2PZIA

Crystal structure of protein kinase pkng from mycobacterium tuberculosis in complex with tetrahydrobenzothiophene ax20017
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
677
structure length
654
Chain Sequence
GSHMLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable serine/threonine-protein kinase pknG
publication title Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 200
structure length 654
sequence length 677
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF16918 PknG_TPR Protein kinase G tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pziA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2pziA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pziA02
4RA5A 4XP0A 3UC3A 2VGXB 3FXWA 4R5SA 1GZ8A 4MXXA 4C2WA 4MXAA 3LLAA 2OO8X 4CMTA 4P5ZA 2ITWA 4WNOA 4NKSA 5EKOA 2XNMA 4AZVA 5AV4A 2Z7LA 4ANQA 2YFXA 2ONLC 2R0IA 2X2LA 4RX9A 5CXZA 3B2WA 5HIEA 4FEUA 4YJPA 5C26A 2YQ8A 2BRGA 2VTRA 3K54A 3VTYA 2CNUA 4M14A 2PL2A 1BL7A 3QU0A 2XB7A 3IG7A 1PHKA 3OBGA 3LE6A 4FV5A 2HZIA 4L43A 4QP8A 4M69A 3WOWA 5JJ6A 4PTEA 2PYWA 3GEQA 3DNDA 4W8DA 2IVTA 2WMAA 2WMSA 4Z16A 1K9AA 4PWNA 2E2EA 5CZHA 4L42A 3UNJA 4J1RA 2XUUA 3TG1A 1PC2A 4AU8A 4D5KA 3PPJA 4IXPA 4F99A 2RFNA 4D4YA 1TQPA 4BHZA 3QC4A 5KZIA 3KEXA 4AGCA 1W82A 3DQWA 3FZRA 5E1EA 5IEYA 3R04A 1M17A 3NUSA 4FG7A 2W1IA 2VTLA 1Q4LA 4MHAA 4CXAA 4FKSA 2CCHA 4F9CA 3OXGA 3P79A 3PJ2A 4FSUA 2UW5A 3KRRA 4FTJA 5E8VA 2O0UA 5HG7A 1PMNA 4BI2A 5I9YA 3FLNC 1PRYA 4O21A 5FDXA 3NUUA 3C5IA 3GT8A 4FNWA 3MKRA 4F63A 1KV1A 4L52A 4QTCA 4Y73A 3DAKA 4ZY4A 1K3AA 3M11A 4YJRA 5F9EA 5DBKA 5D1JA 4JAIA 4MD7E 2A0CX 5C03A 2ITUA 3KMMA 5CNNA 3BU6A 2XCBA 4QTDA 3W55A 5IF1A 4KIKB 3VQUA 2CDZA 2G2IA 5HLPA 1ZWSA 1U5RA 3VC4A 3WZEA 4BKYA 5IH5A 2Y7JA 3KC3A 5EM5A 4QTEA 5E9EA 4FL3A 3SW4A 3ORMA 3ZRLA 1SZMA 2YLFA 3ATTA 3BLRA 3OOGA 2YM4A 4S2ZA 3BV3A 3U9CA 4FTMA 4X0MA 3R9OA 4M0YA 4MBLA 1H1SA 2VWVA 4GMYA 1QPCA 1OUKA 2QODA 3DBCA 3NYOA 3S95A 2OGVA 1PW2A 3FWQA 3UIMA 5AR3A 4NSTA 3AS4A 3TL8A 4XV9A 4CFWA 1NY3A 5CWZA 4F6UA 5E8XA 2PSQA 4O0TA 4YLKA 4EH3A 5IQGA 2J0KA 1O6LA 3U4WA 1UKIA 2HW7A 5BQ0A 4TY1A 3RPRA 4EEVA 2UZTA 2XCKA 2AVPA 3EKNA 3E63A 2Y6OA 3QQKA 4FZDB 4O7YA 3VBXA 2HOGA 5DH3A 4CGVA 3H3CA 2E9PA 3W10A 1QPDA 4IVCA 3WF5A 1KLXA 1LPUA 3TNIA 5D12A 5CQWA 5FP5A 4O27B 4PDYA 2ZV2A 5J9YA 4F7LA 3MJ1A 3JY9A 3UP2A 4W4WA 4BICA 3TDVA 4FTLA 3L9MA 3TNHA 2P33A 3V6RA 1KE5A 1RW8A 4FSWA 2WOTA 3NW7A 5M08A 3ZDIA 2F2CB 3MA6A 2HZ4A 3ZSGA 5BYYA 2CGWA 2YITA 4KD1A 1H00A 3OCTA 4PMSA 3FMKA 1R0EA 4AQCA 3RPOA 1GIJA 2HO1A 2QO7A 2YDJA 4KKHA 4UWYA 3LFCA 3UO6A 1G8AA 1XKKA 1YOJA 4FUXA 3F61A 3WIKA 4AT4A 4BTAA 2GW1A 4FIJA 3O50A 5J1WA 2ITYA 3R8PA 3V5LA 1Z5MA 2XJ0A 4GYGA 3DTWA 2I6LA 4PNIA 4FKTA 4XOYA 3CTHA 4EOMA 3ANQA 3QQJA 4Y8DA 3BGQA 5HKMA 3NSZA 5DT3A 2P2IA 4LEUA 4U44A 4ENXA 3MPTA 3BLHA 4IB5A 4L3LA 2VWIA 3G90X 2F2UA 1LP4A 4FF8A 1O9UA 4QOXA 3TUCA 4L45A 3KF4A 5DR6A 4U80A 4WHZA 4FIGA 3R8ZA 2OZAA 3II5A 2WTDA 2IW8A 1B39A 2BFXA 3PYYA 4K8AA 2G9XA 3F5GA 3NWWA 4TRLA 4C4EA 3QX4A 4MKCA 4GFGA 5JFXA 2ITNA 4FBXA 1OL1A 1W83A 4MCVA 3A4PA 5BVFA 3GXLA 3ULIA 5F1ZA 4FSQA 2VNYA 3ZZEA 1OZ1A 2OFUA 4IACA 3UNZA 2P3GX 4ZJVA 1JKLA 4FTKA 1VYWA 2C6IA 3DK6A 4FOCA 3RWQA 2VSNA 4HVDA 3FLYA 3COMA 3GNIB 4MD9E 1JKTA 3UIUA 3CVQA 3QRIA 2V5QA 3C51A 1YVJA 1FMKA 2A4LA 4JIKA 1P5QA 1ZMVA 3V5TA 4EK6A 2QG7A 1Q61A 4IWQA 3ULQA 3MFSA 2YM8A 5IQDA 4RLLA 2ZAZA 3C4WA 1S9JA 3L8PA 2BKKA 3VRYA 2HXLA 3ZFXA 4C58A 3QTQA 1MRVA 2F7EE 5DGZA 3SHEA 3PVGA 4OTGA 5AEPA 4Y72A 2C6DA 2XRUA 3HP5A 5JQ5A 1RJBA 2CN8A 3E62A 3HYMB 4FTCA 3SXSA 4O7RA 3D14A 4F9AA 3ZSIA 2KCKA 3C4FA 3KN6A 4IM2A 5M4IA 4XYFA 3TT0A 4ANLA 4AN3A 3FZPA 3POOA 2RKUA 2XJ1A 4KIPA 2BIKB 4WNMA 1YI3A 3Q5IA 4WIHA 4DT9A 3NS9A 4PL5A 4YJOA 4J0UA 3FKNA 3R02A 4V0GB 4E8AA 3JR1A 3K3IA 1OUYA 2WMTA 1U54B 3U55A 3O51A 2VO6A 3W8QA 4N5CA 4C4FA 4BIBA 4EHVA 3DV3A 2RFEA 3I7CA 4DEEA 4XG9A 3CJFA 3MW1A 5K0XA 1B6CB 4B4LA 5AMNA 2WMWA 2XNOA 2ZM3A 3R01A 5ANIA 3VIDA 2QOLA 3NGAA 5DG5A 1OMWA 2XA4A 4FKLA 4CZUA 2H96A 4W4XA 4IAYA 4L67A 3DAEA 1KE8A 2IW6A 4NJDA 3DK7A 4K6ZA 5TR6A 4QYGA 4AACA 3HL7A 2PUNA 3EYGA 4GK4A 4KKEA 2VTSA 5CEOA 2YDIA 4HGTA 3ZLSA 2YCRA 2XIKA 3IW4A 1KSWA 2XMYA 3Q4TA 5AAEA 5CZIA 5BVDA 1ZRZA 2QOIA 2DWBA 3OD6X 3P4KA 4RWLA 3TEIA 4QNAA 3SXRA 4D2WA 4WOVA 4DEDA 3O48A 3EYHA 2XK3A 2YM5A 1DAYA 1Z9XA 2VX0A 2XF0A 2YJRA 4M15A 4W9XA 3RK5A 3AC8A 4RIWA 2VGYA 3PSCA 5AM7A 1XO2B 2YA9A 2R3HA 4AT5A 2KATA 3OCGA 3JPVA 4OBOA 4BDFA 2R3LA 1BKXA 5DI1A 4ERWA 3AC4A 5CAVA 2UW4A 4I5MA 3ZU7A 5L6PA 3ASGA 2P55A 1PMVA 3RIBA 4D9UA 2XNNA 2BHHA 5KBRA 4IH8A 4ERKA 3FDNA 4FT0A 4F1OA 3KKVA 2X81A 4EOIA 4KSPA 4O6FA 3UZPA 4NM7A 3NYXA 4BZNA 4GS6A 3KULA 3OP5A 2XS0A 3RCDA 3MH0A 3EFWA 5HU9A 1M7QA 2LGCA 4ACHA 4L6QA 3QD0A 1H01A 4O83A 2IZRA 4RC4A 1SVHA 3VUDA 1TQMA 4D2PA 1LUFA 4EOOA 3PA3A 5EKNA 4ZAUA 4NZWB 1IA8A 3OUNB 5HTIA 2UZBA 5HI2A 4OTWA 2HENA 2BZJA 5LVMA 4QP2A 5HORA 5IA4A 4EOPA 3FLSA 1OIUA 2BTSA 5CCLA 4OW8A 3A60A 3NR9A 2PK9A 3Q32A 2JKMA 4MXCA 5HOAA 4YTIA 2JLBA 5DT0A 5FXQA 3TACA 4FV0A 3ZRMA 3NUPA 4AZFA 3FMHA 4FEQA 3IK3A 3FUPA 2PVHA 1M14A 3IONA 4OBQA 2C0IA 1OI9A 3AG9A 4DLIA 5HVYA 4USFA 2E9NA 1XH6A 4E3CA 3ZYAA 3O7LD 4FOBA 2JDTA 2XKDA 2GS7A 2WMUA 4H39A 4C34A 3ZEWA 4O7ZA 5AJQA 4I2ZA 1WBWA 3I0OA 4B9DA 3VBVA 4ZZOA 3HAMA 2PVYA 5CU3A 4GYIA 2F7XE 3AT2A 4FMQA 4FZFB 4FKPA 5B2LA 4EONA 2R5SA 3O8UA 3EFJA 5AR4A 4UMRA 3GU6A 2ZV9A 2CKEA 3DCVA 3V8WA 2HY81 3KRXA 3Q4CA 3TG4A 2Z7QA 3RKBA 3QKMA 3DB8A 3VBYA 5FEQA 3C0HA 3BRBA 1IEPA 4JG7A 4ZZMA 2C3KA 1URWA 2EU9A 3DBEA 4H1MA 3U8WA 3PSDA 5KO1A 5FM2A 3UBDA 4EK5A 5CXHA 4B8LA 3DFCB 4FTAA 4O0UA 4ASZA 1IYGA 3GC0A 3QYZA 2CNVA 3Q9XA 4FT3A 5DE2A 4O7TA 4RQKA 3O8TA 4JG8A 4J98A 2IVUA 3POZA 5H8BA 1T46A 4E4LA 4G2FA 4J8FA 4S30A 5DYJA 2R7BA 2BAJA 3LQ3A 4DEGA 3Q5MA 3WILA 4X6RA 3CC6A 3R1YA 4XHKB 4LMUA 3WF7A 4FTQA 4E26A 3UUXA 1H4LA 1R78A 2IVSA 2UWJG 4LYNA 2OOEA 5A6CA 3D5WA 3F9NA 4R5YA 4APPA 3R9NA 3ERKA 3UG1A 3OCSA 2YM7A 1HCKA 2J51A 2YISA 4USDA 5IEXA 5BVNA 5JGDA 4MQ1A 3NNVA 4TWOA 5AR7A 5TKDA 4IIRA 3QQFA 4FA2A 2OK1A 3ACJA 3A7FA 1GY3A 4M84A 4O1PA 4EJNA 2OJIA 4D4SA 4Z55A 2JKKA 4GT3A 5DHJA 1P4FA 4LQMA 4TL0A 3ZC6A 4IZ7A 4F70A 2W17A 3SVVA 5EYDA 3MESA 4DCAA 3TTIA 4ZTHA 1ZYJA 2BZKB 2EWAA 2GNGA 4DITA 2FI7A 1YWVA 2UV2A 4YZNA 1RDQE 4DYMA 5HLWA 4FKJA 2CGXA 2CGUA 4O38A 5HO8A 2GNIA 5AADA 4UEUA 4Z9LA 4CG8A 4LGDA 3WYYA 3QGWA 4HGSA 2DS1A 4X3FC 1JLUE 2GFSA 2PMIA 3OTVA 4JS8A 3NW6A 5JH6A 2YCQA 2VTOA 4HYIA 4J96A 2HZ0A 4QP4A 2W5BA 5J7HA 4CCBA 3GYZA 3HRFA 3MY1A 5ANEA 3TZMA 4QMVA 2OXDA 2XCCA 4JR3A 2CLXA 3CR0A 3F5UA 2WQOA 4PPAA 3DKGA 1GOLA 3LM0A 2R3IA 2P2HA 4RBLA 4IAIA 4XH6A 3Q4ZA 4YTFA 5J95A 3RWPA 4YSJA 4RQVA 4BCHA 4HZRA 2OU7A 3UG2A 4HCVA 5AR2A 4CZTA 3CTQA 2Q0BA 4FIIA 3CP9A 4WSYA 5KJNA 3L8VA 1XBCA 4W4YA 3VULA 3AD5A 4XX9A 1Y6AA 2OW3A 5I0BA 4ALUA 2W99B 3ORTA 4EKKA 4IZYA 5I9VA 2IVVA 5JQ8A 4FSNA 2UW6A 4M13A 5I9UA 3ZHPC 3BX5A 4GA0A 4PL4A 4AE9A 4JIAA 1H1WA 5FLFA 5A4CA 5BNJA 4EHGA 3G5DA 2W05A 3E8DA 2ESMA 3JXWA 3R7UA 3P0MA 4WRSA 1XH7A 3EH9A 4O2PA 4FG9A 4WNGA 5IA2A 4L7SA 5ANDA 5HZNA 4CYJA 3N4TA 4I4FA 4YTCA 2OLCA 1YHVA 5E90A 5FWKK 3D7TB 5DPVA 3ZO1A 3KFAA 4CFFA 3HMMA 3R1NA 4GFOA 3FFLA 2C3JA 3HVCA 3QRUA 4JBPA 4AZEA 2PWLA 3QTZA 4N3BA 5AP6A 1XR1A 3R73A 4FIEA 5BPYA 1B89A 4BDKA 5M72A 4FT9A 4BR3A 5HCXA 2W1FA 4IW0A 4IWDA 5DOSA 3MS9A 5EDQA 3P78A 1UNGA 1ZMWA 2QLUA 4LUEA 4XV2A 5AYWD 1PMUA 4JQ8A 5KNJA 4L46A 4A07A 4HYHA 4E73A 2VU3A 3R2YA 4NM3A 4U04A 3CQEA 2PVMA 3KCFA 3M42A 3VRZA 4C4JA 4DH5A 1BX6A 3CSVA 5A9UA 2VTHA 2YIWA 2VO0A 4YJTA 4JBOA 5CY3A 3DKOA 4CFXA 2C2LA 3MPAA 3HV3A 2WB8A 5CTPA 3KVXA 5AA8A 2R2PA 3S7DA 3RAIA 3UYTA 4B94A 1UU3A 4N70A 3GU8A 5C8KA 3C0IA 4G26A 3AMYA 3FLWA 3QWKA 4ACCA 3U6IA 4FVPA 3ORIA 3LY8A 4K18A 1F5QA 2VWYA 4JDIA 4ZJIA 1XH5A 4XG2A 4D58A 4EH5A 5DWRA 2ZOQA 5LJJA 4CCUA 4C4IA 3OXLA 4HVIA 3BHHA 4GPKA 1U5QA 4R3PA 4OBPA 2OSCA 1WAKA 4FV1A 2C3LA 3HA6A 5E1SA 4OAVB 3C4ZA 4IFCA 4JDKA 4O0SA 3U6HA 4NIFA 3AMBA 4FV2A 3ELJA 2PZPA 3GCVA 3JUHA 4WG3A 4I0SA 4H3BA 5ETAA 4XNEA 4IVBA 3PXYA 2VD5A 4RG6A 1Q8ZA 5DA3A 2HK5A 4U41A 5AV1A 3WZDA 1J3HA 2C69A 4FEWA 4FIHA 3QXOA 4FIFA 4L68A 3GU4A 3ZN3A 3UE4A 4MH7A 2QFCA 3H30A 1JSVA 2ITPA 3GQIA 4IVAA 1P14A 4XG6A 5CEKA 4MVFA 1PY5A 3MTFA 1XNFA 4XIFA 1ZOEA 3FC1X 2VGOA 4EOSA 4O7VA 3QL8A 4BDGA 3O8PA 3GVUA 4FK3A 3ATSA 4DC2A 3FLQA 3JY0A 4YVOA 4ZY5A 5HX8A 3U4TA 2VAGA 4IAKA 3RO3A 2VUWA 4FV7A 3C5UA 4I6QA 5ANOA 3R83A 5D10A 3RTPA 4ME2A 3RI1A 4GT4A 3UZTA 4FSYA 1WBVA 5ETFA 3VUIA 1XQZA 3PPZA 2QD9A 2R3NA 4ZY6A 2GTNA 3PXQA 1AQ1A 4YJUA 2X8EA 3DZQA 4J99A 4CV9A 4FUYA 5CX9A 3JS2A 2PHKA 2O3PA 2OI4X 2EVAA 3FMEA 4FTOA 4C2VA 4QYYA 3E5AA 2C1BA 3R9DA 4ACMA 5KMNA 3SW7A 1J7UA 1NT2A 3PIXA 2R3QA 3V01A 1WBNA 4DGOA 1XH4A 5CHEE 4X2KA 4JXFA 3SG8A 4DN5A 3S7FA 3LFNA 2QO2A 4A06A 4ALWA 1V0OA 4PQNA 4RJ6A 4ZLZA 2C3IB 2OF2A 3NNXA 4G6NA 1CM8A 3UZRA 4FKVA 3R6XA 1W8CA 1ZYSA 5DFPA 2XVDA 3PDTA 3R71A 2B53A 4OTFA 4E20A 4F4PA 1NXKA 1NW1A 1J91A 3ZM4A 4F64A 4UYAA 4AGDA 4UMUA 2XK8A 3A8XA 4G6LA 3ZC5A 4EI4A 5HU3A 3WE8A 3AD4A 4O1OA 4DFXE 2FBNA 1PYEA 4CNHA 4O0WA 4EK8A 3FI8A 3GCSA 1FVVA 2X1NA 2Y9QA 4AN9A 4NM0A 4XI9A 4RSSA 5JFSA 2JLDA 4RFZA 1YXSA 3FI2A 3U87A 4FTIA 3LCSA 4RFMA 4YZDA 2NPQA 3I5ZA 4DFYA 1WM5A 5FT9A 4UWBA 2VSYA 2VX3A 3Q2JA 4ZZNA 3U54A 3DLZA 2YAAA 1SM2A 2OIDA 4YZ9A 5BUJA 2JDSA 2OZOA 2C5YA 1A9UA 4G34A 3FZTA 3UC4A 4ANNA 3LMIA 3DKCA 4RFYA 4IM0A 3NLBA 1KE7A 2X2KA 2Z60A 2C6MA 2OXXA 2ZV8A 5CVFA 2FF4A 4O7LA 5DN3A 3QWWA 4KS7A 1NA7A 2F49A 1GZNA 4Q5HA 4XP2A 5E8SA 5EYMA 4GCJA 3TZ7A 4AFJA 3S0OA 3KRJA 1YW2A 2VWWA 3F88A 4TYEA 4LFIA 3IEGA 4NW5A 4BDIA 5HBJA 2C6LA 3G9NA 3COKA 3TIZA 3ZBXA 4KINA 3CE3A 5HEZA 3EQGA 1Q8WA 2W1ZA 2IG7A 3LXPA 4KB8A 4QMXA 5T6KA 4BWXA 4EBVA 1YA0A 1ERKA 4CD0A 2HWOA 3MH2A 2UZLA 4L9IA 4KBQA 2WGJA 3KVWA 3IDBA 3DU8A 4I1AA 2C47A 3ZO3A 3NCZA 5CCMA 2QC6A 3ZFMA 2V22A 4ANMA 4BT9A 4QP6A 2HIWA 2VGPA 4O0RA 3DDPA 3EDTB 2PVRA 3RK7A 4BGHA 2F7ZE 4GW8A 4IX4A 2W0JA 3IW8A 3ODYX 4HYSA 5JFWA 3ZM9A 4C59A 4X3JA 4HVHA 3DK3A 3QUDA 4RZVA 5C1QB 5J79A 4F9BA 5A4TA 5GZ8A 5AFVA 3COHA 4XEYA 3F69A 5FTQA 1Q24A 5IZFA 3DXPA 5C4KA 4D5HA 4O0VA 5IUIA 3S3IA 2W1EA 4D2TA 3R30A 2PUPA 3ROYA 1TKIA 5K3YA 2OWBA 4QMUA 2VTIA 5CT7A 3DNEA 4G6OA 4BI1A 1BLXA 4G3DA 3VQHA 4G16A 2IN6A 5E8TA 2AC3A 1DI8A 1GNGA 5LCWC 4AN2A 3SG9A 4DH8A 3NPCA 4CSVA 5IDNA 2RL5A 4L8MA 4CQEA 5HNGA 4R1VA 3FXXA 3VS7A 5BT1A 2CJMA 3OT8A 2PUIA 3R00A 5GINE 4AA5A 5LMKA 1HOWA 3N4UA 5A4LA 4YSMA 1OVEA 2QHMA 3P9JA 5F20A 5LCKA 3UMWA 5CF4A 3R0TA 3RBWA 4I20A 3KULB 4DBNA 2ZB0A 4OTDA 5ANKA 3NYVA 4BDJA 5AUUA 2XK9A 1L8TA 4ZMEA 5E8YA 5ANGA 3QQUA 1HCLA 5BW8C 3NIEA 3MGYA 2JDRA 3PE4A 3DTCA 5FM3A 5EM6A 3IO7A 3BYVA 4HPTE 5C27A 5L2WA 3I0QA 4LUDA 3L9NA 2YIYA 5KMIA 5CEQA 5KMJA 5HG5A 3E64A 4X2JA 2BRMA 1UKHA 3ORNA 4IDVA 2GQSA 3UO4A 4YHTA 2QLQA 2REIA 3Q52A 3VNTA 1UU8A 2V0DA 4TWCA 1FMOE 3TJCA 4XI0A 1LR4A 1H8FA 4H3PA 3K5UA 3TUBA 4QMTA 3E4BA 3BELA 3WF8A 4DA5A 3NX8A 4A1SA 4TPTA 1PXOA 2QG5A 5A46A 3UTOA 3KB7A 4KS8A 5FXSA 2ETMA 3KREA 4I4EA 4IJ9A 2OIBA 3OCBA 3PRIA 4EC9A 4K1BA 2W4KA 3QCSA 2PULA 4MNFA 3FLZA 4PMPA 1YXUA 4IB0A 2OH0E 2I1MA 3DQXA 5BX0A 5HGIA 3LJ0A 5FBNC 4LRMA 4P7EA 2C5VA 4EHEA 3A7JA 3IGOA 3WF6A 3I6WA 1XH9A 3PE1A 5KHWA 3Q9YA 2G15A 3PG1A 4IADA 4PDSA 1S9IA 3RMFA 5EFQA 5FTOA 5GJDA 1L3RE 3VW6A 3W16A 4EYJA 1HH8A 3RAKA 5EX3A 4S33A 4AG8A 3RKVA 2JGZA 2G01A 5KUPA 2R64A 3QTUA 1OGUA 2B4SB 4IFGA 4U79A 4CFNA 3CXWA 4NWMA 5IG1A 3CK8A 4ID7A 3EN7A 4NUSA 3DA6A 3MPMA 2BRHA 2X4ZA 4HOSA 2QO9A 2XKFA 3MFTA 3QTSA 4IJPA 4M97A 4ZLOA 4EHZA 3FAAA 4Y5QA 5EHYA 4QTBA 3HDNA 2UZWE 3BGZA 3LMGA 4QPSA 3SA0A 3F2NA 3R9HA 2B1PA 3KL8A 4BI0A 5B2MA 2EXCX 1ZLTA 4GYOA 3QQHA 1FBNA 2WTKB 3E8CA 1JKSA 2JFLA 4W4VA 4AS0A 5I5ZA 3VAPA 2KULA 1PXIA 2WMQA 3ZSHA 1OL5A 5KZ0A 2J9MA 3UDBA 4ARKA 4F1MA 4AFEA 2GFCA 4D0WA 1ELWA 2C5XA 4LOQA 4KBKA 2H9VA 5AIRA 5EQYA 3AT3A 2V55A 2QVSE 3HNGA 1PYXA 2I0VA 3EWHA 3O71A 3EIDA 5I3OA 3SV0A 4LI5A 1CSNA 4IB1A 4CMUA 3G0FA 3LY7A 2X39A 5E4HA 3FY0A 2C5OA 3R63A 5AR5A 3ZMMA 4GK2A 5EDRA 3EQBA 3CPBA 1PXMA 1OPLA 3EFLA 3SGCA 4QMSA 4DBXA 2YWVA 3KAEA 2I7QA 4YBKA 2ETKA 3R7YA 4Y6WA 3EHAA 4KRCA 4MXZA 3QD3A 5AA9A 4Y6CA 4ZLYA 3AQVA 3BV2A 3MFUA 3EQCA 4C0TA 2QU6A 3UIBA 3ASFA 4R8QA 5M44A 1IHGA 2GHLA 4FE2A 4UZDA 3HMOA 4HW7A 4QMQA 3D0EA 3WBLA 3SAYA 5M57A 1AGWA 3EL8A 1JVPP 3BHVA 3PUPA 1FPUA 3DXQA 4IZ5A 2X4FA 4K11A 2A27A 5CSXA 2X8DA 3HRBA 4V04A 2WTVA 2G1TA 3FI3A 4RC2A 5A4QA 5LWNA 3Q15A 4ASXA 5CT0A 4G3FA 3H9RA 5CAUA 4BKJA 3IOKA 3E3BX 3MV5A 4UXQA 2ACXA 2FUMA 3FEGA 3EN9A 5JRQA 4O7SA 4RIXA 4UI9C 1B38A 2C6KA 3FMNA 4E4NA 5CAOA 3CEQA 1GIHA 2JDVA 4UB7A 3ZFYA 4XUFA 3W2RA 5CAQA 3OUKA 1U59A 2WHBA 3RPSA 4CRSA 5LVPA 3OXZA 2LSUA 2YERA 3LCKA 4EH8A 3QBNA 2F57A 3P1AA 4M67A 3E8NA 2UVZA 2WD1A 4CGAA 5IQFA 3NEWA 5GJFA 5KE0A 4YVQC 5M07A 5GJGA 3I60A 4AGWA 4YNEA 3GOPA 4YP8A 4DGLC 1W98A 4GFMA 3AS8A 4ANBA 3NDMA 4F6SA 5LMBA 1YXTA 3R1SA 5K4JA 5B7VA 3WXXA 4X7QA 4AAAA 3KA0A 4BCKA 5ACKA 3SF4A 2VTAA 4IX6A 2R3GA 3NW5A 3NIZA 5M51A 4AZSA 2H8HA 1J1BA 1YKRA 3D7ZA 3Q9WA 1OBDA 5DR2A 5LVNA 4TT7A 3VS6A 4MAOA 4YNOA 3Q60A 3VS3A 2WIHA 2AYPA 4OTPA 4R6VA 2OG8A 2W06A 3CY3A 5HX6A 3MBLA 5IQAA 4IEBA 3NCGA 4HZSA 1MQ4A 3MV3B 3BZ3A 2LNIA 3HKOA 4NKAA 3R21A 3RHXA 4F7SA 5CU6A 2IO6A 4BCJA 3NF1A 3LXNA 3PIZA 4AWIA 2UZNA 2YWPA 4JR7A 4Q9SA 3W33A 4E5BA 5L6WL 5A54A 4Z7GA 2WAJA 3FBVA 1YXXA 1R0PA 3FE3A 2E9OA 1OPJA 4D28A 1Q41A 4MF0A 3LCOA 1U4DA 1BL6A 2GQGA 4EH4A 1A48A 2NNWB 4EQFA 4E4XA 2XM9A 4W8EA 4DH1A 3TI1A 4C02A 1ZMUA 3URZA 5EI6A 4CLJA 5ACBC 2QCSA 2W5AA 3ZTXA 3IOPA 3QALE 3L8SA 2JBPA 3AC5A 3BHYA 3KY2A 1H08A 5AUTA 4BL1A 4YR8A 1Q8UA 1EH4A 2BRNA 2HAKA 3S2PA 4MXYA 2BRBA 2HYZA 3TIYA 4DH3A 1KT0A 3VTXA 3VS5A 4GU9A 2FB8A 3TKHA 3ZS5A 3QLFA 4KSQA 4IM3A 3R8UA 4PDOA 4U40A 3MB6A 5D7VA 4UY9A 2UZDA 2J50A 1GZKA 4PMMA 3U4UA 2CHLA 3SOAA 4D55A 4BCIA 1M52A 3QXPA 4JA9A 1Y8GA 4I5HA 5EM8A 1HZ4A 2VYIA 5HQ0A 5ARGA 3C13A 3EOCA 3CGOA 2VO3A 3PXFA 4NH1A 3W1FA 2ONLA 3ZDUA 2BCJA 2VWZA 3TNPC 1H1QA 5CVGA 4EOKA 1P2AA 4E6AA 5BUIA 1X8BA 2W9ZB 3SOCA 1Q99A 3TTJA 3V8SA 4MXOA 4G1TA 4OLIA 4MEDA 5BVOA 3CEKA 1OL6A 3W8LA 4YPSA 3CGFA 1OIYA 3EN4A 3F2AA 5CAPA 4U0ZA 3ITZA 4KXKB 3T9TA 2RFDA 2PVKA 3QQLA 5FQDC 4AOIA 4EWHA 3TN8A 4XMOA 3PVWA 5DIAA 3BGPA 1KUTA 1Q97A 4EQCA 5A4EA 2JFMA 2X6EA 4AZTA 3GC7A 4W9WA 3LKMA 4FYOA 4TWNA 5HD7A 3AS5A 3MVJA 5K0KA 4N3AA 3RM7A 4WG5A 1M7NA 1VEBA 5AUZA 2W1DA 5EOLA 5CSWA 4AXAA 5G04J 2X6DA 3MTLA 3C0GA 3NAYA 4YC6A 5EKQD 1YOLA 2RG6A 3OG7A 3OT3A 4KIKA 4QPAA 3V3VA 3PPKA 3V8TA 4H58A 4CFMA 1U46A 4UYNA 5IUHA 4NT4A 2UW8A 5FG8A 3TKUA 3LXLA 4BC6A 5JMSA 2R7IA 2BVAA 4MWIA 1SNUA 4RMZA 4WA9A 3ZLXA 4NFMA 4IWPA 4BRXA 2CKPA 2XNBA 4PMTA 5C01A 1ZY4A 5HO7A 3LAUA 3FSFA 5T3QA 1OKVA 4XP3A 3WZKA 4I5PA 1XWSA 2BUJA 4FEXA 4X2NA 4HVSA 2XRWA 5EYCA 4NCTC 3AGLA 4XG8A 4FV8A 5A3XA 4I6HA 3SXFA 1E9HA 1YHWA 3ZXZA 4A4XA 2XJ2A 4A7CA 3KXNA 3BEAA 3DJ6A 3OW4A 2PMNX 3OXFA 4AW1A 3TG5A 2PE0A 4FK6A 3LFEA 1H0VA 2ERKA 3O96A 3OXIA 4FX3A 5FTPA 4QMOA 3FZSA 5I3RA 3FV8A 2VTJA 2Y4PA 1NVQA 3PJ1A 4G3EA 4ANOA 3CVPA 4JX3A 2KC7A 2B9FA 3G15A 4UQYA 2XEYA 2BHEA 2R3FA 2QU5A 4DG3E 3CJGA 3TXOA 4IX5A 4GA2A 3N9XA 4LMNA 1PXKA 2O65A 3IDCA 4XRJA 3Q96A 3LM5A 4YJNA 3MH3A 2NO3A 1WCCA 3P7AA 1YI6A 2LAVA 2G2FA 4Q2AA 3GOKA 2YZAA 4EK3A 4FKRA 4FI1A 3UMXA 3MN3A 4R78A 4WKQA 4GL9A 5K5NA 2JAMA 2GU8A 5DLSA 2J2IB 4FKWA 4R7IA 4IQ6A 2Y4TA 4BYJA 2C4GA 4EOJA 5M4FA 4I21A 4NTSA 5HD4A 3AXWA 4AP7A 3WF9A 4L44A 5H8EA 3LLTA 3WYXA 4P2KA 3G6HA 2GSFA 2PVNA 3SC1A 3UP7A 5HVKA 3CTJA 2YIXA 3ORKA 4ASDA 2B52A 5CYIA 4PNKA 4YMJA 3TUDA 2GNJA 2WMVA 2Y4IB 3GFWA 4I6FA 2HY0A 4RIYA 4CKIA 2XM8A 1WBOA 5AM6A 1SYKA 1ZYDA 4LRJA 3R7GA 4TKSA 2BMCA 3OTUA 5AUVA 3TNWA 3MI9A 2NRYA 1TVOA 3MDYA 4V01A 2KTYA 4X6QC 3KF7A 3V5WA 4TNDA 4PTCA 3TM0A 3KQ7A 4ZTMA 4QD6A 4J8MA 5JEBA 4FVRA 4BCPA 4RX7A 5CF6A 4J95A 4D2SA 2A1AB 3L9LA 2XNEA 4YC3A 3LFDA 4AX8A 5LXMA 4QP7A 3CLYA 5CQUA 2IF4A 4RVTA 2Z02A 2GPHA 4MWHA 2V5FA 2WU6A 2QNJA 1VR2A 2GNHA 3EMGA 4D4VA 5G05C 2UW9A 1UV5A 2PVFA 2EB3A 2YHVA 3FHRA 2ITZA 1JQHA 2A2AA 4WNEA 3E92A 4DGNA 2ZDUA 3MH1A 4IZAA 2ZM1A 4RVMA 2ZM4A 4BBFA 4FKQA 3HX4A 4CYIA 5L8LA 3BBWA 2IZUA 2JAVA 3KGAA 3F5XA 3OF0A 5EQPA 4RJ7A 3DBQA 3SKCA 5BUEA 2XK6A 4PX6A 5EM7A 5CENA 3EJ1A 4LM5A 4LL0A 3I5NA 3PWYA 5E91A 3R8VA 2YLEA 1KV2A 2HCKA 3B8QA 4OT5A 3MFRA 4RPVA 3GU5A 1DM2A 5B2KA 3GQLA 4M69B 4RX8A 3HUBA 3LOKA 4GIHA 3WIGA 4MTAA 3QZIA 3UOLA 1RQQA 4TWPA 4NJ3A 2A19B 3HP2A 3QZHA 5IDPA 1CMKE 3UGCA 5D0QD 1Y6BA 1BUHA 3DT1A 1MQBA 1PF8A 3QLGA 3ZPJA 4FV6A 4FYNA 5TE0A 5HBEA 5HIDA 4C62A 4FEVA 1SVEA 3DBDA 3R8MA 5JN2A 3HLLA 4IAAA 1OIQA 5EDPA 2GTMA 3UJGA 2CGVA 1KOAA 4EZ7A 2KCVA 2GNFA 5IA0A 1VJYA 4E6QA 3OBJA 3LHJA 4EH2A 3LXKA 4ACDA 3CKXA 4J97A 4DFBA 3RPVA 4TYIA 4FZ6A 4FT5A 1R39A 4B7TA 4DLJA 5HICA 4KWPA 1WBTA 5IMEA 3R7VA 1IRKA 4GKIA 3V5PA 4D1SA 1CKJA 2ZYBA 5KJLA 2L6JA 3OROA 4I94A 2YACA 2VV9A 1JSTA 2BDFA 3HGKA 4WNFA 1U54A 2V7AA 3DJ5A 2GDOA 2X8IA 2WO6A 3AMAA 1CDKA 2C6TA 3EFKA 3V6SA 4UQXA 1G8SA 3ORXA 4PTGA 5ARFA 4JL9A 3ZUVA 3EB0A 3F3WA 3ENMA 2DUVA 3QWPA 1PXJA 4U0UA 4ZTLA 3GUBA 3E87A 5A6OA 2CKOA 2PMLX 3EN5A 5CI6A 3E3PA 3NZ0A 3PE3A 4C3RA 4LGHA 4UX9A 1ZY5A 5L4QA 2X7OA 4LV5A 4GJ3A 5AWMA 2E2BA 5HBHA 1ZARA 5GNKA 3KXGA 4E4MA 4ZS0A 3CV0A 5DEWA 3T9IA 4BDCA 4FKOA 5CSPA 4HVGA 2ZMCA 4RIOA 2P4IA 3QD4A 4GU6A 1GZOA 4RVKA 1BI8A 4UQZA 4G31A 2ETRA 3G33A 1QQEA 2C68A 2C5NA 4QYFA 3LFBA 4U07A 3I4BA 4OTQA 5TOZA 5K9IA 3VS0A 2OJJA 3W18A 4NW6A 2R3MA 4KRDA 4D0XA 3FL5A 3PTGA 3PJ8A 4PF4A 4FL1A 4D9TA 3A61A 3NNUA 3L9PA 5F94A 5TF9A 4ZSAA 2VQ2A 5AR8A 3HDMA 4DGMA 4PPBA 4BHNA 3OXTA 3F3ZA 4CTBA 2ITTA 4IC8A 5FZQA 4QMPA 2JIVA 2W1GA 3C9WA 4OT6A 2UUEA 4O84A 3VS2A 3LKUA 3E8EA 2EXEA 4QNYA 4UXLA 5EOBA 3QHWA 4U3YA 3FXZA 3ZLYA 4CFUA 3UQ3A 2VTMA 4ZTSA 2PVJA 2WQNA 3DOGA 3UOHA 2ZMDA 3VUKA 5KHXA 3UPZA 2F4JA 3D9VA 2WQEA 2XBAA 3QF9A 1Q8YA 5L3AA 5J5SA 2H34A 3D2KA 3OWPA 2QONA 5LCWJ 4ITHA 1PKGA 2I40A 3GW4A 4L01A 2PQNA 5L8KA 4U5JA 5E8ZA 3I7BA 4FNYA 2Y8OA 2UZVA 1K2PA 4RJ3A 2WNTA 4I41A 5KMLA 2XK4A 5HVJA 3KK9A 4IANA 3L8XA 3QFVA 4EORA 1E96B 4QQCA 3F7WA 1WBSA 5DRBA 2YM3A 4MX9A 5ANJA 2BILB 3AOXA 3ZRKA 5M53A 2WQBA 5AUWA 2XGOA 4NQ0A 1KOBA 5HTBA 4K33A 1OPKA 4JI9A 4XG3A 3M1SA 5AP1A 4PP7A 2Z7RA 3CQWA 1V1KA 3D5UA 2FYSA 3ORZA 4KIQA 3OWJA 2J0MB 4MD8E 4RGJA 3VS1A 3UODA 3OS3A 2PMOX 5HG9A 4BGGA 5IISA 1A06A 3A8WA 3FMLA 2XNPA 4O6LA 4QO9A 3WZJA 5DNRA 5KKRB 2OZAB 3N71A 1APME 2XNGA 4U45A 2XYUA 1JPAA 2ITXA 3BPRA 3R9AB 1J7LA 1E1XA 3O17A 3SD0A 2YDKA 3PY3A 5CU0A 4GA1A 4J8DA 1RE8A 2Y4UA 4YGAA 3B8RA 4FNXA 4O0YA 3O0GA 4WBBB 2J0JA 5IA5A 1MUOA 4JA7A 3RGFA 5LVOA 4QYEA 3H0ZA 4UMQA 3KU2A 5EK7A 5FXRA 1XJDA 3P86A 5EYKA 3ZZWA 2IJMA 1UU9A 4DF3A 4E7WA 1GIIA 2XIYA 1JOWB 3E7OA 2Y0AA 4YZBA 4XLIA 3C1XA 2CNQA 4H36A 4H1JA 3ACKA 4UZHA 4EH9A 4FICA 3GZ2A 2WEVA 3CY2A 3IECA 3BIZA 4H05A 3FZ1A 2FGIA 3CKBA 2WIPA 2XBJA 2UW0A 5DR9A 2UVYA 4B6LA 3EKKA 2MHKA 4BWKA 5G6VA 4WD5A 4WBOA 3RCJA 3BHUA 2PY3A 3R7EA 5FTGA 5CNOA 1AD5A 5FZSA 4RIXB 3K3JA 4HGLA 2G2HA 4MF1A 4DFZE 5M06A 3QX2A 4RA4A 4EUUA 5HE1A 4L7FA 2PZRA 3FHIA 3GGFA 3OWLA 3TKIA 3H9FA 3U9NA 5C8NA 4NTTA 3FQEA 4LRKA 3HZTA 5HHWA 5D41A 2XIXA 2FH9A 3F3UA 4DEHA 4BY9E 1WVYA 4NCTA 1UU7A 4FZ7A 3ZUTA 3OHTA 4WUYA 3VO3A 4DFNA 4U0IA 3R7IA 5IA1A 3TZ8A 1OKYA 4KUJA 1Q3DA 3KK8A 4TYHA 4GVAA 4QRCA 1IG1A 4JDJA 2PZ5A 3BEGA 4IWOA 4CKJA 2DQ7X 4NRHB 2E9UA 3OY3A 4B0GA 1I44A 3H0YA 4YHFA 5IH6A 3CKCA 1J7IA 4TNBA 3QRKA 4I2WA 5EW8A 5D0OD 3A4OX 5J8IA 4FZAB 4DEAA 2WTJA 4AW5A 4G24A 3QWJA 3LMHA 5LCJA 3D5VA 3PFQA 4CG9A 3QHRA 1Z57A 3QA8A 4RG9A 5F95A 4F65A 4WNKA 4O86A 4WSQA 5HLNA 3I6UA 2BROA 3BI6A 4BDEA 2R3JA 3ESKA 5JFVA 3GZ1A 4DEIA 2ITVA 3CBLA 2CSNA 4FSRA 4YJSA 3AC3A 4O0XA 4OGRA 2BFYA 4JQ7A 2O2UA 5CLPA 4E6CA 4K0YA 4BCNA 3KXHA 2IPXA 2EB2A 5M09A 4ORKA 3UO5A 3PY1A 4J8NA 4G9RA 4I1ZA 4JDHA 4X2GA 3RJCA 4I9EA 3HUCA 1STCE 3PSBA 5EG3A 2R3OA 2HW6A 3DGKA 3LPBA 2V62A 3QC9A 4XJ0A 3BHTA 3QZFA 4ZTQA 4YLJA 3QKKA 3UQFA 2NC9A 4S34A 5M4UA 4ENYA 4FKIA 5CASA 4RIWB 4LOOA 3LW0A 2QOBA 3QTIA 5AIKA 3Q53A 3IW7A 3QYWA 3ALOA 4FG8A 5DT4A 4C33A 4DG0E 4D1XA 3S00A 5DIZA 4N4SA 3QA0A 4PPCA 4EK4A 5L6OA 4Q5EA 3LFFA 3O2MA 3ZONA 4I22A 4AM9A 4OUCA 3WE4A 5LWMA 3RO2A 4X3FA 4JQEA 1Y8MA 3NUXA 3THBA 2WOUA 5ITAA 4UI9J 2WFYA 4WUNA 3QCQA 4UV0A 2C0OA 2VRXA 4YURA 4RWJA 3RK9A 2BDJA 4IVDA 5C4LA 4WNDA 5KMMA 3DFAA 2CCIA 2AUHA 4WUAA 3SX9A 3KS2A 2JITA 1UWJA 2GHGA 2QOQA 5E8UA 5AP2A 5AUXA 4GUBA 5BVEA 4BCQA 4IMYA 4M3QA 2B54A 5KBQA 2C30A 2OBJA 5FZRA 3KN5A 4NM5A 4YNDA 4APOA 3SZ7A 3F3TA 3LVPA 4Y5HA 1UVRA 3BEEA 1NA0A 1UNLA 3BYOA 4YJVA 2X2MA 3D7TA 5DVRA 5CSVA 3RJVA 1QCFA 4X21A 1P4OA 4FODA 4GIIA 2YJSA 1P5EA 3HV7A 1CKIA 4TXCA 3SRVA 4AOTA 1A17A 3WI6A 4R3CA 2XK7A 5EW3A 3CKWA 3UPVA 3MVMA 4YLLA 5E7RA 2C1AA 4IN3B 1G5SA 4F6WA 3LFQA 4EWQA 5KJKA 2HYYA 4HGEA 1IASA 3F6XA 4I0TA 2VWBA 4Q9ZA 5FJYA 1H28A 4GK3A 5FEEA 3ID6C 5AP3A 4ZTRA 2WEIA 3G51A 4GH2A 3QAME 5EHLA 1VYZA 4CTCA 3QUEA 2PPQA 4F1TA 4I24A 2HR2A 5AV0A 4RX5A 2O63A 4QMYA 4EH6A 3VWAA 4AUAA 4YHJA 1DS5A 1M2PA 3D15A 4G9CA 4YBJA 2YEXA 4L3PA 3HA8A 2X7FA 4C36A 3PA4A 2LSVA 2YAKA 1H1RA 5L2IA 4HYUA 5C1DA 1DI9A 2Z8CA 4ZSEA 5HESA 1OB3A 3P23A 5FD2A 2WTKC 4ABNA 5IQCA 3D94A 3ZO4A 3QOUA 3CVNA 3LJ2A 3OZ6A 3FQHA 5LARA 3DZOA 4TYJA 4BDAA 1UNHA 3GP0A 3IGGA 3NYNA 4O81A 3NUNA 4ZSGA 1PXPA 3FSKA 4M7IA 4BVUA 1H07A 3ZGQA 3C50A 4IB3A 1XHAA 2B9IA 2RSVA 3N51A 4J7BA 4TTHB 5HIBA 4AA4A 3UVQA 4F9YA 5KMKA 2BUGA 3F5PA 3M2WA 4XBUA 3ROCA 5JJ7A 3PJCA 4IX3A 4F3VA 3R9RA 3S7BA 2UW3A 4JLCA 4RJ8A 3TV6A 4BCGA 2UY1A 4A9UA 1IA9A 3MB7A 3MSSA 1XBAA 4HCTA 1ND4A 2XIRA 3GCQA 1LEZA 2IW9A 1Y57A 3UQGA 3IDPA 4C61A 4FGRA 4O6EA 3W32A 4AY5A 4O82A 4QT1A 4BBEA 5IQIA 3ORPA 4UN0C 1SNXA 3WZUA 4KABA 3AC1A 5AV2A 1KT1A 5JK3A 5BMMA 4F9WA 2YABA 4BYIA 2QOFA 2R9SA 5HE2A 2Z2WA 4K9YA 3ASDA 4GCNA 3IKAA 3Q2MA 2W7XA 1YWNA 4RRVA 3TDWA 4F08A 2PZYA 3P7CA 3UPXA 3F7ZA 5KJMA 3RP9A 2GMXA 3EQFA 1OL2A 4BF2A 3KD7A 5C8MA 3QKLA 3PXZA 4BTFA 3BKBA 1NVRA 3MY0A 1ZZ2A 5JT2A 5IUGA 1PXNA 1URCA 1Y8YA 3DPKA 4HNFA 5CF5A 1O6KA 2XGSA 3S7JA 4I92A 4RIYB 4ZMFA 3GCPA 4CEGA 3CQUA 3MY5A 3ZBFA 3PXKA 1BI7A 4YO6A 5BMSA 3MVHA 4APCA 3H9OA 3PXRA 2XH5A 3GU7A 4JBVA 4E5WA 5K5XA 2OICA 3L1SA 3LFSA 3PIYA 4MBJA 3ZH8A 4DEBA 3ZHEA 3U3WA 3GENA 1YXVA 4UBAA 4ZXTA 5AP5A 4RJ5A 4DG2E 3EQHA 4G3GA 2QURA 3T8OA 4QMWA 5BVKA 2VZ6A 4GZ6A 2PUUA 4Z3VA 4GG7A 3VF8A 5DBXA 3VUHA 2FEZA 4N6YA 3FMMA 4GYYA 3LYAA 4PRJA 4QYHA 4AOJA 2IZSA 4I6BA 2YIRA 4GRBA 4QP3A 3V5JA 3K5VA 3HECA 4E6DA 1JWHA 4WT6A 1W0XC 5D7AA 3EZRA 3FKLA 5L2QA 3BLQA 2OJGA 3CPCA 4D2VA 3HMIA 3LCTA 5IQHA 3OOMA 1NVSA 3BQCA 4BDDA 2FO7A 3TZ9A 2WTIA 3A7GA 1W84A 1Q3WA 4HOUA 3VBQA 4AY6A 4QP9A 4BFMA 5AP4A 3GC8A 4S31A 2UZUE 3QQGA 5M4CA 4N39A 1YI4A 3GI3A 2JDOA 4DE4A 3R2BA 4QTAA 2P0CA 4QQTA 5JZJA 4WRGA 1R1WA 2YCSA 3DDQA 4CMOA 3VF9A 4UI9K 4A9SA 4M12A 2OJFE 4TZRA 4BZOA 2ZB1A 2ITOA 3RNIA 5GIOE 4U9AA 4F0GA 3PLSA 4UWCA 2R3RA 4EJ7A 5KMOA 5IMXA 2PE2A 4USEA 4QPMA 2XCHA 2J0IA 2EXMA 3PP1A 2XIZA 2WPVA 4RLKA 2BTRA 1OL7A 4O22A 1ZYCA 3QUPA 2V7OA 5HE3A 3VBTA 4CGWA 5FUTA 4IAZA 2OKRA 4FR4A 5IPJA 4NYEA 4MNEA 4XCUA 5AAGA 3PRFA 5D11A 3P5KA 2FO0A 5FDPA 3JYSA 5JGAA 1YWRA 3EN6A 3PP0A 2ZVAA 3QD2B 4GCOA 2QQ7A 3F82A 5AAFA 4BTKA 2UVXA 4C57A 3MA5A 4I93A 2C0MA 3QGYA 4FGBA 3LIJA 4GV1A 5J5TA 4CDRA 2IZTA 3DS6A 4IE9A 3LZBA 2JIIA 3AD6A 4G25A 4BWRA 3UOJA 2JC6A 4FSZA 4XG4A 3NUAA 3QRTA 2WQMA 1PMEA 4TW9A 3D4QA 3EQIA 3OMVA 3O7LB 3R22A 4W9RA 4L3JA 3Q47B 4Y46A 4BCFA 2OFVA 3VW8A 5L8JA 4DCEA 5I4NA 2VTTA 3OFMA 3FJQE 4YC8A 4U42A 2JBOA 2VGXA 3EQDA 3QKYA 5EX0A 1T45A 4BKZA 3O23A 4BT8A 2B9HA 3Q4UA 4OTHA 2VTNA 1Q62A 3FP3A 1KWPA 3G9LX 2EUFB 4BCMA 4EC8A 4FKUA 5I9ZA 1M2QA 5HI7A 4ZS4A 2Y6MA 1H26A 3OVVA 4XS2A 5TT7A 3RU0A 5G05J 3A62A 3FPMA 4M68A 4FTRA 4Y95A 1UA2A 3IW5A 3UVRA 4DFUA 4DTAA 2HELA 2QOOA 2XZSA 2AC5A 4HOKA 4N2QA 3LCAA 5CS6A 3TJDA 1W3BA 1YDTE 4ZP5A 4CFVA 3MVLA 4D4RA 1LEWA 4NIFB 3LJ1A 5DRDA 3TNQB 3DXNA 4CRLA 3FMJA 3SQQA 1ZAOA 4FSMA 4XG7A 4J8EA 4IDTA 3VUGA 4I17A 2JKQA 1QPEA 5HE0A 4ZK5A 3NMUF 4FL2A 5H8GA 4NEUA 4A9TA 2Z7SA 3UIXA 3VHEA 4O91A 4EQMA 4XOZA 3Q49B 5AP0A 4GEOA 4EKLA 1IAJA 4DTBA 4C37A 4HOTA 3HYHA 3I81A 3B2TA 4NK9A 1GAGA 3BU3A 3HRCA 3FI4A 3OW3A 4YPDA 3TCPA 2QKRA 4GUEA 5GHVA 3R8LA 3UNKA 2DBAA 3HAVA 3ALNA 2VTPA 5H9BA 3BYSA 2GHMA 5H3QA 3GB2A 4O7NA 4I23A 4FV3A 4FTUA 4Y85A 4C38A 3C7QA 4O7WA 1F3MC 4XLVA 3A2CA 3NNWA 4BIEA 2F9GA 3PG3A 2XKCA 4JOAA 3W2SA 3ULZA 1WZYA 2BDWA 2Q0NA 3RAWA 5LQFA 4R3RA 4P5QA 3HMPA 2PTKA 2YN8A 3BE9A 2YM6A 3OY1A 1XH8A 4PP9A 4U0SA 4U8ZA 3HV5A 2B0QA 4N3CA 5EW9A 4XRLA 4KNBA 3KRWA 4U81A 4JRVA 3R7OA 4ZEGA 1H24A 4GZ3A 2X9FA 4PV0A 2YZLA 5D9HA 4RG0A 5BYZA 2CMWA 4DGGA 2I0YA 2J0LA 4PY1A 1OM1A 4AT3A 1GJOA 4FTNA 5J7BA 3BYMA 5AX9A 3QWVA 3CCNA 2VWUA 3H4JA 5AX3A 5GZ9A 5H2UA 4CT1A 4R77A 1R3CA 3ORLA 5BNWA 1VZOA 4YUQA 2IWIA 1WVXA 4II5A 3MV2B 3MWUA 1WAO1 4G5JA 3C4XA 5TO8A 3ASHA 4HJOA 4RT7A 5CEMA 4RVLA 3Q6UA 2HWPA 4HPUE 5I9WA 3F3VA 4I3ZA 3ZOSA 4LG4A 1M2RA 2C0LA 3CK9A 3PA5A 2B7AA 1PJKA 4YZCA 3VN9A 1OKZA 2UZEA 3ENHA 4O2ZA 1ELRA 1HXIA 3QTWA 2KCLA 1OBGA 5HQ8A 1QL6A 2C0TA 4HCUA 4KIOA 3EQRA 1E1VA 2E9VA 4R7HA 3G6GA 2Y4IC 2JD5A 3BU5A 3VJOA 1YDRE 3F2RA 3W2CA 3LQ5A 3KXXA 3PDNA 1W7HA 3Q04A 5BYLA 3ZO2A 3CD3A 3PVBA 4G23A 4JL0A 4O96A 2PL0A 2OJ9A 5CVHA 4AF3A 3V04A 2UW7A 2GNLA 3RZBA 4QMZA 1Y91A 5K4IA 2W9FB 3FC2A 3G0EA 2GS2A 2NRUA 3NAXA 3R1QA 5IU2A 5J1VA 1YRPA 1ZZLA 2QKWB 4EQUA 4KYOB 3TV7A 4FV4A 4DAWA 5CANA 2RGPA 3U51A 3TWJA 5CALA 4G5PA 4DFLA 5KX8A 4MYGA 4GKHA 5EI2A 3HV6A 4OAUC 4AW2A 2OH4A 3HV4A 4ZOGA 1OECA 2FSTX 2X9EA 3Q5ZA 5FBOA 4C35A 1DAWA 1FVRA 4TYHB 4C8BA 4ZTNA 2XGMA 4G3CA 3OEFX 2WKMA 4A9YA 4B99A 2WQHA 2WTWA 2B55A 5AV3A 2HZNA 3A7HA 4LOPA 2OXYA 2RG5A 3ZXTA 4WG4A 3MIYA 2VO7A 2QOHA 3PWDA 3PZEA 4HNIA 1WFCA 4IAFA 4RWKA 4E5AX 4XBRA 4F09A 4PUZA 3U6JA 1MP8A 1QPJA 1ZOGA 2W1CA 3C4EA 1WVWA 4FVQA 5A7DB 2ZDTA 4P90A 4HORA 4GVJA 3F66A 4JNWA 1NA3A 2JEDA 1CKPA 3DAJA 3Q9ZA 4M8TA 5CI7A 4DINA 3LCDA 3KXMA 3KXZA 5HG8A 4I9CA 2ZJWA 3GCUA 3R28A 2GCDA 2I0EA 1KE9A 2PU8A 2ERZE 4K2RA 4BTMA 4EBWA 5ETIA 1FGIA 5JSMA 1SMHA 5I9XA 4EYMA 3Q4AB 3KMWA 5LMKC 4N6ZA 5CU2A 3VBWA 2PQRA 2NP8A 4XV3A 4GG5A 3MJ2A 3DBFA 3S4QA 3ZEPA 4P4CA 3PVUA 3KRLA 4D2RA 1WBPA 2PVLA 2WZJA 1MRYA 3COIA 3DKFA 3PJ3A 5E8WA 3N4VA 4EOQA 4JX7A 1O6YA 4NU1A 5EQEA 4B8MA 3BWFA 5L2TA 3DLSA 4U97A 3W2PA 2I6HA 2X0GA 1JBPE 3BE2A 1CTPE 3BCEA 4R1YA 5IQBA 3GC9A 3JYAA 5FGKA 4JBQA 4K77A 5JGBA 4GSBA 4MQ2A 5EHOA 2GS6A 1FOTA 2WMBA 1H27A 4LGGA 4N57A 3REPA 4BB4A 4X3FB 2O8YA 4ZSJA 2QI8A 3FQSA 1WMKA 2J9QA 3FZOA 3QZGA 1JNKA 1YDSE 2WMXA 2W5HA 4M66A 5HCZA 3V51A 5F4NA 4ALVA 5L2SA 3Q6WA 3IS5A 3C4CA 4V0GA 5CEIA 5BVWA 4UMTA 1KE6A 5CU4A 5A6NA 3MYGA 4EZ5A 2WXVA 3D2IA 4TYGA 2XP2A 3CS9A 4U6RA 5J9ZA 4BTBA 3H10A 3FL4A 4QP1A 3SDJA 1TJCA 3CVLA 2BZHB 1V0BA 2QOCA 2W96B 3P7BA 4NFNA 3RALA 3JVSA 4C4HA 3IQ7A 3HEGA 5CSHA 1NZNA 5DEYA 3LFAA 5AP7A 1Q5KA 3QCXA 4J71A 5JRSA 4CT2A 4C3PA 4UMPA 3QTRA 4H3QA 2R3KA 4LV8A 4OR5A 3SRVB 5G04C 3OC1A 5JJTA 1JAMA 2J5EA 4TN6A 2IFUA 4A4LA 4A9RA 4F7JA 4G17A 3UYSA 1TQIA 3FY2A 4S32A 4MK0A 4D1ZA 3NUYA 4CKRA 3KCKA 3KMUA 1PXLA 2FA2A 4FV9A 2C6EA 3RZFA 4YTHA 2XEZA 5ICPA 1BMKA 3AT4A 1YHSA 5LVLA 3UOKA 2PZIA 3W2QA 3P08A 4JJRA 5IEVA 5IH4A 1JKKA 3GBZA 4BBMA 4ASEA 4FSTA 3IPHA 3AGMA 1FGKA 3VVHA 1FQ1B 4BWPA 3PY0A 4NL0A 2VWXA 3E88A 1FCHA 3I1AA 1REJA 1UWHA 4BZDA 2BALA 3AC2A 2J6MA 4ZSLA 2VNWA 4AZWA 3MIAA 5JZNA 5J87A 3G2FA 3GFEA 1H25A 2JIUA 3LQ8A 4AA0A 5J9LA 4AE6A 5KCVA 2X7GA 4F7NA 4C4GA 5HNBA 1QMZA 3TGOA 4RC3A 1OUVA 2O64A 4L00A 5HCYA 2O5KA 2VN9A 4KAOA 3DJ7A 2OIQA 2BKZA 2W1HA 5T68A 3K2LA 3NRMA 3QTXA 4IC7A 4JG6A 4JAJA 1Q8TA 3MEKA 1IAHA 1G3NA 2BAKA 2UY1B 4DHFA 2R4BA 4RJ4A 3VJNA 4BDBA 5KKRC 5HO6A 2R3PA 4G1WA 2VTQA 3RM6A 2C6OA 4I0RA 3T3VA 4I5CA 5GIPE 3VHKA 4DTKA 4R7BA 3RAHA 2OF4A 4J53A 5B0XA 3OWKA 1MRUA 1OKWA 2QR8A 2WPAA 4E93A 3RHKA 3VS4A 1H0WA 4GJ2A 3HMNA 3FPQA 4E1ZA 4GYWA 1ATPE 5ETCA 2BIYA 5EH0A 3ZCLA 5GZAA 3PLAE 4ZJJA 1QZ2A 4CQGA 3VUMA 4RWIA 1PKDA 4AIFA 3OEZA 1SVGA 2WU7A 1ZOHA 4ONAA 5G1XA 2PE1A 3BQRA 4KBCA 4DT8A 4A4OA 4EH7A 2BZIB 2WTCA 4FTTA 4DH7A 3LY9A 3CIKA 1ZU2A 2XKEA 2P58C 2BAQA 2ZV7A 4FKGA 5EI8A 2FSLX 3EZVA 2QOKA 3RVGA 4JVGA 3D83A 4F0IA 3K9IA 1FINA 4JHRA 3NVKI 2Q83A 3SLSA 4H7XA 3EL7A 4KKGA 4ITJA 4N0SA 4BIDA 4BTJA 2RF9A 3PZHA 4ANSA 4KBAA 4CVAA 3FKOA 2QHNA 3RINA 1OIRA 4CZYB 4ACGA 3BWJA 2BPMA 4EL9A 5HTCA 4AW0A 2YIQA 2J4ZA 3E93A 2VX1A 3FMDA 4U7ZA 4Y83A 4F0FA 2FVDA 4AGUA 5DMZA 3LPZA 3ZHEB 2I0HA 4IHPA 4GT5A 5FEDA 3D5XA 5IA3A 3BBTB 4HOQA 4YZMA 3ODZX 3TAXA 3A7IA 4QMNA 2SRCA 5IKWA 3PE2A 4FNZA 2W4OA 4C3FA 4M0ZA 4ITIA 3FWVA 4X2FA 4KA3A 2W4JA 4QQJA 2CLQA 2WMRA 3QRJA 2R0UA 3TV4A 3IW6A 3ZUUA 4WNPA 4MBIA 2XEVA 4U43A 4EUTA 4RZWA 4BN1A 2ONDA 4YJQA 2XYNA 3E7VA 2YCFA 3EQPA 4BCOA 3ZLWA 4CV8A 2H6DA 2J90A 4UALA 5A14A 2R5TA 4V05A 3W2OA 3S1HA 4FC0A 2XPIA 4PDPA 2FSOX 5FRIA 2DYLA 3ANRA 3BYUA 3FYKX 2QR7A 5C9CA 4ZIMA 2ITQA 4EZ3A 1F0QA 3ZFWA 3FYJX 4WO5A 5M55A 5JKGA 2BR1A 5CF8A 4YU2A 2YHCA 4OTIA 4BGQA 4H7YA 1ZYLA 2CKQA 3DY7A 4JRNA 2WELA 1IR3A 2CPKE 3ETAA 3VUTA 1ZBPA 4OTRA 4LL5A 2JKOA 3A99A 2GQRA 2J5FA 2RFSA 5E92A 2CN5A 4QQ5A 1V0PA 3QDNA 3WARA 1YOMA 2J7TA 1FVTA 1I09A 4CLIA 5M56A 2HXQA 4BDHA 3Q3BA 5AUYA 4J52A 4MNEB 4L53A 5FP6A 1XBBA 4YO4A 4G2VA 4PL3A 1OITA 3QCYA 1ZXEA 1H1PA 1JSUA 1J1CA 4JT3A 4FT7A 3UQCA 4C7TA 5HNIX 4XV1A 1BYGA 3V5QA 5CEPA 3DB6A 1YQJA 2FSMX 4QMMA 3T3UA 4Z7HA 5LOHA 4IBMA 2Q7FA 4N2SA 3CD8A 5IQEA 4GZ5A 3RPYA 2RIOA 3I79A 2UZOA 3RNYA 4U3ZA 3CK7A 5LMAA 2B9JA 3JVRA 4EOLA 4QMLA 3ET7A 3MA3A 1REKA 3NVMB 3UVPA
chains in the Genus database with same CATH superfamily
4RA5A 4MXXA 2XS8A 4AZVA 2AXZA 2Z7LA 2R0IA 3B2WA 5C26A 2VTRA 3K54A 3VTYA 4M14A 3IG7A 3OBGA 2HZIA 4PTEA 2PYWA 3U66A 2IVTA 4Z16A 3UNJA 1VLRA 5ENTD 1PC2A 4AU8A 4D5KA 3CSFA 2QC9A 4F99A 5ENSD 4P29A 1TQPA 5KZIA 1W82A 3DQWA 5E1EA 4FG7A 1Q4LA 4FKSA 3PJ2A 4FSUA 5E8VA 2LUHA 3CK7A 5HG7A 4BI2A 3D9PA 5FDXA 3MKRA 3DAKA 4YJRA 4MD7E 2ITUA 5CNNA 1KZPA 3TXMA 4BKYA 2G2IA 3WZEA 3EUVA 4G8KA 4JMQA 1RW2A 3ORMA 3OOGA 3U9CA 2IQCA 3LXUX 3T8MA 4ILIA 3UIMA 3AS4A 3TL8A 4XV9A 4C0MA 5CWZA 4F6UA 5E8XA 2PSQA 1UKIA 3RPRA 2XCKA 1OWPA 2AVPA 3EKNA 3QQKA 4O7YA 4CGVA 4IVCA 5D12A 3E34A 2DZNA 4F7LA 4W4WA 3V6RA 1KE5A 1RW8A 4AXEA 2WOTA 3NW7A 2F2CB 3ZSGA 2YITA 3L22A 3FMKA 1GIJA 2YDJA 4KKHA 4UWYA 3F61A 2GW1A 3DXMG 2I6LA 4FKTA 4EOMA 3ANQA 3QQJA 5DT3A 3MPTA 3BLHA 1O9UA 4L45A 3KF4A 5DR6A 4FIGA 3R8ZA 2IW8A 2BFXA 3F5GA 3NWWA 4MKCA 4GFGA 2ITNA 4FBXA 4MCVA 1W83A 1H2TC 3ULIA 5F1ZA 4IACA 2P3GX 2C6IA 3DK6A 3RWQA 4HVDA 1FT1A 3FLYA 1QBQA 4MD9E 3QRIA 2V5QA 2A4LA 2QG7A 4GTMA 3ULQA 5IQDA 4B8CB 1XMMA 1S9JA 2BKKA 3VRYA 3ZFXA 3QTQA 1Y6IA 5AEPA 4QEBA 4Y72A 5JQ5A 3D14A 4F9AA 4ATGA 2RKUA 2BIKB 3Q5IA 3NS9A 4YJOA 4V0GB 3HVEA 3JR1A 3U55A 3W8QA 4C4FA 4XG9A 5K0XA 4DHJA 3R01A 2QOLA 3D9MA 2H96A 3FUKA 4IAYA 3ML8A 2IW6A 4NJDA 4KKEA 1E8XA 4HGTA 3W9FA 2YCRA 3P4KA 1N4QA 3EYHA 2YM5A 3DSXA 3IKOB 3AC8A 4RIWA 3PSCA 4AT5A 2R3HA 4OBOA 2R3LA 3AC4A 2UW4A 4I5MA 3ZU7A 3RIBA 2EIJE 3CVWA 5KBRA 4ERKA 4EOIA 4KSPA 3NYXA 3KULA 3OP5A 2FO1E 2XS0A 3EFWA 3G2UA 3VUDA 4RC4A 4D2PA 1TQMA 4QP2A 5HORA 4F7AA 1X5BA 1OIUA 3NR9A 3KSLA 2JLBA 5DT0A 3ZRMA 3NUPA 3FMHA 4FEQA 3IK3A 3FUPA 2C0IA 3SFXA 5HVYA 3ZYAA 2VJ8A 4C34A 4DDGA 2WMUA 2Y0BG 4I2ZA 1WBWA 2H6IA 3ASOE 4FMQA 4K03A 3O8UA 3GU6A 3TG4A 3KRXA 3RKBA 3QKMA 5ENRD 4H1MA 3ZKJA 4EK5A 4O0UA 4FTAA 4ASZA 3APFA 3GC0A 3QYZA 4FT3A 4O7TA 3LQ3A 4X6RA 4XHKB 3R1YA 3WF7A 4FTQA 3DXKG 2IVSA 2UWJG 4LYNA 5EIBE 4USDA 3FUDA 5JGDA 3NNVA 4TWOA 3QQFA 2X0PA 3A7FA 4M84A 4Z55A 2MOWA 2R05A 4GT3A 1P4FA 5EIDA 4F70A 3TTIA 4ZTHA 2EWAA 2GNGA 4YZNA 2CGXA 2GFSA 3PNLB 4J96A 3HRFA 3MY1A 2OXDA 3F5UA 2WQOA 3ONLA 4RBLA 3Q4ZA 2RKKA 3RWPA 4HZRA 2OU7A 4CZTA 3CTQA 1UN8A 5I0BA 4DX1A 5A4CA 5FLFA 1N9AA 3P0MA 3EH9A 3J5PA 3W9GA 1YHVA 4AAYA 3FU3A 3HMMA 3R1NA 2C3JA 3QRUA 2PWLA 3QTZA 5AP6A 4FIEA 1DVPA 4BDKA 3AJIA 1H2VC 5DOSA 4IWDA 4BVUA 3CVYA 3P78A 1PMUA 4JQ8A 5KNJA 4HYHA 3R2YA 2PVMA 3KCFA 3VRZA 3L16A 2ZU6B 4YJTA 4JBOA 5CTPA 5AA8A 3P5JC 1UU3A 4N70A 4G26A 3QWKA 4ACCA 4K18A 2VWYA 4JDIA 4ZJIA 4D58A 4CCUA 4HVIA 3BHHA 5FQ4A 4R3PA 4GPKA 1H6KA 2C3LA 3HA6A 3JXJA 4O0SA 3U6HA 1OGYA 4FV2A 3GCVA 4I0SA 1J3HA 3QXOA 3FTUA 2ITPA 4XIFA 2WQ7A 1SZAA 3QL8A 3O8PA 2ZXWE 4DC2A 4YDYA 2VAGA 5ANOA 5D10A 3RI1A 4GT4A 5FQ6A 1WBVA 4ZY6A 2QD9A 3PXQA 4J99A 4TXRA 4QYYA 3E5AA 3X2QE 5KMNA 1TYQG 2R3QA 4B8AA 5CHEE 4JXFA 3HXDA 4O4BB 2C3IB 4G6NA 1ZYSA 5DFPA 2B53A 4UYAA 3WE8A 4CNHA 4O0WA 2Y9QA 3R7RA 4NM0A 2JLDA 4RFZA 5ENPD 3Q2JA 5BUJA 2OZOA 3LMIA 3FZTA 2X2KA 2OXXA 2FF4A 5CVFA 4Q5HA 4TYEA 1EF1C 2CHWA 5HEZA 3EQGA 1Q8WA 2W1ZA 3UIOC 3LXPA 4QMXA 4EBVA 2HWOA 4RSYA 3MH2A 2AEGA 2UZLA 2WGJA 4HLEA 3RK7A 2CG3A 3ZM9A 4C59A 5J79A 5GZ8A 4XEYA 5FTQA 5C4KA 4O0VA 5IUIA 2W1EA 3R30A 1TKIA 5K3YA 2VTIA 3MKQB 3VQHA 2IN6A 2AC3A 5LP0A 5LCWC 1N0RA 5IDNA 4L8MA 5HNGA 4R1VA 2PUIA 4AA5A 5LMKA 4Q96A 5A4LA 3R0TA 3RBWA 4I20A 5AUUA 1L8TA 5E8YA 1HCLA 3MGYA 3PE4A 5FM3A 5C27A 4LUDA 4FA6A 4TWCA 4XI0A 1ST4A 4H3PA 2WXQA 1E8ZA 4DA5A 2QG5A 2GROB 2OIBA 4I43A 4EC9A 4PMPA 5BX0A 1TNYA 4DPRA 4DHIB 3I6WA 5KHWA 3PG1A 3VW6A 3RKVA 2JGZA 3QTUA 2B4SB 4OVUA 4NWMA 3CK8A 3EN7A 2X4ZA 2QO9A 2XKFA 4IJPA 4JB8P 2UZWE 3ULEG 1MX4A 4QPSA 3SA0A 3F2NA 2B1PA 3KL8A 2WTKB 4W4VA 4AS0A 5I5ZA 3VAPA 2KULA 1OL5A 4AFEA 1HG5A 1BD8A 2QVSE 1PYXA 4DG0E 5I3OA 3EIDA 3SV0A 2A5UA 3LDZA 5E4HA 3CPBA 1PXMA 1OPLA 3SGCA 4YBKA 4Y6WA 4KRCA 4MXZA 3QD3A 5AA9A 4Y6CA 3AQVA 3BV2A 2QU6A 1MHQA 2GHLA 4HW7A 3HMOA 2AXUA 4JHKA 1A5EA 3EL8A 1JVPP 3PUPA 2X4FA 3HRBA 2WTVA 3FI3A 4UXQA 4X8QA 4E4NA 5CAOA 3CEQA 2JDVA 4UB7A 3ZFYA 4B93B 3W0SA 3OUKA 4Z68A 1TNUA 3LCKA 3QBNA 4FC8A 3E8NA 5M07A 3L82A 5GJGA 4AGWA 4DGLC 3OAWA 4GFMA 3AS8A 5LMBA 5K4JA 5B7VA 4WWNA 3TWQA 4BCKA 3Q9UC 2R3GA 4AZSA 1S70B 1YKRA 1OBDA 4MAOA 3Q60A 2V4HC 2WIHA 5HX6A 4HZSA 1MQ4A 3KSQA 3LXNA 4TRQA 2UZNA 1E8YA 4JR7A 3W33A 2WAJA 1R0PA 4MF0A 4EH4A 3FDHA 3TI1A 3URZA 5ACBC 3IOPA 3NZUA 3AC5A 1H08A 5AUTA 2HAKA 3FTZA 2HYZA 2L0TB 2FB8A 3TKHA 4R7LA 3QLFA 3QK0A 3R8UA 4PDOA 4U40A 2UZDA 4EHMA 3U4UA 3QXPA 5EM8A 5ARGA 3C13A 3CGOA 3ZDUA 3ESLA 2BCJA 3TNPC 1H1QA 3SOCA 4MXOA 1YCSB 4MEDA 3W8LA 4YPSA 4U0ZA 3ITZA 3T9TA 4EQCA 5A4EA 3GC7A 5AQ7A 4FYOA 5G04J 4AXAA 4YC6A 3OT3A 3V3VA 3PPKA 4CFMA 5FG8A 3BG1B 2R7IA 4WA9A 4BRXA 1ZY4A 2WXMA 3PS6A 1JCSA 1OKVA 2BUJA 4FEXA 2XRWA 5A3XA 4I6HA 1YHWA 5KNGA 1OWLA 4A7CA 3S2AA 3TG5A 3O96A 5FTPA 4DT8A 2Y4PA 3PJ1A 4ANOA 3CVPA 4OVVA 2KC7A 2QU5A 3CJGA 3Q96A 3MH3A 1WCCA 1YI6A 3HXCA 4ACKA 2Y4TA 5M4FA 3UIPC 4MRUA 5HVKA 4PNKA 4YMJA 4LRJA 2NRYA 2KTYA 4RX7A 5CF6A 4D2SA 4YC3A 2XNEA 5LXMA 2IF4A 2WU6A 1UV5A 1JQHA 4IZAA 2ZM1A 2ZM4A 4CYIA 5EQPA 3F5XA 5BUEA 2XK6A 3EJ1A 4LM5A 4HRLA 2GRQB 4RX8A 3HUBA 4GIHA 3UOLA 1RQQA 5IDPA 5D0QD 1Y6BA 4FYNA 5HBEA 5HIDA 1BLXB 3HLLA 2GTMA 2ETAA 2KCVA 2GNFA 5IA0A 4E6QA 3OBJA 3CQCB 4FJYA 1JSTA 2BDFA 4WNFA 1U54A 2C6TA 1G8SA 4EBAA 4PTGA 4JL9A 3ZUVA 3EB0A 3ENMA 4U0UA 3E87A 3SO8A 4UX9A 1ZY5A 5L4QA 4LV5A 5AWMA 1ZARA 5GNKA 5DEWA 3T9IA 4ACLA 4RIOA 4UQZA 4G31A 1QQEA 4QYFA 2R3MA 4FL1A 3NNUA 2VQ2A 3L9PA 4PPBA 3UKRG 3F3ZA 4CTBA 2ITTA 4O84A 5G2NA 3VS2A 2EXEA 4QNYA 3FXZA 2PVJA 5KHXA 2F4JA 1Q8YA 5J5SA 3OWPA 2QONA 5LCWJ 1PKGA 4U5JA 3I7BA 2Y8OA 4I41A 4IANA 4EORA 3F7WA 5HTBA 4K33A 4JI9A 3CQWA 3VS1A 3OS3A 2PMOX 3WZJA 3R9AB 3BPRA 5CU0A 3PY3A 4J8DA 3B8RA 4O0YA 3H0ZA 4CT0A 2CNQA 3BIZA 3FZ1A 2WIPA 2UVYA 3EKKA 2MHKA 3CGHA 4WD5A 3RCJA 3CIAA 2WXNA 3BHUA 3HXFA 5CNOA 1AD5A 4RIXB 2B6CA 1IXVA 2XIXA 4BY9E 4DI4A 4FZ7A 4DFNA 3R7IA 4KUJA 1OKYA 3QJZA 4TYHA 2ILRA 4CKJA 2E9UA 4FZAB 4AW5A 3QWJA 3D5VA 4CG9A 3QHRA 3I6UA 2BROA 3BI6A 3AC3A 4HRNA 5CLPA 2IPXA 4BCNA 3UO5A 3PY1A 4CDNA 4XJ0A 3QZFA 4YLJA 4S34A 5CASA 4RIWB 3LW0A 5AIKA 3QTIA 3QYWA 4C33A 1N52A 4D1XA 4PPCA 3ZU7B 4I22A 5LWMA 1Y8MA 3NUXA 3QCQA 2BDJA 4IVDA 4WNDA 2GHGA 4GUBA 2B54A 2C30A 3HXBA 4NM5A 3F3TA 3LVPA 1UVRA 5DVRA 3UM1A 1YMPA 4X21A 1P4OA 1P5EA 3HV7A 4AOTA 4TXCA 4WAFA 3WI6A 4R3CA 2C1AA 2DYSE 3CHOA 1IASA 4I0TA 2VWBA 5FEEA 4GH2A 3QAME 1VYZA 3QUEA 4F1TA 4QMYA 3ZYMA 1DS5A 1M2PA 1OCZE 2LSVA 3HA8A 4C36A 1Z6TA 5L2IA 1HF8A 1W2CA 5C1DA 4ZSEA 5FD2A 3ZO4A 3OZ6A 3T9KA 3FQHA 5LARA 4BDAA 3NUNA 4ZSGA 2B9IA 2RSVA 3UVQA 5JJ7A 3M2WA 4XBUA 3PJCA 3DSVA 3S7BA 3MZLB 4BCGA 5CEAA 1IA9A 2XIRA 4KZCA 1LEZA 3UQGA 4C61A 4O6EA 4AY5A 4QT1A 4GMRA 3TDWA 3F7ZA 3RP9A 3DEOA 5C8MA 3QKLA 2X6KA 5JT2A 2XGSA 4HNFA 5CF5A 1O6KA 4I92A 3CQUA 1BI7A 4YO6A 5BMSA 3MVHA 4APCA 3H9OA 3PXRA 3GU7A 4E5WA 3PIYA 3B95A 1G8KA 4UBAA 5AP5A 4RJ5A 4DG2E 3EQHA 4G3GA 2QURA 3CR3A 4ANXA 2VZ6A 4GG7A 3VF8A 5DBXA 3VUHA 4GYYA 3LYAA 4QYHA 2NSZA 4I6BA 4MKTA 5D7AA 3FKLA 5L2QA 3B7BA 3BLQA 2OJGA 4BDDA 2FO7A 3TZ9A 4HOUA 4QP9A 5CBOA 4QTAA 4QQTA 4WRGA 3DDQA 3TWWA 4TZRA 4BZOA 2ZB1A 2ITOA 3PLSA 4EJ7A 5IMXA 2PE2A 4USEA 2XCHA 3PP1A 2WPVA 1VDYA 4O22A 1ZYCA 5HE3A 4FR4A 4NYEA 2HM8A 4XCUA 5JGAA 1YWRA 3EN6A 2UVXA 4I93A 3QGYA 4FGBA 5J5TA 1NI1A 4G25A 4BWRA 3UOJA 4XG4A 4ILGA 1PMEA 4TW9A 3R22A 3E30A 3Q47B 3VW8A 4DCEA 2VTTA 3OFMA 2JBOA 2VGXA 1T45A 4BKZA 4OTHA 3Q4UA 1ST0A 2VTNA 5I9ZA 1M2QA 3A62A 3FPMA 4FLHA 4FTRA 4FP7A 3ASNE 3UVRA 2QOOA 2AC5A 1YDTE 3LJ1A 3DXNA 3FMJA 4J8EA 3NMUF 4FL2A 2Z7SA 4EQMA 5AP0A 4EKLA 3TWTA 4NK9A 4YPDA 3TCPA 2QKRA 2DBAA 5H9BA 3BYSA 2GHMA 4FV3A 4Y85A 4O7WA 4BSXA 2XKCA 1WZYA 2Q0NA 3RAWA 4R3RA 4N3CA 5EW9A 2YZLA 1JPLA 5BYZA 5CRVA 5J7BA 3QWVA 3ABKE 3H4JA 4CT1A 3RRUA 3PZDA 4R77A 1R3CA 4YUQA 3MV2B 3C4XA 5TO8A 3F3VA 4LG4A 2B7AA 4YZCA 1ELRA 2C0TA 3EQRA 3G6GA 3VJOA 3F2RA 4ATZD 3KXXA 1W7HA 2PL0A 2GNLA 5K4IA 2W9FB 3U51A 3TWJA 4DFLA 4BFRA 1JCQA 1OECA 4JW1A 4C35A 1YYHA 4G3CA 3OEFX 4BSZB 4B99A 2HZNA 2OXYA 4WG4A 1WFCA 4E5AX 4XBRA 4F09A 4FVQA 2ZDTA 3F66A 1NA3A 2JEDA 1CKPA 3Q9ZA 4I9CA 3KXZA 3R28A 2PU8A 2ERZE 1FGIA 5JSMA 4EYMA 3Q4AB 1KZOA 4N6ZA 3VBWA 4XV3A 3DBFA 2WZJA 4UWGA 5E8WA 5EQEA 4B8MA 3BWFA 3DLSA 2X0GA 5IQBA 5FGKA 5EHOA 1FOTA 3REPA 2J9QA 3QZGA 2WMXA 4ALVA 5L2SA 2DYRE 1KE6A 2WXVA 4B0ZA 5J9ZA 3H10A 3FL4A 3JVSA 3IQ7A 3HEGA 2DCPA 3LFAA 1Q5KA 5JRSA 1G8JA 3QTRA 1HU3A 4TN6A 3UDZA 2AW6A 4A4LA 4K0RA 4G17A 1D9SA 1TQIA 3W0RA 2FA2A 3AT4A 2VTBB 4BBMA 1FQ1B 3PY0A 3E88A 3I1AA 4BZDA 4J8YA 3G2FA 2JIUA 5J9LA 3TGOA 4RC3A 3DJ7A 2EQXA 1IAHA 4DHFA 5KKRC 5HO6A 4XE0A 2R3PA 4G1WA 3R7QA 3RM6A 2C6OA 4E93A 3RHKA 3HMNA 4A63B 1ATPE 2BIYA 5GZAA 2IOSA 1PKDA 4AIFA 4EH7A 4FTTA 2I1KA 4I6EA 2XKEA 2QOKA 3RVGA 3SLSA 4KKGA 4BTJA 3BWJA 4AW0A 2YIQA 4AGUA 4JD2G 4JPSA 2EIKE 3A7IA 3DEPA 4ITIA 3FWVA 4QQJA 2CLQA 1HO8A 4MBIA 4EUTA 4YJQA 2R5TA 3ZYLA 2F37A 3FYKX 5M55A 5JKGA 4BGQA 3ETAA 2JKOA 2GQRA 5CMWA 2J5FA 2RFSA 3JUEA 3V5QA 4QMMA 2FSMX 4GZ5A 2UZOA 2B9JA 1REKA 3UC3A 2DWZA 4R5SA 1GZ8A 3LLAA 2OO8X 5EKOA 2XNMA 2ONLC 4RX9A 5CXZA 2PL2A 3QU0A 2XB7A 4FV5A 4M69A 3DNDA 4RQIA 4W8DA 2WMAA 3D9HA 1K9AA 4PWNA 2E2EA 3PPJA 2RFNA 4B89A 4AGCA 5CERB 1M17A 2W1IA 2VTLA 3OXGA 4MHAA 3KRRA 4HRMB 1PRYA 2O0UA 1PMNA 3FLNC 3NUUA 1H19A 4QTCA 4L52A 5F9EA 5D1JA 4JAIA 3KMMA 2XCBA 5IF1A 3VQUA 5HLPA 1ZWSA 4QTEA 2DIWA 1SZMA 2YM4A 4M0YA 1H1SA 2VWVA 4GMYA 2XANA 1OUKA 3G2SA 3FWQA 1NY3A 1O6LA 3U4WA 5BQ0A 4GMJA 2UZTA 2ZFYA 2HOGA 5DH3A 3H3CA 3IXEA 1LPUA 4C0EA 5FP5A 2XARA 4PDYA 3JY9A 3UP2A 4GTSA 3L9MA 1ZB1A 3ZDIA 2HZ4A 4KD1A 1H00A 3OCTA 4PMSA 4AQCA 2QO7A 3UO6A 3DSUA 1XKKA 3R8PA 3V5LA 4PNIA 3CTHA 3BGQA 4IB5A 2VWIA 3G90X 3TUCA 3II5A 4TRLA 4DX2A 3QX4A 5T3RA 3A4PA 5BVFA 2VNYA 3ZZEA 2OFUA 3UMVA 4FTKA 2VSNA 3COMA 3UIUA 1FMKA 1ZMVA 4RLLA 4DDIA 2F7EE 3SHEA 2Y1LE 2XRUA 3HP5A 3ZXPA 2CN8A 1K1AA 3HYMB 3SXSA 3ZSIA 3C4FA 2XRZA 2WMNA 4AN3A 3FZPA 4WNMA 4WIHA 4DT9A 3K3IA 1U54B 2VO6A 4DEEA 5AMNA 3NGAA 5DG5A 2XA4A 4W4XA 4L67A 3DK7A 5TR6A 1MQSA 1FPPA 2YDIA 1NP7A 3ZLSA 3AG3E 5AAEA 2DWBA 4RWLA 2VGEA 3TEIA 4D2WA 3PRZA 3O48A 1NL4A 2XK3A 4L2YA 1DAYA 2VX0A 4W9XA 4M15A 3CVNA 3SD5A 1XO2B 2YA9A 2KATA 3OCGA 4HFGA 4ERWA 3ASGA 4NM7A 4BZNA 1M7QA 4O83A 3PA3A 5EKNA 4ZAUA 4NZWB 1IA8A 5AIJA 2UZBA 5HI2A 4CRWA 5IA4A 2BTSA 2J8SD 4OW8A 1O1TA 3Q32A 2JKMA 4MXCA 4APFA 4AZFA 3IONA 4OBQA 4DLIA 2E9NA 4E3CA 3SQVA 4FOBA 2XKDA 5AJQA 1FVFA 4GYIA 3AT2A 4FKPA 3EFJA 4UMRA 2ZV9A 3DCVA 2HY81 3Q4CA 2Z7QA 3VBYA 3BRBA 4ZZMA 4JG7A 3DSTA 2C3KA 1URWA 5KO1A 4B8LA 3DFCB 4JG8A 2IVUA 5H8BA 1T46A 5DYJA 4G2FA 4S30A 3EJNA 2OOEA 4R5YA 4APPA 1Z3YA 3OCSA 2YM7A 1HCKA 2J51A 5TKDA 2OK1A 4O1PA 4D4SA 2XEHA 5DHJA 3ZC6A 4GZDA 3SVVA 3MESA 4DCAA 5HLWA 1RDQE 4FKJA 4DX6D 3SBTB 5HO8A 2GNIA 4LGDA 5H7PA 2DS1A 3OTVA 2YCQA 2RD0A 3GYZA 5J7HA 4CCBA 5ANEA 2WXJA 4PPAA 4ANUA 2R3IA 1HS6A 3VULA 3AD5A 1Y6AA 2OW3A 4EKKA 3ORTA 4IZYA 3ZYKA 4FSNA 4M13A 5I9UA 3ZHPC 3BX5A 4GA0A 2KBXA 5BNJA 4EHGA 4WRSA 1XH7A 4O2PA 4FG9A 4WNGA 5ANDA 4CYJA 4I4FA 4YTCA 5E90A 4N3BA 5FIOA 4BR3A 5HCXA 2W1FA 4IW0A 1ZMWA 2QLUA 4LUEA 4XV2A 4L46A 4A07A 4E73A 4QDEA 1BX6A 2OCCE 2VTHA 3Q79A 2VO0A 4O4FA 2WB8A 1LTXA 3S7DA 4C48B 1MX6A 3U6IA 1XH5A 4EH5A 5D2MC 5E1SA 4OAVB 4IFCA 3AMBA 3EHQA 5KCMA 4H3BA 5ETAA 4XNEA 4IVBA 3PXYA 2VD5A 2C69A 4FIHA 4FIFA 4MH7A 2AQXA 1JSVA 4IVAA 5CEKA 4MVFA 1PY5A 3FC1X 2VGOA 4EOSA 2F0YA 3ATSA 1XMLA 3JY0A 1Z3XA 4IAKA 4I6QA 3RTPA 4ME2A 5ETFA 3VUIA 2R3NA 1BI7B 4YJUA 2X8EA 3DZQA 3BQOA 4FUYA 2O3PA 2OI4X 3UKUG 4PH4B 1SW6A 3V01A 1XH4A 4X2KA 3SG8A 4DN5A 5B1BE 4ZLZA 3AU5A 3R6XA 1W8CA 3R71A 4OTFA 1NXKA 4UMUA 3AG1E 4AGDA 2A5EA 4G6LA 1HE8A 1PYEA 1SA4A