2PZIA

Crystal structure of protein kinase pkng from mycobacterium tuberculosis in complex with tetrahydrobenzothiophene ax20017
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
677
structure length
654
Chain Sequence
b'GSHMLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable serine/threonine-protein kinase pknG
publication title Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 200
structure length 654
sequence length 677
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF16918 PknG_TPR Protein kinase G tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pziA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pziA02
3M42A 4C2VA 2PVMA 2PMNX 3WARA 3PZEA 1QQEA 4RC2A 3ORKA 4AX8A 4NL0A 2ITPA 2ZVAA 3S00A 4GSBA 5E8ZA 3KL8A 3PWDA 3NX8A 3PXQA 2E2EA 4GH2A 2XIZA 3FKNA 2XCBA 1QMZA 4BVUA 4JQEA 1NZNA 4GA0A 3VJOA 2ITZA 4IBMA 3FZPA 4JXFA 1GZ8A 2CGUA 5BT1A 3Q4UA 5DRDA 3RHKA 4ZY5A 5CAUA 3C7QA 4LGHA 3EQCA 2CKOA 4D1XA 5L8JA 3OY3A 5LMKC 3ZUVA 1FBNA 4FUXA 1IEPA 1PF8A 1U5QA 4FSZA 4GJ2A 4J53A 2C3LA 2F7EE 4FX3A 4KIQA 4TW9A 3QBNA 4FT9A 3UO6A 5EK7A 2PTKA 3ZONA 3VN9A 4X0MA 4DFNA 3VULA 3O8PA 4IWQA 2GTNA 3QWPA 4RX8A 3R8MA 5HU3A 2HWPA 2RKUA 2V5FA 2GPHA 3KXXA 4U40A 3IQ7A 3O7LD 2CHLA 2BRBA 3LYAA 1TQMA 2IZTA 3RP9A 4J0UA 5JGDA 3LFBA 3Q6UA 2AUHA 4LGDA 2OF2A 5G05C 2OFUA 5I9ZA 2VGOA 2YCSA 3LKUA 1WVYA 1OECA 4IX3A 4X3FB 4I2ZA 2WTIA 2IZUA 3P08A 3R73A 2XRUA 5GZAA 5IA1A 5IUGA 3JR1A 4O86A 4BTBA 1YHSA 5AUZA 4AW5A 5AR7A 3DAJA 3FE3A 2R3KA 3EYHA 4OBQA 1IG1A 3MA3A 3LLTA 4D2SA 1F3MC 4FKIA 3CVQA 4XG9A 3UP2A 3LXPA 4RVMA 5CSVA 3IDCA 3KQ7A 2ITUA 4ONAA 5HE1A 3W2OA 3I6UA 3H0ZA 2VGPA 4I6FA 1A48A 2WMBA 4DG2E 5EOLA 3C4ZA 3AOXA 3HV6A 2GNHA 1XH5A 4JT3A 3IW8A 3R02A 2EB3A 5CWZA 4BCFA 5J8IA 3I4BA 4BHNA 2QKWB 4BGHA 4YURA 3AMAA 4IB5A 4GCOA 5EQEA 4CSVA 1YWVA 5E1EA 4DGGA 5HESA 3KN5A 4MD8E 2J7TA 4CVAA 3BU6A 3C50A 2R5TA 5CI6A 4GZ6A 4EZ5A 4DT9A 3A4OX 4O2PA 4CYJA 5AV1A 5I9UA 3D94A 2C1BA 3ASFA 4JX7A 3R7VA 4MTAA 3PJ1A 1MQBA 4C02A 2SRCA 3QHRA 1URCA 3HMMA 2P3GX 3KKVA 3P78A 2R3HA 4I6QA 4LG4A 3MIYA 5HG7A 3VUKA 4A06A 5FDPA 4ME2A 4NIFA 2Y4PA 4QMNA 4IHPA 2WXVA 4FEXA 3F3WA 3ORMA 4Y72A 5A7DB 4D4VA 4FIJA 2VTSA 4I22A 4F1TA 4XI9A 3FI8A 3F5XA 3MGYA 4XCUA 2HXQA 4KRDA 2J0MB 4C3PA 3VUIA 4BBFA 1EH4A 3PIZA 3MJ1A 2OJFE 2XJ1A 2E9UA 4JJRA 4BCGA 3UUXA 1UNLA 4NT4A 3ZFXA 2R3QA 3IW6A 5CT0A 3UQ3A 1O6LA 4UQZA 4ZMFA 4JDKA 3VIDA 3U3WA 1HCLA 4EH7A 3GZ1A 3NRMA 4FV8A 4BIBA 1PMEA 3POOA 3PTGA 5HD7A 3E7VA 2X8IA 3K2LA 4Y8DA 3OZ6A 2LNIA 3C4XA 4DTBA 4KIOA 3MWUA 5BVDA 2WZJA 2XB7A 4G3CA 5DEYA 4EOQA 4ZSAA 2JAMA 4TN6A 2ITVA 4FMQA 3VUHA 4E4NA 2XGSA 4UI9C 3MPAA 4O7LA 3AQVA 4R3RA 4RIWB 2JIIA 1V0BA 2JIUA 4NZWB 3IGGA 5AP4A 2DBAA 4GA1A 3EQPA 5AX9A 3OT8A 3KVXA 2QO7A 5FZSA 3FI2A 4MD9E 5CAVA 3MVHA 5C01A 4A4OA 4AQCA 1VEBA 3GW4A 4MHAA 4EOMA 5EQYA 3ITZA 2QQ7A 3DV3A 4QMOA 2WFYA 2B54A 2JITA 4DGNA 4E6QA 2QURA 4C4JA 1XR1A 1Z9XA 4DEIA 4IC8A 2HZ0A 4CFVA 1ZLTA 1V1KA 3EL7A 3MFSA 4FL1A 1YHWA 4WBOA 4EOSA 4EYJA 4HOQA 2VWYA 4CQGA 2HZ4A 3MI9A 5KJKA 4W4YA 2J90A 2QCSA 4PF4A 3UNKA 4AY5A 3VHKA 1OITA 3PDNA 3PUPA 3C5IA 5M4IA 1XBCA 1RDQE 3FQEA 2XRWA 4G9RA 4AP7A 4LV8A 3MDYA 4QTCA 4RLKA 4TWPA 4WRSA 4DFBA 4Y95A 3BGQA 5C4KA 4FKWA 2VWZA 2W96B 4FOBA 1I44A 5A3XA 4PTEA 1UNHA 4A7CA 3C4WA 4FTNA 3MVLA 4KS8A 3IK3A 4CRSA 4FV2A 3VAPA 5F4NA 4I20A 4UV0A 5D7VA 1FCHA 4FNXA 1H4LA 2DQ7X 4E7WA 2EWAA 1PXJA 1T45A 3D14A 2ZAZA 4E26A 2YM7A 5JJTA 4ITJA 2YITA 3NYXA 4TYHA 3DBCA 3BX5A 4BKJA 5DG5A 1NA0A 3HAVA 4KUJA 5M09A 3QD3A 5HVYA 4ACGA 4C7TA 1ATPE 2JBPA 3NIEA 3O96A 4XLIA 2EU9A 4B6LA 1PHKA 4YSJA 1H27A 4TYEA 3W2CA 3TG4A 4MF0A 3MW1A 4M66A 3DNEA 2PVLA 3TNHA 1L8TA 3KREA 3CK9A 2HZNA 4YJTA 1ELRA 3QRIA 1PRYA 3PP1A 4JVGA 5IF1A 5A9UA 4ORKA 4CG9A 2H6DA 4XP3A 4XV9A 1KE9A 3GCPA 5TKDA 4UXLA 5C8KA 3G0EA 3LFDA 3PXYA 2ZV2A 4O7YA 1FGIA 5E8VA 4ZIMA 3G90X 3GU6A 3V3VA 2CSNA 2GSFA 3GBZA 3T8OA 4V0GA 5IQCA 2I0EA 2F4JA 2UZDA 4I5CA 5DN3A 5EH0A 4C4FA 3RK9A 4EK5A 2Y8OA 3SRVB 5B2MA 2IWIA 1WVWA 2G1TA 3ALOA 4YBKA 2XNGA 2CNQA 4YLKA 3OY1A 4XX9A 2E9OA 4CT1A 4UMUA 4TYIA 2VTOA 4XH6A 4ZSJA 4FZAB 4P7EA 3ZHEA 3KGAA 4EH4A 4LL0A 5IMXA 3QU0A 2P33A 2B9HA 2BIKB 5JKGA 5H8BA 1JLUE 2VO3A 4EOIA 4HNIA 5J9LA 3RU0A 2XM9A 3KEXA 1KOAA 5HO7A 5CLPA 5J1VA 4TTHB 2JKKA 3L9PA 2CGVA 4JDHA 1FINA 2BDWA 2ZOQA 3OXGA 4HPUE 5HG8A 4ANBA 2CNUA 3DXQA 5D10A 3TUCA 3ELJA 4BCIA 4K2RA 1VYZA 3QQFA 3W2PA 2C0TA 3FPMA 3F5PA 3WYXA 2YIYA 3NZ0A 4B4LA 4BCHA 2FO7A 5FZQA 5LCWJ 4N3BA 2NPQA 3COIA 1BKXA 3CVPA 4AS0A 4KKGA 3WOWA 4JI9A 3FAAA 5J5TA 3VUGA 3QUEA 4MNEA 5EYDA 4XEYA 3AD4A 2WPAA 3G33A 3IECA 4RJ8A 5KCVA 3M1SA 2C6KA 3W2RA 4H39A 2PE1A 3EN5A 3EQGA 3KRXA 3PVBA 2C6LA 4I24A 5F9EA 4DGOA 3QDNA 3WXXA 5EG3A 4KBAA 4LRJA 3MY0A 5E8YA 5EHLA 4ZSLA 5HEZA 4EL9A 1Y8MA 3KCFA 4O0SA 5FBNC 3LMHA 3RGFA 4EC8A 2E9PA 2J5EA 4WIHA 5D9HA 3R9HA 3CTQA 3HRFA 5KBQA 4BDGA 3UE4A 2GW1A 3BU3A 4TRLA 2FI7A 2XNBA 2R7IA 5AV2A 1M52A 1WM5A 3W1FA 4I3ZA 1XQZA 2UZOA 5C03A 3ANRA 4F7SA 4X3FA 2IVTA 3CS9A 1GZOA 3R63A 2X8EA 5CU0A 3E5AA 5HCZA 2XKCA 4OBOA 2R4BA 4D2TA 1OVEA 1Q41A 1KE7A 1H1QA 1JVPP 3R1SA 5IUIA 2BUGA 2PPQA 4FYOA 1FQ1B 2JDRA 2JGZA 2XYUA 3GI3A 3AMYA 2J4ZA 4AE6A 3E3BX 3BI6A 4FEWA 3F5UA 5FEQA 3RWQA 1JKTA 2WMWA 4OTPA 3W18A 3HA8A 3QA0A 3WZUA 2LAVA 3NVMB 4F99A 4MXAA 2Z7RA 4DEDA 5AAGA 2GTMA 1FGKA 2FBNA 4BCQA 3ZRMA 3I7BA 4WUAA 4FKTA 4D0WA 1OL2A 5ANEA 1WCCA 2AC5A 2UW6A 3GEQA 4MXOA 5JEBA 2IW9A 4C61A 1Q99A 4TYGA 4WSYA 4N57A 1B89A 4M14A 4JAIA 4XG8A 1DI8A 3VJNA 4ACHA 4FV3A 3F66A 3CKWA 4FSYA 3S4QA 4QP9A 4PL4A 4IB3A 4CEGA 3U6HA 4NKSA 2V7OA 2PZ5A 1WFCA 2OZOA 1H28A 5L6WL 3GZ2A 5FTPA 3Q49B 4R8QA 5GJDA 4DN5A 2YDKA 2X2LA 3EZVA 2YM4A 5JT2A 4E4LA 3CK7A 5LWMA 4QYFA 2B9JA 1BI7A 3FZ1A 4Y5QA 2KATA 1NA7A 5E91A 4DFLA 1TQPA 2O65A 3OW4A 4QYGA 4PTGA 3EKKA 1OGUA 2JIVA 2VTLA 5CAOA 4CGAA 3CY2A 2RIOA 3JPVA 4JRNA 3TWJA 4DH8A 4EHZA 4XOYA 2R3MA 4NFMA 5CVHA 2RFEA 3B2TA 2E9NA 4Q9ZA 5CQUA 5CEIA 1KE5A 2V62A 4I94A 1W8CA 4I1AA 2LSVA 2HW7A 3OXIA 4YTFA 3BQRA 2OK1A 1PKDA 2YDIA 4IANA 2QD9A 3TGOA 4Y5HA 5IQDA 4PP7A 2PVFA 3CK8A 2PL0A 3FZOA 4HCUA 4QOXA 4L7FA 3KRJA 4R7HA 3LMGA 4E5BA 3LPZA 2ITNA 2B7AA 3HV5A 4L53A 3PXZA 4IJPA 5IA2A 3OT3A 4IAZA 4F0IA 3FL4A 2Y4TA 5G04C 3PPZA 4H7XA 4ANMA 5ETCA 4Y6WA 4RIWA 4YZNA 5AYWD 4FKVA 1JBPE 4N3AA 5DVRA 4S30A 4EOPA 3PRFA 4HJOA 4A9SA 3SDJA 3V01A 1STCE 2H96A 1OI9A 2PHKA 3DLZA 4HYUA 3LFCA 2I0YA 2YWPA 3G9NA 4BTKA 3MN3A 3QTXA 2AVPA 1NW1A 1U54B 5BNWA 4EWQA 3UOLA 4E5WA 2PUNA 5EKQD 5HE3A 4BTAA 4Z55A 5AWMA 5GJFA 4IFCA 1H8FA 3OXLA 3ZRKA 5FP6A 2G15A 1OKYA 4M7IA 4PX6A 4DCEA 4A9YA 4CKIA 3R1YA 4RIXA 4J96A 4ASDA 4ALUA 5M4CA 2I6HA 3QL8A 3JS2A 3MS9A 3LE6A 4TYJA 4F7NA 2QOFA 2WU6A 4IACA 5FM3A 3EFKA 4XG3A 1WBPA 5TF9A 3GCVA 3MVJA 3MYGA 3LFEA 4AGDA 4AWIA 4DFXE 4Q9SA 4U97A 3LOKA 3QTSA 2YAKA 4JBPA 4YZ9A 4QMQA 5ITAA 4X2FA 4YVQC 3P23A 5M07A 5TE0A 1H26A 1LPUA 2X7GA 3CGFA 4DC2A 4RSSA 4E6CA 3LFAA 4KBKA 3ZUTA 5KNJA 4FSTA 4LL5A 4BRXA 3Q4TA 3BEAA 1SYKA 3FI4A 1ZOHA 4QYEA 3R7YA 3TZ9A 4IZ5A 3NUSA 4IZAA 3S2PA 3ZEWA 3GGFA 4MQ1A 4RX7A 4WBBB 2W5BA 4TY1A 4Y46A 5CZHA 5ANDA 3WILA 3VF9A 4EKKA 3VBWA 1PC2A 1IASA 4DH5A 5H8EA 4EONA 4S32A 3K3IA 3QX4A 3VUDA 5IDPA 4O21A 4PDSA 5DI1A 3V5PA 4J97A 1W0XC 3ANQA 4WD5A 3PG1A 4ENYA 2R2PA 3DAKA 2RFNA 4DG0E 3UIXA 3F82A 3ENHA 4IB0A 4FIHA 2FSMX 1T46A 5FBOA 4WT6A 5DH3A 3RPVA 4CMOA 2HR2A 3NIZA 4EOOA 3ZLYA 3UG1A 3RI1A 5CAPA 3SW4A 5JMSA 4X2JA 3GFEA 3NF1A 5ANJA 4IH8A 1RJBA 4DH3A 2IZRA 1UV5A 4D9TA 4WA9A 4G31A 4LQMA 4C3RA 2C0IA 4FODA 3OXTA 5EDQA 3PDTA 3DU8A 2WTWA 3ROCA 4EH3A 4AY6A 4MWHA 5IG1A 1OKZA 3H9RA 3RCDA 1JSUA 4P4CA 4G25A 5F95A 3SRVA 3Q53A 4HVDA 4GMYA 3ZPJA 4FE2A 5FLFA 4X2GA 4M12A 4YGAA 2IVSA 2VTRA 4N6YA 3BEGA 4OT6A 4RA4A 2I6LA 4YNOA 3RZBA 4K77A 3LVPA 4KINA 5JSMA 2YLEA 3VS3A 3FI3A 4YPSA 4BTMA 4EH6A 1OUVA 2H34A 4M8TA 4QMYA 3IGOA 4J8MA 5IQGA 3Q9YA 1P5QA 5HIBA 5KKRB 3L9LA 1OM1A 2ITYA 4CFNA 1ZBPA 3L9NA 4QQTA 5L2TA 1LEWA 4X6QC 5CCMA 3O8TA 2O8YA 4AZSA 3AT4A 2Q0BA 3BHYA 3CQWA 1KE6A 3A7GA 2YM8A 1ERKA 1BL7A 2VQ2A 3ID6C 1QPEA 5DR6A 4ZZOA 2ITTA 3QOUA 3AC3A 5HNIX 4R3CA 4XS2A 4LV5A 2JDTA 4F9CA 3QQHA 5EM8A 3WBLA 2OU7A 3VS4A 2C5OA 4LFIA 1FVVA 3OHTA 3THBA 4AT3A 4BL1A 5IMEA 4W9RA 5HZNA 4KB8A 1NVQA 4I0TA 1QCFA 4UY9A 4QP2A 1UVRA 4J95A 4IEBA 2C69A 4BDDA 5CX9A 3POZA 5FTGA 2F57A 3KXNA 2HK5A 3ODZX 1PMNA 3PJ3A 4YNDA 5BPYA 4PDPA 5DBKA 2I1MA 5FG8A 2JDVA 3Q96A 3QZFA 3OUKA 4CT2A 2ETMA 2ZM1A 2J9QA 2YERA 4L52A 4UMPA 1HXIA 3AD6A 4U43A 4CFWA 3HGKA 4C57A 3GENA 3HECA 3FWVA 4JL0A 2OI4X 3PYYA 3GNIB 3LCAA 2OWBA 5I0BA 4DEEA 2ZV8A 3V5TA 3VTXA 2A19B 2OJIA 4O84A 3Q04A 2Z7LA 4U5JA 4Z7HA 2ITWA 3GC0A 1WBVA 4YJSA 4AG8A 1OIQA 5EX3A 4FTJA 4MEDA 4JIAA 3FYKX 4E6AA 3E7OA 5HORA 4FOCA 4B7TA 4HGTA 4E8AA 2Z7SA 3C51A 3TAXA 4XJ0A 2WQEA 4CYIA 4ZMEA 3UJGA 4AN3A 2WELA 5CASA 3QALE 4YTIA 4UMTA 4XOZA 2R64A 3UZRA 4YPDA 1BYGA 3ZS5A 1Q5KA 4QMZA 3HKOA 4C38A 4QMSA 1BX6A 3AC1A 5DFPA 4JL9A 4FGBA 4TYHB 2A27A 3DBQA 4IM0A 4K8AA 4WNOA 3ZTXA 4FI1A 5L3AA 3ERKA 4P5ZA 4RFYA 2ONLA 4BDEA 5BYLA 4AA5A 2W7XA 4RBLA 5AA8A 4RVKA 3F3ZA 3KRRA 4HGSA 2YA9A 3TTJA 5IA5A 4QD6A 5JRSA 3CBLA 1O6KA 2WTDA 2VTNA 3QCXA 3CGOA 4HYSA 4TT7A 3AXWA 3TV7A 3QQJA 4OTDA 5KMNA 3NCZA 4DLIA 5E7RA 4H3BA 5KJMA 3RAIA 1H0WA 4FKOA 4P90A 2PUPA 4IFGA 3KRLA 4QMUA 5EM5A 3WIGA 2B55A 4O96A 4NJDA 4RX9A 5ACBC 3Q6WA 3QTUA 5JN2A 2REIA 3ZSHA 5FM2A 1XH8A 5FP5A 4KBCA 5FXSA 2W1CA 4ZTLA 3L8VA 5BX0A 3BU5A 3V8SA 2Y7JA 4G3GA 4FZ7A 4MH7A 3AMBA 5CTPA 2V22A 5BMMA 2YHCA 3D7TA 4B8LA 2VGXA 3TG5A 1MRUA 3VUTA 3OCTA 2W4JA 1H0VA 1ZYCA 4EOKA 1Y91A 4IB1A 3P79A 1GAGA 4V0GB 3DTCA 2QU6A 2Y4IB 3F88A 5KE0A 3R2BA 5FDXA 4BCPA 3UOKA 4G3DA 2HOGA 1JNKA 5IDNA 3SF4A 3ZZWA 4PMMA 2QLQA 3MTFA 2YFXA 3ZO1A 3COHA 4MF1A 4ASEA 3MY5A 3AT3A 2FH9A 3NPCA 2W9FB 1OIYA 4NU1A 4QP3A 4YMJA 2BILB 4JDIA 4M69B 3V8TA 3T3UA 4D2VA 4QMWA 4IWPA 4NM0A 3T9IA 3QD2B 2GS6A 2W17A 4ZTMA 2BHHA 4ZTHA 2H9VA 4ZJJA 5IPJA 4EH2A 3QKLA 4GKHA 3GC8A 3TI1A 4GZ3A 1QZ2A 4WNFA 1S9IA 3QD0A 3DQWA 4NCTA 5B7VA 3SW7A 5ETAA 1YDRE 4CZTA 1CKIA 4BWPA 1ZMUA 3KF4A 3ZO3A 3BQCA 4I0RA 1YWRA 2CJMA 4P5QA 3LJ2A 4QMXA 3ZFWA 4PPAA 3GU5A 1GZKA 4WKQA 2BKKA 1FMOE 3KXMA 3QC4A 3PE4A 3GCQA 2W5AA 4GK3A 4DTAA 4XBRA 4EK4A 3GU4A 1PXPA 4IM3A 4G23A 1XKKA 2JAVA 3DJ6A 2HZIA 3E8EA 3U4UA 5FD2A 5C9CA 1V0OA 1U54A 3PY1A 3F69A 4OTHA 3T3VA 3MTLA 2X9FA 3EFLA 4EHGA 4AGWA 3OTUA 4MNEB 3F6XA 3HRCA 5M72A 4ZXTA 4I23A 2WU7A 5A4CA 5HOAA 2EUFB 3RZFA 2XK8A 3A7FA 4FTQA 5ANKA 5D0QD 4D28A 1IYGA 3PPKA 3FEGA 2QKRA 3L8PA 4U44A 5LVNA 4IWDA 2CLQA 3SXFA 3EOCA 5L8KA 4OR5A 5DIAA 3QTQA 4YJPA 4HZSA 2XEZA 2QOOA 4X3JA 3MH0A 4IAAA 5J9YA 3CKBA 4GVJA 3EZRA 3SV0A 4LEUA 3R7EA 3VRZA 5EI8A 4C59A 3LY7A 3EIDA 4ZJIA 2XNPA 1YXVA 4I6HA 5JFXA 1PW2A 2XNMA 2C0OA 3ZO4A 3OG7A 4GFMA 4GV1A 4C4HA 4KRCA 3M2WA 3C4CA 3DY7A 3PA5A 4L3JA 1M17A 4RPVA 4O2ZA 4V01A 1XBAA 4AOJA 1OL6A 4DFZE 3PXRA 4I5MA 3UDBA 2C6IA 3GCSA 5D1JA 4E5AX 3TV6A 3NGAA 4BDBA 4F1OA 1PJKA 3UPZA 4USDA 1WAO1 2QFCA 4I2WA 5EQPA 3RNIA 4O1OA 4GPKA 4CTCA 4UI9K 3FQSA 4X2NA 3TZ8A 4YZCA 5LVLA 1QPDA 1Z57A 4X3FC 4G6OA 2BAKA 5KMMA 5IISA 2C3JA 1JSVA 3DBFA 5A46A 5JFVA 1OIUA 3Q9WA 3JY9A 4KBQA 4UWYA 2Y6OA 2WIHA 3UIBA 3LM5A 3LQ5A 4KSQA 4FTCA 1V0PA 3L8SA 5AV0A 4EEVA 1IHGA 2R3RA 3WZEA 3FMLA 3EMGA 3GXLA 4U42A 4RG9A 4HPTE 3MVMA 2WQBA 2B0QA 4KS7A 4YJQA 2FEZA 5T3QA 2GMXA 4HNFA 4LGGA 4OW8A 5AUVA 2QG5A 4O7SA 1UNGA 4M67A 2MHKA 4NFNA 3Q2JA 4GYWA 4O0WA 4WNGA 2W9ZB 5CSHA 1LR4A 1PKGA 1Q3WA 3ASGA 1P14A 5LVMA 3LXLA 2YM5A 3U87A 3WE8A 4HOTA 4FKSA 2PU8A 2GFSA 3S3IA 3CVLA 5CNNA 4CFXA 4FZDB 3VNTA 2VN9A 5HQ0A 5KJLA 4E1ZA 4JG7A 3V5QA 1W98A 3ZUUA 5HE2A 4YJRA 4GS6A 3ZM9A 3DKCA 3QYWA 2O63A 2AYPA 4TWCA 2GHGA 3TUBA 1OBGA 3K5UA 4KKHA 3UODA 2UZEA 1S9JA 3DLSA 5H3QA 5C8NA 4YZMA 2BFXA 3C1XA 4YC3A 5DIZA 3P86A 5LARA 3RO3A 4CCUA 4F1MA 3F7ZA 3CPBA 4ID7A 2XNEA 3IDPA 4LOQA 3WZDA 2JLDA 3BYSA 5CS6A 3GFWA 3QX2A 1JKLA 2VTQA 3U9CA 4V04A 4ACMA 2C30A 5CANA 3SC1A 3OWKA 4IAFA 4YLJA 3EN9A 4L7SA 3COKA 3VS0A 4TL0A 3BBTB 2O3PA 3D5VA 5M51A 2PQNA 1JKKA 3O71A 1Q24A 4PRJA 1WBSA 4IDVA 3IEGA 2QODA 4FT0A 4XHKB 5CEOA 4BCOA 3L8XA 4C62A 1R78A 4A1SA 4ZTNA 5KO1A 4IQ6A 4EQFA 1CDKA 4F4PA 3PE2A 3R8UA 4FL2A 4QP4A 5CHEE 1ZY5A 3R71A 5LVOA 3QFVA 2YISA 4FTMA 4BYJA 3W16A 3WF9A 4EQUA 4G3FA 4AW1A 3CD3A 3CEKA 4O7TA 5FEEA 3W55A 2JEDA 5H8GA 5EM6A 3Q2MA 4YHFA 4ZZMA 4UXQA 2OBJA 3DK6A 2FO0A 4H1JA 3TCPA 3DJ7A 3I1AA 5IQIA 5J7HA 5HLPA 3JVSA 3K5VA 4BCJA 5JFWA 5ACKA 3NS9A 3U6JA 4U81A 2UY1A 1YI3A 2FUMA 3F3VA 2G01A 2WTJA 5J87A 3R04A 3RKBA 4BDHA 4D4SA 5C27A 5CF4A 5IQHA 5CSXA 1OKWA 3FMKA 3LPBA 2IF4A 1GZNA 2Z2WA 2C4GA 4AM9A 2UV2A 4F6UA 3VBTA 1PY5A 5DT3A 4RIXB 3UPXA 3JVRA 2QOIA 2YIXA 3KXHA 2W5HA 4EBVA 3TXOA 4FSQA 4NTTA 4O6LA 3Q4ZA 2X81A 3H10A 4LOOA 4Y73A 5KMJA 5ARFA 3IS5A 5EOBA 4EOJA 4H7YA 3DOGA 3ZU7A 4EHEA 5DMZA 1HCKA 4W9WA 2W06A 3VS7A 4FTTA 3D0EA 5CNOA 5E8XA 4BZOA 5L2IA 4GCNA 3OBGA 1Q8WA 5M08A 4XMOA 2UUEA 4WSQA 5AIRA 3R22A 5DBXA 5BUEA 1CKPA 2BALA 3UOHA 3RPRA 1YI4A 3DA6A 2PZIA 3URZA 2DUVA 1FPUA 2WGJA 3NW6A 1RE8A 3OVVA 3R2YA 3MV3B 3OEZA 4UN0C 5D0OD 4BDKA 4HVHA 1BUHA 1ZMWA 4L01A 3LCTA 3HVCA 3SX9A 4R7BA 2GQGA 3VBYA 3ZOSA 1R0EA 3QGWA 2VTJA 4FV7A 4ENXA 4ZY4A 4LM5A 5AP7A 5KJNA 3HUCA 3TT0A 1QL6A 5I9WA 4L3LA 4NM5A 3ZDUA 3AGLA 3BV2A 3FXXA 2ETRA 2YM3A 2ZV7A 2UZBA 4O6EA 4KNBA 2J50A 2OICA 3UG2A 2HCKA 4FICA 2RSVA 4FIGA 3UYTA 3DNDA 3TN8A 2PMIA 2JLBA 3PLAE 3AC2A 3CCNA 2XA4A 3NSZA 2O64A 1AQ1A 1JSTA 4KIKA 3OWJA 4UB7A 3FHIA 4H3QA 4IVAA 3S0OA 1PXMA 2YIRA 3IONA 2BTRA 4BT9A 3U9NA 2R3PA 4IWOA 5K5NA 3QZGA 4GU6A 3BLHA 3BRBA 4FNYA 2GHLA 3UYSA 3CEQA 4BBMA 1X8BA 2OO8X 2Y0AA 5E92A 4N5CA 4AN9A 2VTIA 3SVVA 4YHJA 3QWWA 4AFJA 5AV4A 3EQRA 3VRYA 4RMZA 5AIKA 3EWHA 5JQ5A 4MXXA 5FXRA 3AC4A 4QTAA 3ASDA 4PDOA 5EW8A 5A6NA 2CPKE 3SQQA 4F6SA 2YCQA 1PXIA 4FT7A 3QGYA 4O0UA 4PPBA 4FK6A 3LW0A 3QLFA 4M69A 3V5WA 5C26A 4QT1A 3TNIA 4ZLOA 5I3RA 4IAKA 2V7AA 4YTHA 2HXLA 4X21A 1E96B 1IA8A 2UZLA 4QP7A 4O7WA 5HD4A 1TKIA 2OJJA 2VWIA 1PXLA 1I09A 1M7NA 3AC8A 4C4GA 4CCBA 4Y6CA 3NUAA 2YIWA 4XV3A 4XBUA 5EDRA 3NLBA 4Z9LA 2ZM3A 3FMHA 3FJQE 4ZJVA 4O83A 5LOHA 4YZDA 4MXCA 4Y85A 4DH1A 1TJCA 3E8CA 3VHEA 3NUUA 5G1XA 1XH4A 4RWJA 2PE2A 4MYGA 3WF6A 1U5RA 4PMSA 1SNXA 3KK8A 2XIXA 4ZSGA 5HNGA 3E62A 3NUPA 3ORTA 5HCYA 4PNKA 3FKLA 2JKQA 1H07A 3UC3A 4JLCA 2XCKA 1KSWA 3VBXA 3O7LB 4AXAA 2OLCA 4FKLA 5EDPA 3NEWA 3QHWA 4JBVA 4DBXA 1ZAOA 3W10A 2QG7A 1ZY4A 3MY1A 1FVRA 3HDMA 3AC5A 3ALNA 3G51A 3VS5A 3DKGA 1OPLA 3SG9A 4FT5A 3PA3A 3HV7A 3N4TA 3DK7A 1E1XA 5D7AA 4ZLZA 4APOA 4FIIA 4BGGA 3BEEA 2W1FA 1BLXA 3OF0A 2Z7QA 4Q5EA 5AAFA 4JIKA 3RJCA 3UOJA 3HV4A 3TKIA 2I7QA 4EOLA 4GCJA 1RQQA 2UW5A 3LAUA 2QO9A 4IDTA 4NKAA 3ROYA 4FKUA 5DHJA 1B39A 2UW7A 3HV3A 4OAUC 4C34A 2ITQA 3JYAA 4KSPA 4JAJA 3RJVA 1BMKA 4WUNA 5HE0A 4RC3A 4B9DA 4EK3A 5HTIA 3O8UA 5LMBA 3K54A 2R9SA 2VAGA 5IEYA 2IZSA 4E93A 2RFSA 3D83A 2C2LA 3ORZA 3NAXA 4IE9A 2R3OA 3EN6A 4BCKA 5K5XA 5HQ8A 3M11A 2YZAA 3UIMA 2IN6A 4MKCA 4C4EA 3BPRA 4FV1A 4NWMA 4Y83A 5IH4A 5KMKA 4FV6A 3GU7A 2F2CB 3O2MA 4RWIA 4AN2A 1VYWA 3AT2A 5HGIA 5AFVA 2DYLA 3QRUA 4OTIA 2XZSA 4X2KA 4FGRA 2C5XA 4R7IA 3NW7A 3SOCA 3UPVA 5D12A 1H1WA 4H05A 4UZDA 4EYMA 4GA2A 4DEAA 2WQMA 3O0GA 1J3HA 3C5UA 3TDWA 1G3NA 4MK0A 3D5UA 4FNWA 3LM0A 3R7GA 3GCUA 4FVRA 5HI7A 4GUBA 3FLSA 4ZY6A 3RPSA 4JHRA 2W4OA 4AA0A 1SVHA 2XKEA 2FVDA 1PXOA 5AM7A 4DGLC 2HO1A 3RWPA 2X8DA 4WNPA 1QPCA 1ZOGA 3H3CA 3LCOA 4JRVA 2YIQA 4PTCA 4QMLA 5FTOA 1U4DA 4APPA 2XIKA 4C2WA 5IQEA 5G04J 2UWJG 5HBHA 2BAJA 3SKCA 3D7TB 1OPJA 2VGXB 4J52A 3R8ZA 3QCQA 3C9WA 3BV3A 3FXZA 2NP8A 4JR7A 1SM2A 1Y8YA 1YWNA 2G2HA 2UW3A 5HG5A 4D55A 3VF8A 4G3EA 1Y8GA 4JOAA 5D41A 3TNQB 1KT0A 4N2QA 3LFNA 3LMIA 3I7CA 3S7JA 5DGZA 5FXQA 4FYNA 4M68A 1HZ4A 4D5HA 3UZTA 2C5VA 1XNFA 4J98A 1AGWA 5EHYA 3ORNA 5HKMA 2PZPA 2BZIB 2B52A 3VC4A 4E4MA 5JFSA 2OH4A 3H9OA 3FY2A 4FKJA 4G2FA 4UYNA 4IX5A 4UALA 1H1SA 2WMSA 3MJ2A 3P1AA 4CV9A 5I9VA 4F3VA 5CVGA 4XP0A 2PVKA 2OIBA 3P4KA 3PA4A 4HCVA 2B4SB 4RZVA 2W99B 3CQEA 3I81A 3IG7A 4ZTRA 1WBNA 2BRMA 4IX6A 3G6GA 1M2RA 3GU8A 2WMTA 4GVAA 2OFVA 2X7FA 1ZYLA 4FTKA 2IG7A 4L43A 4PY1A 3TNPC 3RAHA 5ARGA 2OZAB 3OCBA 2WMRA 4NCTC 3N4VA 5TR6A 1YHVA 4W8DA 3W32A 1FMKA 2GQRA 2BZJA 1K2PA 2JD5A 3LJ0A 3QKMA 1OMWA 2UZWE 4FSRA 5CU3A 4YVOA 2IW6A 1R0PA 2XH5A 1HH8A 3FLYA 3NCGA 3BWFA 4AF3A 2GS2A 3R1NA 4I5HA 4BKYA 4KAOA 4GT5A 4CZYB 4DCAA 4NH1A 4C3FA 1DAYA 3FMJA 3QRKA 4RT7A 1UWHA 3DZQA 3AS4A 3KULA 4PMPA 1NT2A 3O17A 1R39A 4CMUA 4QMTA 5E1SA 3PJCA 3VS6A 3KAEA 4MAOA 3N51A 4O0VA 3UMWA 1NVSA 3A7HA 3H30A 4J8EA 2GNLA 4UBAA 3RTPA 2YHVA 3VW6A 2C6DA 4YJOA 3EQDA 3GT8A 2ETKA 3DDQA 3QTWA 2P55A 2PVYA 2FB8A 3EL8A 3R8LA 1Q8TA 2X39A 3QKKA 2FGIA 1Q97A 3EQFA 2J0JA 3R7IA 4TXCA 1J91A 5K0XA 4BR3A 4CRLA 2VWXA 3FZTA 4W4VA 4YP8A 4A9TA 1ZOEA 3EN4A 3G9LX 4FUYA 4WNMA 3REPA 4YTCA 5GZ8A 1XH6A 2ZB1A 4OTGA 4DGMA 5BVOA 5IA4A 2Q7FA 2GNFA 3GQIA 4UYAA 3QCYA 3ZFMA 4DTKA 2LGCA 2PUUA 5AR5A 5JJ6A 4EHVA 3PIYA 4FTOA 4NUSA 3F2NA 4U3YA 4DHFA 4DH7A 5TOZA 1H01A 1UU3A 3BIZA 4EQMA 3FL5A 2JC6A 5CF8A 2VSNA 4B94A 2R0IA 2BR1A 3R9NA 3QWJA 4FKGA 4OTFA 4DFYA 4WNKA 5J5SA 4U7ZA 3EN7A 3EYGA 4BIEA 2AC3A 4G6NA 4XG6A 3EQHA 3TG1A 4FA2A 4KYOB 3ZBFA 4AW0A 4CMTA 2HENA 4IX4A 4U79A 4YJNA 4BWRA 5KZ0A 1H1PA 1Q3DA 2UZTA 1A06A 5FZRA 4HOSA 4F63A 1MUOA 5AX3A 3LFQA 5AP5A 4RG6A 4G9CA 4FVQA 3MH2A 2GNJA 3DDPA 3DTWA 4HVIA 2J0LA 3CIKA 3WF7A 4A9UA 4RLLA 2VSYA 4M13A 3CD8A 4R77A 3U4WA 4FSUA 4F9BA 4FL3A 5BMSA 3RKVA 2H8HA 3FBVA 3ACJA 3DAEA 4FEVA 4LUEA 3F61A 1H1RA 5J79A 1B38A 4RA5A 4DA5A 2QI8A 4MXYA 5FRIA 3IW7A 4N2SA 2WMUA 3FXWA 4W8EA 3GOKA 5I4NA 4AA4A 5LWNA 2XYNA 2VX0A 3EQBA 4FT3A 3LZBA 3OCGA 2UZNA 5M55A 2BROA 4QNAA 3P5KA 2CGWA 3FMDA 2QOHA 3KFAA 3QAME 3ZHPC 3D2KA 3PVWA 1BL6A 3CVNA 3AD5A 3SLSA 4D2WA 3CV0A 2EXEA 5FQDC 4IVDA 5EW3A 3ZRLA 2WEVA 4RWLA 3TIYA 1DS5A 3UNZA 3P0MA 4L44A 4O22A 3HZTA 3RCJA 3ZXZA 4EJNA 3PE3A 4UMRA 2ERZE 4ZSEA 2XKDA 3TUDA 4YU2A 3S1HA 2PMLX 2X9EA 4MQ2A 2XP2A 4ANOA 2PE0A 4A07A 4NW6A 4AU8A 5I5ZA 1F0QA 2UW9A 2WTKB 3DT1A 1REKA 2I0VA 2IVVA 3ZLWA 2L6JA 2O2UA 2QONA 5KKRC 2UW8A 1WVXA 4R1VA 1UU8A 3D7ZA 3DKOA 2W4KA 3FC1X 4JX3A 3QD4A 3R8VA 3ZEPA 4BC6A 4YUQA 2BTSA 4N70A 3RK5A 3PXKA 3A61A 5H2UA 3LIJA 3BGZA 3UGCA 1Y57A 5AP6A 2KCVA 4H3PA 3QRJA 2VRXA 3VQUA 5AR4A 1OUYA 4U9AA 2WMVA 3ORPA 4MBIA 2QC6A 4QP1A 3PE1A 3P7CA 5AUXA 5HIDA 3VBVA 4G34A 4JQ7A 3ETAA 2EVAA 2FSTX 4NEUA 1KOBA 4HVGA 4PDYA 5KHWA 2EB2A 4JBQA 4KABA 4U8ZA 4D9UA 4BY9E 4FIEA 3QF9A 5HVKA 3O51A 2W0JA 3FFLA 1PYEA 2UY1B 4CV8A 3BYOA 3B2WA 5LXMA 5KUPA 3KVWA 2UVXA 1UU7A 3FUPA 3NYOA 4IAYA 3IKAA 4O1PA 4HYHA 5KMIA 3QLGA 2JBOA 5C1DA 5GIOE 4GYYA 4QPMA 4V05A 4AACA 2CN5A 4J1RA 4K9YA 1J1CA 3L9MA 4RJ3A 3BHTA 5E8UA 4L00A 2X1NA 3E63A 4ITIA 1ZWSA 3PSBA 3WZKA 4CKRA 5ICPA 4LRMA 4WG4A 3VTYA 2NO3A 3I0QA 4RWKA 3RK7A 3DZOA 5BQ0A 4ZTSA 4GEOA 5TT7A 3QZIA 4J8NA 1NA3A 3GQLA 4J99A 5AMNA 4WNDA 4BDCA 1TQIA 4K0YA 3HNGA 5HO8A 3PSCA 3ULZA 3Q3BA 4BTJA 4BZNA 1KT1A 3LXNA 2YACA 3GC7A 4AFEA 2P0CA 2KTYA 2ACXA 2VV9A 2Y9QA 4O91A 4QP8A 3W2SA 3ZMMA 4BHZA 4U07A 4IZYA 4PQNA 3ZBXA 4L6QA 4MWIA 3O48A 3MFRA 4JS8A 3T9TA 1NY3A 3D9VA 4NYEA 4O7ZA 3U51A 3TZMA 3UTOA 5GHVA 3NUYA 3UVPA 2ZM4A 4J8FA 3II5A 1JWHA 2OKRA 2WD1A 4NTSA 4BDAA 5CAQA 4HORA 1Q61A 2PULA 2CDZA 3DKFA 3B8QA 5AP0A 4E4XA 4UZHA 1KV2A 4IMYA 4ANNA 4BB4A 4YC6A 3QRTA 4A9RA 2BHEA 2VD5A 4G16A 4QQJA 4XUFA 2QLUA 3HUBA 4KIKB 4C0TA 4N0SA 2XVDA 1JAMA 4G2VA 1ZYDA 2JKMA 4KA3A 1R3CA 3C0IA 4S33A 4C8BA 5FWKK 3IO7A 5ETIA 3CSVA 2RF9A 3CY3A 3ZCLA 2ZMDA 2C5NA 4D2RA 4FKRA 4L46A 2GHMA 2FYSA 3TL8A 4S34A 2F49A 4RGJA 3KXGA 2YM6A 4EUUA 5IH6A 1YRPA 3UC4A 5KHXA 2X4FA 1DM2A 3MBLA 4GFOA 4J7BA 3BKBA 1O9UA 4K33A 4A4LA 4BIDA 3MPTA 4EH5A 4F70A 2YCRA 2PUIA 4XV1A 1CTPE 5A4EA 4RIYB 1ND4A 2R0UA 3SOAA 3VVHA 2QNJA 3OD6X 5IU2A 3EDTB 2WNTA 2Y4IC 2GS7A 2CKQA 1H25A 3QYZA 2C5YA 1KE8A 3SXRA 3BWJA 2VU3A 3KB7A 4S2ZA 4TPTA 4XV2A 3TEIA 2HYYA 4WG5A 5EKNA 2R5SA 4XG2A 3FLWA 5DR9A 3PIXA 1Q62A 2XBJA 4QMVA 3CC6A 5GINE 2VO6A 5CT7A 2G2IA 2C47A 3FZRA 3NNUA 2ZDTA 4DBNA 3MESA 3CLYA 3AS8A 4ZEGA 5EYCA 1UA2A 3FLZA 4JG6A 4IN3B 2R3FA 2WO6A 3D15A 4LOPA 5AJQA 4EBWA 5EKOA 3WI6A 4E20A 3WF8A 4C36A 3E87A 2WQNA 3DFAA 2P2HA 2R3JA 4L45A 4ZS0A 4AT5A 4DEGA 2YQ8A 2VTAA 3ESKA 4U0UA 2CKPA 2OZAA 3LY9A 3ZO2A 2PSQA 3GP0A 4DYMA 3EH9A 5G05J 2Z02A 4YNEA 4O82A 5IUHA 3VWAA 1IR3A 1M2QA 3UZPA 3RAWA 3CKCA 3MA6A 3GB2A 4F7LA 1ZZLA 5AR8A 3WE4A 2W1GA 3KMWA 4HW7A 2ZDUA 3R8PA 2PZRA 1ZRZA 5E8WA 4LRKA 4ANQA 5HVJA 3ET7A 1W83A 3ASHA 4OLIA 3GC9A 2FF4A 4PPCA 4RFMA 3PLSA 1IRKA 2P4IA 4ZP5A 1M7QA 4D58A 4WNEA 2YZLA 5CSWA 3KMUA 1FVTA 4LMNA 5AP2A 2LSUA 2CCHA 4FG9A 3OP5A 3P9JA 3RM7A 4G5JA 3E4BA 1VZOA 3QQLA 2J2IB 4APCA 5LMAA 3QA8A 2BPMA 1LEZA 1IAJA 5C1QB 1WAKA 4O81A 2BZKB 4XP2A 2C68A 4E3CA 2YDJA 1U59A 4NM7A 3FPQA 2J9MA 1J7IA 1YOJA 5H9BA 4RJ4A 3S7FA 5LCKA 3BHUA 3PRIA 3DPKA 1GIHA 2VTTA 4HZRA 3V8WA 4EWHA 4E73A 2VWUA 5BVWA 5GJGA 4C58A 4IADA 3K3JA 4FSNA 4RRVA 2C3IB 4KD1A 4OTQA 2CNVA 4U3ZA 2HW6A 4EUTA 2J6MA 3BYVA 2YLFA 3LQ8A 3PXFA 4HYIA 1MQ4A 5KZIA 4ZLYA 4DAWA 4Z3VA 2BMCA 3PY3A 5CI7A 1W3BA 4QTDA 5AA9A 3N71A 2R3IA 5T68A 4KXKB 4CLJA 4QMPA 4QP6A 3PVUA 4G6LA 4I21A 2VWWA 1OKVA 3ULIA 4BKZA 4IC7A 4Q2AA 3DGKA 5AR2A 1ZARA 4ACDA 4CD0A 3Q15A 4M0YA 1YXTA 5FT9A 4KWPA 2UW0A 3ZSGA 2FSLX 1GJOA 5K9IA 4OTRA 3BE2A 4QRCA 3GVUA 4QTEA 3BGPA 4ZZNA 3RO2A 1UKHA 3S7DA 2OH0E 4UI9J 4FG7A 3NWWA 3QC9A 4TWOA 4WHZA 5B2KA 5HCXA 1YDSE 3FC2A 3FY0A 5HX6A 2VTMA 4ZK5A 3UP7A 3A7IA 4AGUA 2KC7A 4F7JA 5EHOA 3TNWA 2ZB0A 3TV4A 1BI8A 4EZ3A 5JQ8A 1MRVA 3UNJA 1PMVA 2C6TA 2NNWB 2CMWA 3C4EA 5HO6A 3R9RA 3LCSA 2B53A 2I0HA 3PPJA 3U8WA 4EORA 3QUPA 4QTBA 4QQCA 4QQ5A 4D5KA 3AG9A 2WTCA 3I5ZA 4GK2A 3OEFX 5CEQA 4YHTA 4FKQA 2F7XE 5FGKA 4F64A 4LMUA 4I6BA 1K3AA 2VTHA 3BZ3A 2P58C 3OUNB 4B0GA 5M44A 4OT5A 5IQBA 4U04A 3HYHA 2YCFA 4PNIA 3KCKA 4AZVA 3DBDA 4WUYA 2BAQA 3HP5A 4K1BA 1PMUA 5D11A 4DEHA 2Y4UA 2PMOX 2XPIA 4BN1A 2VGYA 2ESMA 5DT4A 4J8DA 5AUWA 1LP4A 5KMLA 4W4WA 2UZUE 3UQFA 3C0GA 3VUMA 3EJ1A 4EK8A 3Q4CA 3R21A 4PL3A 5AUUA 5GZ9A 4QYYA 1P4FA 1UWJA 3OWPA 2OF4A 3F3UA 1WBWA 1Y6AA 3FQHA 3R6XA 5K3YA 5B2LA 4RG0A 3ZZEA 4O7NA 4XLVA 3DXNA 3C4FA 3OWLA 2QVSE 3BHHA 4GK4A 3JYSA 5HBEA 4O38A 3ZDIA 5EX0A 3RNYA 2VX1A 3KULB 3V6RA 1GIIA 3OXZA 2QOQA 4AOTA 5E8SA 3TKUA 2C0MA 2G2FA 1SNUA 3SZ7A 4FSWA 5FEDA 2DWBA 4GG5A 2XK7A 3PZHA 5EW9A 1WBOA 4LI5A 3DB8A 2R7BA 3OCSA 3SXSA 4BFMA 5M56A 3LY8A 2XEYA 3SD0A 4U80A 2PYWA 4G17A 5JK3A 5DYJA 4G1WA 4UWCA 5CVFA 4CZUA 5HU9A 3K9IA 5LVPA 3GUBA 5CEMA 2BZHB 2HY0A 3VW8A 1REJA 2XK9A 4GIIA 4H36A 2XEVA 1ZZ2A 3HLLA 4EC9A 4RJ5A 1F5QA 1VJYA 3UO5A 1JQHA 4HCTA 4CFUA 4L9IA 3ZXTA 3W2QA 3OMVA 4KIPA 5HIEA 3NYNA 2OJ9A 4QPSA 2XGMA 5K4IA 4QMMA 4L3PA 4ERKA 3PJ8A 4MVFA 3TJDA 3HA6A 2PVHA 4RIOA 4YC8A 5JGAA 3H4JA 4U6RA 3E64A 5KMOA 3OBJA 4FTUA 2WHBA 1XWSA 3A62A 3RBWA 5HLNA 3E88A 4CTBA 3SHEA 3ZC5A 4AGCA 3IDBA 4BGQA 3DB6A 5DOSA 2VNWA 4YSMA 3AS5A 4GL9A 2C6EA 3COMA 2XNOA 2ZYBA 3OS3A 2OJGA 3JUHA 2W1IA 5DA3A 4GYOA 4CGWA 4I1ZA 3G2FA 4D4RA 4B99A 5DR2A 1XO2B 3Q9XA 2A4LA 4AZTA 4IVCA 4E6DA 5LQFA 4C37A 5IH5A 4QNYA 1M2PA 3F7WA 3S7BA 3RIBA 4Z7GA 3HMOA 1P5EA 4R78A 3A8XA 1JPAA 1Q8ZA 5E90A 4RIYA 5EM7A 1ZYJA 2RL5A 4F0FA 2P2IA 1O6YA 3BE9A 2OXYA 1XH9A 3QZHA 1FOTA 4LYNA 1ZXEA 2UZVA 4W9XA 4FF8A 4ARKA 3A2CA 5IEVA 5A4LA 2Q0NA 4JQ8A 4FSMA 4ERWA 4RVLA 3CTHA 3NYVA 4ANLA 4IM2A 3KF7A 4FTRA 2QOBA 2YEXA 2GQSA 4F09A 3N9XA 4II5A 4FV4A 2NRUA 4DEBA 4USFA 4IJ9A 4XI0A 5J7BA 2GCDA 3SG8A 2XK6A 5BUIA 4ACCA 2GNIA 3HRBA 4CGVA 3LCKA 4JA7A 4HOUA 4ZS4A 5AR3A 4N4SA 3WZJA 5C4LA 2RG5A 3R01A 2X6DA 1GOLA 1LUFA 3MIAA 4FTIA 4KKEA 5CY3A 4BZDA 5J1WA 4G1TA 5E8TA 3MKRA 4FC0A 2I40A 2YN8A 4DITA 3FZSA 5L8LA 3TDVA 4H1MA 5HHWA 2RG6A 4R5SA 2WEIA 1YKRA 2XK4A 3UQGA 4I0SA 3JXWA 5A6OA 5AUTA 1YOLA 5M4FA 2F2UA 3DK3A 4QO9A 4F0GA 4AT4A 4NW5A 1KUTA 2X0GA 3V5LA 5IKWA 5FUTA 4BCMA 5LMKA 3PY0A 4ZTQA 4I4EA 1RW8A 1U46A 2GNGA 3TTIA 2VX3A 5F20A 3W8QA 2XNNA 2ZJWA 3NDMA 4GYGA 1R1WA 4UWBA 4R5YA 3MA5A 2JDSA 3D5WA 1YXXA 3RAKA 5CQWA 4WRGA 3TKHA 4EZ7A 2RGPA 5CU4A 4RX5A 5I9YA 2X4ZA 2ITXA 2HYZA 1IAHA 4TNDA 5EI2A 1WMKA 2PK9A 3KK9A 4FNZA 4ALVA 3SA0A 2OG8A 1OL7A 3WIKA 3BELA 4IVBA 3ZC6A 3D5XA 4RQVA 5CU6A 1OIRA 3OW3A 4BF2A 4K6ZA 4JDJA 2QOLA 5BVNA 2CN8A 3CKXA 2VNYA 4EH9A 4A4XA 2XBAA 4N6ZA 3MFUA 2QR7A 3KU2A 2XCCA 4BWKA 4JNWA 1E9HA 1SMHA 2XCHA 3UO4A 5KX8A 4UQYA 3FV8A 1H08A 4MCVA 3DXPA 1DAWA 2V0DA 2WMQA 5C8MA 1A9UA 2ONDA 5CZIA 3NNWA 2E9VA 3HMIA 3Q9ZA 2X7OA 5HICA 2HAKA 2WPVA 2A2AA 4FK3A 5LCWC 3LCDA 1YW2A 3BLQA 3R9OA 5M57A 2XGOA 4CFFA 4EJ7A 2XK3A 2OGVA 3MH3A 4TWNA 2W1HA 1G5SA 2HY81 3PVGA 1ELWA 2VYIA 2W05A 1OL5A 2OOEA 1W7HA 4AUAA 4X7QA 4AZWA 3E8DA 4CKJA 1OBDA 4NRHB 2ITOA 1J1BA 2YABA 3N4UA 3ZGQA 3RVGA 1JKSA 5JZNA 2F9GA 4D1SA 3OROA 5DPVA 3KY2A 2IVUA 1ZMVA 5HTCA 2JFLA 3QQKA 2E2BA 5M53A 3NMUF 2ONLC 1MP8A 2Y6MA 3I5NA 3QQGA 3RPYA 5T6KA 4XRLA 3OXFA 4YZBA 2EXCX 4BI1A 1KV1A 2FA2A 4FKPA 4YJVA 5DLSA 3UBDA 3QCSA 3F2RA 1Q8YA 5CEKA 3R0TA 5BYZA 3TJCA 4ANSA 2J0KA 5IQAA 4I5PA 2W1EA 4MX9A 4QYHA 4I9CA 4GG7A 5DE2A 3A8WA 4FV5A 4FEUA 1Q4LA 2YJRA 3HAMA 4CG8A 2KULA 4ALWA 3NUNA 3PWYA 3F5GA 4S31A 4BDJA 2BRGA 1YDTE 3QKYA 4I41A 3QWVA 5BW8C 2IJMA 4QPAA 4WO5A 3NNVA 2VTPA 2QR8A 2QOKA 4JA9A 4BTFA 4ABNA 2UVZA 3DCVA 3H0YA 4NSTA 4PL5A 4XNEA 4O27B 2C6OA 3F9NA 1QPJA 2XM8A 3FDNA 4FTAA 4RJ6A 2V55A 3V51A 2XF0A 4CFMA 1J7UA 3GOPA 4F9WA 3HL7A 3FP3A 4F9YA 3CJGA 2PL2A 3U54A 4UX9A 3VO3A 2OIDA 1OUKA 1PYXA 4K18A 2X2KA 3EB0A 3FWQA 4U45A 4XRJA 4ASXA 4AOIA 1WBTA 4N39A 5A54A 4XIFA 4OTWA 5E4HA 3NVKI 3FMNA 2GFCA 2WIPA 3A99A 3JY0A 3NR9A 4H58A 3EKNA 5K0KA 1YA0A 3V6SA 4K11A 5EFQA 5BVFA 2OSCA 3QWKA 1DI9A 3CP9A 3G15A 3OFMA 1G8AA 4J71A 2X2MA 4YO6A 2ZMCA 3LHJA 4FZ6A 4GU9A 5CYIA 4L8MA 4RQKA 4X6RA 3FSKA 3VS1A 3V5JA 4MNFA 3LKMA 3DQXA 1SZMA 4BDIA 3MEKA 2QO2A 1IA9A 3D2IA 3PG3A 4U0IA 4BI2A 4OUCA 1OL1A 2WB8A 4NJ3A 1KWPA 5BYYA 4IW0A 2JDOA 3QTIA 5BVEA 4TNBA 3UVRA 4NM3A 4CQEA 1CKJA 2WOUA 2DS1A 3KA0A 5EYKA 4BT8A 1JOWB 5CF6A 4HGEA 4RVTA 2KCKA 3CJFA 4MXZA 4O0XA 4F6WA 3R00A 3FYJX 3LFSA 4EKLA 3QTRA 4JBOA 2G9XA 4R3PA 4ZAUA 1M14A 2Q83A 4DINA 4FIFA 2W1ZA 3HMPA 5DT0A 2CGXA 2ERKA 4GT3A 5EYMA 5HG9A 4GT4A 3Q4AB 1OPKA 2BFYA 3EFWA 4ZOGA 5IEXA 5ANIA 2XUUA 3Q60A 5F94A 5JZJA 4NQ0A 4YLLA 3R1QA 2WKMA 1K9AA 1VR2A 4L42A 5ETFA 2JKOA 3R7OA 4DLJA 3FMEA 2BVAA 5BNJA 3R9AB 4CDRA 3ZFYA 4O0YA 2B9IA 3E92A 3LLAA 1URWA 3LXKA 4XG7A 4OGRA 2A0CX 4TZRA 2Z8CA 3ULQA 2XIRA 4M84A 5HLWA 4PV0A 4BCNA 4BYIA 2VWVA 2PVJA 5HX8A 4CNHA 2WAJA 3Q5IA 3R83A 3CR0A 3ZH8A 3O23A 5DWRA 2J5FA 4JR3A 4YO4A 2WMAA 2UVYA 4F9AA 3NAYA 4C35A 4MBJA 4D2PA 2VZ6A 5CSPA 3A7JA 3AGMA 3KMMA 3TM0A 5IQFA 1CM8A 4PP9A 1J7LA 2VUWA 2NRYA 2OXDA 2X6EA 1UKIA 2C3KA 4IZ7A 4YR8A 2B9FA 5A4QA 3RPOA 1APME 1NVRA 2BCJA 3GYZA 3CTJA 4BI0A 3P7AA 4GJ3A 2RFDA 3BBWA 2XS0A 5ANOA 5HI2A 4Q5HA 3EQIA 2WOTA 3G6HA 3I60A 4IIRA 2QOCA 4AIFA 2C6MA 5AUYA 4AAAA 2PQRA 2CLXA 1XJDA 4DF3A 3BYUA 2NC9A 4RC4A 5AAEA 4DFUA 3PJ2A 1B6CB 3MV2B 3OC1A 5L2WA 3L1SA 3QTZA 2PY3A 4GFGA 5KBRA 4O7RA 1E1VA 3KXZA 2BKZA 3MV5A 4G26A 5CXZA 2PVNA 3Q47B 2HIWA 3MFTA 5GNKA 3FKOA 3CQUA 4GIHA 2YWVA 3KN6A 5K4JA 4PWNA 4C4IA 3IPHA 2GDOA 4M3QA 4HGLA 3D4QA 5DEWA 4MBLA 4XYFA 5DRBA 5HNBA 3S95A 4G24A 4NIFB 3Q5MA 4AZEA 5GIPE 2A1AB 2Z60A 4FVPA 3RALA 3KC3A 1SVEA 3RM6A 1Y6BA 2XJ0A 3ZLSA 3LJ1A 3FLQA 3ZSIA 4U41A 2BRNA 4U0SA 5DNRA 1GY3A 1XHAA 3IW5A 4FEQA 4M15A 5I9XA 1ZU2A 2O0UA 1YQJA 4PUZA 2VO7A 4FBXA 2QHNA 3HX4A 1GNGA 3DS6A 3CPCA 4M97A 4AE9A 2WMXA 5A14A 2C0LA 5IZFA 5CCLA 5F1ZA 1XBBA 4HVSA 3PP0A 5I3OA 2WTKC 2EXMA 2YJSA 3SGCA 3E93A 2WQHA 4O0TA 4D1ZA 3ATSA 3QUDA 4EH8A 5L4QA 1WZYA 2R3NA 3FLNC 2VWBA 4GW8A 3R28A 3VBQA 4UQXA 4P2KA 2XJ2A 4JG8A 3HEGA 4RZWA 2F7ZE 4FR4A 4YJUA 4IAIA 3IOPA 4ITHA 5ANGA 2YAAA 3LQ3A 3E3PA 2IO6A 3KRWA 5A6CA 3ORLA 3HYMB 4I93A 1A17A 4FTLA 2OXXA 4BWXA 1P2AA 2IFUA 3KS2A 3R9DA 1HOWA 2W1DA 4AZFA 3U6IA 2WQOA 5CXHA 3QXPA 3ZLXA 4R1YA 4FV0A 4N3CA 4D0XA 3EFJA 1H00A 3RINA 4Z16A 5HBJA 3LFFA 1P4OA 3HMNA 3PFQA 4L68A 3RMFA 1KLXA 4GKIA 5AEPA 5J95A 3DFCB 4O6FA 4BICA 2OIQA 5FTQA 5B0XA 2XIYA 2B1PA 5E9EA 1AD5A 3U4TA 3G0FA 5J9ZA 1UU9A 4CXAA 4W4XA 3R7UA 2XMYA 1CSNA 4C33A 1H24A 4FG8A 4UEUA 3Q5ZA 3NNXA 2J51A 5JGBA 5JRQA 4USEA 1YVJA 2FSOX 2BIYA 2PZYA 3I6WA 4GYIA 3H9FA 1GIJA 2WTVA 2V5QA 3NUXA 2IPXA 5IA0A 3BLRA 3C0HA 3CXWA 4O0RA 3IW4A 3KD7A 4I17A 5FJYA 5M06A 5CEPA 4LUDA 3Q52A 4DG3E 3ATTA 4MD7E 4TKSA 2CCIA 5AP1A 3U55A 5BUJA 3TACA 5AV3A 5AM6A 3SAYA 4GUEA 3ORXA 3UVQA 4NK9A 3VS2A 3WYYA 2CKEA 5BVKA 4CLIA 5CU2A 3MH1A 3FHRA 4B8MA 4HOKA 4EI4A 3RHXA 4XG4A 3TIZA 2XKFA 3R30A 4AW2A 3BYMA 3V04A 4EK6A 4F08A 2PVRA 3FSFA 5TO8A 4L67A 4R6VA 5JJ7A 1OZ1A 3EHAA 2HWOA 1W84A 3P7BA 3W33A 1W82A 1CMKE 4PMTA 4I9EA 2IW8A 1Z5MA 3OOMA 3WF5A 4GRBA 4BBEA 4F65A 5AADA 2QHMA 5CF5A 5IA3A 2JFMA 1PXNA 2C1AA 3UMXA 2ZV9A 4OBPA 1NXKA 3MSSA 2O5KA 3W8LA 4FZFB 3UQCA 2OW3A 4U0ZA 3ORIA 4DT8A 4ASZA 2GU8A 5AP3A 4OAVB 1L3RE 5CENA 4DE4A 5JH6A 2R3GA 3C13A 2QU5A 4YBJA 5L6PA 5M4UA 3FMMA 3TZ7A 3QXOA 5CALA 3BCEA 3E8NA 4UMQA 3UIUA 1G8SA 3PSDA 3QQUA 4G5PA 5A4TA 4WG3A 3ZN3A 3IOKA 5EI6A 3Q32A 5LJJA 4FV9A 3A60A 3ACKA 3DBEA 3MB6A 3MPMA 3HP2A 4RJ7A 5L2QA 5HTBA 3O50A 3I0OA 4IXPA 1Q8UA 3OTVA 3I79A 2PWLA 3DJ5A 3F2AA 3F3TA 2VO0A 4WOVA 3NW5A 5G6VA 5L2SA 1YOMA 4GZ5A 4O7VA 1PXKA 3ZYAA 4I92A 2J0IA 3B8RA 2R3LA 4RFZA 3BHVA 3ENMA 3ZM4A 2HELA 3G5DA 3HDNA 3OOGA 1TVOA 1YXUA 2BRHA 1SVGA 1YI6A 2UW4A 2BDFA 1MRYA 3ODYX 2BUJA 4BDFA 2BDJA 4D4YA 1OB3A 3A4PA 4EQCA 3VQHA 1ZYSA 4I4FA 1XH7A 4M0ZA 3CE3A 2KCLA 1YXSA 3MB7A 5LCJA 3ZHEB 5L6OA
chains in the Genus database with same CATH superfamily
4PS8A 4GTRA 4V3IA 4AX8A 4GSBA 3PXQA 4GH2A 4GPMA 4BVUA 1NZNA 4IBMA 3EQCA 4D1XA 5LOZA 2LXMA 4YDYA 4J53A 2PTKA 3ZONA 2GTNA 3R8MA 2HWPA 2GPHA 2CHLA 3LYAA 2IZTA 3RP9A 2J4DA 2AUHA 2VGOA 4KZCA 3LKUA 4JW1A 4I2ZA 2XRUA 5IA1A 4OBQA 1IG1A 3MA3A 4D2SA 4FKIA 3UP2A 4RVMA 2ITUA 4DG2E 3C4ZA 4BHNA 2EB3A 3I4BA 3MYVA 3AMAA 3DPDA 4GCOA 4LNUD 2XPYA 3JXJA 3A4OX 5I9UA 3ASFA 4MBGA 4MTAA 4C02A 3HMMA 3KKVA 4I6QA 2R3HA 3VUKA 5FDPA 4QMNA 1OWLA 3ORMA 4Y72A 4D4VA 2VTSA 4XCUA 4KRDA 5IY5E 2CHXA 3MJ1A 4BCGA 2R3QA 3IW6A 5CT0A 3UQ3A 4ILHB 3VIDA 3U3WA 3NRMA 4FV8A 4BIBA 1PMEA 5HD7A 3E7VA 1N4PA 4Y8DA 3C4XA 5BVDA 3MPAA 2R03A 3KVXA 4MD9E 4MHAA 5EQYA 2QYUA 4QMOA 2QURA 1Z9XA 4CQGA 2J90A 4PF4A 3UNKA 1QYMA 1OITA 3PUPA 1TNZA 4G9RA 4RLKA 4WRSA 4DFBA 4Y95A 3BGQA 4FOBA 2W96B 5FWQA 5A3XA 4A7CA 3C4WA 4CRSA 4FV2A 5F4NA 1FCHA 2DQ7X 1T45A 4TYHA 4BKJA 2J4BA 3DBCA 3BX5A 1NA0A 3TXNA 5HVYA 1ATPE 3NIEA 4XLIA 2PVLA 2RFAA 2HZNA 1PRYA 4HB5A 2QYJA 4ORKA 3C3RA 4XV9A 3GCPA 2WXRA 5C8KA 3G0EA 3G90X 2CSNA 2UZDA 3CHOA 5DN3A 5EH0A 5B2MA 3FUHA 2IWIA 2H6HA 2XNGA 4XX9A 4FZAB 3ZHEA 3TWSA 4LL0A 3QU0A 2P33A 4JZYA 1JLUE 4EOIA 2J08A 4HNIA 1KOAA 1YYHA 5CLPA 2DWZA 5HG8A 5D10A 3TUCA 4BCIA 1VYZA 3F5PA 2YIYA 3HVEB 4KKGA 3WOWA 3FAAA 3U64A 3AD4A 3G33A 4RJ8A 2C6KA 3EQGA 4I24A 2C6LA 1HS6A 3RGFA 3BG1B 2IOSA 3CTQA 4BDGA 2R7IA 1M52A 4I3ZA 3R63A 1GZOA 1JVPP 5IUIA 2BUGA 1FQ1B 2X6JA 3GI3A 3DPYA 3AMYA 3F5UA 2B6CA 2ETBA 3WZUA 2LAVA 3NVMB 4MXAA 5AAGA 3HHMA 4FKTA 4D0WA 1OL2A 2UW6A 5JEBA 3D9KA 1Q99A 1B89A 4M14A 4FLBA 1DI8A 3CKWA 3S4QA 4NKSA 2DYSE 5ENSD 5GJDA 3CK7A 4QYFA 2B9JA 3FZ1A 1NA7A 1TQPA 4MS6A 3TWJA 4XOYA 2R3MA 2E9NA 5CQUA 4I94A 2LSVA 2HW7A 4YTFA 1H2VC 1PKDA 4Y5HA 4BY6A 5IA2A 3PPZA 5ETCA 2AW6A 3PRFA 3SDJA 3FUFA 1STCE 3MN3A 1U54B 5HE3A 4BTAA 4Z55A 1H8FA 1OKYA 5CMWA 3R1YA 4RIXA 3MS9A 3LE6A 4TYJA 2DCPA 2WU6A 4NIKA 3GCVA 4AWIA 4U97A 4L2LA 2YAKA 4QMQA 5ITAA 4YVQC 3D9HA 5TE0A 5M07A 4E6CA 2EIME 4QYEA 3ZEWA 3GGFA 1PC2A 5H8EA 4S32A 3QX4A 4ENYA 4WD5A 2R2PA 3UIXA 4IB0A 1T46A 5DH3A 4CMOA 3UG1A 3UX4A 5CAPA 4AV7A 3GFEA 3NF1A 1RJBA 4G31A 4C3RA 2C0IA 3OXTA 4JEUA 5EDQA 2J07A 3ROCA 5IG1A 1OKZA 3H9RA 4G25A 4FE2A 4X2GA 4YGAA 2VTRA 2H34A 4U7EB 4QMYA 3IGOA 3TWVA 4QQTA 3O8TA 1ERKA 3NZSA 3WBLA 2OU7A 4A55A 3OHTA 4I1MA 4I0TA 4IEBA 4BDDA 3POZA 2F57A 3PJ3A 1PMNA 2I1MA 5FG8A 3Q96A 4AXFA 2ETMA 3J5PA 1HXIA 4B0ZA 4U43A 2P9NG 3HECA 1H6PA 3PYYA 3GNIB 5I0BA 4U5JA 4YJSA 1WBVA 3SI5A 4FTJA 4E6AA 4E8AA 3TAXA 5CASA 3ZS5A 4QMZA 3AC1A 4IM0A 3ZTXA 4RFYA 2ONLA 5BYLA 5AA8A 1K8KG 3F3ZA 3KRRA 4EBWA 5JRSA 3CBLA 4HYSA 3TV7A 4KVOA 4H3BA 5KJMA 4P90A 2PUPA 4IFGA 3TWQA 3KRLA 4QMUA 5EM5A 2B55A 4O96A 5ACBC 3ZSHA 4KBCA 4ZTLA 3BU5A 4G3GA 3D7TA 1Z5SC 2W4JA 1Y91A 4IB1A 3F88A 2QU6A 2Y4IB 4RLYA 4QEBA 4BCPA 3SF4A 2YFXA 4ASEA 3NPCA 3V8TA 2P9PG 4L23A 2W17A 4ZJJA 3TI1A 4CZTA 4BWPA 1ZMUA 3KF4A 3LJ2A 2IQCA 4WKQA 1FMOE 3PE4A 4DTAA 3DJ6A 3U4UA 2HZIA 3E8EA 3PY1A 4OTHA 2Y1LE 4EHGA 3HRCA 4ZXTA 4I23A 2WU7A 1IYGA 4D28A 4U44A 3EOCA 4OR5A 3MH0A 3EZRA 4LEUA 3EIDA 5JFXA 2XNPA 5CRUA 3DSVA 1PW2A 2C0OA 4GFMA 2Y0BG 3PA5A 4RPVA 3UDBA 5E76A 5B1BE 5EDSA 3NGAA 1WAO1 5EQPA 2H6IA 4X2NA 3TZ8A 4X3FC 4G6OA 5IISA 1JSVA 3DBFA 3Q9WA 4KBQA 4UWYA 4HFGA 4KSQA 3L8SA 4EEVA 3CQGB 2R3RA 1JCSA 4RG9A 4YJQA 4HNFA 2QG5A 4M67A 4GYWA 1LR4A 1Q3WA 5LVMA 3EIQC 3LXLA 3DSWA 4HOTA 4FKSA 4DDIA 3S3IA 2XQ0A 2WQ7A 5HQ0A 5KJLA 4E1ZA 4YJRA 4GS6A 3ZM9A 3DKCA 3QYWA 2O63A 4TWCA 3UODA 1S9JA 3DLSA 5C8NA 3P86A 2IO2C 3IDPA 3WZDA 3BYSA 5CS6A 3QX2A 1JKLA 3U9CA 3COKA 4TL0A 3BBTB 2O3PA 1JKKA 1Q24A 3L8XA 4C62A 1R78A 4EBAG 5KO1A 1CDKA 4F4PA 3PE2A 5LVOA 3QFVA 2YISA 4FTMA 4BYJA 3UMVA 3WF9A 1NP7A 4O7TA 3W55A 2JEDA 3TCPA 3DK6A 5IQIA 4H1JA 3U6JA 3K5VA 5ACKA 4BDHA 4D4SA 5CSXA 2IF4A 4WWOA 2Z2WA 2IF8A 1HG5A 3UPXA 2YIXA 3PS6A 2X81A 3H10A 1X5BA 5EOBA 5AQ9A 3VS7A 4FTTA 5L2IA 3OBGA 1Q8WA 5M08A 2UUEA 4WSQA 5BUEA 3URZA 2WGJA 3NW6A 2VSXE 1RE8A 4BDKA 1BUHA 4L01A 3HVCA 1ST0A 2GQGA 4FV7A 3ZDUA 3AGLA 3FXXA 2ZV7A 4O6EA 5FQ7A 2J50A 3UG2A 4FICA 4FIGA 3DNDA 2JLBA 2PMIA 1MJ0A 5BPPA 1AQ1A 1JSTA 3FHIA 3S0OA 3U9NA 3EUVA 4FNYA 4BBMA 2OO8X 4N5CA 2VTIA 4RMZA 3AC4A 4QTAA 2CPKE 3V5WA 5C26A 4ZLOA 2V7AA 1KZOA 4QP7A 5HD4A 3SA0A 3AC8A 4XBUA 5EDRA 3DXMG 4EPZA 4O83A 3E8CA 1XH4A 3PH0C 3WF6A 4MYGA 1U5RA 1NL4A 2XIXA 3FKLA 2JKQA 3EJNA 1FVRA 3AC5A 3G51A 3DK7A 3UI2A 4ZLZA 4APOA 4FIIA 1BLXA 2Z7QA 4Q5EA 5AAFA 2MRIA 3UOJA 4EOLA 3SD5A 1H19A 3LAUA 4NKAA 2UW7A 3JYAA 4KSPA 4JAJA 1BMKA 5LMBA 4EK3A 2IZSA 2C2LA 5HQ8A 2YZAA 3UIMA 4C4EA 3GU7A 2F2CB 4AN2A 3AT2A 5HGIA 3SBSA 2C5XA 1WDYA 3NW7A 4UZDA 4GA2A 3C5UA 1G3NA 4MK0A 3RPSA 1PXOA 2X8DA 1ZOGA 1U4DA 5IQEA 2BAJA 4MKTA 2VGXB 2XZTG 3R8ZA 3QCQA 3C9WA 4JR7A 1Y8YA 1Y8GA 4JOAA 2JEKA 5FXQA 3L9TA 4JD2G 2B52A 3VC4A 4CV9A 4UALA 1H1SA 3P1AA 3HRAA 4XP0A 3PA4A 3IG7A 1WBNA 4IX6A 3BG0B 3G6GA 1M2RA 4LCTA 2IG7A 4A3TA 2BZJA 3UKUG 3LJ0A 4FSRA 1OMWA 2UZWE 1R0PA 3FLYA 3NCGA 3JQ1A 2GS2A 4BKYA 4CZYB 4NH1A 1NT2A 4PMPA 3O17A 4CMUA 4QMTA 3N51A 3UMWA 1NVSA 2C6DA 4YJOA 2X39A 3FTYA 3QKKA 3R7IA 4BR3A 5K0XA 1J91A 4CRLA 3FZTA 4A9TA 4YP8A 5GZ8A 4WNMA 4O4EA 3LXUX 2Q7FA 3ZFMA 3PIYA 4DH7A 3AU4A 5CF8A 3R9NA 2X0OA 3ONLA 3EN7A 4KYOB 3PUFC 3TG1A 4IX4A 5KZ0A 3IHYA 4F63A 1MUOA 4G9CA 2VSYA 3CIKA 3QB2A 3ZYKA 4FSUA 4F9BA 3F61A 4RA5A 4DA5A 4MXYA 2WMUA 5I4NA 4FT3A 5M55A 2BROA 3SQVA 3PVWA 4D2WA 3CV0A 4IVDA 5EW3A 3ZRLA 3TIYA 1DS5A 2I9CA 4DDGA 2XKDA 2PMLX 2X9EA 2XP2A 4ANOA 4U07A 4GA0A 2WTKB 1REKA 2I0VA 2IVVA 2O2UA 4JX3A 3ZEPA 4YUQA 3PXKA 5AP6A 4U9AA 3VBVA 4JQ7A 4NEUA 4KABA 4U8ZA 4D9UA 3FFLA 3O51A 2UVXA 1UU7A 3NYOA 4IAYA 3QLGA 4AACA 2CN5A 4J1RA 1J1CA 1N95A 5E8UA 3E63A 3PSBA 2NO3A 3I0QA 3RK7A 2OVBA 4GEOA 3QZIA 4BDCA 1TQIA 3PSCA 1KT1A 5AQ7A 2KTYA 4ANXA 4BHZA 3MFRA 4JS8A 3T9TA 4J8FA 4BDAA 4NTSA 3CHPA 2CDZA 4UZHA 3QRTA 2VD5A 4G16A 4XUFA 4C0TA 2XVDA 3CSFA 4G2VA 3IO7A 2RF9A 2C5NA 3CQCB 4D2RA 2GRQB 5IH6A 2X4FA 1DM2A 3MBLA 3BKBA 4EH5A 2YCRA 3EIJA 4XV1A 5A4EA 4RIYB 1ND4A 2R0UA 2QNJA 2CKQA 3QYZA 1KE8A 3RRUA 4TPTA 4XV2A 2ZGDA 4XG2A 3FZRA 4DBNA 3CLYA 3AS8A 4ZEGA 1GW6A 4U0UA 3ZO2A 2Z02A 3VWAA 1M2QA 3UZPA 2W1GA 3KMWA 3EHQA 5HVJA 3ET7A 3ASHA 3GC9A 4PPCA 4RFMA 2P4IA 2P9SG 1M7QA 1FVTA 3P9JA 3UKRG 5LMAA 3QA8A 2C68A 4J6IA 3S7FA 3PRIA 2VWUA 5GJGA 4C58A 2NSZA 3BYVA 4ZLYA 4Z3VA 2R3IA 4CLJA 4QMPA 3ULIA 4Q2AA 5AR2A 4ACDA 3Q15A 4M0YA 5FT9A 4KWPA 2UW0A 1GJOA 1K1AA 4QRCA 2EIJE 4BFRA 4FG7A 3NWWA 5B2KA 3FY0A 5HX6A 3TNWA 4EZ3A 1MRVA 4LSZE 4M3OA 3X2QE 1L5JA 1A5EA 3BL7A 4L1BA 4QQ5A 4D5KA 3AG9A 3I5ZA 4GK2A 2F7XE 4F64A 4LMUA 4N5QA 4B0GA 2IY0C 1DC2A 2WXLA 3DBDA 2BAQA 3T8MA 3HP5A 4K1BA 5D11A 2Y69E 2Y4UA 2XPIA 4FULA 4J8DA 5KMLA 4F6RD 4FADA 3VUMA 4C0MA 4O4BB 2OF4A 3F3UA 4HVBA 4XLVA 3C4FA 3QNKA 3ZDIA 2VX1A 3KULB 4ZHBA 3OXZA 2QOQA 2G2FA 1SNUA 3DB8A 4BFMA 2XEYA 4U80A 4G1WA 3HXDA 4CZUA 3IBEA 3K9IA 2XS1A 3GUBA 5CEMA 2HY0A 2XK9A 4GIIA 2XEVA 4EC9A 1VJYA 1IHBA 3ZXTA 4KIPA 5HIEA 2OJ9A 4QMMA 4ERKA 3TJDA 4U6RA 3OBJA 4RVBA 3ZC5A 4YSMA 4GL9A 2C6EA 3COMA 4GMJA 4B99A 1XO2B 3FY4A 5LQFA 4C37A 5IH5A 4AXCA 1Q8ZA 5E90A 1O6YA 2DIWA 1FOTA 2ILRA 4ARKA 3A2CA 4IM2A 3HXCA 2GQSA 2GCDA 3TWUA 2XK6A 4UUCA 4CGVA 4JA7A 4ZS4A 5C4LA 1GOLA 3FHEA 4KKEA 4I1OB 5L8LA 3IKOB 1YKRA 3JXWA 5M4FA 3DK3A 4AT4A 4NW5A 5ENRD 3PY0A 1KLXA 4EZ7A 2RGPA 1IAHA 2X4ZA 1DVPA 4ALVA 1WMKA 2PK9A 3D5XA 1OIRA 3OW3A 4K6ZA 2CN8A 3AKJA 2VNYA 4N6ZA 2QR7A 1SMHA 3FV8A 3DXPA 5C8MA 2X7OA 2HAKA 2IEJA 1FT2A 4NURA 3R9OA 1YW2A 3BLQA 5M57A 2XGOA 4EJ7A 2XK3A 2WXMA 4CKJA 4X7QA 2ITOA 3N4UA 5CBNA 3OROA 5DPVA 2IVUA 5HTCA 2Y6MA 4XRLA 3UBDA 3QCSA 1Q8YA 5CEKA 3TJCA 2J0KA 4I5PA 3A8WA 4ALWA 3MX3A 3NUNA 3PWYA 3F5GA 4BDJA 1YDTE 3QWVA 4I41A 2QR8A 2QOKA 4JA9A 2UVZA 3DCVA 4PL5A 4XNEA 3EDTB 2XM8A 3V51A 2YINA 2OEWA 3ABLE 2PL2A 2RKKA 3VO3A 2X2KA 3FWQA 4XIFA 4GTSA 3TWTA 5BVFA 3QWKA 1DI9A 3G15A 3OFMA 4FZ6A 5CYIA 4RQKA 3V5JA 4BDIA 3G2WA 3MEKA 3D2IA 4OUCA 1OL1A 4NJ3A 5BYYA 4AEZC 4TNBA 3UVRA 4NM3A 2DS1A 4BT8A 5CF6A 4X8QA 4HGEA 4RVTA 4MXZA 3BQOA 3QTRA 2W1ZA 3G2SA 3Q4AB 1OPKA 4NQ0A 5F94A 3R1QA 4L42A 4FEUA 2BVAA 3LLAA 1URWA 2A0CX 3APDA 3Q5IA 5DWRA 4YDOA 4JR3A 4F9AA 3NAYA 4MBJA 4D2PA 5CSPA 5IQFA 3DRAA 1CM8A 2NRYA 2C3KA 5CEDB 2BCJA 3I60A 4IIRA 1H0AA 4AAAA 3BYUA 3SFZA 2PY3A 3MFTA 4GIHA 2YWVA 2GDOA 5DEWA 3D4QA 1H6OA 3RALA 3RM6A 2L0IA 1Y6BA 3LJ1A 4U41A 5I9XA 2O0UA 1SVXA 2VO7A 4FBXA 2QHNA 4M97A 4DRXE 5CCLA 5F1ZA 2YJSA 3E93A 2WQHA 4JC8A 3ATSA 4EH8A 3FLNC 2IJGX 4JG8A 2F7ZE 2YAAA 1LTXA 1P2AA 3U6IA 3HVEA 4D0XA 1H00A 1EYHA 4L68A 4GKIA 4GMRA 4BICA 4EZLA 3U4TA 3G0FA 4CXAA 3R7UA 3AU5A 4E85A 3I6WA 3H9FA 2V5QA 3CXWA 5FQ6A 3Q52A 1OWNA 4TXPA 2CCIA 1G8JA 5AV3A 2GRMA 2AXZA 4GUEA 3Q73A 3AG3E 4CLIA 4HOKA 4EI4A 3RHXA 3TIZA 2XKFA 5AAOA 3BYMA 4R6VA 2IW8A 3OOMA 4F65A 4BBEA 2JFMA 2F37A 4OBPA 3UQCA 4DT8A 3OAWA 4BESA 3C13A 3FMMA 5CALA 3BCEA 3QQUA 4G5PA 4WG3A 3ZN3A 3IOKA 5EI6A 5LJJA 3DBEA 3ZYQA 3MPMA 5HTBA 5KBAA 3O50A 3I0OA 2PWLA 5G6VA 3NW5A 1YOMA 1PXKA 4I92A 3ENMA 3G5DA 2BRHA 3FTXA 3ODYX 2BDJA 1OB3A 3A4PA 4M0ZA 2KCLA 1YXSA 3ZHEB 4C2VA 3ML9A 4LG6A 3PZEA 3ORKA 2ITPA 5E8ZA 3PWDA 2XIZA 2XCBA 1QMZA 4JXFA 5DRDA 4ZY5A 5CAUA 2CKOA 4Q96A 2BTDA 4FUXA 1U5QA 4GJ2A 4TW9A 4FX3A 3QBNA 3UO6A 1AWCB 3VN9A 3QWPA 4RX8A 4U40A 3KXXA 3IQ7A 3O7LD 5JGDA 3LFBA 5I9ZA 3P08A 3R73A 5GZAA 4BTBA 3FE3A 2R3KA 3H0ZA 2VGPA 1A48A 5EOLA 2GNHA 1XH5A 3IW8A 1FPPA 4IB5A 3TWXA 5HESA 2J7TA 3BU6A 3C50A 4GZ6A 4DT9A 4EZ5A 4QDVA 5AV1A 3R7VA 3PJ1A 2X6HA 3QHRA 4O2PA 1URCA 4ME2A 4NIFA 2Y4PA 4IHPA 2WXVA 4I22A 3MGYA 1EH4A 2XJ1A 1O6LA 4UQZA 4JDKA 2X8IA 4DTBA 2WZJA 2XB7A 4G3CA 5DEYA 4EOQA 2JAMA 3VUHA 2JIIA 2DBAA 3AG4E 3EQPA 3OT8A 5FZSA 3S2AA 4DX5D 4AQCA 3GW4A 2JITA 4E6QA 1XR1A 4IC8A 2HZ0A 4CFVA 4FL1A 1YHWA 2VWYA 2HZ4A 2QCSA 4A3VA 3FQEA 4LV8A 3MDYA 2R2LA 3ZXSA 4FKWA 1UNHA 3MVLA 4I20A 4O60A 1H4LA 4E7WA 1PXJA 3VLFA 5JJTA 4CDNA 5M09A 3L6AA 4ACGA 4C7TA 1H27A 3W2CA 2CHWA 4M66A 3DNEA 3TNHA 1OXJA 1ELRA 3PP1A 4JVGA 4C48B 1KE9A 5TKDA 4UXLA 3LFDA 1RZ4A 5E8VA 3PZ3A 3GU6A 2P9LG 2I0EA 3D9LA 2BEDA 2G1TA 3ALOA 4YBKA 4KMOA 4XH6A 4P7EA 4EH4A 2B9HA 2RFMA 2VO3A 2I1KA 5HO7A 3KEXA 5J1VA 2JKKA 2WXFA 4JDHA 1FINA 2BDWA 4ANBA 3DXQA 2CNUA 3ELJA 3QQFA 4B4LA 2C0TA 3FPMA 4BCHA 5LCWJ 4N3BA 2NPQA 3CVPA 1BKXA 4JI9A 3W2RA 1OCCE 5F9EA 3KRXA 2WM9A 4DGOA 5EG3A 4KBAA 4LRJA 5E8YA 4ZSLA 4GTQA 1VDYA 3LMHA 2E9PA 4TRLA 2UZOA 4X3FA 2IVTA 3CS9A 3E5AA 1N9AA 3V2OA 1OVEA 1Q41A 1H1QA 3ZIMA 4FYOA 2JGZA 2J4ZA 4AE6A 4FEWA 1IQUA 3RWQA 2Z7RA 4BCQA 3CVYA 3C72A 5ANEA 2AC5A 2V4LA 2IW9A 4TYGA 4WSYA 4AXDA 4XG8A 4FV3A 3F66A 4QP9A 4PL4A 4IB3A 5L6WL 5FTPA 3Q49B 4R8QA 2YDKA 5LWMA 2KATA 4Y5QA 5E91A 2VTLA 3CY2A 1E90A 2VJ8A 4NFMA 2RFEA 4Q9ZA 1KE5A 2V62A 1W8CA 3KEZA 3OXIA 2PVFA 3CK8A 2PL0A 3NBNB 3KRJA 2ITNA 2B7AA 4IJPA 3OT3A 4IAZA 3W9GA 3FL4A 5G04C 4Y6WA 4RIWA 4YZNA 4FKVA 1JBPE 4N3AA 5DVRA 2XRZA 1OI9A 2PHKA 3LFCA 2I0YA 3G9NA 4BTKA 1NW1A 5BNWA 2CG3A 2PUNA 3VLEA 1Q2ZA 3ZRKA 4PX6A 4QDEA 5M4CA 4ASDA 2I6HA 4URKA 3JS2A 2F8YA 4F7NA 3EFKA 3MVJA 5KCMA 4JBPA 4X2FA 3L13A 3P23A 1H26A 2X7GA 3LFAA 3FUIA 4LL5A 1SYKA 4IZAA 3S2PA 4MQ1A 4EKKA 3WILA 4EONA 5HKPA 4O21A 5DI1A 3V5PA 1W0XC 3ANQA 3F82A 3ENHA 2FSMX 5FBOA 3RPVA 4EOOA 5JMSA 3CIAA 4HRLA 1D8DA 5ANJA 3IXEA 4DH3A 1UV5A 3DU8A 4AY6A 3SRVA 3ZPJA 4M12A 4BEPA 4N6YA 4OT6A 4RA4A 4YNOA 4KINA 3VS3A 4BTMA 3B7TA 3L08A 5HIBA 5KKRB 5L2TA 4X6QC 3D9PA 5CCMA 3AT4A 1KE6A 3A7GA 2YM8A 1BL7A 2ITTA 4R3CA 4LV5A 2JDTA 4F9CA 5EM8A 3VS4A 1UW4B 1FVVA 5IMEA 3ULEG 5HZNA 4KB8A 4UY9A 1QCFA 5CX9A 3LVRE 4YNDA 5BPYA 5DBKA 1E7VA 2JDVA 4EZKA 2ZM1A 2YERA 4L52A 3ZRHA 3FWVA 4JL0A 2ZV8A 3IHVA 2WVIA 2OJIA 3Q04A 2Z7LA 2ITWA 4MEDA 3FYKX 3E7OA 4HGTA 2LXLA 4XJ0A 4CYIA 4ZMEA 3UJGA