2PZIA

Crystal structure of protein kinase pkng from mycobacterium tuberculosis in complex with tetrahydrobenzothiophene ax20017
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
677
structure length
654
Chain Sequence
GSHMLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase pknG
total genus 200
structure length 654
sequence length 677
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF16918 PknG_TPR Protein kinase G tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pziA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pziA02
5LVOA 3UBDA 4LV8A 4J95A 1QCFA 4FK6A 4D55A 2J51A 5H9BA 3F2AA 3S95A 5E8ZA 4F6SA 4G24A 2CKOA 4MVFA 4R1VA 1UVRA 3C4EA 3FP3A 3MY1A 4ALUA 3RTPA 4DBXA 5IQEA 5JSMA 1GAGA 3TNWA 3LXPA 4LUEA 4QP6A 3EQDA 1KWPA 2GNGA 3VS5A 4CD0A 2L6JA 2BZKB 2YN8A 4I0SA 4DFZE 4LGDA 5F94A 2C3LA 2WTWA 4L8MA 1XH6A 3SXRA 4UMRA 5J7HA 2PVLA 5I4NA 4Z55A 4YLKA 3AGLA 5EHOA 3OCSA 2NNWB 2QR7A 3SA0A 1H00A 1YWRA 4RIOA 3KKVA 2QI8A 4IVDA 2F7EE 2DUVA 3FUPA 2GDOA 3KCFA 4AA5A 2W05A 4C58A 3WF9A 3TDVA 3EWHA 1ZYJA 3HA8A 4QO9A 4AW1A 4J8DA 1OKVA 2NP8A 4FT0A 3ZSGA 3G15A 4E20A 4RA4A 5AIKA 3NCZA 2BZIB 4DG3E 5EI6A 2JIUA 4QMTA 4GYYA 4NYEA 4JL0A 4DEIA 4D9UA 5GNKA 5C1DA 5IH4A 1NVSA 2ITWA 3LFCA 4L67A 4MH7A 4NJ3A 4GV1A 2QQ7A 5CU4A 2C6LA 2C0TA 3GENA 4FSRA 5HE3A 4D4YA 3VQHA 3TM0A 5J8IA 3HYHA 3MGYA 4U0ZA 3IKAA 3QKLA 5CF8A 3LCOA 4BTKA 4WNKA 2OF2A 5HEZA 3UNKA 3ROCA 3EOCA 3Q53A 4NFMA 1BL7A 2EXEA 4UMQA 5GJGA 2BKZA 3TNHA 2VTJA 4D4VA 5EQPA 3FI8A 2W9FB 2BALA 4NIFA 2PMOX 1H26A 4AWIA 1JLUE 4FKSA 3OCGA 3ET7A 1UV5A 3Q9WA 3ZSIA 3QTRA 3RALA 1SVHA 3NYXA 4BC6A 1T45A 3FHRA 3R83A 2FSMX 3OOMA 5I3RA 4GUBA 4Q9SA 3Q15A 4U9AA 3K2LA 1WMKA 4CLJA 3MY0A 4QP4A 1W3BA 2J5FA 3REPA 2A2AA 4HGSA 2XIKA 5AUWA 4GT3A 5AUVA 4AUAA 4M67A 4AQCA 2BRBA 4EKKA 3KREA 2UZEA 4RVMA 4IE9A 4NJDA 4E26A 3GU5A 2C0MA 4BKJA 1BX6A 2O8YA 3CIKA 3F5XA 1ZZLA 3HUBA 5TOZA 4ENXA 1CKIA 3QX4A 1IA9A 3U6HA 3E8EA 2VSYA 4EKLA 3OW4A 4OBOA 4BGQA 2X6EA 2VO6A 4M15A 4DLIA 4YSMA 4YO4A 5CI6A 1PKDA 3ESKA 4QPAA 3NWWA 4O0VA 4QMYA 2PMLX 4DA5A 2A1AB 2Z60A 3QFVA 4WSQA 4DGNA 5GIPE 4BZDA 2VZ6A 3AC3A 4MXYA 4Q5EA 5HESA 1MQ4A 2GNIA 1OKZA 4FE2A 4ZMFA 4RX8A 1ELRA 2QLQA 3JY9A 1URCA 2QHNA 1UNHA 2QU6A 3NPCA 5I9VA 3FXWA 4X2NA 1REJA 1PMNA 3FI4A 3VBTA 5IZFA 4EK4A 3UDBA 1PW2A 3CD8A 3H0YA 3NUUA 4FK3A 5BQ0A 4AIFA 4E4NA 3D14A 2VWYA 1AQ1A 5BX0A 5BNWA 5JJ6A 4O82A 1FOTA 2VWUA 2XJ2A 3NX8A 4AY5A 1H1PA 1R39A 1E9HA 1ZOHA 4H3BA 2V62A 3ANRA 4FGRA 1Q24A 1WBPA 2X9EA 3W10A 3W55A 2KTYA 3HV3A 5A6NA 5J5TA 4OUCA 2GNLA 5C03A 1J7UA 5E91A 3KD7A 3EQFA 3T9IA 1DS5A 3DOGA 3QALE 3OBGA 4G1TA 4HOSA 4P90A 3HRCA 2JGZA 3PLSA 1OPJA 5TKDA 4G3CA 4L68A 4PDSA 2WXVA 5IDNA 2F9GA 4XYFA 4QNYA 4ZIMA 2ZYBA 3BI6A 4XG8A 3KRWA 4NM5A 3VBQA 3VC4A 2WPVA 3EDTB 4APPA 3MJ2A 1YOJA 2ITVA 4YJSA 3QDNA 2WTKB 3KK8A 4RX5A 2YAAA 2NPQA 4LRJA 4O1PA 1RE8A 1V1KA 4YTIA 3R7YA 3JXWA 4GMYA 4EZ3A 2QOIA 5JQ8A 5K4IA 4EOLA 3GI3A 5AUYA 3BBTB 3ERKA 3NNUA 4WG3A 3URZA 3RPSA 3OXLA 3R8ZA 3FAAA 4D2VA 3HKOA 5FWKK 3IGOA 4CQEA 3LY9A 1JKTA 3ZFXA 4CV8A 2G2FA 3PJ1A 4YJTA 5HD7A 3TJDA 2VTOA 3FYJX 4C4HA 3KFAA 3PA3A 5FTGA 2WTKC 5FT9A 2AUHA 4R8QA 5AADA 4JIKA 1LP4A 4JLCA 1YXUA 2OZAB 3R7IA 3FY0A 1Q4LA 2VTIA 2WKMA 4N6YA 4DFYA 3D7TB 1HXIA 4DFLA 2IF4A 4XCUA 5K4JA 5M4IA 3V5JA 4NU1A 4FT3A 2YM6A 4IZ5A 3O7LD 3A8XA 4IX3A 3QD4A 2QOCA 4L7FA 4JA9A 2ZM3A 3II5A 3A62A 2UZOA 2XNEA 4G3GA 4OBQA 4BDCA 2Y4UA 3RNIA 3MA6A 4EH5A 1JSVA 4ITIA 4CSVA 2I40A 3EN4A 5DVRA 4TWNA 1BKXA 2XNOA 4RIWB 1MRUA 4YGAA 4J52A 4FYOA 4X2GA 4AE6A 2PVNA 4IAYA 3COHA 3ANQA 3ZOSA 5JN2A 5EX3A 4NW5A 3GU6A 3SF4A 4DEAA 1SMHA 1YI3A 4RFYA 2BCJA 2AC5A 2P55A 3PY0A 4C8BA 4IVBA 5CAUA 1F3MC 4O22A 2IW8A 4I0RA 4KXKB 4QMWA 3V04A 1P5QA 2BPMA 4I17A 3P4KA 4RC4A 2WIPA 1RJBA 2YACA 3GB2A 4BBMA 5AUTA 2R3GA 2FF4A 5G04C 3RPYA 3SGCA 5HQ8A 2J9MA 4EH4A 3FLZA 3WE8A 4BFMA 5BUEA 5E7RA 3QYWA 4AAAA 2OI4X 3T9TA 2X8IA 3WARA 4AOTA 1TQIA 3FI3A 3LOKA 2YCSA 3Q5IA 5D11A 5D10A 4DBNA 1U54B 3SQQA 5JJTA 3BEEA 3EB0A 3F6XA 5HIDA 3VUTA 3MVJA 3Q4ZA 4L52A 4A9YA 2UWJG 4BGHA 3QAME 3B8RA 3R2BA 4YTHA 4DAWA 4E8AA 4EC9A 2BRGA 2VQ2A 3CQUA 3BQCA 3UOHA 5HO6A 2Q83A 3RI1A 4ZTQA 4HVSA 5EKQD 3RO2A 3GC8A 4I41A 3MWUA 3KAEA 2I0YA 4U7ZA 5DR6A 4JR3A 3QLFA 3MBLA 1BYGA 2OG8A 3F82A 2PZYA 3MPMA 4IAFA 5M4CA 2W1DA 1Y8GA 1OI9A 4OTDA 5E8SA 5AR5A 4AZVA 4NL0A 4M69B 3RHXA 3RKBA 5AR8A 4GT4A 2OZOA 3OZ6A 3O17A 4RMZA 4A9SA 3HAMA 4M12A 4LUDA 4RRVA 4AN2A 4EUUA 4EK3A 4I6FA 3WYXA 5BMSA 3H3CA 2BAQA 3RAWA 3OT3A 1K2PA 3MTLA 2RFEA 4GYGA 4JX7A 5KJKA 5M08A 2R3LA 4DCAA 2I0HA 2YQ8A 4FZ7A 4IAKA 3RZBA 4JXFA 2XZSA 3MDYA 4JL9A 4RSSA 3TI1A 5G05C 4GT5A 4CZYB 4BCMA 5KJMA 2BTSA 2XKCA 4RVKA 2I0VA 3LFEA 5AJQA 2WTVA 3BPRA 4JAJA 4HW7A 3MEKA 2J0MB 3C9WA 3VJNA 2UZVA 5IU2A 1YXTA 3PSDA 4I24A 4ZMEA 3UPVA 4JQ7A 4O0UA 3FKNA 5AP4A 2WGJA 4WNPA 3UP7A 3PIYA 4AM9A 3P08A 2XGSA 3ZYAA 2XYUA 5D0QD 4IM2A 1W84A 4PPBA 4X2FA 3TKUA 1Q3DA 4FMQA 4IQ6A 5DT0A 2FA2A 4MK0A 4KBKA 4KS8A 5IQBA 2ITYA 4LGGA 1OKWA 4ANLA 4PTCA 4ANSA 4C57A 4OTQA 3FWQA 4E5AX 3DTCA 4DH1A 4L3LA 2ZV7A 4FTKA 2HCKA 4S31A 4G26A 4R77A 4CFWA 4R3RA 2R3MA 2JITA 4GJ2A 4IEBA 3CQWA 1HCKA 3PPZA 3IDBA 3U4UA 3QCQA 4K1BA 4GVJA 2QOOA 3FLSA 4IZYA 1LUFA 4ZZNA 1XWSA 2ITQA 5KJLA 1WBNA 3LQ5A 3ZRMA 4O84A 5C4LA 3LIJA 2QOFA 3G2FA 4FSNA 4IVAA 3KQ7A 2IJMA 4HOUA 3MS9A 3NNWA 3KY2A 2E9PA 2R64A 4M69A 4Y46A 5HQ0A 2YABA 3W2QA 3T8OA 1KOAA 3FQEA 1OL5A 2R3PA 4B6LA 4MBIA 5HORA 4AS0A 3ACKA 4PL5A 3G90X 4FVQA 4RJ8A 4YJRA 3TIYA 3OEZA 2IVUA 4BCQA 4I5MA 3NF1A 1J7LA 2PMNX 5AUUA 1KE8A 1TQMA 3G51A 3OOGA 4DGOA 4ZLYA 1OVEA 4R78A 2PPQA 2ETMA 1H1QA 3HX4A 5FZRA 2GW1A 2ZMDA 4CMOA 4CZUA 3ZHEB 4V0GA 4RWKA 4IVCA 4G17A 5B2LA 2OXYA 4CKJA 1RDQE 3HZTA 2R4BA 5IQFA 4RFMA 3ZMMA 3ENMA 4NSTA 3R8PA 4QMQA 3RPRA 4EOKA 4C4JA 1M52A 3I5NA 4G2FA 3UO6A 5JFWA 4CQGA 1M14A 3VULA 4RWLA 3DJ5A 3RINA 2Y4TA 2ZDTA 2JBOA 5CASA 5IDPA 4IXPA 1Q99A 2QKRA 1W8CA 2HZ4A 3QTUA 4CT2A 4UMTA 3Q6WA 4GS6A 3VS0A 4HGTA 2H8HA 2GS2A 3R02A 3E3BX 4K0YA 4HYUA 4RVLA 3TG5A 3LJ2A 2H9VA 2YM4A 3L8SA 3AD5A 4BI0A 3E4BA 4YR8A 2PUIA 3NNXA 3RJCA 1PXJA 2BROA 2WELA 5CT7A 4TXCA 2B0QA 4USDA 4APCA 4EYMA 2WPAA 3EN5A 4XV3A 4B0GA 5JFVA 5CNNA 2GNHA 3VIDA 1HZ4A 3IDPA 4TKSA 2PZIA 1XH5A 3OXFA 3QCXA 3NDMA 3RK7A 4EOMA 2JKQA 2WO6A 4FKJA 4YURA 4EHGA 1Y57A 5L2IA 4PL3A 3GQLA 3OXIA 4RJ6A 4APOA 5GJFA 5HLPA 4U6RA 4DITA 4ZZOA 2JD5A 4YZCA 3VRYA 3CV0A 2E9VA 3GYZA 3ID6C 5HI2A 1YXSA 2PUUA 4AW2A 2J9QA 3SZ7A 4AZSA 3QTZA 5AV0A 4TYEA 3O0GA 3TCPA 3C51A 4D5HA 3GCSA 5EHYA 5I3OA 1HOWA 4GRBA 2ZM4A 1FGKA 3DNEA 3R1YA 1KOBA 1J7IA 3HRFA 4W8DA 2ONLC 3IK3A 4N3BA 5TO8A 2XGOA 3OCBA 5HZNA 4O7YA 4ACHA 2R3JA 2Q0NA 1YRPA 4FG9A 4DLJA 3JYSA 2O65A 5EW9A 2Z02A 4P7EA 5CT0A 2XEVA 4M68A 2WMAA 3R9DA 5J79A 3R28A 3Q5MA 4CRSA 2YCRA 2YCQA 2EXCX 2V55A 4A07A 4USEA 1ZOEA 4ZP5A 2Z7RA 4UZDA 2OO8X 5L8KA 1R78A 4DEDA 4EHEA 4G25A 4FZAB 4XBUA 4WT6A 4M0YA 4EOPA 4TW9A 4C3PA 4AGDA 1FMKA 1OZ1A 4BYJA 4FVPA 5CHEE 2GHLA 3M42A 4I92A 4MCVA 3KVWA 3ZEPA 4CKIA 2CN8A 4N6ZA 4DT9A 2GPHA 3OWKA 4O6FA 4EC8A 4NZWB 4GA1A 2X9FA 2Y0AA 3C0HA 1PC2A 3AGMA 4YHFA 3ORTA 3TT0A 4PPCA 4TYHA 2C2LA 1H01A 4WRSA 2VWIA 4LOPA 4QYYA 1DAYA 3UZPA 2J2IB 3WZUA 4E5WA 2C5XA 2YA9A 2I6HA 1WCCA 3BE9A 5C8KA 5DEWA 5M57A 3K54A 4G9CA 4KABA 4MF1A 3S7DA 3NIEA 5B0XA 2VNWA 3OD6X 5KHWA 4JHRA 2VYIA 3ZRKA 3RBWA 1FMOE 3W8QA 1OMWA 2OWBA 2ACXA 4G3EA 5FBOA 3FY2A 3UE4A 3GCVA 1WBOA 1UU9A 1XH4A 3AXWA 5CY3A 4E4MA 2WTDA 4QOXA 5J7BA 2XCCA 5CAQA 2HIWA 3CC6A 2ESMA 3KULB 4XG3A 3E63A 3LXKA 5KUPA 2WNTA 2WQBA 5EDRA 4GZ6A 3PE4A 1RW8A 4O7RA 3NUXA 2V22A 4D58A 4DTKA 4I9EA 1GZKA 4EZ7A 2IG7A 3IONA 2WU7A 4FV2A 1I09A 4U79A 4CCUA 4F4PA 4CV9A 3FL5A 4AZEA 4F0FA 2XK9A 5M4FA 2J0LA 4EOJA 4HPTE 4L01A 4F63A 1JOWB 5AP6A 5K9IA 3PJ2A 4PX6A 5BYLA 3LKUA 1REKA 4PMPA 4C34A 4XG4A 3U9CA 2KCKA 4ZZMA 4MNFA 3QTSA 4RVTA 3ZLWA 4FX3A 4IIRA 3MJ1A 4ZK5A 5JGBA 2ZV9A 1XBCA 2FVDA 2VO3A 2XYNA 2NRUA 3ALNA 2W06A 3EYGA 4QMVA 4GIHA 5HBJA 2PL2A 4N5CA 4O86A 3U6IA 4I9CA 5F4NA 4N57A 3I81A 2W1EA 2XJ0A 1YI6A 2XGMA 4YHJA 3MTFA 2ITNA 5G6VA 3KXHA 4RX9A 1GIJA 3QTXA 4A9TA 5HVJA 3G6HA 3FZRA 1KUTA 3PA4A 1Q3WA 4RLLA 3RAHA 3I5ZA 4MTAA 2UZNA 4YVOA 2XCKA 2Z7LA 4FL1A 2ZMCA 4G9RA 3V3VA 4MEDA 1ZYDA 1NXKA 4ASDA 2HY0A 5FJYA 3W18A 4MWHA 5AYWD 3OVVA 3IOPA 4GCJA 4WIHA 4DE4A 1XJDA 4YJPA 4JRVA 4Z9LA 2OBJA 2XKEA 5ACKA 2VGXA 3OFMA 2PTKA 3P7BA 4D1XA 1ATPE 4LI5A 4WUNA 2XK4A 3DKOA 5A3XA 2J0IA 4MHAA 4XBRA 3QU0A 3TNQB 2F49A 3ETAA 4FEXA 5IUIA 2XB7A 1AD5A 2MHKA 2VTLA 2X7OA 3P0MA 4A7CA 3V8SA 3DQWA 3DK7A 4JQEA 4LG4A 2X2MA 3LYAA 4XOYA 3F69A 5DR2A 4E6CA 3DLZA 3KXGA 3HV5A 5LCKA 2XK8A 2Y9QA 3UIUA 4HYIA 4U07A 2VTTA 3GCQA 4ZJVA 4ANBA 2O63A 1J1BA 3CK8A 4O91A 4FIJA 3ZC5A 3MSSA 4AACA 1XHAA 4F7JA 3ZN3A 3D5VA 5ETIA 2VO0A 2UZWE 5BVKA 3QQJA 4GCOA 4N70A 5CF4A 4YLLA 5FM3A 5LWNA 3DCVA 3ZPJA 3CBLA 4OT6A 5EQEA 1U5RA 2UUEA 3HMOA 3KRJA 3PSCA 3TZMA 2CN5A 4BYIA 5GZ8A 3MVMA 4BGGA 2LNIA 4QT1A 3PSBA 4YJOA 4CZTA 3C0GA 5CWZA 4DHFA 4EH8A 2ITPA 2VRXA 4RX7A 4D2TA 3RIBA 4FIFA 2Z7QA 5C01A 2C1BA 4N2SA 3FKOA 2B7AA 2BDFA 3BYVA 4FSUA 3V6RA 4A4LA 3UZTA 4MD8E 5DRBA 4EHVA 2VTPA 1OGUA 1WVYA 2O3PA 3PRIA 5AA8A 1TKIA 2R2PA 3EYHA 4W4VA 1YOMA 3CGFA 3LE6A 2Y7JA 2IVSA 4FEQA 3AC4A 5AP2A 4QYGA 4L7SA 5G1XA 2J0JA 3PPJA 3ZHEA 3TACA 3Q9ZA 4QMPA 4BCIA 4UI9J 4I6HA 2C4GA 2C5OA 2VTSA 4GVAA 3LAUA 4XJ0A 4HCVA 5EKNA 4BDEA 4KB8A 4MBJA 4LL5A 2ZVAA 2X4FA 5DLSA 3RHKA 1E96B 4ORKA 2C5VA 4P5QA 3ZDUA 3DXQA 3GFWA 2RL5A 2OIBA 3ZUTA 3ZXZA 4FKWA 4CGAA 1ZYLA 3ULZA 3A7HA 5AX9A 5IA3A 4N3AA 3HYMB 3RWPA 3QQUA 4IX4A 5M07A 3R71A 3BHUA 3BV3A 3WXXA 3R01A 1H8FA 2W4OA 3B2TA 3QGYA 1OIYA 1ZLTA 3MVHA 3FZ1A 4NW6A 1K3AA 4ZLOA 5JK3A 1ZRZA 3LZBA 3NVMB 4JDJA 1YDRE 3UIBA 1FPUA 3NYNA 1UU8A 3GU7A 3WF6A 3CGOA 4IBMA 2C5NA 3NSZA 2X7GA 5FZQA 2P4IA 4C37A 4DH3A 4PNIA 4IAAA 4NIFB 1BLXA 2OXXA 3IW8A 4CFFA 5M44A 5A4CA 3G0EA 2ZV8A 1XH8A 2PE1A 4LQMA 4FTLA 4Y85A 3OUKA 1OL7A 2Q7FA 3W2PA 4C3FA 4ZAUA 3PYYA 4JR7A 3TNPC 2C6DA 2WHBA 4CMTA 5FG8A 2CGWA 4I2ZA 4RA5A 3VWAA 2YZLA 4UWBA 3U55A 3AS8A 3KN5A 5L3AA 5GJDA 5EYCA 5J1VA 3LCSA 3PJ8A 5L4QA 4WNFA 1MRVA 4YZNA 1P2AA 5IA5A 5K0XA 3DZOA 4F1OA 3Q32A 4OTRA 4BWXA 3LCKA 4NM7A 4FICA 2UZTA 5I5ZA 3AG9A 3DGKA 4FTUA 2FYSA 4S34A 3ZLSA 3UMXA 5FEQA 3DAKA 4W4WA 4ME2A 4DEGA 3QF9A 2J6MA 4KYOB 3LVPA 4X3FB 3PA5A 3BYUA 4ZTHA 5D0OD 3DBQA 1UKHA 4JG8A 3CE3A 4FKGA 2PZRA 3F88A 3UG2A 2Q0BA 4GK2A 4J8MA 5ANGA 3Q47B 4YNEA 3CVNA 4HCUA 2CKEA 1JNKA 5HE0A 2CGUA 2BIYA 3L8VA 5E1EA 3FKLA 3OP5A 3PG3A 3EFKA 2BRHA 2XUUA 4PQNA 5AV4A 2LAVA 3KXZA 5A46A 5BPYA 3JY0A 2C6TA 4CG8A 3EH9A 4AT5A 3SC1A 2CGXA 5DH3A 4BZNA 5AP1A 1YDSE 3KA0A 3F61A 4WO5A 5IQAA 3GCUA 3BLQA 4PTEA 5AM6A 4B94A 4FOCA 2VV9A 3F3UA 3FZPA 3F2RA 2CNUA 4Q5HA 5B7VA 4FSWA 4L3PA 4UX9A 1QPEA 3SHEA 4NWMA 4FV8A 5EM5A 4FKRA 4NFNA 4QTDA 3LJ1A 2FO0A 4FTJA 3S1HA 2JKMA 2HZNA 2YWPA 1KT0A 3UUXA 2X2LA 3ITZA 4DC2A 3VS2A 5LMKC 2WMSA 3NMUF 4JVGA 2PU8A 1YVJA 3R7EA 1PYXA 4IFGA 1H08A 4JDKA 4XG7A 2GQSA 3RK5A 5LVMA 1WAKA 5DBXA 5KBQA 5AR3A 3T3UA 2ITTA 4GPKA 4L53A 2W9ZB 2XIXA 3HMMA 3HA6A 3LM0A 3AT2A 3FQHA 3V8WA 3SVVA 1H1WA 5HHWA 3S2PA 4FV9A 2EU9A 4JA7A 3LLAA 2W5HA 2BFXA 4LEUA 3LKMA 4ANMA 1XR1A 4G5JA 3RM7A 4FTQA 2WMTA 3ROYA 3MIYA 4BTAA 3TTJA 1XH7A 2QCSA 3F5PA 1GIHA 4S30A 4XH6A 4Y72A 5ETCA 4BWRA 1IYGA 4NKSA 5DHJA 4C4FA 4O83A 3RCDA 3F3WA 4ITJA 1R1WA 1Y6BA 4IX5A 4BWPA 3QCYA 4IB5A 4KUJA 5HVYA 2BFYA 3LHJA 3O96A 5JH6A 1O6KA 5ARGA 3DU8A 3LFBA 3G6GA 4TYGA 4O7SA 1P4FA 2EVAA 3H9RA 2IN6A 2J50A 1O9UA 4K2RA 4PPAA 3D0EA 2JIVA 2RFSA 3EFWA 4S33A 5HGIA 4KKEA 3PG1A 4RJ3A 5E8WA 2DBAA 3AT3A 3RMFA 3ZTXA 2ITXA 2C6MA 4IB0A 4D9TA 3QA0A 1OITA 2FSOX 3R8LA 2KC7A 3E8DA 3DDQA 3VQUA 3GQIA 2JDTA 3LY8A 2R3QA 5GINE 4CTCA 1JVPP 3O51A 5DGZA 4M66A 4YTFA 5I9ZA 3F9NA 4BDJA 1SVGA 4J8FA 1YWNA 2XRUA 3R8MA 4RIWA 4D5KA 5IUGA 1CSNA 2R3FA 4DGMA 3OXGA 4O6EA 4MXZA 2XEYA 4QYFA 4U0IA 1GZNA 2JDSA 5EOLA 4GKHA 3CPCA 3UPXA 2XBJA 4EQFA 4XS2A 5J87A 5DRDA 3WZKA 4ZOGA 1WAO1 4CMUA 4XG9A 4QMMA 2HAKA 3BCEA 2IVVA 4GUEA 3HDMA 3K3JA 4EH7A 3QQGA 4F9BA 5A4LA 4W4YA 2ETKA 5FZSA 4EUTA 2OKRA 4U8ZA 4FV4A 3PE1A 4YPDA 4FTRA 4QPMA 4M84A 3QZIA 5I9WA 5K5XA 3V5TA 4IZAA 4XP3A 2GFSA 4RIYB 2HYZA 4CGVA 5EDQA 5LCWJ 2BVAA 2ZJWA 3BYOA 4ZY6A 3SRVB 5E1SA 4A9RA 4QYHA 5KKRB 5GZAA 3L1SA 4BWKA 3UYTA 1O6YA 2XM8A 4O38A 4X2KA 1MQBA 2EB3A 2JDVA 4GK4A 4ALWA 4Y6CA 1JKLA 5CSWA 4MQ1A 3UVQA 1V0BA 2KULA 2YM3A 5E8TA 5EW8A 4G3FA 2GFCA 3WF8A 4BDFA 4EEVA 3NUSA 4KD1A 5DN3A 4BDGA 3P23A 4D2PA 2KCVA 1V0OA 2ZDUA 3L8PA 2VO7A 4U45A 1NA7A 5ANJA 4AXAA 3DBFA 4IWQA 2UVXA 5EYMA 3AOXA 1WZYA 3FPMA 5FUTA 4GZ5A 4O0RA 5CVHA 2BAJA 3E8NA 1H27A 5GZ9A 3U4TA 3M11A 4TZRA 4Y73A 3ORMA 3E8CA 2UZBA 4OT5A 5C4KA 2QHMA 2F7XE 3BELA 2IZUA 4H1MA 4QTAA 1NVQA 1PMEA 1H1SA 3CKXA 2X81A 4LGHA 4I5HA 5T68A 4DEHA 4DH8A 5IEXA 4HOQA 1BUHA 3BGPA 3LPBA 4IWOA 4FG8A 5CTPA 5EW3A 4GYOA 3C4WA 3JYAA 3LM5A 4UYAA 3HP2A 3A99A 5FBNC 2BDJA 4BDHA 5IEYA 4K33A 2OSCA 3LFQA 5CVGA 2QURA 5KMJA 3EQHA 1H0VA 2FSLX 4C33A 1W98A 3DPKA 2X6DA 4ZTLA 4FEVA 1Z57A 4RIXA 4U40A 3UNJA 5JMSA 3S7FA 1OM1A 5BUJA 4F3VA 1OL1A 2FB8A 1KV2A 3C7QA 2I0EA 3ULIA 5AFVA 4HZSA 3W2OA 3WILA 4XV1A 4YHTA 4I1ZA 5AAGA 3B8QA 3ASGA 3KS2A 3PDTA 4IFCA 4X2JA 1FVVA 1Q8UA 2VX1A 3QUDA 4FNWA 4C2WA 5IQHA 1U59A 4QMUA 4XP2A 3EJ1A 2NRYA 1B38A 3TTIA 4JI9A 1PXMA 3VRZA 4HCTA 2C6EA 3JS2A 3SAYA 5DWRA 2XKFA 5CXZA 1H28A 4PMSA 5G05J 2ITZA 4E3CA 3R0TA 5CZIA 3QXOA 4U97A 2E2EA 4KINA 2JLBA 2XVDA 2ZB0A 5BVNA 2JFMA 3HUCA 3ZRLA 4CCBA 3QBNA 4FIIA 4AGUA 1B89A 4O7WA 3IOKA 3GNIB 4J98A 4R3CA 5AX3A 1UWHA 3COIA 3HMIA 1XBAA 2OLCA 2IW9A 3Q2JA 1BI8A 3DB6A 4FT7A 4BKZA 3GW4A 3COMA 3W2RA 3Q04A 4RWJA 2B9IA 5CVFA 3S00A 2W5AA 3CPBA 4LMUA 4UB7A 2PVJA 3IW7A 5FTPA 1YI4A 4AE9A 5HNIX 4EL9A 1UNGA 4HGLA 3TL8A 4C7TA 4FIHA 3R8VA 1M2PA 4E6QA 2FI7A 2AVPA 4I94A 3QKKA 2UW6A 2GTMA 3QTQA 2VGOA 5LVPA 4GYWA 5ARFA 4D0XA 1G8AA 5JEBA 3HV4A 2P58C 4M7IA 3MV5A 4AZTA 4U0SA 2PE0A 2ETRA 4GJ3A 1MP8A 1Y91A 2WMUA 4PUZA 2RKUA 2VTHA 5FTQA 1Z5MA 3UOLA 3P79A 3VJOA 2YM5A 1KLXA 2OH4A 1U46A 3O23A 3F3ZA 4L00A 4P5ZA 2NO3A 4RIXB 1LR4A 4J7BA 5EK7A 4YP8A 4EOQA 4F1MA 1MUOA 1Q8TA 3I6WA 4NM3A 4OGRA 3GZ2A 3RZFA 1WVXA 1URWA 3VN9A 4GYIA 4K9YA 4FKTA 2BUJA 3GOKA 4NQ0A 3EN7A 4USFA 4DCEA 3G5DA 4E93A 4YC6A 3QWVA 1YKRA 4ZSGA 1IRKA 3F3TA 3G9LX 4K8AA 3W16A 4EH6A 3BX5A 3TG1A 4N2QA 3GGFA 2UZUE 4J96A 5ANIA 3U54A 3KC3A 3HLLA 3R1QA 4C4IA 2XA4A 4GFMA 3H30A 4K77A 3H9OA 4FZFB 3CJGA 3SX9A 4F7LA 2XK7A 5LMAA 3M2WA 3R8UA 3Q5ZA 2UV2A 4DG0E 3MV2B 4IB3A 1YOLA 1UKIA 3PXRA 3S0OA 2CLXA 3ASHA 3AC8A 4UWYA 5D7VA 3EKKA 4TWCA 1QQEA 3LY7A 4D2RA 4Z7GA 4DGGA 2ONLA 3QRUA 4E4LA 1FQ1B 3I0QA 5J95A 4F99A 3VW8A 4J97A 2LGCA 3C4ZA 4F9AA 4LYNA 4ACGA 3MH0A 3CCNA 5FEEA 4BBFA 4YUQA 4H05A 4G34A 5BVDA 4FEUA 2GMXA 3QC9A 2XF0A 3FXZA 4YJUA 3R63A 4Y83A 3VUKA 3UTOA 2YM8A 4C4GA 5KZIA 3RAKA 3I79A 4D1SA 2BZHB 1NZNA 5HTBA 1NA3A 2CMWA 3L8XA 3L9NA 3V6SA 4HVHA 2XJ1A 4XI9A 4G31A 4WSYA 3E3PA 2W99B 3EMGA 2E9NA 3E7OA 5L2SA 4MAOA 3E92A 2O64A 3BV2A 3RO3A 4OW8A 5M55A 2IZSA 1CM8A 3PVWA 4XX9A 4OR5A 3ZSHA 4HVDA 1UU7A 5D41A 2W1CA 4CFMA 5J9LA 3AT4A 3LFDA 4YZBA 4C35A 4BKYA 2R0IA 3G9NA 3Q49B 3SOAA 3UO5A 4J0UA 3ZFMA 5HG5A 3OXZA 3DJ7A 3HECA 3NNVA 4XLIA 4WKQA 4IADA 2XIYA 4U80A 3HP5A 5F9EA 4HOKA 2XMYA 3IW6A 4U04A 2VTRA 3TZ7A 3UQ3A 3RVGA 2X39A 3W33A 4D1ZA 2OOEA 5A14A 4H7XA 2YIXA 5DPVA 2WAJA 2X0GA 3R21A 3ACJA 4I3ZA 4LM5A 2UW4A 4RFZA 5BVEA 3QQLA 4HYSA 4JBPA 1PXIA 4UV0A 4EBWA 4F09A 3D4QA 3U3WA 3KL8A 5TR6A 5J9YA 3ZZWA 2GTNA 2HXLA 2ZB1A 4TYHB 3V8TA 3ASDA 3BLRA 4IANA 4BT9A 4A1SA 1CDKA 3C5IA 3LMGA 4X3FC 4BTFA 5C26A 2P0CA 3H10A 2H6DA 3ZO2A 1SYKA 5ANEA 4IH8A 2QNJA 3C1XA 5E8VA 3K5VA 2Z2WA 5KMMA 4L6QA 2HW6A 2QOBA 5F1ZA 1BMKA 3QRIA 5AP0A 4KIPA 5F95A 3N71A 1J3HA 5CEMA 4RJ7A 4WG4A 3IEGA 3PXYA 3KRLA 3VBWA 1LEZA 2UW0A 2QLUA 4YPSA 5ETFA 4GKIA 2YEXA 3QHRA 4C59A 3JPVA 3IG7A 4F7NA 1PXNA 2PE2A 5HKMA 3D15A 1JQHA 3DDPA 4WA9A 3WIKA 3FXXA 5CEIA 5JFSA 5HD4A 2PQNA 1ZWSA 4BDAA 3WE4A 3MESA 2UVZA 4PY1A 2PVKA 2X8DA 4YLJA 1H24A 1Y8MA 2V5FA 2XH5A 4O0TA 5LVNA 2VSNA 2C1AA 4EQCA 3SW7A 2G9XA 3RPOA 5K5NA 4YC8A 3GC9A 4FGBA 2B52A 3BYMA 5EQYA 4FL3A 2XBAA 5IMXA 3TV4A 2BKKA 5CEOA 3KMWA 4B99A 3IO7A 2A27A 4FIGA 2OICA 3FQSA 2R7BA 1MRYA 4CXAA 4FTNA 5KBRA 2J5EA 3VF8A 4OTPA 2CNVA 3ZO3A 3U6JA 1F0QA 3MY5A 1UWJA 2QD9A 3HGKA 3P86A 4ZSLA 1NY3A 4LL0A 5HIEA 3ATTA 4HYHA 4QMOA 2P2IA 1TVOA 1ZY5A 2VTAA 4FTMA 1OKYA 1KSWA 3F5GA 4KIQA 5ETAA 3V5LA 5A4TA 5BVOA 5LXMA 4C38A 5BUIA 5LWMA 2DWBA 4AY6A 3EZVA 3FMNA 4KIOA 4GL9A 2XNBA 4QMSA 4R5SA 2RG5A 2VWZA 5D7AA 3TEIA 5T3QA 1NT2A 4IWPA 5CAPA 3OCTA 4FYNA 3IW5A 3N4VA 5J5SA 4BVUA 3ASFA 1KE7A 2FO7A 2QOKA 1Y6AA 4O0SA 5J1WA 1IEPA 2IZTA 3OWPA 4O27B 2BMCA 5LCJA 4U3ZA 3QD3A 3KCKA 2JC6A 3OY1A 4UXLA 4F9YA 3QGWA 3PXQA 3SLSA 2C6KA 3LMHA 3PZEA 2VWBA 3OT8A 1OBGA 4F70A 1PHKA 4IWDA 4AOIA 4JX3A 3KGAA 3QZFA 5E8XA 4ZY4A 4CG9A 3UP2A 4O0WA 2PQRA 3KK9A 4BBEA 3U8WA 5M53A 2DS1A 3I7BA 3TG4A 3A2CA 2PVRA 1GJOA 3FLYA 2UW5A 4JBQA 4R3PA 4BF2A 2QFCA 3OF0A 5KJNA 4FODA 4X3FA 3TJCA 4YC3A 4KWPA 1E1VA 4CFXA 5CENA 2HR2A 3MPTA 4F1TA 3A4PA 2J0KA 5BYZA 5DOSA 4B9DA 4FTOA 4G6NA 4XOZA 3NIZA 5CSVA 4GU6A 4BZOA 4DTAA 2VU3A 2VTMA 1VJYA 3KRRA 2B55A 4C36A 3LCAA 5HI7A 4IM3A 2X2KA 4I1AA 5HBHA 2REIA 5CEPA 2HY81 3NW7A 3PP0A 3BLHA 4MNEA 1PMVA 2QONA 2BRMA 3NW6A 4ALVA 1H4LA 1ZMWA 2HXQA 2PK9A 4NT4A 4A4OA 2WIHA 3SG9A 4E73A 2IO6A 3FWVA 3NVKI 2CSNA 3PJ3A 1IR3A 3FMEA 2C0IA 4IB1A 1OIUA 2ITOA 3UODA 4X7QA 4WNGA 4A4XA 4AX8A 4EONA 2GU8A 4O2ZA 4JG7A 5AAFA 2PVMA 4UQZA 3TDWA 4U5JA 4YO6A 3UYSA 1Q5KA 5M72A 5EYKA 5JT2A 3CQEA 5IA0A 4RC2A 4TNBA 4WNDA 5FD2A 3QTIA 1JSUA 2UW3A 3BHHA 3NUNA 4QRCA 3VS1A 3WI6A 5BVFA 5KX8A 3OWLA 4ENYA 2GQRA 5M56A 4TWOA 1Z9XA 3CVLA 3P78A 5CXHA 4BR3A 2VD5A 5HNGA 3ORIA 4DGLC 5C27A 3OEFX 3CTQA 1Q8ZA 4LOQA 3I6UA 4C2VA 5JJ7A 5CEQA 5B2MA 1OIQA 3MN3A 4KBAA 5J9ZA 3QHWA 1W82A 3SXFA 4CFNA 5C1QB 4F64A 4AFEA 4TWPA 4UY9A 4I4EA 4AN3A 1DI9A 2OIQA 2VWVA 4X6RA 5HX6A 3ORKA 4ASZA 2GHMA 1UNLA 3VNTA 1ZAOA 3U87A 4NM0A 1UU3A 3NZ0A 3UG1A 4XLVA 2XPIA 3DXPA 1M7QA 5D12A 3OROA 5A7DB 1VYWA 2WQEA 5EOBA 4UI9K 1PXKA 4KBCA 1ZYCA 3GC7A 4IJ9A 4G6OA 2Y4PA 4BCPA 3DJ6A 3GBZA 2JLDA 4RJ5A 3DKFA 2C3KA 3O2MA 3I7CA 5CU0A 3UMWA 1NW1A 3FC1X 2CPKE 3GFEA 2A19B 2FH9A 1OUYA 4HPUE 2W4JA 4PMTA 2R5SA 5DIAA 2W0JA 3ZGQA 5AP7A 5AP5A 3BZ3A 3M1SA 3CK9A 4V0GB 4UN0C 4UEUA 3DK3A 3MFUA 1UA2A 2OJGA 3SKCA 3CXWA 2QO7A 3C4XA 3OC1A 5FDXA 3AD6A 3EL7A 4C02A 3R9NA 5D1JA 3BGQA 3QKMA 4XRJA 1B39A 5CSHA 2RG6A 2GQGA 2OFVA 3DAJA 3TAXA 5E90A 3FMJA 4YJNA 3VHEA 5HVKA 4H7YA 4F6UA 4HNFA 2F57A 2CNQA 5HIBA 5IKWA 5BMMA 4ARKA 4GG5A 4BCJA 3BWJA 3PWYA 3NW5A 5M4UA 3P9JA 5JRSA 4OTHA 4FV6A 3HNGA 3S7JA 2CJMA 4CNHA 1ZYSA 4XG6A 5HG9A 2YCFA 2QOLA 4FF8A 3UC3A 2RGPA 4G1WA 4PRJA 4L42A 2YITA 4QQCA 4BIBA 4ZY5A 3SD0A 2GSFA 3MKRA 1IAJA 3FE3A 4WUAA 4C61A 3CEQA 3R73A 5E8YA 5AM7A 3QZGA 4AW0A 1YA0A 4ZEGA 3DKCA 2VTQA 3GEQA 3WIGA 3CVPA 1DI8A 1OUKA 3UQFA 4FTCA 1KE9A 5KKRC 3QYZA 3NGAA 4FSZA 3DV3A 4LV5A 3RM6A 4PDYA 1L3RE 3CEKA 3CKCA 3QX2A 3PZHA 4MWIA 2PMIA 3OWJA 4QP3A 3TV7A 4IN3B 4QP7A 3O7LB 4FSYA 2QC6A 3TN8A 4FV1A 4N4SA 4OTFA 4DH5A 4GZ3A 3Q6UA 3FJQE 2JEDA 4GEOA 4MD9E 5F20A 4EORA 4EBVA 4O7LA 2CGVA 4OTWA 4EOOA 1KE5A 3PY3A 4MXAA 4D4RA 1QPDA 4AT4A 2VX3A 1IASA 4AF3A 3BU5A 4EOSA 3BE2A 2OXDA 3HL7A 4BCNA 4F7SA 4AZWA 4FKIA 5DT3A 5EG3A 3HV6A 2KCLA 2FSTX 3OBJA 4GK3A 5ITAA 4UMPA 1ELWA 4EYJA 5BNJA 2EB2A 3VTXA 2YHVA 3EIDA 4M97A 4UQXA 3LW0A 1JKSA 1XQZA 4NCTC 1JSTA 4PMMA 4R6VA 5CSXA 2A0CX 3ZBFA 3A60A 3KXNA 5H2UA 2C47A 2V7AA 2WQNA 4PNKA 1J91A 1CTPE 4IAZA 4GFGA 3WF5A 2XEZA 4BDBA 3AMYA 5KMLA 3I60A 3PUPA 4IM0A 3TKHA 4ZLZA 3FMDA 3V01A 3Q52A 2GNFA 4MBLA 1P5EA 3C4CA 2WB8A 3EQCA 1P14A 2O2UA 3OS3A 1H25A 3QZHA 3ZC6A 4UWCA 2VGYA 3CS9A 4FTAA 4QP9A 4Q2AA 4JJRA 4XMOA 4GA2A 2OF4A 4D2WA 3CKBA 2X8EA 4U44A 2CCIA 5HE2A 4OAVB 5DYJA 2PVHA 4IW0A 2PWLA 4JBVA 4TPTA 2X1NA 3DNDA 3SW4A 3VS3A 3ZONA 3FL4A 1G5SA 5CLPA 2Z8CA 5AV2A 3VW6A 2HWPA 1OL6A 4TYIA 5K0KA 3PWDA 1L8TA 2PHKA 3PVGA 2W4KA 3ZDIA 2UW8A 4EJ7A 3PIXA 5CU3A 4C4EA 3CP9A 2WD1A 2HW7A 1OB3A 2CCHA 3OY3A 3TWJA 4BL1A 1WBVA 1RQQA 2WZJA 3PTGA 3QCSA 3R22A 4C3RA 1OPLA 4J8EA 4WUYA 4RT7A 1YWVA 1XKKA 2WMQA 3ZLXA 4FKOA 4DFUA 4E1ZA 3HRBA 5HOAA 5FDPA 1LPUA 3NRMA 4FV5A 4B7TA 2YWVA 3LQ3A 1PXLA 2HOGA 5FRIA 4EQMA 2W1GA 3ZH8A 4Z7HA 4XI0A 2Y8OA 2JIIA 5CQWA 4QQJA 4I93A 2W1IA 4IZ7A 4MYGA 5CAOA 3VBYA 3R6XA 4HVIA 4V01A 2PZPA 3QWPA 3QUEA 3ATSA 3NUYA 4Y5QA 2R5TA 1YHSA 2R9SA 4L44A 2I6LA 2CHLA 3WF7A 1PYEA 3BQRA 1M2RA 4OTIA 2G15A 5DNRA 3VS6A 3R2YA 4DINA 5I0BA 3ZZEA 4RG9A 3GC0A 4U0UA 3UZRA 3Q4UA 5HICA 3KEXA 3PRFA 4RWIA 3RCJA 2PULA 4D2SA 3BU3A 2BZJA 1PXOA 5DI1A 4EWHA 2RFNA 5M51A 3ZM4A 3E93A 5FQDC 4HZRA 4H1JA 4JAIA 1XH9A 3R00A 3PXKA 2H96A 3UIMA 4O7TA 2HWOA 1BI7A 2QG5A 4KRCA 4O81A 5HG7A 4L9IA 5IMEA 4QTBA 1FCHA 4DTBA 4UXQA 3CY3A 4X3JA 5DMZA 1ZARA 5LARA 4R7BA 3UIXA 1A9UA 4I5CA 3TXOA 2VN9A 3UOJA 1YXXA 5AWMA 4FSMA 5ANKA 5A4EA 3F66A 3P7AA 4XRLA 2PVFA 4DG2E 4C62A 4X0MA 2FBNA 4JDHA 3R7UA 3ZM9A 2WMVA 3AC5A 4DF3A 1XO2B 3WZJA 3BEGA 1TJCA 3I1AA 4O96A 3FFLA 1XBBA 4X6QC 3WOWA 1ERKA 3IDCA 5AUZA 3NUAA 3EQPA 4TYJA 2G01A 2W17A 3BYSA 3FMLA 3KF7A 4FL2A 4FTTA 2P2HA 4H36A 4KNBA 3IQ7A 4FUXA 2RF9A 4O0XA 4NK9A 3E62A 2YERA 3BHVA 2G2IA 4IX6A 4J8NA 4W8EA 5A9UA 4G3DA 4QTCA 2FUMA 2WEIA 2IW6A 5CANA 4A9UA 2BRNA 4DFNA 2KATA 2B53A 1M7NA 2XIRA 3FSFA 1W83A 4XHKB 1OUVA 4QMLA 5AV3A 3ZU7A 4XP0A 4RPVA 3R9HA 5CAVA 4BICA 4ACCA 3QKYA 5EYDA 4JG6A 2ZOQA 1DM2A 4QP1A 4GA0A 5KCVA 3CJFA 2IFUA 4E7WA 4XV2A 5L2TA 4BI1A 3JVRA 3ORXA 3CLYA 4RIYA 4AW5A 4FV0A 5E9EA 2R3IA 2G1TA 3FZTA 3UC4A 3SRVA 3FZOA 3DKGA 3PY1A 2LSVA 4JS8A 4BTBA 3D5UA 4MXCA 3E7VA 1H07A 1TQPA 4OBPA 4ZTNA 3LPZA 1OBDA 4Z3VA 3C13A 4WHZA 4CYJA 4ERKA 3COKA 3GZ1A 4FEWA 4W9RA 5CYIA 4AFJA 1ZXEA 1Q61A 3PP1A 4BY9E 5IF1A 5L6PA 3DT1A 5M09A 3RJVA 4ZXTA 4M8TA 4K11A 1ZOGA 4BTJA 3Q4CA 5HU9A 5JRQA 5HLNA 3DBCA 2AYPA 4KBQA 4I0TA 3BIZA 4EOIA 4LMNA 2UW9A 5DE2A 5TF9A 3U4WA 3R7GA 4BRXA 4MKCA 4IDVA 3ZUVA 1YQJA 3F5UA 4FIEA 3PE3A 4ERWA 3OTUA 3KU2A 4J71A 3QWWA 3FBVA 3MH3A 2XIZA 3TIZA 1FBNA 4ZSJA 4GFOA 2YFXA 3NYVA 3MA3A 3ZLYA 4ASEA 4YZMA 3KMUA 5CI7A 4PV0A 3DAEA 4JRNA 4AP7A 2CKPA 5AAEA 4L46A 2QKWB 2C30A 2QO9A 3VS7A 3F2NA 4AGWA 4MF0A 2C6IA 2R3RA 3NS9A 1KV1A 3T3VA 3UO4A 5L2QA 3W8LA 3SV0A 4CFUA 5C9CA 4FKPA 4KSPA 4PP7A 5FEDA 3EFLA 4ZTSA 4G2VA 4LFIA 5DT4A 4N39A 4HVGA 5K3YA 3QQHA 4N0SA 3CKWA 2WTIA 4ZTRA 3QRJA 4Y8DA 2VUWA 3TNIA 4XIFA 2IZRA 4YBJA 4U43A 5GIOE 1WVWA 4W9XA 3FHIA 3OHTA 3W32A 2DYLA 4C0TA 3Q96A 3AC2A 5IA1A 5JKGA 1H0WA 4MX9A 4V05A 2BHHA 2OJJA 3IGGA 2E2BA 3F7ZA 3QD0A 3TZ8A 3QRKA 4FKQA 4TNDA 4ANNA 3FMMA 4B8MA 2BILB 5JGAA 3EKNA 3P7CA 3FMHA 5ANDA 1V0PA 2B1PA 2F4JA 3VUGA 3DA6A 3PIZA 5DG5A 2QOQA 2UY1A 3GVUA 5HU3A 2GNJA 3ULQA 4XG2A 5E4HA 3QTWA 2XNPA 2ONDA 5KNJA 3UGCA 4DN5A 3R1SA 2F2UA 2OJ9A 1JKKA 3Q2MA 4UMUA 4PTGA 3TZ9A 5HX8A 3QRTA 4ACMA 4QP8A 3BBWA 3O71A 2IVTA 3B2WA 1G3NA 2OJFE 4EHZA 2E9UA 4XV9A 3PFQA 4H3QA 1BL6A 3QC4A 2WMXA 5FP5A 4UALA 3WBLA 1HCLA 4PWNA 2YDKA 3Q3BA 1U5QA 3A7GA 1IG1A 3RK9A 1ZMUA 4FZDB 3R7OA 5L6WL 2EXMA 2BAKA 4AA0A 4ZSAA 4HORA 4FOBA 3R04A 4HGEA 3G33A 2HK5A 4R1YA 5CF6A 4MXOA 2PVYA 3FLWA 1I44A 5M06A 3TV6A 2GHGA 5LMKA 4KRDA 4ACDA 5KE0A 4RJ4A 4BCOA 1APME 3RP9A 4EJNA 4EZ5A 1R0EA 3RU0A 4FSQA 2J90A 4KA3A 4F6WA 4BHZA 2OH0E 3MFSA 3D2IA 4XEYA 4EI4A 3NCGA 3QL8A 3NLBA 3EFJA 5AMNA 4ZSEA 4DH7A 4WG5A 3NR9A 2UVYA 4FNYA 4FV7A 4L3JA 5L8LA 1LEWA 5IUHA 3LCTA 1SNUA 4M14A 4MXXA 3ENHA 3VUIA 1FVTA 4CDRA 4FV3A 3VHKA 3DK6A 5L6OA 5EM7A 1SVEA 1W0XC 4AOJA 5CZHA 3AS4A 2C3JA 4S2ZA 2F7ZE 1PKGA 5EX0A 5IQIA 3MPAA 1FGIA 4AZFA 3GP0A 3O8TA 3LXLA 5CNOA 3GUBA 2WQHA 3QOUA 3OG7A 3LJ0A 2VNYA 3IS5A 4F08A 1GNGA 3SG8A 5BT1A 1JPAA 4J53A 4I6QA 2W1HA 2RIOA 4YU2A 3V5WA 3CSVA 3S7BA 2I1MA 2VGPA 5C8MA 4G23A 4I21A 3HVCA 2OJIA 5FXQA 1R0PA 2YIQA 2EWAA 5KZ0A 2R3HA 3FDNA 2P3GX 1SZMA 2NC9A 1JWHA 5CQUA 4ZS4A 3POZA 2C0LA 3I4BA 3ZHPC 1OPKA 3QA8A 5CU2A 5CCMA 2R3NA 3QWJA 5EI8A 4RZWA 4IACA 1GOLA 5H8EA 2EUFB 4AU8A 4V04A 1P4OA 5DFPA 4J99A 5BYYA 3S3IA 4YZ9A 3VS4A 1YHVA 2F2CB 4Y6WA 2V0DA 2C69A 3AMBA 4E4XA 5AIRA 3E88A 1Q8YA 3VTYA 2OIDA 2YDJA 1ZU2A 2XCBA 5HCYA 3LMIA 1G8SA 4JQ8A 2I7QA 4DT8A 3BWFA 3QLGA 3A61A 2JBPA 4J1RA 3LQ8A 4R7IA 4UZHA 1QMZA 3QWKA 3C50A 4EQUA 5TT7A 4CVAA 2PUNA 1U54A 1U4DA 3MB6A 1WBSA 4QQ5A 3RNYA 5LOHA 2HO1A 3A7IA 3CVQA 5HTCA 1A17A 2X4ZA 5IG1A 1M17A 4IMYA 4YVQC 4K6ZA 3LXNA 2HENA 3EQIA 3WYYA 3MB7A 3C5UA 3JR1A 1NA0A 3KMMA 1SNXA 2YLEA 3F7WA 4FKLA 3GU4A 3AMAA 4BDKA 4YJVA 3DFAA 3GU8A 4CYIA 2QOHA 3FMKA 4FA2A 5FM2A 3KN6A 5AR7A 4BHNA 2RSVA 3GT8A 5IQCA 5EKOA 2P33A 4CT1A 2V5QA 5E8UA 2R0UA 2OFUA 3ORNA 3GXLA 3QUPA 4FUYA 4I6BA 5JZNA 2WQOA 3FC2A 3D5XA 2C6OA 3DS6A 4AT3A 1A48A 3PXZA 4BCKA 3EHAA 2WQMA 4CKRA 2RFDA 5EHLA 2J4ZA 4Z16A 1IAHA 1VZOA 5FLFA 3CD3A 4FI1A 5DIZA 2BDWA 2V7OA 5IEVA 2GS7A 3ELJA 1Q41A 3VUHA 1E1XA 3UJGA 4TY1A 4RLKA 3BHTA 4KSQA 5EM8A 2QU5A 2BIKB 3R1NA 4U42A 4F0GA 3U9NA 2YZAA 5BVWA 5CF5A 1Y8YA 3D94A 3E87A 4DEBA 2WFYA 3ZCLA 5HO8A 2B9FA 3NYOA 4B4LA 5I9XA 1FINA 2ZV2A 3LFFA 3A4OX 4FKUA 5DR9A 3ODYX 1S9JA 2OGVA 5JGDA 2YJRA 3KVXA 4WNMA 4AN9A 2UZDA 4I22A 3K5UA 2CDZA 4YJQA 5HNBA 3ZXTA 4BTMA 4EK6A 5TE0A 5FXRA 3PVBA 4OLIA 4KKHA 5LMBA 4IAIA 2B9JA 1XNFA 3MFRA 3L9PA 1VYZA 4AGCA 3EZRA 4S32A 3D9VA 4ONAA 4RC3A 5LVLA 3AS5A 3MIAA 3ZFWA 4HNIA 1GZOA 5E92A 4M3QA 4EK5A 3PLAE 2Y4IB 3DY7A 3UOKA 4IJPA 3IECA 1H1RA 3D5WA 1B6CB 4RQVA 3K3IA 4QMZA 5HO7A 3I0OA 3FLQA 4YSJA 5IQGA 2XM9A 1PJKA 2E9OA 1W7HA 2XNMA 1DAWA 2YDIA 1WBWA 5CSPA 2ERKA 5IQDA 3MW1A 4YMJA 3MFTA 3V51A 1GIIA 2BTRA 4FC0A 4EWQA 4YBKA 4JOAA 1K9AA 3ODZX 3L9MA 2W1ZA 4E6DA 3KRXA 3LLTA 1KE6A 4TN6A 4AA4A 4O7ZA 4H3PA 3DTWA 3N4TA 2QR8A 3H9FA 4GU9A 4MNEB 5AV1A 5GHVA 2YIWA 1IA8A 2FGIA 2OU7A 4GW8A 2Y4IC 4D0WA 2AC3A 3EL8A 3BKBA 3DBEA 2W1FA 2YISA 4RBLA 3POOA 4I20A 4TT7A 5FGKA 4ASXA 4PL4A 4P4CA 3NAYA 3CTHA 1GY3A 3UNZA 4RG6A 4FNXA 2WOUA 3JVSA 2QG7A 1M2QA 4GH2A 3RWQA 3W1FA 2A4LA 4D28A 4ZS0A 5A54A 3DLSA 3RAIA 4CRLA 3D83A 2BR1A 3A8WA 3PDNA 3PXFA 3GCPA 1CKPA 4B8LA 4E6AA 4MQ2A 3FPQA 4QQTA 4ZJIA 2ZM1A 3D2KA 3HMPA 1Q62A 1ZY4A 3AD4A 3BEAA 3DB8A 4H58A 5FP6A 3H4JA 3P1AA 1QPJA 2B54A 3FI2A 3OXTA 4MD7E 2VWXA 3FV8A 4PDPA 4WBBB 3E5AA 5A6CA 3PE2A 4QPSA 4UQYA 4RGJA 2VGXB 3A7JA 3IW4A 4DFXE 4DEEA 4EK8A 3R7VA 2XKDA 4NTSA 3TUDA 3QD2B 2YJSA 1JBPE 4JBOA 1T46A 4W9WA 4FKVA 3DXNA 5H8GA 3D7TA 3THBA 5G04J 2XP2A 4OAUC 3RKVA 5CCLA 1VR2A 2X7FA 4L45A 4NUSA 4ZJJA 4O2PA 4PP9A 4F9CA 4FT5A 3K9IA 4CLIA 4IC8A 2CKQA 4QYEA 1OL2A 3DZQA 4BIEA 2XK3A 2QVSE 2SRCA 4WNOA 4F0IA 4XUFA 4CTBA 4G6LA 2IWIA 5CALA 1JAMA 1ZZ2A 5EH0A 2G2HA 2FEZA 2R7IA 2W5BA 3LFAA 3U51A 2QODA 4TTHB 2O5KA 2PSQA 4Y95A 4YTCA 2UY1B 2JFLA 4BDDA 3O8PA 4ANOA 5L2WA 3UVPA 3JUHA 1PRYA 2JKKA 2PY3A 3F3VA 2WTCA 3FZSA 3NEWA 4BCFA 4GSBA 4I5PA 4KIKA 5BW8C 1PMUA 3ORPA 4WOVA 2PZ5A 2UZLA 2HZ0A 3ZS5A 4BB4A 3QQKA 2XCHA 2C3IB 2R3OA 4R5YA 5JQ5A 1YDTE 4QNAA 4KAOA 3CK7A 4WRGA 3ZFYA 3Q4TA 1CMKE 4M0ZA 5FXSA 5EDPA 4FZ6A 2HYYA 4I23A 4U81A 4WBOA 3MI9A 5IA4A 2YHCA 3PJCA 2DQ7X 3S4QA 3O50A 3CTJA 3AQVA 1FVRA 5B2KA 3N51A 5ICPA 4HOTA 3D7ZA 4EH3A 4O0YA 3QXPA 4BT8A 3SOCA 5C8NA 3FYKX 4I4FA 3TKIA 4DYMA 3LFSA 4G5PA 1OECA 4JIAA 5LJJA 1R3CA 2BUGA 4Q9ZA 4JNWA 3C4FA 3O48A 1OIRA 5D9HA 4FVRA 5H3QA 2JAMA 3ORZA 2J7TA 4II5A 5EFQA 4BCGA 5IH6A 4O6LA 4O7NA 5DEYA 4D4SA 4QMNA 4UYNA 2LSUA 3TUCA 2C5YA 1STCE 3E64A 2ERZE 5DBKA 3N4UA 4YNOA 2VTNA 3OUNB 3KB7A 4LRKA 4Y5HA 2B9HA 2OK1A 4QMXA 5ANOA 4XNEA 4ZTMA 2YLFA 2VAGA 5KMKA 1S9IA 3SDJA 4JT3A 5KMOA 5KO1A 2VX0A 3EQGA 4NCTA 2WMRA 1QL6A 4ITHA 2W96B 4QP2A 2CLQA 4X21A 3OTVA 4BN1A 5HTIA 4YNDA 2XNGA 4TRLA 4PF4A 3MH1A 1ZBPA 1F5QA 2O0UA 3R9AB 2PYWA 2B4SB 2ZAZA 4GCNA 2HZIA 4QD6A 3RGFA 2Z7SA 2GS6A 3Q9XA 4BDIA 4P2KA 2YIYA 2R3KA 3KXMA 2XRWA 4KIKB 3VVHA 4FBXA 4JDIA 2WEVA 3V5PA 4H39A 2IPXA 3TGOA 3DBDA 4O21A 5CEKA 5HLWA 1EH4A 4HJOA 4EH2A 2Y6MA 2UW7A 5CX9A 4FSTA 2JAVA 1IHGA 3DQXA 1ND4A 3W2CA 3MVLA 3AC1A 4E5BA 4U3YA 4GIIA 4CEGA 3DFCB 3LFNA 4WD5A 2JKOA 3VO3A 3UVRA 4IHPA 2HELA 3KULA 3L9LA 4ABNA 3SXSA 3PVUA 3GOPA 5HG8A 2XS0A 3WZDA 5HBEA 3Q4AB 3V5QA 4IDTA 2W7XA 2H34A 3VUDA 2C0OA 2OZAA 3EN9A 2WMWA 4F9WA 5AEPA 4N3CA 3HV7A 5JFXA 4QTEA 5JZJA 4BI2A 3NAXA 3VBXA 5EI2A 4RG0A 4ANQA 3TUBA 3NUPA 5KMIA 3ALOA 3IPHA 4GG7A 5T6KA 4LOOA 4I2WA 3BHYA 2QO2A 3BRBA 4W4XA 3UQGA 4K18A 3EQBA 3ORLA 3R9RA 2C68A 4FG7A 1WBTA 1YW2A 3Q60A 3KF4A 5HCXA 5A6OA 1ZMVA 4O7VA 5KMNA 3UPZA 3Q9YA 3ZO4A 2VWWA 2JDRA 2Y6OA 3H0ZA 2WU6A 4ID7A 4FNZA 4R7HA 3N9XA 4RQKA 4G16A 4TL0A 5IISA 1WM5A 1Q8WA 5LCWC 4IC7A 5LQFA 5IA2A 4L43A 3VF9A 2WTJA 4FTIA 1QPCA 3HDNA 4NKAA 1QZ2A 3UQCA 1HH8A 4NEUA 3G0FA 1A06A 3OW3A 3P5KA 3MYGA 3VUMA 3QQFA 3EN6A 5IH5A 3RPVA 5HE1A 3CR0A 4PDOA 2PL0A 2ITUA 3R30A 4M13A 5IPJA 4BCHA 3MH2A 3KXXA 1YXVA 3C0IA 4A06A 1PF8A 3BGZA 4YZDA 1CKJA 1GZ8A 3EQRA 3ZUUA 5I9YA 3ZEWA 5CU6A 2YAKA 3LCDA 2JDOA 2YM7A 5A4QA 2BHEA 4DFBA 5AP3A 3HEGA 4LRMA 5I9UA 1PY5A 1Q97A 4NTTA 4O1OA 3A7FA 2WMBA 5FTOA 4BIDA 3PPKA 5KHXA 1J1CA 4NH1A 3VBVA 3VAPA 5AA9A 1VEBA 5DA3A 4CGWA 1PXPA 2OW3A 3O8UA 4AG8A 3FSKA 2PUPA 4UI9C 1KT1A 5ACBC 4FT9A 4CFVA 4NRHB 4KS7A 1WFCA 4OTGA 4KKGA 1X8BA 5CS6A 4F65A 4FR4A 4UBAA 1AGWA 5AR2A 4WNEA 1NVRA 3FEGA 5H8BA 3MV3B 3W2SA 3ZO1A 5EM6A 3CY2A 5L8JA 4EH9A 3OMVA 5AR4A 2XNNA 3WZEA 2XK6A 4RZVA 1SM2A 3MA5A 2YIRA 3FLNC 1YHWA 3ZBXA 3BU6A 1O6LA 2GCDA 4U41A 3HMNA 3R9OA 2WOTA 3HAVA 5AUXA 5HCZA
chains in the Genus database with same CATH superfamily
4ILGA 1QCFA 4FK6A 4F6SA 3C4EA 3MY1A 3RTPA 4DBXA 1GAGA 3EQDA 2L6JA 2BZKB 2WTWA 2PVLA 5I4NA 1H00A 4UWLA 4IVDA 2GDOA 3KCFA 4C58A 1ZYJA 4AW1A 4J8DA 2NP8A 4E20A 5AIKA 3NCZA 5EI6A 4JL0A 4D9UA 3LFCA 2QQ7A 2C6LA 5HE3A 3B7BA 5J8IA 3MGYA 1JWFA 4U0ZA 4BTKA 3FEXA 4UMQA 1BL7A 2EXEA 5GJGA 4D4VA 2BKZA 2VTJA 4NIFA 2PMOX 1S64A 5EIBE 4FKSA 3ZSIA 3QTRA 1SVHA 1T45A 4F6RD 1WMKA 4QP4A 1K1BA 3AU4A 4M67A 2BRBA 4EKKA 4E26A 3HUBA 1ZZLA 4ENXA 3OW4A 3OAWA 2L9BA 4YSMA 5CI6A 4QMYA 4BZDA 1OKZA 4FE2A 4ZMFA 4RX8A 2QHNA 3FXWA 1REJA 3FI4A 3CD8A 4FK3A 2LXLA 2VWYA 5BX0A 2VWUA 3TWSA 1H1PA 3ANRA 1V54E 2WXGA 1Q24A 2KTYA 1HX8A 5C03A 1J7UA 1DS5A 3ZYMA 3HRCA 1OPJA 5TKDA 4L68A 2DYSE 3VBQA 1YOJA 3QDNA 2WTKB 5AQBA 2NPQA 4LRJA 3NNUA 5ITZF 3RPSA 3HKOA 5FWKK 2I9CA 4CQEA 4CV8A 3ZFXA 2VTOA 3FYJX 3KFAA 3G2VA 2WTKC 3LEWA 4JIKA 4JLCA 4ZHBA 1Q4LA 4GTMA 4DFLA 3FTZA 4L7FA 4JA9A 2ZFYA 3A62A 3MA6A 2I40A 3EN4A 4RIWB 4YGAA 4FYOA 4X2GA 3COHA 5JN2A 3FTVA 4CDNA 3SF4A 4RFYA 4C8BA 3PY0A 1F3MC 4I0RA 1P5QA 2WIPA 2YACA 5AUTA 3RPYA 2J9MA 3HDXA 4AAAA 2OI4X 1TQIA 3LOKA 4DBNA 1U54B 3F6XA 4A9YA 4YTHA 5AJLA 2VQ2A 2XENA 4ZTQA 3MWUA 4JR3A 3MBLA 2OG8A 2W1DA 4NL0A 3RHXA 3OZ6A 4AVXA 3O17A 4A9SA 4M12A 4I6FA 5BMSA 3KIOC 2RFEA 4JX7A 5KJKA 5M08A 4LNGA 2YQ8A 4F7AA 3RZBA 4JXFA 2XZSA 4JL9A 3SD5A 4CZYB 2I0VA 3LFEA 5AJQA 3BPRA 4JAJA 2J0MB 3C9WA 3VJNA 3HRAA 2AXZA 2H6HA 3FKNA 4WNPA 1SQMA 2XGSA 4IM2A 1W84A 4PPBA 3L17A 4MK0A 4KS8A 4OTQA 4E5AX 4FTKA 4R77A 2R3MA 4GJ2A 3IDBA 3U4UA 2QY7A 3QCQA 4GVJA 3FLSA 4ZZNA 3LQ5A 3Q78A 4FSNA 3MS9A 4Y46A 2WMNA 4I6JA 1WG0A 3FQEA 2R3PA 5T3RA 4MBIA 3ACKA 4BCQA 3NF1A 2IVUA 4I5MA 1FVFA 3FUIA 4ZLYA 4R78A 2PPQA 5FZRA 3HX4A 4CMOA 4IVCA 2R4BA 3ZMMA 3JXJA 3RPRA 4G2FA 3DJ5A 5CASA 3VS0A 3R02A 4HYUA 3TWXA 2H9VA 2YM4A 3E4BA 2BROA 5CNNA 2EIJE 3IDPA 1XH5A 3OXFA 3QCXA 2JKQA 2WO6A 4YURA 4EHGA 1Y57A 4PL3A 3GQLA 4U6RA 2LUHA 3ULEG 3HVEA 4AW2A 5AV0A 3FULA 3GCSA 1HOWA 1KOBA 3HRFA 4N3BA 2XGOA 3OCBA 2R3JA 1TJFA 4A1GA 5L8KA 4ZP5A 4UZDA 2CHWA 4EOPA 4TW9A 4C3PA 5CHEE 1OZ1A 3KVWA 4N6ZA 2OVFA 4NZWB 2X9FA 1PC2A 4YHFA 3V2OA 4WRSA 4E5WA 2C5XA 2I6HA 5M57A 3NIEA 5B0XA 3OD6X 5KHWA 4JHRA 2R2LA 1OMWA 4G3EA 5FBOA 3UE4A 1XH4A 4E4MA 5J7BA 2Y69E 3PS6A 4XG3A 3LXKA 4JEUA 4RLYA 4D58A 4I9EA 4F4PA 4CV9A 2XK9A 2J0LA 4HPTE 4F63A 1JOWB 3LKUA 4PMPA 1FPPA 2KCKA 4RVTA 4ZK5A 2FVDA 2VO3A 4QMVA 2OVBA 4WWOA 3IHYA 4N57A 4TRQA 2ITNA 1GIJA 1KUTA 4RLLA 2XCKA 1ZYDA 4BERA 3LXUX 3W18A 5AYWD 2OBJA 4CEMA 3P7BA 1ATPE 4LI5A 4WUNA 4XBRA 4FEXA 4ANWA 3ETAA 2MHKA 1AD5A 2X7OA 5AIJA 3LYAA 3HV5A 4U07A 4HYIA 3ML1A 2VTTA 4ZJVA 4DX7D 4O91A 2YNQA 3ZN3A 3D5VA 3D9NA 4GCOA 3ZPJA 3CBLA 4OT6A 3HMOA 4BYIA 4YJOA 4CZTA 4D2TA 4FIFA 3FKOA 3V6RA 3ABLE 2VTPA 2O3PA 3PRIA 2WXHA 4AP2A 2Y7JA 4FEQA 5G1XA 3TACA 3Q9ZA 4QMPA 4BCIA 4I6HA 2C4GA 2C5OA 4KB8A 4MBJA 4JMQA 4ORKA 3ZXZA 4CGAA 3ULZA 2GRQB 3RWPA 3QQUA 3R01A 1K3AA 4ZLOA 2XAMA 1ZRZA 3LZBA 4DH3A 4NIFB 2OXXA 3IW8A 4LQMA 3OUKA 3PYYA 4JR7A 4CMTA 5FG8A 3VWAA 2YZLA 3U55A 2R05A 5EYCA 4O4DA 3LCSA 1MRVA 4YZNA 1P2AA 2Y3AA 3DGKA 4S34A 3ZLSA 3UMXA 5FEQA 4W4WA 4TXRA 3QF9A 4X3FB 3PA5A 1UKHA 3UG2A 5HE0A 1JNKA 3FKLA 4PQNA 2BRHA 2XUUA 2LAVA 5A46A 4CG8A 3JY0A 3EH9A 3SC1A 5DH3A 3F61A 4WO5A 5IQAA 3BLQA 2CNUA 4Q5HA 4UX9A 4KT6B 3LJ1A 3S1HA 2YWPA 5LMKC 2WMSA 4JVGA 3ONLA 2AEGA 3U66A 5KBQA 2ITTA 2XIXA 5HHWA 4U63A 5KWDA 2W5HA 4G5JA 3ROYA 3HG0D 2KZTB 3TTJA 1XH7A 4JD2G 4NKSA 3QCYA 3O96A 2IN6A 1O9UA 4PPAA 4KKEA 4RJ3A 4O4FA 3DDQA 4CTCA 3O51A 5I9ZA 3F9NA 1YWNA 5IUGA 4K0RA 4O6EA 1GZNA 3UI2A 3CPCA 5DRDA 1OWPA 4XG9A 4QMMA 2HAKA 3BCEA 2IVVA 4EH7A 3PE1A 4M84A 3QZIA 5I9WA 5K5XA 3E32A 4RIYB 3CSFA 2ZJWA 4A9RA 5KKRB 4BWKA 3UMVA 3UYTA 4XZ4A 3PNTB 3UVQA 5EW8A 2GFCA 4BDFA 2KCVA 2DZOA 3P23A 4APFA 4AXAA 4MKTA 4DHIB 4TZRA 4OT5A 2QHMA 3BELA 2IZUA 2QYUA 1H1SA 5T68A 3HXBA 5IEXA 1H6PA 3LPBA 5EW3A 3C4WA 4FLHA 3HP2A 5IEYA 5CVGA 5KMJA 3EQHA 2FSLX 3DPKA 4ZTLA 1OCOE 4FEVA 1OM1A 4F3VA 2FB8A 2I0EA 3QB2A 3CR3A 3WILA 3KS2A 3PDTA 4X2JA 3TJPA 2VX1A 4C2WA 1U59A 4XP2A 2EIME 3EJ1A 3TTIA 1PXMA 4HCTA 3JS2A 2XKFA 3TXMA 1H28A 4PMSA 4E3CA 3QXOA 3C3RA 2JFMA 3QBNA 4FIIA 1B89A 3GNIB 4R3CA 1BI8A 2IF8A 3GW4A 3FUNA 5CVFA 2W5AA 3CPBA 4K5CA 1UNGA 1M2PA 2AVPA 4GYWA 5JEBA 3HV4A 4M7IA 4PUZA 4GJ3A 1Y91A 2VTHA 3F3ZA 4J7BA 5BV0A 4OGRA 1WVXA 3EHQA 3VN9A 4K9YA 2BUJA 3EN7A 3DSVA 3G5DA 1YKRA 3F3TA 3W16A 4EH6A 3ZVVA 4J96A 4C4IA 2XA4A 3VONA 3H30A 4K77A 3H9OA 2XK7A 3R8UA 3MV2B 1YOLA 1UKIA 3S0OA 3LY7A 4E4LA 1FQ1B 5J95A 4F99A 4LYNA 5BVDA 4FEUA 4I6GA 3DSTA 3VUKA 2YM8A 4C4GA 5KZIA 3RAKA 2BZHB 1NA3A 3L8XA 4HVHA 4G31A 5L2SA 4MAOA 4OW8A 2IZSA 5J9LA 2NXPA 4C35A 3SOAA 1LF8A 5HG5A 2P9NG 4OYSA 2IO2C 3DJ7A 3NNVA 4IADA 3HP5A 3TZ7A 3UQ3A 4H7XA 2X0GA 1PXIA 4EBWA 3U3WA 5J9YA 3ASDA 5HKPA 4BT9A 3LMGA 4X3FC 3K5VA 5F1ZA 2XEHA 3N71A 4KIPA 3PXYA 3VBWA 4GKIA 3QHRA 4C59A 3IG7A 4F7NA 2PE2A 1XMLA 4WA9A 5CEIA 5JFSA 1HG5A 1ZWSA 2UVZA 4YLJA 1H24A 3B7UX 4K5AB 2GRLA 2LAIA 3GC9A 3KMWA 4B99A 5KBRA 2A27A 2OICA 3FQSA 2R7BA 3U6JA 1F0QA 3MY5A 2QD9A 4FP7A 4ZSLA 1TVOA 1ZY5A 1KSWA 4RSYA 5BUIA 2DWBA 2RFMA 4KIOA 3DPYA 4BVUA 4GZCA 5J1WA 1IEPA 5LCJA 3SLSA 3LMHA 3PZEA 3OT8A 2BTDA 4AOIA 4DLQA 3QZFA 4O0WA 5BV1A 3U8WA 2J08A 2DS1A 3FLYA 5KJNA 3TJCA 1E1VA 3MPTA 4JPSA 4GU6A 5HBHA 5CEPA 4MNEA 2BRMA 3NW6A 2X0PA 2PK9A 2WIHA 2GROB 2CSNA 1IR3A 2C0IA 3DPDA 3UODA 4AX8A 4EONA 2WQ7A 2GU8A 5AAFA 4UQZA 4YO6A 4KZ0A 1Q5KA 3CQEA 4RC2A 3QTIA 1JSUA 2Y1LE 3CVLA 3P78A 4BR3A 5C27A 3OEFX 1Q8ZA 5J9ZA 2OIQA 2GHMA 1UNLA 1ZAOA 1M7QA 5EOBA 4GPMA 1ZYCA 1N4QA 2JLDA 3DKFA 3O2MA 3I7CA 2V0PA 3FC1X 2W4JA 3ZGQA 3CK9A 4GU5A 2R03A 4C02A 5D1JA 2RG6A 2XHEA 4H7YA 4F6UA 5IKWA 4OTHA 4FV6A 3S7JA 4DI3A 2YITA 4BIBA 1IAJA 5FQ8A 3R73A 1YA0A 5AM7A 3PUFC 1DI8A 5KBAA 5H7PA 1BI8B 3QYZA 4FSZA 1TYQG 4N5QA 1L3RE 3CKCA 4HRMB 3QX2A 4MWIA 3OWJA 3O7LB 4FSYA 3TN8A 2JEDA 4OTWA 3R7QA 4AF3A 3BU5A 1VDYA 4EOSA 3TWTA 4BCNA 4F7SA 4FKIA 5EG3A 3HV6A 3OBJA 4UMPA 1UOHA 3EIDA 1JKSA 4R6VA 5CSXA 3ML9A 3A60A 5H2UA 2C47A 1UN8A 4ZLZA 3C4CA 2WB8A 2O2UA 3JQ0A 4QP9A 4GA2A 3CKBA 4U44A 2PWLA 4JBVA 3ZONA 3VS3A 3FL4A 1L8TA 2VSXE 2W4KA 3ZDIA 4U8HA 2UW8A 3PIXA 5CU3A 5JMND 2CCHA 3TWJA 3OY3A 2WZJA 4JB8P 3R22A 1YWVA 3HRBA 1LPUA 3NRMA 3LQ3A 2W1GA 4QQJA 2W1IA 3ATSA 3WF7A 2R9SA 4L44A 3BQRA 3Q4UA 1HF8A 4G11A 3PXKA 4O81A 4DTBA 3AKJA 4X3JA 1ZARA 5T4YA 2DWZA 5ANKA 3CVXA 3P7AA 4DG2E 1XO2B 3PRZA 3WOWA 1ERKA 3NUAA 3EQPA 4FL2A 3BYSA 4O0XA 1ELKA 3E62A 4TXQA 4J8NA 4W8EA 4G3DA 2IW6A 3FSFA 2XIRA 4XHKB 4RPVA 4ACCA 5EYDA 1G3NB 4QP1A 1WDYA 4RIYA 3PH0C 2R3IA 3Q73A 3PY1A 4JS8A 3D5UA 1H07A 3C13A 4ERKA 4CYJA 1WY6A 1ZXEA 5ENSD 1ZOGA 3CVUA 3Q4CA 5HLNA 4I0TA 3BIZA 4BRXA 5C2YA 3C5RA 3MH3A 4U7EB 2GRPB 3MA3A 4ASEA 3UM1A 4AP7A 5AAEA 4L46A 3VS7A 3F2NA 4MF0A 2C6IA 2JEKA 2R3RA 3UO4A 4CFUA 4PP7A 4ZTSA 5DT4A 5K3YA 4N0SA 3QRJA 3FHIA 3Q96A 5IA1A 5JKGA 3CVVA 2E2BA 2OEWA 2F4JA 3DA6A 3PIZA 1E8XA 5HU3A 3R1SA 2F2UA 1MX6A 3EU9A 4PTGA 2NYAA 2WMXA 3WBLA 1QYMA 4JXTA 1OWOA 4PWNA 2YDKA 4AA0A 1IG1A 4ZSAA 4FZDB 1EPUA 1ZU2A 2BAKA 4DHJA 3FUEA 2HK5A 5CF6A 4MXOA 3D9JA 2PVYA 1I44A 3TV6A 4ACDA 4RJ4A 1APME 4EZ5A 1R0EA 3W9GA 3RU0A 4FSQA 4KA3A 2XRZA 4F6WA 4XEYA 3NCGA 3QL8A 3EFJA 5AMNA 3R7RA 1H0AA 3LCTA 1SNUA 1O1TA 4CDRA 4FV3A 3DK6A 5L6OA 5CZHA 5EX0A 4C0MA 3OG7A 5BT1A 5G55A 2W1HA 5HS0A 3S7BA 3HVCA 2OJIA 1R0PA 1JWHA 2C0LA 5CU2A 3DSUA 5H8EA 5BYYA 3S3IA 2F2CB 4Y6WA 2V0DA 1Q8YA 2OIDA 2YDJA 3LMIA 4JQ8A 2IEWA 4LUNU 4UZHA 3QWKA 4EQUA 3C50A 5TT7A 4IMYA 4K6ZA 2HENA 3C5UA 1NA0A 1SNXA 3F7WA 4FKLA 4YJVA 4FA2A 3FMKA 4GTPA 4CT1A 2R0UA 4I6BA 3GXLA 5JZNA 3CHQA 2C6OA 4AT3A 3EHAA 4FI1A 2QYJA 4RLKA 4U42A 5BVWA 1Y8YA 3D94A 4DEBA 3ZCLA 2R59A 2ZV2A 3A4OX 5DR9A 3ODYX 1S9JA 4AN9A 4I22A 5HNBA 5FXRA 3PVBA 4OLIA 4IAIA 3EZRA 3NZSA 3ONKA 3PLAE 4M3QA 3DY7A 3IECA 1B6CB 3K3IA 5HO7A 3D9HA 3D9PA 2I2OA 2XNMA 1W7HA 5CSPA 3MFTA 3V51A 1GIIA 4EWQA 3LLTA 4H3PA 1ZB1A 4MNEB 3BKBA 5FGKA 4TT7A 3PZ1A 3CTHA 1GY3A 2WOUA 3JVSA 4WAFA 4AOFA 3RAIA 4CRLA 1IKND 4B8LA 3AD4A 3DB8A 4WBBB 4MD7E 4UQYA 4NIKA 2FULA 4NTSA 1JBPE 1T46A 1VR2A 4PP9A 3L22A 4CLIA 2CKQA 3L6AA 3IBEA 4CTBA 3CSTA 2IWIA 2G2HA 3FH7A 4Y95A 3RRUA 3FZSA 4KIKA 4B8AA 3ZS5A 2PZ5A 3QQKA 2R3OA 3U9WA 2WXPA 4KAOA 5FXSA 2IQCA 2HYYA 4U81A 4WBOA 5IA4A 3PJCA 2DQ7X 3CTJA 3AQVA 2WMOA 4BT8A 3FYKX 4DYMA 4Q9ZA 3O48A 4FVRA 2JAMA 3ORZA 2J7TA 5EFQA 1K3ZD 4BCGA 4O6LA 4QMNA 3TUCA 3N4UA 2ERZE 4Y5HA 5ANOA 2A98A 2VAGA 4JT3A 5KMOA 2VX0A 1QL6A 1DVPA 2ZAZA 4GCNA 3PEUB 3ZXSA 2YIYA 2R3KA 2XRWA 3W0QA 2F8YA 2WEVA 4H39A 4HJOA 4L7TA 2UW7A 1JCRA 1IHGA 3DQXA 3AC1A 3I3NA 4U3YA 3LFNA 3VO3A 4IHPA 2HELA 4ABNA 3SXSA 3GOPA 2XS0A 1UG3A 3VUDA 4LNUD 2WMWA 5EI2A 3BHYA 2QO2A 2C68A 4FG7A 3Q60A 1YW2A 3KF4A 4R7HA 4FNZA 5LCWC 5BXUA 3VF9A 1QZ2A 1HH8A 1A06A 5ENRD 5IH5A 5FWQA 5IPJA 4YZDA 3EQRA 2EQXA 4BFRA 3ZEWA 2YM7A 1PY5A 1Q97A 2VJ8A 4E85A 2WMBA 1J1CA 3VAPA 3AJIA 2PUPA 4UI9C 1INZA 4OTGA 1X8BA 2LO6A 3CY2A 5AR4A 2XNNA 3WZEA 1SM2A 3MA5A 5LVOA 3UBDA 2XS1A 4LV8A 3F2AA 5E8ZA 4ALUA 4LUEA 1KWPA 4CD0A 4LGDA 2C3LA 3RSEG 3SXRA 1XH6A 5J7HA 2QR7A 1E8ZA 4RIOA 3KKVA 2QI8A 3FUPA 4AA5A 1FT2A 2W05A 1U2VG 3WF9A 4FT0A 3TYKA 4RA4A 4QMTA 1NVSA 2ITWA 5CU4A 3TM0A 2R17C 2OF2A 5HEZA 3EOCA 3RAUA 2BALA 1JLUE 3OCGA 3NYXA 3R83A 2FSMX 4Q9SA 3K2LA 3MY0A 4AUAA 4IE9A 3GU5A 4BKJA 3CIKA 3F5XA 1OY3D 3QX4A 2VGEA 3U6HA 3UDTA 3ESKA 4QPAA 2PMLX 3QFVA 4WSQA 3L82A 3CHMA 2GNIA 3SQVA 3NPCA 4MRUA 1PW2A 3D14A 5JJ6A 5ENOD 4ANVA 4AY5A 1R39A 1ZOHA 2V62A 3W10A 4ATGA 2GNLA 5E91A 3QALE 2WXVA 2F9GA 4XYFA 4QNYA 5CEDB 4ZFHA 3KRWA 3VC4A 2AWIA 4LCTA 3EDTB 3MJ2A 2ITVA 4RX5A 1Y6IA 1RE8A 4YTIA 3R7YA 5K4IA 3URZA 3FAAA 4D2VA 2G2FA 5HD7A 3R9MA 4R8QA 5EILA 1LP4A 4NURA 4N6YA 4DFYA 1TNOA 4IZ5A 4RQIA 3A8XA 4IX3A 4G3GA 1ST0A 2UZOA 1PY1A 4EH5A 3ZYKA 5DVRA 1BKXA 2XNOA 4IAYA 1SMHA 2BCJA 4IVBA 4KXKB 4QMWA 4CRWA 4DUIA 3P4KA 1RJBA 2R3GA 5HQ8A 4EH4A 5FINA 5LFAA 2X8IA 3WARA 3SQQA 5JJTA 3EB0A 3VUTA 3MVJA 4BGHA 3QAME 3B8RA 3CQUA 2Q83A 5HO6A 3RI1A 3QLFA 1SZAA 3MPMA 5AARA 1OI9A 3G2TA 4AZVA 5AR8A 2V4LA 2OZOA 3HAMA 4RRVA 4AN2A 4EUUA 2A4ZA 3WYXA 2XPZA 4IAKA 4RSSA 3MDYA 4GT5A 2BTSA 2UZVA 1YXTA 3PSDA 3ZEFA 4O0UA 2WGJA 3PIYA 2XYUA 4A63B 4X2FA 2F8XK 4FMQA 5DT0A 5IQBA 4ANLA 4C57A 4S31A 4G26A 4FJYA 4CFWA 4BSZB 4IEBA 3PPZA 2QOOA 3PUKA 4O84A 1XWSA 5KJLA 1WBNA 3ZRMA 3G2FA 2E9PA 4M69A 3W2QA 3T8OA 1OL5A 4B6LA 3G90X 4RJ8A 1J7LA 3OEZA 5AUUA 1KE8A 3G51A 3OOGA 5FQ7A 1H1QA 2GW1A 3ZHEB 4RWKA 4NACA 5ENQD 4G17A 4CKJA 1RDQE 4K03A 5IQFA 3PZ2A 4NSTA 5JFWA 3UO6A 3VULA 4RWLA 1H2TC 2OEVA 2QKRA 3QTUA 4CT2A 4UMTA 4GS6A 5AAOA 3NNXA 2WELA 3AU5A 5CT7A 2WPAA 3EN5A 4XV3A 3VIDA 4EOMA 3RK7A 4FKJA 3T5VA 5HLPA 4DITA 1G8JA 4YZCA 3CV0A 2E9VA 4RVBA 3ZU7B 3ID6C 5HI2A 1YXSA 3ZKJA 2PUUA 1V55E 4D5HA 5I3OA 4GRBA 1J7IA 2ONLC 3IK3A 4O7YA 1YRPA 4FG9A 4DLJA 2O65A 2Z02A 4P7EA 4M68A 2WMAA 3FU3A 3Q5MA 4CRSA 3P2BA 4A07A 4USEA 2OO8X 4FZAB 4M0YA 4AGDA 1FMKA 1JCSA 2GHLA 3M42A 4I92A 3UM3A 4MCVA 3ZEPA 2CN8A 3OWKA 2CFUA 2Y0AA 3ORTA 2C2LA 2J2IB 1WCCA 3BE9A 5C8KA 4LG6A 3FDHA 3K54A 3GZSA 4MF1A 4XX5A 2VYIA 3RBWA 4GTRA 3C3QA 3FY2A 5CY3A 1UU9A 2XCCA 4QOXA 4J7WA 3CC6A 2ESMA 5KUPA 3EJNA 2ZGGA 4O7RA 3I4RB 3IONA 4U79A 4CCUA 4F0FA 4EOJA 4U95D 5AP6A 1REKA 4C34A 4L2LA 3U9CA 4ZZMA 3ZLWA 3FUJA 2ZV9A 1XBCA 3ALNA 2NRUA 2PL2A 3EYGA 2OCCE 4GIHA 4N5CA 2XGMA 5G6VA 4MTAA 2Z7LA 4FL1A 4ASDA 4GCJA 1XJDA 4YJPA 5ACKA 2XKEA 2VGXA 4D1XA 5A3XA 2XK4A 3DKOA 4MHAA 3QU0A 3P0MA 4A7CA 3V8SA 2X2MA 4KVOA 2V5QC 3KXGA 5LCKA 5CBNA 2WXNA 4FADA 2VO0A 5BVKA 3QQJA 4N70A 4O60A 3PSCA 2CN5A 2ZU6B 3MVMA 4BGGA 3PSBA 5CWZA 5KCMA 2ETBA 2C1BA 1MQSA 4N2SA 5EIDA 2B7AA 3BYVA 4FSUA 3UZTA 4EHVA 2NSZA 1OGUA 5AA8A 1TKIA 2WXMA 3AC4A 4L7SA<