1A 4C4JA 3VUDA 4DYMA 3DNDA 5E7RA 4TY1A 4EYJA 4DFNA 2PVYA 2O3PA 3QX4A 5ANGA 4E6DA 5DLSA 5T6KA 4JG6A 4B99A 4IWOA 2PWLA 2PMOX 3BZ3A 4FIHA 2GS2A 3R0TA 4FTCA 4Q5EA 2OJJA 5LWMA 4KIKA 4F7SA 2B7AA 5FUTA 4QP3A 3ODYX 3PIYA 3W18A 1A17A 3Q4ZA 4K6ZA 3Q4AB 1VYWA 2YM4A 1YOJA 3ZPJA 2GNGA 2QG7A 3ATTA 3GB2A 1OITA 2YERA 4APOA 3PVWA 2PQNA 3RAWA 2VN9A 4J96A 2VTIA 4ZAUA 3FQEA 2Y6OA 4WO5A 3VS4A 3UNKA 2UW9A 3TNWA 5I4NA 2WMSA 2PVJA 1XNFA 3CKCA 4G5JA 4IE9A 3DJ7A 4HGEA 4IJ9A 2HENA 4QMSA 3G15A 1SMHA 3OTUA 3C4EA 2GSFA 4U0IA 4ZSLA 4M8TA 2PL0A 5HHWA 2QOOA 3SRVB 4KSPA 4O1PA 5HI7A 4IX6A 4ASEA 4IACA 2XMYA 2W1HA 4F1TA 5GIOE 5AUYA 3LJ2A 3I81A 4FEVA 4ZY4A 2XPIA 5BUJA 3BLQA 1PMVA 1RJBA 3KMUA 1NVSA 3W16A 2VTHA 4AZFA 3FLYA 4OLIA 1LPUA 5C03A 2FI7A 5FZRA 1XWSA 2CGWA 4ACDA 4XLVA 1XBBA 1OI9A 1OUKA 2C68A 3NCGA 4AW0A 5IU2A 3QCYA 3VUKA 2LSVA 4G3DA 4HORA 3FQHA 4GK3A 3CKWA 3UPZA 4EK8A 2PZYA 2WTKC 3EL7A 3R1QA 3U4UA 1A06A 3G6HA 2NC9A 3MB6A 4U07A 3A7FA 3TM0A 4FV2A 3UGCA 2O65A 3HV4A 3IONA 3ZO3A 4X21A 4R8QA 2SRCA 3MIAA 4EBVA 2HYZA 3CCNA 2ZYBA 4J97A 4OBPA 4XG9A 1OIYA 3VWAA 3ZGQA 2ETKA 2HELA 2BZHB 1NW1A 3OD6X 3V8TA 3DK6A 4YZMA 4WUAA 1J7IA 5AP1A 1CKIA 5E91A 3P4KA 3ZONA 3W32A 4C8BA 4E8AA 4CG8A 3R21A 3R01A 3NUNA 4FG9A 1URWA 2Y9QA 4XJ0A 2EU9A 2WQNA 1VJYA 4LMNA 4PL3A 3VBQA 4TYJA 3TT0A 2WTKB 1HCKA 4GFOA 3UMWA 3HA8A 2WMBA 5DA3A 3ZU7A 3DBDA 2NO3A 3NW7A 4MQ2A 2YM3A 4G9RA 3NYVA 4KBKA 2WEVA 3OCTA 4C2WA 4WNFA 4AGCA 3E63A 3F5GA 3ZFYA 1GAGA 4BDKA 3IW8A 4H1MA 5HX6A 2YEXA 3ZMMA 2WZJA 4EH3A 3FKNA 4FTOA 4XNEA 3PDTA 2R3OA 4FKLA 1IRKA 2OBJA 3S95A 1J7LA 4YVOA 2OF4A 3HMOA 2O5KA 4BDGA 3G6GA 2GNFA 4ZMEA 2ITZA 4FKJA 5CVGA 5J9YA 5EK7A 2C5NA 4IVCA 4CQGA 4IN3B 3R8LA 4RA5A 2HWPA 2WTVA 3S2PA 4F70A 4P5ZA 3OWKA 4LM5A 4TYHA 2YM5A 4HJOA 5DMZA 4DF3A 3PJ8A 3JVSA 4HYSA 4ALVA 4D2VA 2IWIA 3AD6A 3JYAA 2X2KA 5AAEA 4OTWA 3FJQE 1PJKA 5G1XA 3MH0A 4ASDA 1WVWA 3PLSA 2ETMA 3S7JA 3ASFA 4AOIA 4ONAA 4PDPA 2PMLX 4FKOA 4YJPA 3VQHA 3TN8A 4PMTA 3OCBA 4QQCA 3WZKA 3RZBA 5BNJA 4IM3A 5ANIA 2C6OA 2J0LA 2OZAA 2ZB0A 5D12A 2GQSA 5HORA 5TF9A 3MA6A 4LQMA 3VULA 3E92A 4DG3E 2XK9A 4DFLA 5CXZA 1LP4A 3ORZA 1DAWA 4RIWA 3WF5A 5FEDA 4J95A 2PPQA 4FR4A 4LRKA 4D2WA 2WPAA 4YBJA 3G90X 4AP7A 1G5SA 2OW3A 4L7FA 2JC6A 4E20A 2XIYA 2YIXA 3NGAA 4PPAA 1Y8YA 3UMXA 2GTNA 5C9CA 3ZUTA 2BROA 4TYGA 2QOKA 3GC9A 5DRDA 4I5PA 4JXFA 3DCVA 4DE4A 4IANA 4Y83A 3RCDA 3LW0A 3ZLSA 2HK5A 4RZVA 3ELJA 2OU7A 1W82A 4C62A 4DFUA 4USFA 4ANMA 3NF1A 3EQRA 3HMPA 4YLLA 3A8XA 3L9NA 4EZ5A 3ZDUA 3NIEA 5EM5A 4C57A 5D11A 4FL1A 5IQDA 4DEHA 5CANA 1P2AA 4JBPA 3VIDA 4I2ZA 1UVRA 2XIXA 3QL8A 3SW7A 4MYGA 3BYVA 3PXZA 3C13A 4Y8DA 5F9EA 3T3VA 4MBJA 5IQEA 3F3WA 4LRJA 4MNEA 3L8PA 5L2WA 2G1TA 1OIQA 2HZ0A 3EQGA 5LVPA 3CKBA 3QA8A 4BZOA 4YGAA 1JBPE 4NYEA 5KMMA 3IG7A 4CZTA 2XBAA 2X7OA 2W1ZA 5DT3A 4CTBA 4JDIA 4TNDA 4AE9A 1U59A 1U54A 4CXAA 1JSUA 2BHEA 3BHUA 3ROCA 1WAO1 3QKKA 5LVOA 3ASDA 4J8EA 5CLPA 2PYWA 1OKVA 4TWOA 4UN0C 1VZOA 1H1QA 3CTHA 3LCTA 4RPVA 5HG9A 4TYHB 1R0EA 3TNPC 4GW8A 1IAJA 2GHMA 3SAYA 2P58C 4L42A 2EWAA 3Q9WA 3UNZA 3QXPA 4F7NA 5ICPA 3BEGA 3IOPA 2I0EA 4I9EA 2E9UA 3LFBA 1XJDA 1XKKA 2BVAA 3KXNA 3OFMA 2AC3A 4KABA 2W4OA 4EOSA 1L3RE 3G2FA 2ITPA 1UNHA 3JY0A 1KE8A 2B9FA 4MHAA 4FSRA 4XOYA 4A9TA 3F61A 3RKBA 3SOAA 4DLIA 4K9YA 3NIZA 5IUIA 4EORA 3QZFA 3CVPA 2BRGA 4R7HA 2CGVA 2X7FA 4FV7A 1AD5A 3I6WA 4IX4A 4UWBA 1DS5A 1ZMWA 4ZSJA 4J99A 4BKZA 4BZNA 1UNLA 3ULQA 4RQVA 4B9DA 3F69A 3UQGA 2VTJA 4O7YA 2C3JA 1G8AA 5G04J 3GC8A 3KXXA 4PPCA 3OY1A 4ZTLA 5CS6A 4FSMA 4D2RA 4KYOB 4R5SA 4UQZA 3UPVA 3QTSA 1JVPP 4BGHA 2XH5A 3A7GA 4E4NA 3WZEA 2WO6A 5DT4A 3ORPA 4B6LA 3PE2A 4ACCA 3JVRA 4H3QA 3HYHA 3TNIA 3WXXA 4I41A 4WSYA 1F3MC 4IVDA 5F1ZA 4IVBA 3IGOA 3NNUA 3ITZA 4RC4A 1OL6A 2VAGA 3ZM4A 5BW8C 4GKIA 3FI2A 5D0QD 3GU7A 5E8UA 4JJRA 2EXMA 4AGWA 3E5AA 4FC0A 1CKPA 3OWLA 4IAFA 3DTCA 3QLGA 5J7HA 4D1ZA 4BT8A 3ANQA 3THBA 3RO2A 3MB7A 5K0XA 1OIUA 3DDQA 4DCAA 2X1NA 2QG5A 2QOCA 3A4PA 4RIXA 3U87A 3BYSA 5HTCA 3BV3A 4NQ0A 3ZSIA 1ZMUA 1JPAA 2C47A 2GS7A 4HGSA 5EQEA 5ACKA 4CGAA 3LAUA 4L6QA 3WYXA 4AWIA 4ANNA 2VUWA 3CQWA 2X2LA 2W1IA 3COIA 4RT7A 3W1FA 4Z7HA 2YHCA 1YRPA 4QMZA 4ERWA 3UOLA 1YHWA 3PWYA 3MV5A 2CKQA 4FV5A 4W8DA 1I44A 5BT1A 3D5UA 3DKGA 4GFGA 4KKHA 1E1VA 5L6WL 2P3GX 1JKTA 1YI6A 1VR2A 4M13A 4NTTA 4D1SA 4IH8A 5FDPA 4AY5A 4O6LA 3MESA 1KE9A 3I7CA 3RPYA 4A07A 3DBQA 3AC5A 3FQSA 3MIYA 5L8KA 5ACBC 3SG9A 4BCFA 5IH5A 4R78A 5CSHA 2XNPA 2B1PA 3AXWA 4C59A 4KB8A 3TIZA 3ET7A 4EQUA 1JQHA 5EHLA 1RW8A 4G34A 2E9VA 1WZYA 5CHEE 5FTGA 3FXXA 4YTCA 3ERKA 2C0IA 3W8LA 2VGYA 4BDCA 3CR0A 4L9IA 5HE3A 4CGWA 5DG5A 3GYZA 4UMPA 4O1OA 3OOMA 2JAVA 4EHZA 2OFUA 4G6OA 3VS5A 5CVFA 4O7ZA 1XQZA 3DPKA 4DEIA 4YUQA 2F7XE 5DNRA 5EKOA 3FDNA 4Z3VA 2GFCA 5LWNA 3ODZX 3LXLA 2Z7QA 1M17A 2WKMA 3M1SA 5DR6A 4I5MA 3QKLA 2OIQA 4D9TA 5KKRC 3PPZA 3UYTA 5BQ0A 4G1TA 1J7UA 2B55A 4MXYA 4ZTSA 4HYUA 4IZAA 4F9WA 1PW2A 4AGDA 4EZ3A 4YJTA 3FI8A 4O96A 3EFLA 4I93A 2XNOA 2GNLA 4RMZA 4HPUE 3SX9A 4D28A 4FVPA 3RM7A 3P7CA 1A48A 4OBQA 5J9ZA 4GZ3A 4RIYA 4BYJA 2DWBA 3RPRA 4J71A 3CV0A 3TZMA 4QTAA 3R8PA 2HZ4A 5E92A 4DCEA 2FUMA 4UB7A 3URZA 5AUTA 4FV9A 2HCKA 3IKAA 4UMUA 2WEIA 4C4HA 2CGXA 3PY3A 2XZSA 4QYYA 5H9BA 3VVHA 3VTYA 3U3WA 2ZVAA 4BBFA 2IVUA 1J3HA 2WXVA 2UW6A 3BV2A 3GENA 4K2RA 4RIXB 4D2SA 3KXHA 5BVFA 3DKOA 2BRHA 4P4CA 4C61A 1HH8A 3H3CA 4HOKA 3OBJA 3CGOA 4GJ2A 3M2WA 5EW3A 5B2KA 3PZHA 4ZMFA 4OT5A 4FGBA 1NT2A 1WBSA 3CPCA 4MXCA 4U40A 4O0XA 4YVQC 1URCA 3GVUA 4JRNA 3VBXA 3W55A 5KZ0A 4Y5HA 4C37A 3UO5A 2OJ9A 4IIRA 5HX8A 2VGXB 3H10A 3T3UA 2IFUA 4U04A 5EQYA 3DBCA 2BUGA 3BE9A 3E7OA 4CEGA 5HEZA 4ZLOA 3PJ1A 3C7QA 3KXZA 4F08A 3SHEA 4R3RA 4FUXA 4R5YA 4BCPA 4EHEA 1XHAA 3FI3A 1GZ8A 4X6QC 5CZIA 2OJFE 4KWPA 5KCVA 4O84A 3QZIA 4AG8A 1PKGA 3WILA 2C0LA 4FNWA 4TTHB 3EKNA 3TNHA 3OT3A 3FUPA 4DINA 3R7GA 5D1JA 4ENYA 3CK8A 4K77A 3KMWA 4AW2A 1ZRZA 2HZIA 3NUUA 3PE1A 5HLWA 3VTXA 5LJJA 2VWBA 3BU5A 3KRJA 3Q96A 3KF7A 3EIDA 4PV0A 1H07A 3A8WA 2P2IA 3DS6A 5DWRA 5HE2A 4AOTA 2FSLX 3R7EA 2BZJA 2IVSA 4UI9K 4WNGA 3AC8A 2VTSA 3DLSA 3V6SA 1Z9XA 4R7BA 2WTIA 3MVMA 4ACMA 1IYGA 3D2IA 5J5SA 5L4QA 3F66A 3NSZA 3VHEA 4PDOA 3ZTXA 5BVOA 3D14A 4XH6A 5AFVA 3QQHA 3AC3A 1OL2A 4JDJA 1GZKA 4O22A 5CAPA 4ALUA 5J5TA 3CVQA 3VN9A 4N2QA 4LUDA 3NCZA 5AV2A 5DN3A 4AT3A 5CF5A 2CLQA 1Q24A 2H9VA 3UOHA 5I0BA 3KL8A 4GEOA 2XGSA 4PDSA 1OGUA 2JKKA 4CFWA 2IF4A 1YVJA 3HDNA 4ZS0A 2IZSA 4BDJA 4HGLA 2GPHA 4XG8A 3BEEA 3R73A 5I9UA 4KKGA 3RPVA 3FMNA 3UQCA 2YHVA 1PKDA 3G0FA 3CVLA 2FA2A 3CP9A 2B9HA 4G9CA 4N6ZA 4YTIA 3RIBA 1V0PA 2YITA 2QONA 4X7QA 5CX9A 1HXIA 3Q2JA 4JR3A 2C6TA 1O6YA 3CPBA 3K5VA 3PP1A 3PPKA 4FOCA 3UJGA 5HNBA 2I0HA 4AOJA 1SYKA 4ZEGA 4CFMA 4AY6A 4EOJA 3HV6A 4O7VA 2O0UA 2NP8A 4BDEA 4G2VA 1PXMA 3DOGA 5IQGA 5BMMA 1JKSA 5EDQA 2C69A 4FNYA 2ITOA 3ORTA 3PRFA 3W2SA 1H25A 3MV2B 3SDJA 3NS9A 4AX8A 4D55A 3O8TA 4GFMA 5AIKA 4L67A 2JLBA 4XP0A 3W2OA 4B8MA 3U6HA 4ID7A 3MJ1A 4FICA 4L7SA 5EX0A 4DFZE 3DXNA 4L01A 4YSJA 2PVFA 4YR8A 5BYZA 5AAFA 1Q99A 3CK9A 5EKNA 5J95A 3QU0A 2XK3A 2CKPA 2W9ZB 5EI8A 3HV3A 4U97A 4I23A 4BICA 4V05A 3D7ZA 5HZNA 4IWDA 3QQLA 5CU6A 1Z5MA 5KMLA 5FTOA 3S00A 4O0RA 4UY9A 3TV4A 4F09A
chains in the Genus database with same CATH superfamily
1H0WA 5FTQA 4RX5A 2F2UA 1UJKA 4YZCA 4YURA 4IHPA 3LVQE 5JFXA 2OZOA 4GMJA 1H6OA 4WG4A 4Y85A 3ZO1A 1Y6BA 5M4CA 4DT8A 1S64A 4FTLA 5AYWD 3UINC 4EHVA 4ZTHA 1UKIA 3OW3A 3P23A 4M97A 3DSSA 3QXOA 3LZBA 3MVHA 5JQ8A 4R3CA 3FU3A 2UZVA 4QP7A 4ANUA 5JZNA 4FU3A 4ZFHA 4FBXA 5IH4A 4LRMA 5CF4A 3OXLA 5BVNA 4KKEA 1GW6A 1CKJA 3OUNB 4CNHA 2WU7A 5AUXA 3FULA 1MYOA 3BU8A 4QNYA 3F3TA 4LNGA 5CI6A 1EH4A 2PHKA 1SQMA 1EDUA 2WXFA 5CU4A 3D9HA 5E1SA 4RSYA 3DZQA 4ZHBA 3GNIB 3BQCA 4ZZMA 3ZU7B 5CRUA 3EHAA 5JHAA 3PJ2A 5IKWA 1W2FA 4CFFA 4XRJA 2BALA 2HY81 3BHYA 2J09A 1XH7A 2V22A 3B8RA 2OZAB 2I9CA 2QLQA 5D66A 2XCCA 3VO3A 4IDTA 1J91A 3G33A 3LQ8A 4FEXA 4DA5A 2PUNA 4E3CA 4F9CA 3JYSA 4O86A 3CQEA 5ETCA 2W1FA 4R1VA 3PE3A 5C4KA 2PY3A 3Q4CA 5DT0A 3RU0A 3T9TA 4XI0A 4K33A 1Q2ZA 3NUXA 2V0PA 4GK4A 4CT4A 3MY5A 5AJDA 3SKCA 5IEVA 4F53A 1KE7A 1AQ1A 4QTBA 5AADA 4WT6A 2UZWE 3CK7A 4IWPA 1ZWSA 2R3FA 3W2QA 4O2PA 1K8KG 2B9JA 5CVHA 2QR7A 3GC7A 3ENMA 4G2FA 4RWJA 4LOOA 4ANQA 3FTWA 5EYKA 3QD0A 5B0XA 4FEUA 4TYEA 4HRNA 3D9VA 3SXFA 4FA6A 1H0VA 5JKGA 4WKQA 1W2CA 1HX8A 2VNWA 5KMNA 4NFMA 5D2MC 1V0OA 4FKTA 5A6OA 2QOQA 3OTVA 3SNXA 2QKWB 4HOSA 4PNIA 3Q9UC 3PXRA 3AG2E 1PXLA 3RWPA 3PZ3A 3W0PA 2X6DA 4GTOA 4L2YA 3RTPA 3R1NA 3OXZA 4NM5A 4FV4A 4DI4A 3ZVVA 2LSUA 5J8IA 2C1AA 3AGMA 5EG3A 3LJ0A 3VUGA 4CVAA 4GT4A 4JC8A 2I2OA 2R4BA 2EIJE 1HG2A 4GS6A 5BPPA 5H8EA 4FLHA 2X8DA 5ITAA 4GV1A 3R8ZA 5HCXA 4ERKA 2O2UA 3F7WA 3UE4A 3L9TA 2ETAA 5AUWA 1ZOHA 5JK3A 5E8VA 3O71A 3PE4A 3FAAA 4MD9E 4Z55A 3L13A 2GFSA 3UM3A 3LFAA 3C3RA 2KZTA 3AQVA 4FKWA 3RNYA 3ZUVA 5H2UA 2C6DA 3NAYA 1KZPA 3LMIA 3LE6A 3K3IA 5HO7A 5AM7A 3FWVA 4YBKA 3R7RA 3ORLA 4ZTRA 4C4IA 3T8KA 1KUTA 2PE1A 4DH3A 1P5QA 2RG5A 2XNNA 2GNJA 4QO9A 4KZCA 4BIBA 4XBUA 5FXQA 1FVTA 4K5BA 5EW9A 4BB4A 1ZBPA 4U41A 3K9IA 5KE0A 2J5EA 4D2TA 4L43A 2W1DA 5KMIA 1ZAOA 4I0SA 4C3FA 1IHGA 5HESA 3ZHEB 5FQ8A 2KTYA 2VGOA 4W9WA 2F7EE 1MRVA 4C34A 5M56A 3EQHA 3UKRG 4OUCA 3Q9YA 3OTNA 1MP8A 5CEPA 2CSNA 2Q0BA 3AS8A 4YJNA 3FWQA 4CSVA 3BE2A 2JKQA 5G05J 3NB2A 4GJ3A 5IA1A 4ACLA 4IAIA 5JRSA 4QYFA 4V04A 4A7CA 4MX9A 3UODA 4FZDB 4Y73A 2LGCA 3CSFA 2UW7A 4LV7A 4N57A 1TQIA 3Q2MA 3WIKA 2ETRA 1TR4A 3RJCA 4RJ6A 2WXMA 3MPAA 4DTKA 3QQFA 3PZEA 3FKOA 5KNGA 4FA2A 2VO0A 3ZKJA 4XLIA 3MGBA 4FV8A 1FMOE 4J98A 4HVDA 4O7SA 2WVIA 1MQ4A 3VJNA 4UBAA 1P4OA 1JCRA 2KC7A 5BNWA 3FH7A 3W0OA 3PREA 1MX2A 2FH9A 4G1WA 2OH0E 4RVLA 3LFNA 3PPJA 4DFYA 2OOEA 3C0HA 5IA0A 3QD4A 5A4CA 3NUSA 4BCGA 3JCKC 2VWIA 2VZ6A 3UO4A 5C8NA 2Y8OA 4FEQA 2F2CB 3U9NA 2HR2A 5CQUA 3O8PA 3Q9ZA 2Y4TA 5HG7A 5AARA 3BL9A 2UWJG 3SA0A 4AFJA 3NOCD 2CG2A 3E32A 4MTAA 3GFEA 2OJGA 4B8LA 5KJLA 1ZU2A 4KRDA 3PXQA 4YHJA 4WWNA 3RHKA 4JQ7A 3WBLA 3FXZA 3AS4A 1Z3XA 3TXOA 3ACJA 1SNXA 2WIPA 4ZJIA 4R1YA 4HYHA 3L82A 4PMPA 4XHKB 4EOOA 4GPKA 3DXQA 1KV2A 5L6OA 2VTAA 4M68A 2PVLA 2QNJA 5DVRA 3EFJA 2V7OA 1V55E 4HB5A 3GCPA 3U54A 4DDIA 4JG7A 4I6EA 3FMHA 4LG4A 2ZAZA 5EI2A 3HXCA 3F6XA 4DGNA 4KVMA 3OP5A 5DIAA 2BHHA 5FGKA 2HOGA 3QDNA 1S9IA 3EN5A 3TUBA 3NVMB 4BI1A 2F7ZE 4DUIA 2WB2A 1KT0A 1XH5A 3MZLB 1PMEA 1OL1A 4FIJA 2OSCA 5CCMA 3EHNA 3UIUA 2R02A 3IW7A 3QD3A 2X4FA 1TQMA 4IXPA 3ZO4A 3TACA 3TDWA 4HGTA 3NNXA 3T8MA 1YKRA 4TT7A 2IVTA 3DB8A 5JJ7A 1Q8TA 3EQFA 3L9PA 4M0ZA 3D0EA 3C4FA 4IM2A 1ZXEA 4M12A 3UT7A 1BI7A 2P33A 3MY1A 3OCSA 1WM5A 2C4GA 2XM8A 5EX3A 3ZRLA 2X9FA 1OWOA 4ME2A 1BL7A 4PRJA 1BI7B 1NZNA 3PEUB 1JPLA 4U8HA 4YC8A 4GTRA 2R2PA 2EVAA 3QWVA 2XKEA 3C5UA 5M51A 4TW9A 4W4WA 1LTXA 2JFLA 3P7AA 2QD9A 3ZBXA 1HU3A 3U66A 1U5QA 2PVRA 4UYNA 4L46A 3DJ5A 3F3UA 2WQOA 3DPYA 3I0QA 5CI7A 5AIJA 2BKKB 3COKA 1MQBA 3CIKA 2CKEA 3QZHA 4O7LA 4XE0A 5AR7A 5KWDA 3QLFA 3IPHA 4BWRA 3QHRA 5I9WA 3BHVA 2YDIA 3U4TA 4IW0A 1BMKA 4DH1A 4FIEA 5CECB 2C3LA 5GJGA 3RCJA 4QMQA 3RK9A 5KJMA 3ALOA 1JKKA 3WARA 5L3AA 4EC8A 2E9PA 5CAVA 4I5HA 4NW5A 2W1GA 2QOLA 4AA0A 1B39A 2WTWA 3P7BA 5EM7A 3N51A 4AGUA 3MN3A 4PL4A 4PTGA 5AP2A 3ZXZA 2VTTA 4FZAB 3MS9A 4AQCA 1H2TC 3ORKA 1ZLTA 4OW8A 5CBNA 2ZM1A 4YJRA 3NR9A 5T3RA 5FDXA 3D5WA 4UWHA 4UWGA 5C8MA 4EOMA 4HVBA 4URKA 2AYPA 3TEIA 3SQQA 1YXVA 3ML8A 4QMPA 4AN2A 4EOIA 2R9SA 1PXIA 3LCOA 4KS8A 3R7IA 4A06A 1KE5A 3GQIA 3DAJA 4FTQA 4BGGA 2V4LA 1OWMA 2J9MA 2WQ6A 3WZUA 3OZ6A 5FTPA 5GNKA 4A55A 3HA6A 3PXFA 2LAIA 4MEDA 1H26A 1FMKA 4YJVA 5K3YA 4GYGA 2HXLA 2XK4A 2QCSA 2WAJA 4PH4B 2A4LA 3I0OA 3V31A 2QYJA 3HVEB 3GOKA 4C9BB 2YWPA 2OXXA 3MGYA 4AF3A 4BJJB 3WZJA 4IAZA 4Q5HA 3ZEWA 4UALA 3OAWA 3D9PA 4RG0A 1PF8A 4MAOA 4O0SA 4AXFA 4F6SA 2P9LG 2PE2A 3OROA 4J53A 3TKUA 2OXYA 5JGAA 3BKBA 5EN5D 4NT4A 4GCOA 4O6FA 4EYMA 3ZYMA 3V5LA 4TV3A 4Q9ZA 2X0QA 3A61A 4U45A 3KCFA 2VRXA 4Q9SA 2VSNA 4ANVA 4FL2A 2UZOA 4DH7A 4JAIA 3P0MA 1M2QA 4FJYA 4L44A 2YM6A 4BIDA 4JL9A 3D3MA 4O27B 4JIKA 2KM4A 3LM5A 5T8IA 3VBVA 3L8XA 3AC2A 4O0VA 3TV6A 3MY0A 1TVOA 2DCPA 4BGQA 3QC4A 2YINA 1OKZA 3KF4A 4PNKA 5IA2A 5CEDB 5FQ6A 3EHMA 4FV1A 4ITIA 3OUKA 4Y5QA 3I4BA 2CN8A 4TN6A 3BU3A 3NZUA 4E1ZA 1H19A 1ZYCA 3J5PA 5A9UA 4GMLA 4DHFA 4FT9A 4F1PA 3HXBA 3ZZEA 3FC2A 1BL6A 4PMMA 3P5KA 1H1SA 2R3LA 4I20A 1KOBA 4DEEA 5A6CA 4I6JA 3NZSA 3UQ3A 3QCXA 3OXTA 2GGFA 2VTBA 1UKHA 3FLNC 4G3CA 1J1CA 4DBNA 2XK6A 2L6BA 3IS5A 4FHKA 5IDNA 1JUQA 2FVDA 1SZ9A 5BVWA 3BWJA 3ZRMA 3SZ7A 5E8SA 4AA4A 5F4NA 5HVJA 1NVQA 4EH2A 2EILE 3ZRHA 4EQFA 5FP6A 3SFZA 1WVYA 4YTFA 4Y6WA 4Z16A 2Z2WA 4YHFA 4IAKA 2PQRA 3MPTA 4D4RA 3SRVA 5KBQA 4LRZA 2XALA 4D58A 3N4VA 4ACKA 1TJFA 3GW4A 5JQ5A 5ENTD 3ZH8A 3ROYA 2Z7RA 3TYKA 3ORNA 1N0QA 1Q8YA 2R03A 1SVGA 4S33A 1OPJA 1P14A 3UT4A 1OM1A 1N11A 5L2TA 3QQUA 4CLJA 2F4JA 4E6HA 3RINA 3EQCA 5IEYA 4X8QA 1VEBA 2UW3A 3PA5A 3TTIA 2WNTA 1PXPA 2PZIA 2VTPA 5HQ8A 3Q9XA 2BAKA 2XRYA 2XNMA 3IO7A 3RAHA 4CFUA 4BX9A 4RFZA 4IDVA 2Z7SA 3ZXTA 3BU6A 4TL0A 2C5OA 2UVXA 2HIWA 4P90A 2B52A 1M7NA 3B2TA 4ACHA 2P9KG 3TMOA 5CAOA 5EDRA 4ZSEA 1U2VG 2XIRA 2IQCA 3VF9A 2CJMA 3FSFA 2UZEA 2JEKA 3LOKA 4TNBA 2YJRA 5TO8A 5BX0A 2IJGX 4QPMA 1B38A 1QPDA 3UVPA 2RG8A 5DR9A 3Q47B 3QKMA 5JJ6A 3MKRA 3CXWA 1HS6A 4APFA 4RJ3A 1BKXA 4CCBA 2WQEA 3TKIA 1R0PA 2X0GA 3UIPC 1XH6A 2PUUA 4UWLA 5M4IA 3PSCA 1H0AA 4ZZOA 1K9AA 1SZMA 2G01A 4XG7A 4CEMA 3FMEA 4NW6A 4BI0A 3F5PA 4FKPA 3HV7A 2RL5A 3C5IA 3Q3BA 2Z8CA 3HMMA 3OW4A 3PNLB 3Q7FA 4JIAA 2XGOA 3TG5A 2X6KA 3JXWA 4FYOA 5M08A 4ARKA 2W1EA 4AZEA 3LMHA 5I5ZA 3ZDIA 4LCTA 3ZOSA 3V8WA 4O4BB 1OECA 4G23A 4CYMD 5JGDA 5AR2A 5DOSA 4E85A 4X2FA 4DEAA 1ZYSA 4GG7A 5TKDA 3UPXA 4K8AA 1N52A 3B2WA 3RJVA 3UG2A 2J0IA 4YHTA 3FZ1A 5LVLA 3MTFA 5CEIA 2OO8X 3ZM9A 1Z6TA 3MDYA 3UZPA 3BYUA 2YIRA 5DE2A 4O81A 3B7BA 4IRUA 3WE4A 5DRBA 1ZY5A 3B8QA 3SI5A 4Z7GA 4DEDA 2IW6A 1H28A 4QQ5A 2QYUA 5FWQA 3ASOE 4XV9A 1MRYA 2JIVA 4CKRA 3RPOA 4IAAA 4PPBA 3QQJA 3WE8A 3MKQB 4MF1A 4C4JA 4DYMA 1JCSA 4DFNA 5DLSA 5T6KA 2PWLA 3BZ3A 2GS2A 4Q5EA 5FUTA 3ODYX 3PZDA 1A17A 4K6ZA 1VYWA 1OITA 4APOA 4J96A 3VS4A 3UNKA 2WMSA 2HENA 4M7CA 2GSFA 5HHWA 3D9KA 4IX6A 4ZY4A 4DI3A 3BLQA 3KMUA 1NVSA 2VTHA 1LPUA 3ZYKA 5C2YA 1XBBA 2C68A 3QCYA 1TYQG 3UPZA 3EL7A 3MB6A 4U07A 3UGCA 3HV4A 4X21A 4EBVA 2WMNA 3CCNA 4OBPA 1OIYA 4YZMA 4C8BA 3R01A 3NUNA 4FG9A 2Y9QA 4XJ0A 2EU9A 4LMNA 3VBQA 2WTKB 4JB8P 3NW7A 3E63A 4BDKA 3Q78A 4H1MA 2YEXA 2WZJA 3D9MA 4FKLA 1J7LA 4YVOA 3HMOA 3G6GA 2GNFA 4FKJA 5EK7A 2C5NA 4IVCA 4RA5A 2WTVA 3S2PA 4ATGA 4L2LA 4P5ZA 3OWKA 5DMZA 1ST0A 3AD6A 3FJQE 5G1XA 4ASDA 3S7JA 2ETMA 2PMLX 4IM3A 3VULA 2DYSE 3E92A 4RIWA 5FEDA 2PPQA 2OW3A 4L7FA 2JC6A 2XIYA 3NGAA 2GTNA 3ZUTA 4TYGA 3IHYA 3DCVA 4IANA 3RCDA 3KEZA 1W82A 3NF1A 4ANMA 3SBTB 3NIEA 4AP2A 2WXGA 3DXKG 4DEHA 3VIDA 2AXUA 2XIXA 3QL8A 4HFGA 3SW7A 4MBJA 3NFFB 4BZOA 1JBPE 3IG7A 4CTBA 4JDIA 4AE9A 1U54A 1XGWA 3BHUA 1VZOA 3CTHA 4LUNU 1N4QA 4F7NA 3QXPA 3BEGA 2I0EA 2E9UA 1XJDA 2BVAA 2XEEA 3G2FA 2ITPA 1X81A 4AJWA 4R7HA 4ZSJA 3MYVA 4BKZA 1ZMWA 3UQGA 1G8AA 3GC8A 3KXXA 4ZTLA 3QTSA 1JVPP 3L17A 2WO6A 3ORPA 3JUIA 3JVRA 4RC4A 3D9IA 5BW8C 4GKIA 3GU7A 5E8UA 2P2CP 3E5AA 3PUFC 4D1ZA 4BT8A 3MB7A 3KIOC 2GS7A 3LAUA 4L6QA 4QQIA 2VUWA 3CQWA 2W1IA 5JHBA 3MV5A 4W8DA 3D5UA 1QNFA 5L6WL 2P3GX 5LFAA 4A07A 3DBQA 3FQSA 3MIYA 4KB8A 3TIZA 3RSEG 1RW8A 3FXXA 4YTCA 3W8LA 4UMPA 4EHZA 4G6OA 3VS5A 1XQZA 2F7XE 4Z3VA 5LWNA 3LXLA 5DR6A 5BQ0A 3UYTA 4MXYA 4YJTA 2XNOA 2GNLA 1YYHA 3RPRA 3R8PA 2HCKA 1D8DA 4QYYA 3VVHA 3MX3A 3CHPA 4AEZC 1J3HA 3BV2A 4RIXB 4R7BA 4D2SA 4P4CA 1HH8A 5EW3A 3PZ2A 4OT5A 4FGBA 3APDA 4U40A 4Y5HA 2OJ9A 4IIRA 3H10A 3T9KA 3BE9A 4ZLOA 3KXZA 5CBOA 3SHEA 1H2UA 4FUXA 4BCPA 1XHAA 3FI3A 5CZIA 2J8SD 4KWPA 3T5VA 3EKNA 3TNHA 3OT3A 3FUPA 4ENYA 3CK8A 4BSZB 1ZRZA 2HZIA 5LJJA 4A3VA 3KF7A 3EIDA 4PV0A 5HE2A 2P2IA 4GZCA 4WNGA 3AC8A 3VHEA 5AFVA 4JDJA 1OL2A 3L08A 5J5TA 3CVQA 4LUDA 2CLQA 1Q24A 2H9VA 4FADA 1OGUA 2IF4A 4UUCA 3FMNA 3CVLA 3HXEA 2FA2A 3CP9A 4OVVA 1V0PA 2YITA 2QONA 4X7QA 4JR3A 4FOCA 4EECA 4JVSA 4AOJA 4ZEGA 4G2VA 3KSQA 3SDJA 1OCCE 2JABA 4L7SA 3DXNA 5AAFA 3CK9A 3QU0A 3ZYQA 2CKPA 4V05A 4LG6A 1Z5MA 5KMLA 4UY9A 1KT1A 4F09A 2X8EA 2VTBB 3R7YA 1T45A 4WOVA 2PULA 2AW6A 4F64A 2IEWA 1ZARA 3U64A 4F9AA 3FZPA 3CJGA 5KHWA 4RLLA 3EQBA 3A60A 2W06A 3HMNA 3A7IA 3QCQA 2C0OA 2XAMA 4D9UA 3UM1A 5CYIA 4EOQA 3LEWA 4O82A 3UIXA 4J1RA 4DG0E 2RD0A 3HAMA 2P55A 2A0CX 4DK5A 3PP0A 3IOKA 2XCBA 4I2WA 5LVNA 4FTUA 1TEZA 4RBLA 2A19B 4FTIA 2R59A 4YC6A 2R7IA 1LUFA 4FSTA 3KSLA 4I24A 4IFCA 1M14A 3LXNA 4HNIA 4NJDA 5L6PA 2IN6A 5TR6A 3LFDA 3ZUVB 5KNJA 3LFFA 5D41A 3MYGA 3VRYA 4PUZA 1NI1A 4UQYA 4KAOA 3DA6A 4FKGA 3R9OA 4N3BA 2YDJA 2IG7A 2J07A 2VGXA 3ZLXA 4MVFA 4C4GA 2ZV9A 4AN9A 4DHZA 4LI5A 4X3FC 3BX5A 4XX9A 4APPA 4FE2A 2IW9A 1XR1A 4Q2AA 4RZWA 4I3ZA 4QMNA 2OIDA 3EZRA 4F9YA 4BZDA 3RAUA 2X9EA 4BTMA 4C33A 5HKMA 1E8YA 5AA9A 4NIKA 3FUMA 1Z5SC 4MWIA 2JLDA 2PVMA 1FVHA 3TDVA 3DAKA 5A4QA 3HECA 3TCPA 4GA1A 4RLKA 1XO2B 4CRSA 2H6GA 4ORKA 4JL0A 1UA2A 3E7VA 4OTGA 4IB3A 3CHRA 4MCVA 1WMKA 4FSWA 3ASGA 2KULA 3PEVB 4E7WA 4QRCA 4S32A 1GIHA 2A4ZA 1SZAA 3HYMB 3EB0A 1L8TA 3QUPA 3VF8A 3GQLA 4CDMA 4ZK5A 4NM3A 2UZDA 3FYJX 3DWLG 5C4LA 4AXHA 3PH0C 4EBWA 1R78A 1YQJA 2QC9A 4EK6A 2RFNA 5AM6A 2G2FA 4LOPA 2OWBA 3FMKA 3FC1X 1FT2A 3BBWA 5E90A 4YU2A 5CEMA 4JNWA 5EM8A 4F99A 3HUCA 3GOPA 2PMIA 2CHXA 2BMCA 3AD5A 1I09A 3BGPA 4KZ0A 1KOAA 3TWXA 5JA4D 3R02A 2Y69E 5F20A 1YDSE 4AXCA 5AUVA 3G0EA 4ZLZA 5IMEA 1WG0A 2UY1A 1IR3A 4DFBA 5AN8A 3W0MA 1Z57A 4G6LA 1PXKA 1QCFA 4PF4A 4X2KA 4OTFA 2Y0AA 1R1WA 2Q83A 3CVVA 1H1WA 3HUBA 4FODA 3PY0A 3QUDA 2XRUA 5LX8A 5AP7A 3TL5A 3E4BA 5ETAA 5ENPD 3GCVA 4M84A 4PP9A 4PS7A 5EQPA 4P29A 3R1YA 3EH9A 2VX1A 2ETBA 5HQ0A 4I4EA 3E37A 4YO4A 3CVUA 5HLNA 2DVWA 3ENEA 5BYLA 2YIYA 5HE0A 4YDYA 5AP4A 4F78A 4EQCA 3WF8A 5CALA 4C4FA 2H34A 4CKIA 4BVUA 1E8WA 4J8YA 3BELA 2PSQA 3W0QA 1VYZA 3EN9A 4DITA 5CEKA 3RALA 3IBEA 2Y1LE 4CV9A 3C4XA 4A4LA 1Y91A 3NYXA 3V01A 3VHKA 4UZHA 4N70A 3QB2A 4OTQA 2ZGDA 2X4ZA 1PXNA 4LL0A 3WG7E 1OY3D 2BILB 4S31A 2EIME 1YHSA 4FT5A 4A9RA 3BQOA 4NACA 2R5SA 4QOXA 2R0UA 5BV3A 3QHWA 2XKFA 5G04C 1E1XA 4NJ3A 3PDNA 3BRBA 3WIGA 4EKKA 3O5AA 2WTCA 3LY8A 4IQ6A 5KMOA 4XMOA 1JWHA 4FTAA 4M15A 2XIKA 5K5NA 4I4FA 4FHJA 4XV3A 4JT3A 4RWKA 2XS1A 2VO3A 5A23A 1OT8A 3AKJA 4QP1A 4HCVA 4N39A 1HO8A 2XENA 4NEUA 3BLHA 2WOTA 4IZ7A 2KCKA 4A9UA 3FUNA 3MTLA 4N5CA 2HZNA 5IQIA 4F0GA 3VBYA 4PWNA 1ZY4A 4AT4A 3MKQA 1X8BA 5FJYA 3AGLA 1YDTE 2Q0NA 5FWKK 2J7TA 3H9RA 4NU1A 4HRLA 4C38A 2W7XA 3VS1A 1VLRA 3CVNA 3UBDA 5C1QB 3NBNB 4IX3A 3O96A 1U4DA 1GJOA 2HWOA 2YHEA 5JFWA 2GRLA 4CD0A 3UZRA 3VBWA 5LCWJ 5CEAA 3P2BA 4H3BA 3TWUA 2DS1A 1FGKA 4GCJA 5HBJA 5JT2A 1XBCA 4FT3A 3LYAA 1ZOGA 2HE0A 3D4QA 4OT6A 2C2LA 5AV4A 4QMVA 2X6HA 1BU9A 1YDRE 3TUCA 4BDDA 3F88A 3U8WA 4ANWA 1SNUA 1TJCA 4I6FA 1OB3A 1V54E 3DSWA 3CE3A 4HOUA 3UT8A 5KNHD 4EH8A 3PYYA 2V0DA 4FTTA 5AQBA 1FVVA 3ANRA 3V6RA 2CKOA 4DEGA 5FRIA<