2PZKA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
SHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 107
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzkA00
2OORA 3RKUA 3H9UA 2NQ8A 1D7OA 3JCZA 1I3MA 3DHYA 1GUYA 3DQPA 4L8VA 4HWKA 4UVEA 3K2EA 4J4HA 5AVOA 3VH1A 4IDDA 3D5QA 1MXHA 1NPDA 1IULA 3PJDA 1C0KA 1IL0A 3BMCA 3ZN2A 1EFLA 3ZNPA 3QRWA 4NBUA 4CM6A 4R3WA 2OZPA 1DOHA 1DO8A 4E31A 1T2DA 2NQTA 1YOVA 2Q2WA 4BNWA 4YYZA 2I65A 5TT0A 2GN8A 5L95A 1M67A 3EVNA 4BNGA 3MOIA 3WDSA 1TLTA 1QLHA 1LQUA 2IODA 1E3WA 4TZTA 4FPXA 1M6HA 4ND3A 3GH3A 5TQVA 5A06A 1X7HA 1DC4A 4JROA 4DIFA 4YR9A 2AE1A 1QYXA 1V8BA 1KVSA 3RC2A 3EC7A 3RC9A 3FPLA 4L4SA 2IEDA 4WCFA 2FPPA 4M8SA 4WE3A 2QZZA 3Q11A 5CG1A 2H9IA 2EW2A 4MINA 2WTBA 4NFHA 4WLFA 1EQ2A 4XDZA 2OO5A 1W4ZA 4LMPA 4S1VA 2HSDA 2I6TA 5AXCA 4PLHA 3JYQA 1Q0LA 3ONFA 2HO5A 5C7LO 3FNFA 1DAPA 1MC4A 4YPOA 3UN1A 5IFLA 3NDRA 5ILGA 1B26A 5TNXA 3RU9A 3KUXA 4B3HA 2CF6A 3PZRA 2NVWA 3GPIA 4Y9DA 4IPTA 2DFDA 2Q45A 3GUCA 4LGVA 2HKIA 3VZSA 2JAHA 1N8KA 5KVCA 5BQFA 1YBAA 1C1XB 1B7GO 2WM3A 4NQZA 1IOLA 5FI5A 3PP8A 1YB5A 3QWAA 2NADA 3DTTA 5L7YA 1EFKA 2QG4A 3O9ZA 4J90A 3S55A 4BO4A 1E3IA 2ZTMA 1C1DB 2AE2A 3GLQA 2Q99A 2F00A 1K6IA 5BSEA 3G0OA 3AM3A 3R3JA 1WDMA 5A5EA 1ZXLA 4XX0A 3I9MA 5DBFA 1UXKA 3ASUA 1LSOA 4ND4A 1KOLA 3BHJA 1YDEA 1R0KA 1WMAA 4GX5A 3GOHA 4RF3A 5T5QA 3BMNB 1V6AA 1PTJA 3GVXA 4MVJE 1OC2A 4OKNA 4P4NA 5DT9A 5DDIP 2FZEA 1IYZA 5JXWA 4WECA 3MEQA 1NQAO 3P19A 4GVXA 1H0KA 3DB2A 4J2HA 5HTOA 4FB5A 2EIHA 3DEYX 3HFGA 3GHHA 3UHAA 2YQ5A 3HDQA 4B7CA 4CL8A 4BQRA 5T57A 1XEAA 2VOEA 4PVDA 4Q3DA 4QQRA 4AG3A 4FW8A 4EI2A 3ETGA 4DYDA 3A06A 4PG4A 1D3AA 2IXBA 3OEYA 3MCVA 2YY7A 3SX2A 1J0XO 1T1SA 2R00A 3GC6A 5TF4A 3ZI0A 5GMOA 4D0SA 1Q2XA 1ZNQO 4A73A 2J8ZA 3EUWA 1M6WA 2EP7A 3AUUA 4H3VA 3ZW8A 4XRGA 1VSUA 2DC1A 5G0VA 1SOWA 1JVSA 2DPHA 5ICMA 4KWIA 4U7WA 2GDZA 4XYMA 1GADO 4EUEA 1YBVA 5DP2A 5IN5A 5EL0A 2OBYA 1N9GA 1ADCA 4BNMA 2RCYA 3ASVA 2Y99A 3C1AA 1BMDA 5C7OO 1E77A 4I5FA 2O2YA 4FFOA 3L6OO 4PN3A 2PR2A 1P0FA 4OO3A 1XA0A 4AJ1A 1Y9AA 4KMSA 3W8FA 1KBZA 2NWQA 1IB6A 2B36A 1Z75A 3DL2A 4CM9D 2OMEA 3NT2A 3D5TA 4RLSA 3SC6A 1LC3A 5ENDA 1JQBA 1KVQA 3VKVA 3H5NA 2X0NA 3HJAA 2WEKA 3GAFA 3MTGA 1Z45A 2FP4A 5JMWA 1WNTA 1Y8RA 4E2ZA 3GDOA 4A7PA 3C24A 3NTOA 1HE2A 3NKLA 3ANNA 1EE2A 4YQYA 4DUPA 3JQ6A 2D8AA 5EINA 2C59A 1H5QA 4NJMA 4BNIA 4EITA 4F45A 3ZZNA 3RROA 3AWDA 1O8CA 2O7SA 1VJTA 3NDJA 5HWSA 1PS9A 3JSAA 1PGOA 5B4TA 1U9JA 4IMRA 4WGGA 3WNQA 5CDSA 1NBOA 4BO3A 2DBVO 4CMCA 1U3UA 1U3VA 2F1KA 2OP0A 3PI7A 4NK4A 4CV0A 1EBFA 2IZZA 4BMVA 1NASA 1RYDA 2O3TA 5DBIA 4LRTB 2VTEA 4EUFA 3ZHXA 1OC4A 2FWMX 4PLCA 4UVHA 4EDFA 1LSSA 1VPDA 1WP4A 1NFFA 3DMTC 2AQIA 3F4BA 4R9SA 4DQXA 1KEPA 1PSDA 3R3SA 1YL6A 1ISHA 1K0UA 3QP9A 4BB5A 4E5PA 4L9RA 3KYBA 4J7UA 1E1KA 3INTA 2CF5A 2P4HX 4MIYA 5DF1A 2ZB4A 2PZJA 3WJAA 3AY7A 1ONPA 3GG9A 3VPGA 1TT5B 3MJVA 3JD2A 4TKLA 5C5IA 3G49A 4JN6B 3U9LA 2P68A 3TOXA 5BT9A 3VKUA 3B1JA 3VTFA 3SJUA 4DBZA 2X8LA 3D64A 1E3LA 2ZJ1A 3LT2A 3HNPA 1WVGA 1TI7A 2X9NA 1F17A 2Z95A 2B37A 1SEPA 2YHIA 3FI9A 4BO6A 4NH4A 4QFDA 4BNTA 4MKZA 2Y1CA 4QO7A 1TT7A 2B69A 2DTEA 4KQXA 4D44A 1HLDA 1PJ4A 3OIDA 2NU7A 4R1SA 3TL3A 4TMFA 2LDBA 2O3UA 3GMSA 1XLTA 5GZ6A 4MVJI 1B15A 1PX0A 4YT5A 1HXHA 5C7IO 2D4AA 4MVJD 4MVJF 2NM0A 1F14A 4JJIA 4E4YA 1HDGO 3FF4A 1P1HA 1UXJA 3PTZA 1F8GA 3NEPX 1DIHA 4XDYA 2AEFA 1HETA 2VZ9A 4FSHA 1ZMOA 4J1NA 1B0AA 1P1KA 1KVRA 5I9LA 1RM3A 3V1YA 3LLVA 4CMHA 4RVSA 2O50A 4CL3A 3H5AA 4ALJA 2VNSA 4FS3A 4JNKA 2QRKA 3BMOA 2EXXA 4J2OA 1NHGA 4A27A 2Y05A 1H9AA 2G76A 4YT4A 1T1RA 3KLMX 4PLFA 5GY7A 3KRTA 3GNTA 1A9ZA 2UYYA 1ZZEA 4G81A 5JCJD 4Y6PA 5F21A 2POQX 1ZK3A 3STHA 1MX3A 3ZU2A 4MO2A 3E1KA 3FR8A 3U09A 4RPKA 2WJPA 3LSYA 2GERA 1Z73A 2VYND 1R15A 3IIEA 2R6JA 3DOJA 4R1UA 3ONEA 4RF4A 1I5RA 3JQBC 3V1UA 3GVPA 9LDTA 5JSFA 2WWRA 2C7GA 4HADA 2CD9A 2QYTA 3GK3A 3S2GA 4EJMA 2J3KA 4BO1A 4R4JA 3TFOA 4E0BA 4Q3BA 2PLAA 3OJEA 4XGIA 3ZHYA 3W4IA 1QG6A 3C1TA 1N2SA 1LDNA 2IDZA 4PLYA 1TB4A 1QSGA 1GZ3A 1U8FO 2QRLA 2GCGA 3VVBA 1K3TA 1GYPA 2D0IA 1NAIA 2NNLD 2EF1A 2Q46A 5BNTA 3H5RA 3HZZA 4BO9A 1XU7A 2D5AA 1JKJA 3JQCA 3V2HA 1W6UA 5JAQA 3RSHA 1E3EA 2DU8A 1A9YA 4PG5A 4A2CA 1R4MB 1CIVA 1S7CA 4AJNA 5IXSA 3PJFA 3SXPA 4XD2A 2ZATA 2GNAA 3QY9A 4FBGA 1E1NA 4CV1A 4Y67A 1GCOA 1P1IA 3Q0EA 4R5HA 3TZQA 4CLOB 5I7EA 3LT0A 1ISGA 4IDEA 1DAOA 2VHZA 4AJ4A 4P8RA 2J6IA 5K9ZA 4R5MA 1GV0A 3QWFA 4P22A 1SB8A 4HFNA 1XU9A 4R68A 1T2CA 1C1XA 4FC6A 3T4EA 4I5GA 1JKFA 4BNZA 3LVFO 4NG5A 3KYDA 3WB9A 4YJGA 4PG8A 1R0SA 4GKVA 4OIMA 1KC3A 2YZ7A 1QR6A 2Y1DA 2A94A 4D43A 1YVEI 4NU5A 3S8MA 5ITVA 1HTBA 3QLJA 4TWRA 5JFOA 5TIIA 4Z3DA 4JK3A 3G79A 2E82A 1KVTA 3PWZA 4ONEA 5L9AA 1CYDA 3IL2A 1I0ZA 3T7EA 2I3GA 1HKUA 2JD0A 3KSUA 1Z74A 1F8FA 2CDAA 2DUWA 2D59A 1HDZA 2DQ4A 7MDHA 5I9NA 5DN9A 4A03A 1V3VA 5H82A 5KVQA 5ENVA 1GEEA 1YBMA 3A14A 1C3VA 1QYVA 2IXAA 2PWZA 2D5CA 2NU6A 3AUAA 1MFZA 4D3FA 1I33A 4A26A 5JCXA 4QSMA 5K6AC 3JQ9C 1DPGA 5L53A 4YRAA 3S2IA 5IZCC 1U8XX 1DJNA 1XELA 4IJWA 1GZ4A 1V0JA 4JBIA 1N5DA 3FBGA 5IDQA 4E5KA 4IZHA 2J3IA 3PDJA 4RVFA 2W2LA 1SMKA 4OOEA 4XGNA 3M2PA 2ZB7A 2X7HA 2FY8A 1AE1A 1PEDA 3AFMA 3ENKA 5JDIA 2AQKA 4D46A 2X22A 1JAYA 1ORRA 1NFRA 3UCEA 1XGKA 2VYVD 2WYVA 1BXGA 4YRDA 1F06A 2WD8A 3EZYA 1A72A 2I67A 4CM5A 5F1KA 4EYEA 5BNFA 3PK0A 4OOFA 1DIAA 1I2CA 5A9RA 5TGDA 4WCDA 2IZ0A 1KETA 1WDKA 3TOZA 5T67A 2Z1MA 2A9FA 4GQAA 3ZV5A 3W8EA 1YL7A 1Y5RA 1BSVA 1X15A 3FCOA 3NGXA 1E1LA 3QQPA 4L75A 5COAA 1U7TA 1GL3A 3H9GA 1SEVA 4KQWA 5ILOA 5KJ6A 3K9QO 4IIUA 5CEEA 3BTVA 3CZRA 4NR0A 2AEMA 3ZHZA 2W2KB 4O6VA 4NFYA 2NV6A 1DBVO 3A9WA 3LQFA 5KKCA 1O6ZA 2VWPA 4Z9XA 1PWXA 3DOCA 2QHXA 4O59O 5A3JA 2XOXA 4XZ3A 1WMBA 4M86A 4ZD6A 1HYEA 5A9TA 2AQHA 3ANLA 3CMMA 3L0DA 4W9NA 1NTOA 1YQXA 1Z7EA 3EDMA 1MGOA 4TRMA 4IINA 5TJ9A 5CDGA 5IF3A 2QW8A 4ND1A 2HK8A 1P0CA 2XPCA 1P74A 5F1OA 3GVHA 2YW9A 2WSBA 3WG9A 2EWMA 3WTCA 4IIVA 1ZW1A 3PRJA 5JO9A 3WMXA 2VHWA 1EBUA 2GZ2A 1LC0A 2BLLA 3AJRA 3C7AA 4IDBA 5TS3A 1YONA 3PFFA 5G2OA 3HADA 4ZQBA 3IUPA 2DBZA 3L07A 1HEUA 2QX7A 3ENNA 3GG2A 2AMFA 4R3NA 4UAGA 3HDYA 4W6ZA 3TQHA 3CH6A 2X0RA 1PJBA 1EUDA 2JJYA 4FJ2A 4K6FA 1H2BA 4ZQHA 3ZCXA 3AI1A 4CMEA 2YV2A 3DAFA 3QVTA 1DEHA 2NTVA 3GT0A 2G0TA 2PKRA 2VRBA 3HE3A 2I66A 3JQ7B 3PVZA 4MKXA 4Q3EA 4UUNA 4EJ0A 3TSCA 3SEFA 3Q3CA 1F0YA 1JW9B 3ROPA 1DIBA 5B4VA 1QLJA 3ON5A 2O3JA 1LX6A 1VRWA 1M75A 1AGNA 2BHLA 1ISFA 4WLEA 3F3SA 3RVDA 2J3JA 4IQ0A 1R16A 5G0TA 3I9JA 1ZK2A 3I9LA 4W9NC 5FI3A 4D3DA 5A1TA 1EEHA 1PJQA 1MUUA 1NXQA 2AG8A 3KV3O 4AJEA 3ITDA 3EGOA 3WFJA 1D1SA 3B70A 5JYDA 1H93A 1ZBQA 1MG0A 3WSVA 1C0IA 2O2SA 1PQPA 5I8WA 2RHCA 4PIVA 1SOVA 1Y81A 1ADBA 5A04A 5GZ1A 4GGPA 3TF5A 2X5JO 2Y67A 2C2XA 4WJZA 4AJIA 2VWHA 1OI7A 3DHEA 3O38A 1ADFA 4Q3CA 3GEGA 2EHDA 5HM8A 2HDHA 3WGOA 3DZKA 1FDTA 1LI4A 1W0CA 2D2IA 3WLEA 4IQGA 4PLWA 2R00C 1PGPA 4QEDA 4ZJUA 3AUTA 1SC6A 3OQ6A 3DMYA 1U28A 3OP4A 4OM8A 4KTTE 4W82A 1ZVMA 1B3RA 5B4UA 1Q7BA 4Q39A 3FTPA 3WGGA 1E7MA 2PA3A 3GDGA 4XGKA 4YTEA 1DC6A 1PZFA 3HDJA 4ZVVA 5CDUA 4RQUA 1FDSA 4E32A 5JC8A 4TVOA 3CIFA 3GMDA 3ETDA 4ZICA 2VTDA 1Y9EA 9LDBA 1ZEMA 2C0CA 1SO8A 4I9NA 1YL5A 3JQ8B 4EEXA 5FYDA 1QORA 2RHRA 1XCBA 1O0SA 4CM9A 1EUCA 1UR5A 3ROMA 3ONDA 3D4NA 1N1EA 1PGJA 7ADHA 3I4FA 4TRJA 1BG6A 3WGZA 2DFVA 4BIIA 1CF2O 3WICA 1KVUA 3NTQA 1Q0HA 2PTGA 1PL7A 1JTVA 2ZB3A 4ND2A 4I8XA 5B37A 3RBXA 4TROA 4PLTA 2O3RA 3P2YA 5JLAA 6LDHA 1NQ5A 3ST7A 2J5QA 4K9DA 1EDOA 3LC1O 4BV8A 3WIEA 5IAAA 2HMWA 1NP3A 3I23A 3RFXA 1E3SA 1LRJA 3KYCA 1LDYA 4BO8A 4E13A 3Q2KA 5EERA 5DOZA 1E7RA 3DAPA 2IYOA 2TMGA 4BGEA 3HN7A 4U0KA 3ZWWA 4FFMA 2VHXA 4FQ8A 4HX5A 3P2OA 2D3TA 3RU7A 1GUZA 2DT5A 3H9EO 4JBHA 3B1FA 3S2EA 4R69A 2EERA 2O3QA 4CM8A 3GGOA 8LDHA 2Q2VA 3JYPA 2NVUA 5DCWA 2Y1GA 3TZ6A 4N18A 4IMPA 2A4KA 1MG5A 3LDHA 1U3TA 2NTNA 3DFZA 3EYWA 4XWYA 3OHSX 4Z3KA 3ORFA 4WASA 4WCFB 4KZPA 4BV9A 4DL9A 2EGHA 2WD7B 1RJWA 4RPHA 4NI5A 4OJNA 3VOSA 1GV1A 4XJTA 3OICA 1HSZA 3BMQA 4IJUA 3ZWCA 4TQGA 4GI2A 4OQZA 4Z9YA 1E6EA 1NR1A 3H6KA 1N7GA 1HWYA 3HB4X 4DRYA 3EMKA 4YAIA 4CM4A 4UREA 4BO0A 4B8WA 1DDOA 1HRDA 2DKNA 1Y7TA 4EBFA 2Y0CA 4DREA 3GNQA 2E37A 4MVJA 3F1LA 1ID1A 1LSJA 1YOVB 1UH5A 4RVDA 1HDRA 3L9WA 4N5NA 1ADGA 3PLRA 1P31A 3GRKA 4B79A 4E12A 3CUKA 1A7AA 2V65A 4BUCA 4BNVA 4EGFA 2VUSA 1TA4A 1BRMA 1HDCA 3JQ9A 4CQMD 2O4UX 1BTOA 1I10A 3TN7A 1YJ8A 3I4CA 4MP3A 4KUGA 4B4VA 2GUGA 3PIDA 5F5LA 2V6GA 2IRWA 2X6TA 4JBGA 4Q3AA 4WLVA 3AU8A 4I5EA 1P1RA 1H6CA 4WOKA 5IDXA 3QJ5A 1E0DA 3GPDG 3WQSB 2GGSA 3QVWA 1N7HA 2VT3A 5AOVA 1O95A 4B4UA 3JD4A 2FZWA 3F5QA 2VWQA 3I6IA 5JDIC 2FR0A 3I83A 4IDCA 3QW2A 1OAAA 3RC1A 1UAGA 4BMNA 2GSDA 4O5OA 5DZSA 5DP1A 3JD1A 4O0LA 3UAGA 2O4CA 1DRWA 1MA0A 3G17A 5L4SA 3UOGA 1X0VA 2Y93A 1CQJA 3ETEA 2JFFA 3WGTA 4AJJA 4CQLB 2GN4A 4IS2A 2X4GA 2RIRA 1B14A 3VH4A 4CUKA 3ICCA 1LDMA 4B7XA 4TKMA 1LBEA 4W7HA 3MWDB 3OJ0A 4XR9A 3E9QA 1VJ1A 4NZ9A 4UULA 1NVTA 3G1UA 3C1OA 2BKAA 1AXEA 5HS4A 1PJLA 1CJCA 1ONNA 5ADHA 3QVSA 4AJOA 5JAIA 1B2LA 2OXIA 3DZHA 1NHWA 3HWRA 2UVDA 3JTMA 4KUEA 1UDCA 5ER9A 1BW9A 3MOGA 1HT0A 4R01A 5DOVA 4LVUA 3DZBA 4WNIA 3WR5A 2RAFA 5JE8A 1ZCJA 3E5MA 4UVIA 3NV9A 1OZAA 3GGGA 3U5TA 5LCXA 3R1IA 3O8QA 4BO2A 4XEHA 2DAPA 3TWOA 2X5OA 2Q4EA 2BRUA 3Q9UA 5A03A 3B20A 3OETA 4Z0HO 1LDGA 3AI3A 3DWFA 5JC1A 2GRAA 5IXYA 4JJGA 3CE6A 4ZA2A 1DJQA 4PFJA 5JW6A 3KYDB 3I9NA 2ZTLA 3K73O 1E3WB 3W4KA 4Z9FA 2IE0A 4IDAA 2HK7A 1A71A 1QYDA 2CMDA 3C3XA 2BGMA 1H94A 2ZCUA 1I24A 1V3UA 4KDEA 5A5FA 1MLDA 4D79A 2PZMA 3AOGA 1Q0QA 3LT1A 2ZYGA 2QQ5A 5GZ3A 2Q4BA 3PGJA 2PGLA 3E82A 3VPHA 1E5QA 4PGFA 4BGUA 4DGSA 1FJHA 3IP1A 4P4GA 4LCEA 3O03A 4RQTA 3H3JA 3BMOB 1R4MA 5LDHA 3HB5X 1RKXA 3F47A 2JKVA 4HKTA 2PKQP 2H5LA 4Y98A 2J5RA 3IJPA 1GYQA 3NJ4A 1E7SA 1U5CA 4G5HA 5CFZA 3AOEC 3WSWA 2EP5A 2Q49A 1FDUA 4MJLA 1KERA 4M87A 3TFQA 1IPEA 3RUIA 5COQA 3F1KA 5KVSA 2H63A 4O1MA 4DWVA 3QWBA 3IAHA 1CQIA 3CTMA 4GVLA 4CMIB 1DFHA 1AHHA 1D4FA 4GH5A 3DONA 1WW8A 1VL8A 5ICSA 4NBVA 1C0PA 1E6WA 1GPDG 2OGUA 3OSUA 1VI2A 3T4XA 4YAKA 1I2ZA 3I9OA 4MDHA 5CAEA 1YO6A 2W2KA 4CMGA 1XDWA 4KUHA 4J6FA 3JQGB 1E7YA 4HNGA 5T8KC 4D42A 4U5QA 2BFMA 2HLPA 1T2AA 4CQMA 2E6UX 3WYBA 1WAMA 4BKOA 4YACA 1PR9A 1ZUD1 4RCVA 3HHPA 3VC7A 4IGFA 2GN6A 3RFTA 5L4NA 1G0OA 3LZ6A 2IEBA 1ENZA 1LSUA 3GNSA 2EGGA 4Y6SA 2AA3A 3UKOA 4FFNA 4AJLA 4BO5A 1IHXA 4K26A 2YFHA 4OHUA 5B1YA 3BMNA 3M6IA 4YJHA 4AFNA 3V5NA 3VDRA 1Q7GA 4LSWA 2CUKA 1J4AA 4LMRA 2Q1SA 3OECA 2YYYA 2B4TO 2PFGA 2C5EA 4HFJA 4M49A 1UJMA 1U7HA 2Y0DA 2VUTA 3OJFA 1ZKMA 5KTKA 1G6KA 3TZKA 1E7QA 2QRJA 5L3ZA 3DR3A 3ZWAA 1C0LA 4DXHA 3D3WA 3QIVA 1PGQA 3P7MA 4WUVA 1JWAB 1YJQA 3PJEA 4WK6A 5T8KA 5U4QA 4E2WA 1EVJA 4F6LA 1QKIA 2Q1WA 3VVCA 2YQ4A 4M54A 3JQAA 4L4XA 5KWEA 5T6BA 1X7DA 3EHEA 3PJGA 4D3SA 3H8VA 2PH3A 4CR7A 1VKNA 2DTDA 3JD0A 4PCVA 2VYNA 4XQCA 4RZHA 3H4VA 4WLOA 4YWJA 1HF3A 4B4OA 4CLOA 2JFGA 4OXKA 3ZWOA 1EZ4A 5I7SA 3GFGA 3C8MA 3CSDA 3WQQA 1PS8A 2CY0A 1T25A 2DVMA 2C54A 2GO1A 4GX2A 1ZEJA 4CODB 4YJGB 5DNAA 3W6UA 3OA0A 2JHGA 3K6JA 1I3NA 3IJRA 2BGKA 1YWGO 5U9CA 1XQ6A 4OQYA 3DBRB 4FOSA 3MJEA 3H2SA 3H65A 4NNJA 3E9NA 4A10A 5KJCA 3FN4A 3ABIA 1K6JA 3K96A 4RGBA 1LJ8A 1ZK0A 2C82A 3KXDA 4DIBA 4RF2A 4CLXA 1O89A 5KVVA 1PGNA 1QXSA 3OQ1A 4KWHA 4NBTA 3PFWO 2HMUA 5H81A 1BDMA 1KEWA 4JCOA 5A05A 3U4HA 4I9HA 1SPXA 2OP1A 3P5SA 4DMMA 4TRRA 2OFPA 5IDWA 1UXHA 5TSDA 1H6BA 2P91A 4FIZA 4TRNA 3KVOA 4GKBA 3JYOA 3OIFA 1K6XA 1B3BA 4OH1A 1QV7A 4URFA 1HZZA 4OSOA 4ALKA 1UUFA 3PYLA 2WYWA 4GLOA 4NK5A 3O4RA 3RBZA 3OM9A 4XYBA 4YVFA 2HQ1A 5L7TA 1DSSG 3PXXA 3D1LA 3CEAA 4RDIA 2VZ8A 3JQEA 1R4NA 5EIOA 5EJ2A 4ZGWA 3KB6A 5KKAA 4L76A 2FN7A 3PGXA 1P9LA 4CM1A 3WLFA 2PD4A 1MC5A 1OFGA 4B3JA 2GR9A 3VTZA 1K5HA 1YKFA 4J7XA 5JY1A 4L73A 5G0UA 3RC7A 2P4QA 3U62A 3N7UA 3VH3A 1I8TA 1XSEA 5FWNA 5KJFA 4AICA 1PJSA 2GZ3A 1GAEO 4XYEA 4YAGA 1L7DA 4AVYA 5IN4A 3ZWMA 2VYVA 1QP8A 2P9EA 5KJ1A 3N74A 1XR3A 4UUPA 3RUAA 2ZYAA 3D7LA 2UAGA 4DIOA 1UP7A 4NMHA 5TC4A 5JY6A 3GGPA 1H6AA 4PZDA 3QA9A 1LA2A 2X1HA 1A7KA 4XIYA 1VSVA 4D41A 2AQ8A 5TX7A 4P38A 3Q6IA 4BNLA 1B16A 2J3HA 3UVEA 4CMKA 4C4OA 2VRCD 3PQFA 3WNVA 3HFSA 2PZLA 1LTHR 3WWYA 1DC5A 3RKRA 4AJHA 2E48A 3ZWPA 2LDXA 3MTJA 4CM3A 3E5RA 4II2A 3DZJA 4BKRA 4DLAA 4RPJA 3H9QA 3HN2A 4DC1A 2FSVA 3BTOA 1XKQA 4MP8A 4CUJA 1Q1NA 3HG7A 4QUKA 1XG5A 1SB9A 3L4BA 2X9VA 3LK7A 4DVJA 1O9BA 2G1UA 3GEDA 2BD0A 4IUYA 4YJFB 3ZWXA 4DPKA 5BSFA 1RWBA 4JP2A 3BMQB 1ARZA 1H9BA 1WXDA 3PDUA 2O48X 5FFFA 4F46A 3QVXA 1E7WA 4J49A 4QXMA 3TL2A 4NJMB 1LLCA 1IZ0A 2PH5A 2VZ0A 4PLPA 1NYTA 3ZNQA 1EDZA 4BNHA 4U8GA 1RM5A 3MWEB 3WOHA 4MIOA 4GX1A 1RM0A 1JU9A 2DBQA 4XQEA 1GDHA 4UEKA 1D1TA 1G1AA 4J0EA 4BNXA 3WX0A 3VH2A 1NVGA 3AW9A 3JV7A 4HBGA 1EVZA 4N7RA 1HE3A 3RUFA 3UCXA 5BNIA 4KP7A 4HFMA 1VL0A 3IS3A 2ZK7A 3BTSA 3WFIA 1LU9A 1M66A 5K0ZA 3JQ7A 4G2NA 3CPSA 3E18A 1FDWA 4L0QA 3C7CB 4JQCA 4XCVA 4EZBA 4B7UA 1E1MA 2A35A 3M1AA 3GA0A 4RO0A 4WLNA 4CR8A 4S3MA 2Q1UA 2WE7A 4BKQA 5A3VA 3PZBA 3ZWBA 1E92A 4BNNA 3D4OA 3RJ5A 3EW7A 3ZDFA 4F3YA 3UH1A 3JQDA 5CDTA 4QFCA 1ULSA 2FR1A 2FRDA 4R1TA 1DLIA 3L6DA 2A92A 1T4BA 1W73A 4J1SA 4RLHA 2PNFA 4M1QA 4CQMB 1Z6ZA 2GZ1A 1TXGA 4DQVA 1DC3A 3DO5A 5TJHA 5THQA 1M2WA 1FK8A 3WYEA 3JQGA 3DOOA 1QYCA 1M76A 3ZNOA 3ZU3A 1A27A 1X1TA 3TPCA 4YQZA 4R54A 4WEOA 4ALNA 3KZVA 2Z1NA 3M2TA 3MJ4A 3AY3A 2PD6A 4OYRA 4ALMA 4Z6KA 1NPYA 4J7CA 4N5LA 4CMIA 1V9LA 3AM5A 3KO8A 3F46A 4DC0A 4K28A 4UEJA 1GU7A 3W1VA 3JQ8A 1CETA 2C07A 5AXDA 4BOYA 1PQWA 2EJWA 4L4RA 1CDOA 4RZIA 5L51A 1SZJG 2YFQA 3GHYA 2B0JA 2B35A 3DZGA 5U1PA 3JYNA 2YV1A 1PQUA 1VJ0A 3FNEA 1EMDA 1PU2A 1A5ZA 3HSKA 3D0OA 1DHTA 4PLGA 4UVDA 2C5AA 5B12A 3GF4A 3DZFA 1X7GA 4DQUA 1DFIA 4ZRMA 1BXZA 2W4QA 4BNJA 3X2EA 2Q1TA 3WXBA 4P4LA 5JAZA 4TVBA 1DFGA 2Y1FA 2B5VA 3BHMA 1QRRA 1QV6A 3COSA 1KY4A 3PWSA 4GWKA 2Y1EA 1R66A 3E6AA 1YH3A 3KEOA 4ZQEA 1ZH8A 4CLEA 5CPBA 4XJSA 2I99A 2VHYA 1E6UA 1ENPA 1BXGB 3E03A 4I9UA 1CERA 1EUZA 4MVJM 1HLPA 1IE3A 2DPGA 3D3EA 3BTUA 1K89A 4YDRA 4E2XA 1VLLA 3IKTA 5CEFA 3VZRA 1GEGA 4FDAA 2JL1A 4R41A 1A4IA 4Y8VA 3RI3A 3LF1A 4NIMA 3NUGA 4LSMA 2P5YA 1LRKA 1ISJA 1PS0A 2X23A 3BZUA 6ADHA 3B1KA 1P1JA 5EMHA 1BGVA 4CLHA 4YCAA 3R6DA 1X1EA 2E49A 2B4QA 2FOIA 4JLWA 1YB1A 4MVJP 4K1LA 1I30A 2WYUA 3LU1A 2V7PA 4DLBA 1TEHA 1ZK1A 2NVBA 5FF9A 1YRLA 2Q50A 2VHVA 3NGLA 4IQ8A 5CP8A 3H9JA 1PJCA 4X54A 2EV9A 3KBOA 3T7CA 1ZIDA 4U6SA 4J0FA 4CLRB 3ICPA 1S6YA 4QO8A 2AG5A 2X9GA 5CPFA 2E4AA 4O63O 1LLUA 3NJ8A 4PZCA 4E21A 2PK3A 2OHXA 3AU9A 3R0IA 4YXFA 1LXCA 2DBRA 3UCFA 1LDBA 3Q2IA 4RPGA 4BGVA 4ZU3A 4NBWA 2ET6A 1HZJA 4FCCA 4XRRA 1DXYA 1VL6A 4J16A 1U1IA 1VC2A 3I52A 3QWIA 3VAZA 4YEDA 3VPSA 5G4KA 3LYLA 1CWUA 4HV4A 1H2HA 2QIOA 3LT4A 1T4DA 3EVTA 1LLDA 1GYRA 4RPLA 3IMFA 1PWZA 4CV2A 1B8VA 4CUZA 2BI8A 3K2BA 3NYWA 4ZQFA 4OGWA 4CV3A 3KSZO 3K30A 4LW8A 5IZCA 3PWKA 3ZV6A 3OQBA 1ML3A 4G65A 4J1TA 3DBLA 2B4RO 3RUCA 4UEOA 5JDCC 4NU6A 4E5YA 3OBBA 4MKRA 3FHLA 1PR3A 2JD1A 2O7QA 4IDGA 4OL9A 4ZN6A 3U49A 1N9GB 1BVUA 1BXKA 1R0LA 4U6QA 3GZNA 3BHIA 1YXMA 3L9XA 5EPOA 4YT8A 1LRLA 5ES3A 5H83A 2HJRA 4PRLA 3QV1A 4GMFA 3FBTA 4N5MA 4JGBA 3S1LA 5K6AA 1EVYA 3Q9NA 4YJDA 2B5WA 1AHIA 1YQDA 4GBJA 1ISIA 2C7VA 1DLJA 1HDYA 2PKQO 3UW3A 4XYLA 1P3DA 4E2YA 1AXGA 3MJCA 3V8BA 3RQSA 1GQYA 1ZK4A 1GFSA 5L4LA 4CLRA 3FSRA 3GZ4A 1P1FA 1QYWA 2EKQA 2R2GA 1PIWA 4LVCA 4A5OA 3DZIA 3GUYA 2HAEA 1R37A 3IP3A 2DTXA 4Q9NA 4BB6A 5L7WA 5J23A 3GVIA 2EW8A 1HE5A 3LC2O 1WLYA 2RH8A 3OIGA 2I9PA 1T2EA 1BWSA 3RUEA 3H3FA 2NUAA 2BGLA 1LNQA 3ROKA 2HU2A 4IDFA 2CVZA 1NPTO 2CVQA 3OH8A 1XHLA 3JQBA 3U4IA 3PYXA 1E3JA 2NLOA 3WIDA 3OEWA 4RJTA 1N92A 4CQLA 2Q3EA 3BA1A 1AN9A 3GVCA 5MGBA 3ZV4A 3DDNA 4JJFA 1UDBA 4PG7A 3CINA 4D7AA 4IXTA 3WQRA 5ITWA 5KCZA 1O5IA 3C85A 3QSGA 3L4BC 5I9MA 3JQFA 4W99A 4YJHB 1IZ9A 5HA5A 3MJTA 3B6ZA 4ITUA 1R12A 3TZCA 4MIEA 5TT1A 3WGQA 3RASA 1K2WA 1EVIA 4BKPA 3FWNA 1ZO8A 2G5CA 4GX0A 3F9IA 4J4BA 4II3A 4GPD1 3SJ7A 4ID9A 5CDYA 3ZNNA 3NT4A 4FJ0A 1ONOA 1NWCA 4ZQGA 5IJZA 3EAGA 3TDKA 5KIAA 1ULUA 5AXAA 1L1FA 3RBVA 4J43A 4U0JA 1ZSVA 3QHAA 4DPMA 3AFNA 3VPXA 1PZEA 2PD3A 2HJSA 2Z5LA 1C14A 3NRCA 5KJEA 1J6UA 1Y6JA 1ZMTA 3UFXA 1OMOA 4W4TA 4TSKA 2JD2A 3L4SO 2JCXA 3TNLA 3WMWA 3Q1LA 4J9VA 1OOEA 3WGYA 2GYYA 1Z82A 4WOJA 2EEZA 3DBRA 1MP0A 5MDHA 2GN9A 5A9SA 4B4WA 4CM4B 2NVUB 4LISA 3QVOA 4PRKA 3PHGA 4GGOA 4CMEC 3WYCA 4XQGA 1HDXA 4K6CA 3JQFC 1YE3A 4NDNE 2V6BA 2BF7A 4H16A 4IGEA 3GRPA 1F12A 1UDAA 5DBGA 3X2FA 3NAQA 4AJPA 2I5PO 4QECA 2HCTA 1I36A 3S2FA 4R51A 4FGSA 3AUSA 3WGHA 4CMBA 5A4DA 8ADHA 4CMAA 1OBFO 5G0SA 2FPIA 3K92A 2BH9A 1GCUA 1IUKA 3OJLA 4JX8A 1Y8RB 4HXYA 2ZJ0A 4OMUA 3VHRA 3MJSA 4B8ZA 5F5NA 1IHYA 5HBRA 4IY1A 1MXFA 3FTNA 4C7JA 1XQ1A 4BNYA 2VUUA 1KY5A 1WDLA 3ITKA 3OF2A 4GSLA 4XKJA 1Q7CA 4A0SA 2ILTA 4M55A 3BMCB 3UUWA 1NVMB 2X58A 2FR8A 2HMTA 2EJVA 2ZTVA 4YBZA 4INAA 4AJKA 2RBEA 4DMLA 4QX6A 3ZWNA 1UP6A 4HY3A 3FR7A 1UP4A 5AYVA 2HMVA 4E30A 4IS3A 2I76A 4XA8A 2ZYDA 3FNGA 2CZCA 3KLPX 4WLUA 3DMTA 2P2SA 1X14A 3RUHA 4EUHA 4XQ9A 4ROSA 5LDGA 4BO7A 3KETA 3PHHA 4Q3NA 3F6YA 1O94A 3L77A 2I3AA 4NBRA 4RF5A 4LRSB 3CMCO 2PY6A 1LQTA 5HRUA 1DRVA 1V35A 2XAAA 4F6CA 5A02A 5C37A 1ENYA 1SCUA 2BELA 3NT5A 1NR7A 1SAYA 4BQPA 2JFHA 4NPCA 1JDJA 2NACA 1X0XA 4YAJA 1MV8A 2Q2QA 4JXKA 4DA9A 5C3MA 1WZIA 1A4UA 1U3WA 2YDYA 3IUSA 1PL8A 1EE9A 2C2YA 3JD3A 3KOUA 4GSKA 2H6EA 4MOWA 3CXRA 3GEMA 4XB1A 3ZWVA 4YT2A 5JBIA 3WGIA 3F4LA 2C29D 4HUJA 1GUFA 2AEJA 4DPLA 1WPQA 2DUUA 1D8AA 1IY8A 2YV3A 2ZCVA 4C7KA 2Y68A 2NTJA 1RM4A 3OJOA 3RJ9A 2CSUA 1EQUA 3INRA 3BXXA 3W6ZA 3NTRA 1Y5MA 1T26A 4E5NA 1H6DA 2C20A 2IZ1A 1UZMA 3ANMA 3K5PA 1PJ3A 2WMDA 4BGIA 4KTVE 3GN1A 5EQFA 1V3TA 3QE3A 2NU8A 3EZLA 2BFPA 2NSDA 4OKIA 4GLLA 4FFRA 3SC4A 2P5UA 4GMGA 4Y6RA 1R4NB 3G1TA 3GZNB 3KEQA 3OMLA 4PLVA 4ALLA 3EY4A 3ZV3A 4IZIA 5CHEA 1U2DA 1DIGA 1EK5A 3DXFA 1VE9A 1X13A 4HP8A 3LF2A 4IJKA 5KOIA 3IOYA 3SBOA 2CFCA 1SNYA 1YS4A 2QYSA 2W90A 3BYZA 4PG6A 4JIGA 3A1NA 3IKVA 4EJ6A 3I6QA 5LC1A 4IBOA 1VM6A 1TT5A 2XF8A 2PV7A 4AL4A 4MVJH 3O8QB 3E9MA 4GAEA 4DYVA 1NFQA 2RH4A 2ZQZA 3ZHBA 1I01A 4J4TA 2X0JA 1MFPA 4FJ1A 1KS9A 3WBBA 4JP3A 1T24A 4PZEA 1G0NA 4I5DA 5I7FA 1J5PA 4EW6A 3RD5A 1BDBA 1U4SA 4R1NA 3VPFA 1U5AA 3PPIA 2V6MA 1GD1O 1RPNA 1W8DA 4FD3A 4FOOA 4CM8B 1KEVA 3M1LA 2ZTUA 3NDIA 3DBLB 1FF9A 2YHUA 3AM4A 1HSOA 2BFAA 2XXJA 3INGA 3F5SA 1PJTA 2G82A 4ND5A 1GQQA 2WDZA 2WD7A 5G0WA 3GQVA 4E33A 1PJ2A 5COBA 3I5MA 2FHSA 3C7DB 2AW5A 3CKYA 3JYLA 3OFSA 2OBNA 4RVHA 3DTYA 2VNAA 5JAMA 4J3FA 2V6FA 3E8XA 3RCBA 2HMSA 2GPTA 2PGJA 4XB2A 4FGWA 3ZGYA 4WKGA 1HYGA 4PVCA 1B8PA 2EKLA 1AUPA 2HRZA 3VZPA 5JCJA 1XYGA 1GPJA 2BI7A 2DLDA 4FFPA 3KHUA 4CJXA 2P9GA 3A4VA 3I9KA 2H1SA 1BVRA 1MB4A 4E3ZA 2X5KO 5JYEA 3EK2A 3TJRA 1DHRA 3FD8A 3AY6A 3KYCB 4MPDA 3TZHA 3HDHA 2X86A 3KTDA 4E5MA 4RVUA 1JVBA 2UUPA 2FPGA 5EESA 4BNFA 4R16A 3U0BA 3GDFA 5G4LA 2B83A 2P9CA 4AJ2A 4E6PA 2QZ9A 5ER6A 3DFUA 4J9UE 1ZFNA 1JKIA 3H7AA 4XYGA 4H15A 5F3RA 3JQAD 3O26A 4BHTA 1QMGA 1YB4A 2VWGA 3LLSA 2X0IA 4XIJA 4XR4A 3UF0A 1JAXA 3W4JA 2CVOA 3I1JA 1YDWA 1FXSA 2O23A 1IPFA 3IDSA 2JCVA 1Y8QA 2ZB8A 3IQDB 1ZSNA 1DB3A 4MVJG 4W7IA 5DCYA 3LC7O 5EQDA 3VZQA 3UGKA 4YB8A 3PEFA 4DTIA 2UDPA 3GAZA 1L7EA 3DHNA 3PQDA 4NJOA 1XWFA 3FRJA 3V2UA 1JA9A 4CR6A 2VQ3A 5IG2A 5L40A 1Y8QB 2D1YA 2G17A 1Z7BA 3W8DA 4H7PA 1GTMA 1UXIA 1U4OA 3NX4A 2ZKLA 2OL4A 4FR5A 3SLGA 3RAJA 3GFBA 4GWGA 2HUNA 3BIOA 4RL6A 1BHSA 4ILKA 2CDCA 3I3OA 3RFVA 1J49A 4I08A 3ZWYA 3FPCA 1C1DA 2EG9A 5BSHA 2HRBA 4IJVA 5I7VA 5HS6A 2W98A 1NNUA 3ZW9A 1P44A 3HUDA 4J1QA 4BVAA 4CMJA 2GF2A 3K8ZA 1PZHA 5CG2A 3BAZA 1KIFA 3TRIA 3N58A 2YUTA 1JWBB 4BL5A 2W2LD 5JDCA 3HQ4O 4M89A 3FNHA 5L45A 2AHRA 5BSGA 5JO0A 3PHJA 1UZNA 4QT0A 3GY0A 1NQOA 4HNHA 1NQTA 4LN1A 4ALIA 3PLNA 3PHIA 4D45A 3DBHB 2UV8A 1EK6A 3A28A 2O3SA 2VT2A 3KSDO 3U3XA 3ZU4A 1I32A 2FSSA 3DBVO 5F1PA 2Y0EA 2YDXA 2OOSA 1JLLA 2YHIB 3U4DA 3AI2A 4BMSA 1WZEA 4OSPA 2BMAA 3RUDA 1KC1A 1T2FA 1CEQA 5DCUA 3SLKA 5FEUA 3QWHA 5JNLA 5JS6A 1FDVA 3IC5A 2DM6A 1HDOA 1HYHA 1NAHA 2J5KA 1XIVA 4NHEA 1TVEA 1I2BA 3WJ7A 1LLQA 1SBYA 3ZH2A 4IXWA 5TLSA 2EKPA 1LDEA 4B3IA 4J91A 4OAQA 4RV9A 1WWKA 4D0RA 1BW9B 1N1GA 1HE4A 1GR0A 1PZGA 2YJZA 4L74A 4RDHA 2GLXA 3CZMA 1LEHA 2JCYA 4LK3A 3PHLA 4QTZA 5BR7A 3GR6A 4YAEA 2IYPA 4WNCA 3ADPA 2ZQYA 1JN0A 4YJFA 3ZU5A 1I3KA 4N54A 3E48A 4Z0TA 3U4CA 2BFOA 3PQEA 1UZLA 1KEUA 2AXQA 4YRBA 4CPDA 1P33A 3D4PA 1ZSYA 2TMDA 2VN8A 3RIHA 2W8ZA 1ZXBA 3ADOA 4MP6A 3H2ZA 4ZHSA 1R6DA 4YA6A 3VDQA 2SCUA 2VRCA 1FMCA 3JQAB 3PIIA 4FC7A 5G4KB 1GZ6A 1E5LA 3DBHA 4BNKA 4WEQA 1CRWG 4ESOA 4KOAA 3G3EA 2GD1O 5IDYA 1P77A 2WE8A 1LUAA 4PLZA 1ISMA 5AQ1A 3DAGA 1ZJZA 4DLLA 3D3WB 4FFLA 1DIRA 1I3LA 1NWHA 4CLDA 5KNLA 3ROQA 1YQGA 3SVTA 2NU9A 1ENOA 2JHFA 5CEJA 4UUMA 1UXGA 3KM0A 4IM7A 2XXBA 4KDFA 4LCJA 1UAYA 2PGDA 4DBVO 3AK4A 5A9SB 1PL6A 4I1IA 1HL3A 3WWZA 2VCYA 4R9RA 3RWBA 3L6EA 3MZ0A 1DRUA 4UUOA 1NM5A 1YGYA 4GL4A 5JMPA 2Y66A 2CNBA 5I8ZA 1GQ2A 2CDBA 2ZIZA 2OUIA 4OXYA 3ULKA 4HFRA 5T64A 4FN4A 3GN2A 1ZJYA 4NFSA 2PZKA 4BNUA 3OA2A 4ZRNA 2GASA 1P45A 3AOEA 3DC2A 4RORA 2JAPA 2VOJA 5TRTA 1NX6A 3WBFA 4Z0PA 5THKA 4CM7A 2Y1OA 3FWZA 3PYMA 4WCFC 5JPIA 5EN4A 1KYQA 1U2GA 2FMUA 4TZKA 3V2GA 4UVGA 4WPGA 5DULA 4BS9A 4BKUA 3V1TC 1GY8A 3UXYA 4RVGA 2UUOA 5AXBA 1VKOA 3WS7A 5IZ4A 4EEZA 1Y1PA 3K31A 4OXNA 3UICA 1RYEA 3WTBA 1B8UA 2HK9A
chains in the Genus database with same CATH superfamily
2OORA 3GLTA 1FUYB 5AI4A 2CBZA 2AH5A 2PXAA 1I3MA 2KHZA 2ECQA 3DHYA 4JBXA 4L4ZA 2XE8A 4L8VA 3WBKA 1XJQA 2G9ZA 3HXOA 2BDEA 4HN2A 4UVEA 3VH1A 4IDDA 3QKUA 3D5QA 4QOSA 2VAVA 1KTVA 1PX2A 4JFAA 4OJKA 4RY9A 3T0FA 1NYRA 1W4LA 2F4VB 2V4ZA 3HZOA 2E18A 4R1OA 4MCJA 4CZ2A 3B6JA 4I1VA 2WF6A 2OXRA 3ZN2A 3TNDA 4UU7A 5ECDA 1EFLA 3EWNA 5BRNA 2ZSBA 4HDSB 4M7OA 2OZPA 1DOHA 4C6SA 3ZI4A 1O8BA 2YIDA 2C04A 1Z5GA 2GPBA 4E31A 4AK9A 1T2DA 1VLJA 3HXTA 3L5OA 2Q2WA 4GXTA 1ZM3A 3ZBQA 1X9GA 4IGAA 1JFFA 2GPYA 2I65A 3OZBA 1M67A 1S2IA 2I2WA 4BVGA 3QU4A 4KQ1A 5DM2A 1CRZA 3AKEA 4BNGA 2VUHB 3WDSA 1KK3A 1TLTA 1ZVVA 1YZGA 2L19A 2G4CA 3NDPA 2IODA 4MYHA 4RA9B 4FPXA 5JXIA 1JEYB 3GH3A 5KTSA 1T2VA 3A1UA 3G2PA 3W06A 4ZI5A 3EA4A 4JROA 1HTTA 4E88A 1JAZA 2ID7A 4OHWA 2FQ1A 3QNWA 2QTFA 3LT5A 2WI8A 2AFIA 1KVSA 1UEIA 4H6WA 3VOTA 3ZE1B 1O5OA 1D2EA 3KZKA 3P0FA 3HV0A 5GJCA 5K8JB 3FPLA 2DLNA 3IIJA 3ZIAA 1U1EA 2IEDA 3KT0A 4WCFA 1NG9A 1SRQA 1V7CA 1YS7A 4H1TA 4DR3B 1IN1A 4LYHA 1UK8A 4PC3A 5DLEA 2V5VA 3L1HA 2JC3A 2QZZA 3Q11A 5L3QA 1MX1A 1MPXA 4TMTA 3TG2A 3UAOA 2WWWA 1M1YA 1GPAA 2VIIA 2I3BA 4NFHA 3NFRA 2RBKA 1EQ2A 3KQMA 1AQNA 5AOBA 3RYHA 4YQFA 2REBA 3SKXA 4ABTA 3TIXB 1Q20A 3IOCA 4S1VA 5A4AA 2GTPA 3AIMA 1PEAA 1JI0A 4QUJA 3JYQA 3RYTC 4YI3A 3A6HA 4PICA 1HFWA 2BM8A 3HCFA 1JYSA 1OYOA 1QKJA 1T0IA 4H1HA 5C7LO 1UZUA 1MV5A 2V4UA 1NYQA 3WGJA 3MTQA 3OZWA 4RD1A 3UN1A 1OFTA 3R09A 5ILGA 2GPJA 5B7PA 3ZQJA 4A36A 3KUXA 4MGKR 3RKSA 2NVWA 2GCOA 4OKSA 4Y9DA 5J4HA 4ZYYA 1HA3A 2IYUA 3G8YA 2FI1A 1RWMA 5FLEX 3L7AA 2QL6A 2ENUA 4LGVA 2HKIA 3VZSA 4YECA 1N78A 4RUKA 4ZAXA 3BBLA 3H2HA 3MRVA 5FOQA 4EB6A 5A6SA 2Z4SA 1HE8B 1YBAA 1Z4LA 1YJBA 2HQRA 2P7HA 3DE5X 4NQZA 3MRSA 5FI5A 4B6JA 3QWAA 4I4CA 4O4IA 4OQLA 1ZM7A 2ECFA 3WGNA 3DLAA 1I94B 2QG4A 3VO9A 3O9ZA 4L6AA 3T5GA 5H02A 3D43A 1NF9A 5IYZF 4NDAA 3S55A 4BO4A 2AE2A 1C1DB 2ZTMA 3VOAA 5AM2A 3GLQA 2CL5A 2AUMA 1K6IA 2P2DA 2Q99A 3Q7SA 4ZOLA 3VYRB 2CFIA 3WK6A 1WDMA 1MC1A 2XY4A 5CM8B 5A5EA 1ZXLA 1CQPA 3EQ7A 2QP3A 3QVUA 2O52A 1UXKA 4DZTA 4ND4A 4NOJA 1L3IA 4HPWA 5EVCA 1MAVA 2BBOA 3RAEC 1TK2A 1G59A 4GYWA 4JUAA 1JDBB 3NH6A 4ND7A 1T9HA 4GX5A 4JEHA 4S12A 1N2BA 3L1JA 4I5IA 3P1JA 3ZKAA 4F1WA 1QU3A 3C3PA 1T3LA 1V6AA 2DWUA 2PWBA 4KQEA 4P4NA 1P9RA 3SHVA 4WECA 2CCJA 4G85A 2ST1A 1YAJA 2PG3A 3RJZA 4L57A 4DR2B 3UGTA 4MUNA 1WXXA 1A9TA 1ZJ4A 1QC5B 3H8SA 1BNCA 1DINA 3A1FA 1KRWA 1JPUA 1CUEA 2Y92A 2C00A 2YQ5A 3EH1A 3HDQA 3O7MA 1XTBA 1W87A 4K9NA 5AMXA 3L8GA 3NHLA 1ST2A 4KPFC 4KBGA 2DH6A 4PVDA 4B71A 1W0KD 2NPOA 5H1YA 4BFLA 1XRLA 5KNCA 5B58T 2VF2A 3A06A 5FBVB 1SOUA 2IXBA 3C98A 4FOPA 3OEYA 4PBTA 1D6JA 3MCVA 1FNMA 4JLBA 2K2QB 2YOHA 4M98A 3FOBA 4U9IS 3SS9X 2AUTA 1NJSA 5TF4A 1DGQA 3UMGA 1HQYE 3AUUA 4NCAA 2H0QA 3DD5A 2HW8A 4KI7A 4KHZA 2D0PB 3B1WA 5CNIA 4XIGS 4JI5B 2DPHA 3SDZA 3WYGA 3ZWKA 1SXJC 4AMVA 3LI2A 4MICA 4RTLA 4XYMA 1ATZA 1N2ZA 4CKYA 4MWTA 4MEJA 3JR3A 5DP2A 5JI3E 1O7JA 3MD9A 4YRJA 5LU8A 1FSGA 2Y0PA 2CHVA 4PHTA 5E7QA 5EL0A 5IN5A 1JZSA 5IHXA 1IJBA 1RIFA 3PF9A 4DMUB 1N9GA 1Z39A 3HL0A 5CHYA 4BASA 2ATEA 3FGNA 4NCXA 3IAXA 4BNMA 1W75A 4ZJPA 4N3NA 1BMDA 1ODKA 5AESA 5ULLA 3OOSA 1E77A 3JVIA 3BXPA 2Z57A 3L6OO 4M1MA 5F2OA 4HQLA 2RGNA 3WXMA 3SSAA 4PN3A 4Z4GA 1P0FA 2IY7A 1EI9A 3W8FA 3BF8A 4L0CA 4LZWA 3RYCA 4GZ6A 1P1CA 1YS6A 2ZBUA 1D8TA 2OMEA 5HQ3B 4Y3UA 4HYTA 1PV2A 4D9EA 1Z34A 3UPTA 4G0ZA 3VOBA 3HXQA 1JQBA 3H5NA 2X0NA 3HJAA 2WEKA 2WHXA 3CBGA 2QX9A 3EIUA 2ZUTA 4I3HA 4JYCA 4I1PA 1Z56C 5FAKA 3OZXA 2B1GA 4YP7A 5LXTA 4B6GA 3A2MA 2BCGY 4IJ6A 1P7CA 2RSLA 2WF5A 4IUBS 1WNTA 3AF4A 5CVVA 4EABA 4EL0A 5HKOA 4PONA 3L02A 4AUMA 1VJDA 5TEVA 5KNLA 2ZE5A 2ZR9A 4L5YA 2IDJA 2WJVA 4YQYA 1DP4A 1K5GA 1T13A 3ZTYA 1IH8A 3JQ6A 2W6IA 3PX7A 2D8AA 1A2QA 4F45A 2QMHA 1U11A 1GG8A 4HDNA 2JFUA 4QWMA 5AK6A 3RABA 3RROA 3WK8A 5AVTA 5JXHA 4YO7A 1OR8A 1OX6A 3FM9A 3GLSA 4KV9A 1J2EA 1TUIA 5HWSA 1KMHA 3CO0S 4IMRA 1XD2B 1NBOA 4IVQA 2RK4A 1JIQA 2H3HA 2W5UA 3GPBA 4O2AA 2NT3A 4CMCA 2JIZA 2C2WA 2IIQA 5FOUA 1HM5A 4YXFA 3LIPA 1RDFA 3VISA 2OP0A 2ID4A 4DMCA 5C35A 4BMVA 4M9ZA 3K9GA 4EX6A 3E7PA 1NASA 3C6XA 3G0IA 4LRTB 2VTEA 5C8XA 3ZCSA 4V1CB 2X2FA 1OC4A 1ZC4A 2WC1A 4UVHA 3F49S 3A4MA 4EDFA 1VPDA 1WP4A 1NFFA 4XASA 3QVVA 1J9EA 1XTUA 1YL6A 3GWGA 4DW8A 1K0UA 4I4TA 4Q16A 1UPFA 4MX8A 4E15A 4B6SA 2HUPA 6CHYA 1JDBC 1GG9A 1P7WA 1X70A 1I1OA 2DFKB 3M5CA 3BERA 5DF1A 3AY7A 1C3OB 2OB1A 1XRNA 2IUTA 3GG9A 3MJVA 3OESA 5EIFA 1EBBA 1CKEA 1E0KA 3G49A 1TO1E 4MLZA 1S3FA 2P68A 3TOXA 5LNK1 3VKUA 3B1JA 2X9QA 4GR9A 4B9AA 5B2FA 1Y98A 2EFHB 1DKMA 3SQMA 4RD6A 3LT2A 3HNPA 3OPYA 5EFZA 2DJIA 3CISA 3IXLA 4HGQA 4P7BA 2B37A 1MB2A 1SEPA 4IUCS 1X1BA 2XE4A 2FQXA 4G07A 3D6VA 5H80A 3W1EA 4I6EA 5C80A 4QLOA 3MD0A 4B48A 4EF5A 4O4HA 3TVDA 2Y1CA 5J40A 4QO7A 4QREA 4QTXA 2ONZA 4A1OA 1D2CA 4KMMA 5K3FA 1HLDA 3QYPA 4FK8A 3CF6R 4UBNA 4XAQA 2ZS8A 4R1SA 5NULA 2CEAA 5GZ6A 1AG9A 2O5CA 1B15A 4MVJD 2CGEA 3O75A 3HJCA 2PKCA 1F14A 1X2BA 3CONA 1T3HA 3I09A 3O94A 4GZ5A 3ROZA 1HDGO 3FF4A 4GE0A 3ROXA 1BDIA 4DHEA 4OB7A 1X42A 3ZKWA 1GGVA 3RBAA 4XDYA 1SQ0A 1QYRA 1KO8A 2AEFA 2VDRB 1WB4A 3GRUA 1W9HA 2C4WA 3NLLA 2XMGA 1J21A 1P1KA 1KVRA 2J3MA 1FIUA 1CUCA 1XMXA 3H2KA 1VB3A 2VF7A 4QYXA 1KDZA 4CMHA 1DELA 1UBLS 4IRMA 3G13A 1Y1SA 2H4XA 4ZCQA 2X0FA 4CL3A 4ZZIA 1ZA2A 2I03A 1OYWA 2H31A 1YUMA 1NHGA 4XB6B 3THYB 3R23A 5BMVB 1I6MA 5L3VA 2G76A 1E2DA 4MITA 4QJ3A 4YT4A 1I7NA 1RI5A 4P9NA 1V71A 3NRBA 4U2EA 2WMNB 3FUXA 5SZHB 3RYIB 5JZ9A 2JHAA 1XLVA 4NCIA 3WGVA 1USWA 2WSLA 1YFZA 1WNFA 1ZZEA 5JCJD 2KYRA 4Q37A 1C9YA 1FRFS 1ZNYA 3N2IA 2IW1A 4G41A 5F21A 3W05A 5FWDA 3AM1A 1OSNA 4G23A 5CD9A 4FWBA 2PR7A 4HDKB 3V7YA 4DMHA 3ZU2A 3LUCA 1IJFA 3D6UA 4PPNA 4DEXA 5KQLA 2XRMA 4NFLA 4GC5A 3S1AB 3FR8A 3A9UA 2WJPA 4NEGA 3LSYA 3AV3A 3EVAA 4S1NA 3U3JA 3KJEA 3FE2A 4NBKA 5T3YA 3DOJA 1P80A 3HPQA 1YD7A 5DWVA 1ES9A 5E9WA 1E9RA 3UUFA 3V1UA 1H3FA 5KX5B 4MDEA 1NE2A 2BEWB 1VECA 4R2MA 3STYA 2OBLA 5IANA 1L7NA 1I6WA 5LUBA 4X24A 1RWVA 2CD9A 3S1AA 4E6EA 3L82B 3SR3A 4DLZA 2J3KA 3V4ZA 4R4JA 4RJKA 4BO1A 3TFOA 1AOXA 1ZX1A 3NFYA 4P5PA 4RY2A 4BDTA 1E61A 2ZYWX 3ONWA 2BEUB 4IKEA 2QM7A 4V0KA 4XGIA 1XZAA 5BN4A 4C4RA 1SCKA 5LDDC 5F7JA 4ZAFA 3HKCA 3MJDA 1D0VA 1RW4A 2G9UA 2PMEA 1U8FO 4NCNA 1F38A 3M83A 4HLUC 4OBBA 1K3TA 3VVBA 4MJ7A 1O2DA 4X90A 4DNXA 2G71A 4FMCF 3SDBA 3H5RA 3HZZA 5BR4A 1M34E 1XU7A 2FVXA 4RZ3A 5CB6A 3EXIA 3NRJA 1T29A 1JKJA 1W34A 2WWXA 3V2HA 1E3EA 4JXJA 2YWCA 3QKRB 1OGJA 1A9YA 4P58A 4PG5A 2WU0A 4P2GA 3ZD9A 3ZDYB 5KU7A 2Z8XA 1S7CA 1VYTA 4E1BA 1VCHA 1VHQA 5IXSA 3PJFA 2NP6A 1Z33A 5F23A 1Z5ZA 4KWEA 1KP9A 1ZN8A 3DM9B 5I7EA 3ZIUA 1W59A 5E6SA 1ISGA 2J3DA 3AGPA 1DAOA 3VR2A 2VHZA 4O25A 1OGIA 1Y4DE 3WKBA 1TZKA 2J6IA 5TR9A 5K9ZA 1RABA 3QWFA 1A5TA 2JDID 4KFRA 4HFNA 1XU9A 4V3BA 3A6FA 4FLFA 2D3WA 5I8PA 2IJGX 5D51S 4XVRA 4NG5A 2ZLBA 1WO8A 2WUEA 4YJGA 5LQAA 3M4NA 4UCFA 1DIOB 2H5EA 3EGCA 4N5DA 4OXRA 3I04A 2XTMA 1WZCA 4D43A 4URXR 4W8HA 4NU5A 5JFOA 1P3JA 1B23P 2WBLC 3A2NA 5AVVA 2UUCB 4F3TA 4R8LA 3LMKA 4O4HB 3FPKA 3RS8A 1T91A 3K20A 1E18A 1CYDA 4JOQA 4ZTBA 2FRVA 5LUAA 4RETA 4OGKA 1F8FA 2A0WA 7MDHA 1HDZA 3K0CC 5I9NA 1M7HA 2NXNA 2ZW9A 2OGTA 4Y2GA 5KVQA 1R5NA 1XTTA 4LJ4A 1YBMA 2EZUA 3A14A 4P35A 5FBWB 2H4WA 1ZD5A 4BZPA 3AUAA 1QYVA 2VDQB 3IJ5A 2NU6A 1L7BA 3T4UA 5DNUA 5H8WA 3TH5A 3WYAA 4D3FA 1I33A 3LUJA 3RJMA 3PGLA 5JCXA 4QSMA 2CL7X 1E1RA 1TZMA 1LD3A 2QNRA 3JQRA 3S2IA 1X7ZB 4REOA 3DMPA 5K3OA 1KDOA 1XELA 3PFCA 1MO2A 1GZ4A 2BGNA 3FBGA 2CYCA 4P0QB 3ZDXB 4R0MA 2C2OA 1NVKA 3D0KA 1WD5A 2ETVA 1E99A 2WA2A 1U2TA 2OQVA 4IOLA 1LTKA 3VMFA 1JPVA 3G0DA 3BE4A 4R7TA 2X7HA 3DKVA 3IV6A 2DWCA 4YASA 5ECYA 1MRZA 3AFMA 3FPGA 2SNIE 4BNDB 3M9XA 1XZDA 1NJFA 1G98A 2WTUA 3SF8B 2X22A 5C2JB 2JGIA 4UBJA 1F06A 3GOQA 3PGA1 2I67A 5BWNA 4GYKA 3QXSA 3EXFB 1DIAA 1Y4ZA 3IAS6 3SHFA 3NTXA 1XCJA 4DLSA 1K97A 3JS5A 5TGDA 2O14A 3LHIA 3DL0A 3Q8WA 1QRTA 4HDMB 1W6RA 4U7PB 1F8YA 3C3YA 4EPWA 1II8A 1TD9A 2G9QA 2RMKA 5EI5A 5JWOA 1QO9A 1BSVA 1YK1A 3FCOA 2B9EA 3F67A 4DA0A 4DSTA 1JG1A 1ESCA 4P80A 4Q01A 1W19A 3AR4A 3KP1A 3QX8A 3VJRA 4IH1A 2XMQA 1C80A 3SBXA 3TPFA 4Q9KA 2HN9A 5CYOA 2D7JA 4Z86A 2FDXA 2WJJA 1U7TA 1XHFA 3QI2A 3K70B 3BDAA 1UMDB 1SEVA 2IVFA 4O4JF 4BQFA 4UHHA 2JASA 5AW5A 5CEEA 3IKMB 4YHHB 4NX2A 4FHCA 3UENA 2AEMA 3A9CA 4W63A 3NBAA 5A4MS 2EQBA 3I2KA 3HO6A 4ZU1X 2NV6A 3LQFA 1KJYA 3GZJA 5KKCA 4FYPA 1O6ZA 4WKPA 2VWPA 4Z9XA 2E7ZA 1W36D 4PGHA 4UPEA 1XEWY 1YFJA 5A3JA 3RLFA 2R4QA 3WWPA 4YUYA 3MWFA 1WMBA 4HT3B 4N0DA 4QGAA 3C5VA 3ID6C 4ZD6A 1NN1A 1V47A 3RSQA 7ABPA 2J30A 1Z18A 2AOTB 3ANLA 3CMMA 3L0DA 1IQRA 4QBIA 2NSJA 1QWSA 3EDMA 1MGOA 4W9NA 4C0JA 4M0PA 5CDGA 3LY5A 3PS9A 4Z49A 4ND1A 4JENA 1P0CA 2C98A 1J06A 1N2CB 2D0OB 2H17A 1MAUA 3IQEA 2C7PA 1P74A 2FQQA 2QG6A 1ATIA 4CF4A 1CZOA 5HZMA 1JJBA 2CXRA 2XT9A 3TQTA 3WG9A 3WAKA 5JAHA 4OH7A 3WTCA 2OHVA 1OWPA 2BGGA 1SXJD 1ZW1A 5JO9A 4G36A 2G1AA 1OZHA 3IELA 4JV5B 3MLEA 1J0DA 3E15A 3ZLUA 1UMDA 2GZ2A 1WQ1R 3X1ZA 3KU4A 4MUJA 2GJ4A 1IDOA 4OHMA 5E8RA 2GCIA 1FQKA 4Q19A 1Y42X 4QNNA 3CVVA 3IUPA 2XBLA 3HBLA 3NONA 2ODEA 5CH3A 5AIAA 4UAGA 5LQMA 2EDCA 3TQHA 3OQIB 4QJ5A 3OIUA 4C4TA 5FRDA 4BWVA 3ZCXA 5CLQA 3BAFA 2YV2A 4PN7A 3UPDA 2IITA 1XAGA 3FCAA 4M0KA 4CFSA 1FS4A 3GGSA 3OQJA 3F7OA 3PVZA 3W7AA 5KTOA 4Q3EA 2WWVD 2IEIA 4R3UC 1RRVA 1JW9B 2ZIXA 4D9IA 5TQ0A 4HZIA 1U7XA 1P81A 4HQOA 5JFTA 4A23A 3ON5A 2O3JA 3H0KA 3HB7A 1N7IA 2BHLA 1OXBB 3LPLA 1DV1A 4UM8B 1GN9A 5G0TA 2EBUA 2QM8A 1TO6A 1ZK2A 3D7NA 3LZCA 4LRUA 1JZTA 1MUUA 1H85A 3KV3O 1RIIA 3GRAA 4H60A 2A1TR 4V2UA 4AJEA 4IDPA 3WFJA 3B70A 2DR0A 2HV9A 1ZBQA 1G9XA 5AJVB 1MG0A 4PZ9A 1PQPA 3PQ8A 2RHCA 3FWKA 4PIVA 4UOEA 1YACA 1Y81A 4IXDA 3FXAA 5A04A 8AT1A 4CEIB 2E5WA 2R44A 2YFKA 1EX7A 1XTPA 2RBGA 2ZQ5A 3BD9A 2LP4Y 3TQRA 2X5JO 5EIBC 3L4EA 2R8BA 1OI7A 4Q3CA 4Z51A 3GEGA 4TMVA 2NU6B 2IOYA 4ZARA 2FF7A 1P6XA 1W0JA 3PUWA 2ZANA 2BTQB 5DLPA 4MAFA 1F6WA 5CIYA 3UJ7A 3FLMA 4OVKA 4QEDA 1T1JA 3AUTA 1SC6A 3NOXA 4RLQA 4MMXB 1GNVA 3E9ZA 1LI7A 4OM8A 2ROQA 1RVV1 2CJPA 4W82A 1WETA 4DMGA 1L8AA 2HSWA 1JHZA 3PUJA 4Q47A 4LOHA 3OP1A 4RKQA 1C4WA 1MORA 3WLQA 2JGEA 1IC6A 2WIBA 1E5TA 1XROA 5EXDA 3HYCA 5EY5B 3A4LA 3WGGA 1YU9A 2PA3A 3TAXA 4YTEA 3AEYA 1WCWA 3P2MA 5JNSA 2Z2YA 4DF3A 4E32A 3ZQ4A 1P4GA 4YAOA 3CIFA 4DCUA 1P29A 3L7BA 3RS2A 4ZICA 2Q07A 4KN9S 4B40A 1SO8A 3PPWA 4I9NA 3GLFA 2A4MA 3JQ8B 4D4KA 1EJ6A 1QVAA 1ZVQA 3LKDA 4RH0A 3BD8A 5EJAA 4K6HA 1V2HE 1MJHA 4KPUA 5CXUA 1UR5A 2EFDB 3ONDA 1E2NA 3D4NA 2GO7A 3DQZA 3H75A 4JB0A 2FFRA 4M76B 3LCMA 2BHSA 1QK3A 1KXZA 1XNRB 3MGBA 3UV3A 1DBWA 3CEHA 4X7PA 2XKKA 3GLUA 2WPDD 1Y7HA 1K8RA 1T3ZA 3FZQA 3DLBA 3PC2A 1GTL1 4EY8A 4EYSA 3NTQA 4Y9TA 1NI5A 2RB4A 1G3UA 3AVOA 4LJYA 3TSZA 2W42A 3JPWA 2JGFA 4ND2A 5GJVC 2F9FA 2B3TA 5B37A 4K8OA 4PLTA 5EUMA 3AIOA 5EJ8A 5I7UA 3O91A 1LPAB 4UQLA 3ST7A 3UWKA 2ZSKA 5LXTB 3LC1O 1FTGA 1NP3A 1ZZGA 2KBEA 1E3SA 1LRJA 4KK3A 1LDYA 4X6YA 4BO8A 1YCDA 5C53B 5EERA 3E23A 4F9GA 3KHTA 3VC1A 3BGWA 1R3DA 2NV2B 2BRUC 3IE2A 4TMXA 4O1HA 2FF5A 4U0KA 3A1EA 2R6HA 4TV8F 1NVBA 1S3SA 4FQ8A 1RMQA 1AQJA 2D3TA 2I55A 3FAKA 3L4JA 4ZVSA 4FSXA 3EXEB 3S2EA 5I7WA 3O8OA 2C5GA 1BE0A 4TTVA 2Z8YA 4PC7A 5AO9A 4EX7A 3ZD6A 4QIHA 1RQLA 3JAWB 2H29A 3RK4A 3RTDA 1UPUA 4EFNA 6AT1A 2Z3WA 3LP6A 3JYPA 1WG8A 3RVOA 2C9DA 2VJAA 3TZ6A 4BJ6A 2C2ZA 2DQKA 2C61A 4MCHA 2JW5A 1V3QE 1XZMA 3DFZA 2ESRA 1MQAA 2YVQA 3PQ5A 3I05A 4KZPA 4DL9A 2EGHA 2WD7B 4G24A 1RJWA 1J0AA 5MFPA 5AVYA 3IDZA 4K1XA 2H2GA 4BX8A 4WADA 3P0RA 5JS7A 2QTGA 2WIFA 3QMWA 1HSZA 3M3HA 1UJ4A 2KQUA 2YXDA 3QBTA 4Z9YA 1YHNA 3HY6A 3OJCA 4K9SA 4EZEA 3CWQA 3TTXA 1PP4A 3CJQA 1QB7A 1MNAA 3TFWA 2MOKA 2NV0A 3VVMA 3B85A 3W90A 4DARA 5A3QA 1DRKA 4F5YA 1Z38A 3D3NA 3D3QA 4FYYA 1XZGA 4A6XA 1BFUA 5ELMA 1Y7TA 4NENA 2Y0CA 2ZRHA 3R7DA 1ZUNA 1NQWA 3GNQA 2WTAA 4MXDA 2R84A 3RC8A 2J41A 4RHXA 3N3AC 4MR7B 5F2KA 3TQFA 1UMBB 1YOVB 4RJ2A 4RVDA 1X7ZA 4WZBA 3ZXYA 3L9WA 1KORA 3D7RA 1NOJA 1ADGA 1WMDA 2BZGA 3BGSA 1POWA 4R1MA 1VJCA 2VUSA 4BYMA 1BKYA 3ESCA 4LV8B 4L2IB 4CQMD 4CTOA 3NKVA 1I10A 3TN7A 3PWTA 2N9UA 4YAUA 1ZD1A 1VCNA 1KU0A 2X3FA 2ZTSA 4EVIA 1WMEA 3BOSA 3EQ2A 2RFLA 5F5LA 1KMMA 2IRWA 5DHPA 1WA5A 3OFKA 4WLVA 3FVRA 5DIZA 4MKHA 4XX0B 3DGEC 2UUAB 3HCRA 4LWOA 4IQFA 1FSSA 3N5KA 4A8HA 5B3JC 4WOKA 2G9RA 3RJTA 3AILA 2GGSA 5AOVA 1O95A 5EP1A 5FHQA 1X1RA 1OHHA 1JRLA 4B3BA 2VWQA 3N8HA 4N82A 3CCCA 3OZFA 4D99A 1M6EX 1D04A 3OZUA 3RC1A 5C8ZA 2FCAA 2NO0A 3GUVA 1IVNA 5DZSA 3P9YA 2F3PA 3O2SB 2O4CA 4WHMA 1DRWA 2WV7A 2IU6A 4I6GA 3VYWA 3F6BX 1X0VA 2Y93A 1M2GA 2JFFA 4N6NA 4RTMA 1S2MA 4OQQA 1NMSA 1O9HA 1XNGA 1XP8A 1QLWA 2OD9A 5DN6A 2Q7DA 3RNOA 3TTVA 3ICCA 4D6YA 4DR6B 1KWGA 3FZGA 2VL7A 2AVNA 2GRJA 4MWDA 3OJ0A 4TLEA 2X5XA 4D9HA 4XR9A 3E84A 3ONVA 3PV0A 5CFOA 4NZ9A 5LJLA 3HGTA 5FL3A 3AR9A 1RHMA 4JR1A 4DIUA 2GA8A 2BKAA 5EYPB 1JKJB 1ZRHA 4MI9A 2ZYRA 1CJCA 2HC9A 3CLSC 3ILHA 3H0CA 2D2XA 1NNLA 3BQNB 5ALNA 1CUVA 3OEHD 1N4DA 2O8VA 1UKAA 3QVSA 5IJWA 3AHCA 1C1HA 3SHOA 1DV2A 1Y89A 1B2LA 3DZHA 2BSAA 2QORA 2Z9DA 1EHIA 4KUEA 3MWYW 3MOGA 2XZOA 1BAPA 4R01A 5DOVA 4LVUA 3DZBA 3SHQA 3T06B 4CL2A 1FTQA 3C5HA 4K87A 4U3JA 5AT1A 3WIVA 5JH7F 3PSHA 3BILA 1CU1A 4X20A 3E5MA 1G64A 4ZALA 4DJFC 5KYXB 5JANA 1DQNA 2H4FA 1Z5UA 1OZAA 1PW7A 4LXIA 1QP7A 3ZHTA 1J1IA 1TQ2A 2PMDA 3O8QA 4XEHA 3QU2A 3TWOA 4BO2A 4CT0A 4YUWA 1V6SA 1G3QA 5KDDA 3MFYA 2BRUA 1XLTC 4B34A 4KNYA 4CIWA 1Y3FE 3B20A 3OETA 1Q3TA 1XI2A 1LDGA 3OQPA 1S89A 2XB8A 3DWFA 3R2JA 5EWMB 4ZA2A 2FZCA 4PFJA 2W2NA 2DPYA 5JW6A 4R8SA 1KZ1A 3STVA 1ZRMA 1RYHA 2K7FA 3O4HA 3UAWA 1IXZA 1ZH2A 4HNUA 3ZDCA 1ND6A 1R4AA 3M6VA 2HK7A 3G2LA 2QLLA 1RRMA 4X60A 1E2EA 1A71A 1QYDA 3QX9A 1H22A 2H8GA 1CUHA 2ZCUA 3PCXA 4FT2A 4HB3A 4B17A 1KZYC 1X87A 4CNBA 3RTBA 3FFBA 2CL6X 5KPDA 2ZR7A 2PZMA 4KC0A 4C4AA 4NATA 4NNOA 1H2WA 1Q0QA 2C2BA 4LZPA 3W2FA 4A91A 4LHXA 2APJA 2I8CA 1IEQA 3A31A 3NHAA 3R8XA 1CUDA 4PGFA 3VPHA 4TWAA 4DGSA 2PJUA 5JRJA 1F8XA 1ZUIA 1WIWA 1FFDA 4UQPA 5FUXA 2W11A 4FGLA 4HXFB 4FGKA 3CKMA 4RD3A 5HRAA 3BWBA 2PXHA 2Q0QA 2WT4A 2VQSA 3KKMA 4KQJA 1YA6A 3BK7A 3O2JA 3EDOA 3FNRA 4G5HA 4HOYA 3OLZA 5TARA 2HWKA 3NHFA 3UMCA 1BE1A 2PPLA 4UMVA 4BHTA 3HWX1 4MJLA 4TMKA 2BBSA 2GJKA 4M87A 3TFQA 3SVLA 4K9MA 4ARBA 2H63A 3P9SA 2LTAA 3C4VA 3IAHA 3QWBA 1C30A 1P5ZB 3D8RA 4LJSA 3GP5A 2ZVDA 2CLLB 3V6LA 4GVLA 3TW8B 4ZO4A 2D7DA 2JIPA 1AHHA 4GH5A 5HE8A 3L0ZA 4MKIA 4BJ1A 3RVNA 4BN5A 2ZJFA 4NBVA 1GPDG 1WR8A 5PGMA 1R9JA 4LCBA 1H5NA 1VI2A 4RD2A 1JIKA 3ROEA 3TLAA 3I32A 3U3RA 5BVGB 1RXVA 1GRQA 3WR5A 3WLTA 4HQ0A 1IM8A 3W6NA 1XDWA 3T3PB 4J6FA 1JBQA 3JQGB 4CTKA 3WLKX 5LWQA 2Q6OA 3CZQA 1CE8B 3VC2A 1IHUA 4DRXB 4HLCA 1T2AA 1TRKA 2JLZA 3F71A 1HORA 5BRAA 1WPGA 4ZVPA 1EGQA 1WAMA 2OCDA 2FG6C 4HTAA 4LHWA 2Q8QA 1ZUD1 4YACA 5KSOA 3HHPA 5JVDF 1ECJA 1P2UA 1Y4AE 4ON9A 4QXOA 1JG3A 1LSUA 3GNSA 2WFLB 1QQ5A 1EVQA 1CE8A 3DHWC 5G3ZA 4DRXA 5AW3A 1VSTA 4PNZA 4JDPA 5IJAA 5AKHA 3FOCA 5LM3A 3FYUA 2B5OA 2JGKA 2XCQA 4GOMD 1AZLA 3ASYA 4UTZA 4BO5A 5B7QA 2IWHA 5BYJA 4A4DA 4ODIA 3B12A 4FDMA 1OXKB 5EFOA 1A9SA 5K0LA 3V33A 2OAP1 1F6BA 1Q7GA 2BI4A 2PRJA 3HI6A 4LSWA 4EJSC 3REQA 1SPBS 3RNLA 4H31A 1H8EA 2Q1XA 3OECA 2HV8A 1QP0A 1GCAA 1SUPA 3AQ4A 2GPSA 2M9MA 4N5HX 1R5OA 1WQ4A 3BWMA 4HFJA 4M49A 2A58A 2VUTA 4JKYA 2JGNA 2VS1A 2V6JA 1WXGA 3GD5A 4N4AA 5FPSA 1TUEA 5L3ZA 3AF2A 3I39X 4OGLA 2J0SA 2H9AA 3OI7A 4RMGA 5TQ0B 4HQNA 2MINA 5FI1B 1KJ8A 3JZFA 1OW3B 1CSEE 4E2WA 1K98A 2CK3A 3ETHA 2ZUCA 1TMOA 2VG8A 1XWWA 4KKXB 3BA6A 1W48A 5UKDA 4M54A 4EIWA 4WFKA 4DSAA 3KB8A 3D8TA 3OPXA 3PB3A 3PXAA 4L4XA 1W7AA 3WDKA 1E2UA 3D0QA 4PQEA 5HF9A 3UGJA 1FP4B 3MQ2A 3EULA 3WI7A 2R8EA 1D6SA 1BU5A 1MJGM 4GPAA 6YASA 4RZHA 5IK2D 4FS8A 1X8XA 1Z0SA 221PA 4EAQA 1VRVA 4QRDA 1TQ6A 5F98A 4G1EB 4PYKA 5F73A 4IUDS 3ZZMA 2RB5A 2I4NA 1K88A 1TGYA 3DCNA 4HWOA 1M6VA 3V4SA 4ZHQB 3PEYA 1AK2A 4NZNA 1ZL0A 3ANYB 5KDLA 4AKIA 3C45A 1LBSA 5J63A 1DARA 1HNWB 4WKNA 4JY7A 1Z12A 4LI0A 2C2MA 3TL6A 5KNCH 1A9XA 4H7HA 5HOEA 1Q6YA 3K6JA 4HRYA 3IJRA 4J16C 1OBVA 1YWGO 5U9CA 3KC2A 4LJRA 4PIPA 3G2HA 5DV9A 3TMAA 1JFLA 1XDGA 1TA9A 4UQOA 3VHXA 5E9JA 1TYZA 1Z62A 4X20B 3GI1A 3H2SA 3TEJA 4YRIA 3DMRA 2P2LA 3KFLA 3C97A 3JRXA 2VCHA 3E9NA 1OIWA 4QBGB 5KSPA 4A10A 1T6XA 1WUHS 2ODWA 3K96A 1WULS 4WV3A 5CYFA 5BWCA 2VBFA 4Q1FA 4QWWA 4DIBA 3FMPB 3JX9A 1WKCA 3G0GA 4DLTA 1O89A 1PGNA 5AW8A 4LUCA 3EG5A 4D8UA 4P3NA 3T9FA 1CUFA 2IZ6A 4JCOA 2ZBDA 2AI1A 3HR7A 3IUMA 4RM2A 4I9HA 2OP1A 3P5SA 2XT0A 4Z2AA 4TRRA 4AN1A 4Q05A 4FW9A 5J5CA 2OFXA 2AI3A 4RH3A 1Q21A 4LXUA 3KVOA 3OIFA 4EI7A 3SC2A 4JLNA 4OH1A 4RW0A 3DKIA 3OT1A 3Q1KA 4P4TA 4URFA 4U2KA 3U4QB 2Q8NA 2C5BA 2WYWA 1QMPA 3F98A 3QPUA 1ZESA 3P9NA 4MH0R 2R3SA 1WXWA 2WJAA 3CV3A 4BEWA 1T34A 2VI5A 1XF9A 1PE0A 3KWLA 5IKOA 5L7TA 3UMSA 1WXHA 2PX2A 3JQEA 2QZJA 5AJHA 4DZZA 3PC4A 3KB6A 3ZQUA 4L76A 2XVZA 3C8HA 3C16C 1RQ2A 3VTZA 5EE5B 5FWXB 4QDZA 2EKZA 2O9JA 4IV8A 2BUBA 2JAUA 2XTAA 3N7UA 2YJNA 1GO2A 2FW8A 1XSEA 5FWNA 7AT1A 1GAEO 3EISA 1ZGBA 1J25A 3VU0A 1B73A 4YAGA 3ZWMA 1EESA 2HPZA 1NOIA 1PSWA 3K9BA 1MO3A 3M1YA 2ZYAA 4I2NA 4YCJA 2PV0A 5BRJA 4EVRA 3S70A 1JWLA 1MJ5A 1UKZA 2YMPA 1XTZA 4HPJB 1J97A 4DTCA 1C9KA 4JLOA 4OB6A 1LA2A 1FTNA 1L4HA 4UU8A 1Q16A 2G63A 4GECA 2B99A 5TX7A 4FMBB 3Q6IA 1RP1A 3DWGA 1JEDA 1QPBA 3FDJA 3UVEA 1Q7RA 1A88A 4RA6B 3H1EA 2QN6A 4CL0A 1BN6A 1XMVA 2KB0A 2PT5A 3RUPA 4ESEA 4HVCA 1OKKD 4YCSA 2E48A 2QT9A 5EKXA 1L8OA 1U31A 1VLZA 4JKOA 2CXNA 4LOIA 1A04A 2PUWA 3MTJA 3RTEA 4C3UA 1LVUA 4I1OA 1NBEA 1CS0B 2WABA 3KBBA 3FUCA 2CJWA 2IEYA 3H9QA 4FU0A 4RPJA 3STWA 4Y2YA 5KU1A 1N6KA 1OX4B 2PS1A 1OBOA 3U7HB 4CEJB 3MIIA 1XJWA 3I2GA 1O6CA 1XKQA 4MP8A 4NU0A 1CRLA 2RHBA 6PFKA 2O2EA 4OYLA 2W6CX 4QUKA 3VQTA 2XYRA 3USES 4XCQA 1REQA 2OSVA 3VNBA 2ZE8A 1XPJA 4V0ME 1UANA 1O9BA 4IFIA 4PXSA 4F4UA 4RMNA 3M70A 3QOWA 1FFYA 2BCEA 1QQAA 4NH0A 1OFIA 4QASA 4NJMB 1YAHA 4RK6A 5HFAA 2EJBA 1GSHA 1LLCA 3TNFA 2E4YA 4C0XA 5TV2A 4PLPA 1ZNWA 4DEVA 1EDZA 4U8GA 1KO1A 4TWBA 2IP4A 1VBNA 2P41A 4H7EA 4QBTA 1FZTA 4Y2TA 2HJGA 3A6EA 5FA5A 1E69A 2CCKA 1GCIA 3A8TA 4MV0A 4XQEA 1IRIA 2NW6A 4UTVA 4ZYZA 2GYWA 1W47A 1OI4A 2R8OA 1ESDA 1D1TA 1G1AA 3GT3A 1PR2A 3L0BA 3VH2A 1NVGA 5K3AA 1YS9A 1EVZA 1ML4A 1VFPA 1HE3A 4GBMA 3UCXA 2FUG1 4YRGA 2QSZA 4RGQA 2ZK7A 2B20A 2Z04A 3U7JA 1LU9A 3X1KA 4D9JA 1U6IA 3JQ7A 2JZCA 4YDQA 3GQBB 3CPSA 3E18A 2JH9A 3GARA 5A4JA 4JL8A 3C7KA 2FG7C 3SIRA 4EZBA 3EDYA 2J0UB 5HJEA 1CX9B 4RDCA 3GA0A 1S01A 3CX4A 3EPLA 1UWLA 4S3MA 4BKQA 3ZWBA 1E92A 2HRRA 1RJ9B 3EW7A 3IHLA 4HH3C 4J03A 1RLUA 3OE4A 4E5VA 1XMJA 4F3YA 1J39A 2CMHA 4D26A 4RIGA 1SCUB 4QFCA 4WINA 1ULSA 2FR1A 2PLWA 3K6KA 2O8FA 1DLIA 2JLQA 3KHSA 3L6DA 4ZEMA 3CLSD 2Q27A 4D8TA 3AFHA 4JEIA 2E85A 5JCOA 1PR4A 1NXPA 1XLWA 4DV7B 3A6GA 3DO5A 3IT0A 5THQA 3UBMA 1IPHA 1OH8A 1BX0A 2FZVA 1IWBB 1FK8A 3JQGA 4MPPA 3Q0TA 1M76A 2XA1A 1KQGA 1A27A 1NLZA 3TPCA 2OK8A 3TUIC 5I48A 2VUIB 3KZVA 3P94A 2XX3A 3MJ4A 5CFNA 1GZ5A 1YB6A 5C4GB 4G4GA 2XYGA 4M1OA 2PD6A 3F96A 3TR0A 2QUKA 3M6AA 2WQ7A 4ALMA 4Z6KA 3QYJA 2AKYA 4J7CA 4RZ2A 1CIJA 1R18A 2ZJ7A 4KR0A 1N8NA 1T4CA 4K28A 2WOOA 4UEJA 4UHFA 4DC0A 3JQ8A 3VR5A 3W5AA 4J3JA 4PQFA 2EJWA 2NX2A 5JJLA 1ODSA 2B0JA 4R0VA 2IF0A 2X5NA 2YV1A 1GT6A 4XOIA 2ZIUB 1ZGCA 2IHYA 2HO4A 3KPJA 3RT9A 3FYCA 1W0JD 3R77A 4EYGA 3HA2A 4PX5A 2YWJA 1A5ZA 3HSKA 5FXMA 3D0OA 1GTRA 4PLGA 3GJQA 1CRPA 3MT9A 1K06A 3RIEA 1DFIA 3T3GA 3UUEA 1XA4A 1AKYA 2AFHE 2XA2A 2YNMC 3R3ZA 4QHTA 4X41A 3B9PA 2FSGA 3R0VA 5CLGA 5HUJA 2Q1TA 2GWHA 4P4LA 4F8JA 2HHHB 3ZV7A 4JHLA 1V1RB 4MQEA 5KYUB 3G9TA 3ZGNA 2IPLA 3H2BA 2H7XA 2XXAA 4DDVA 3GGCA 5C4MA 3PWSA 5FKJA