2PZKA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
b'SHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
total genus 107
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzkA00
4J1QA 4YT5A 1HF3A 2NU8A 4U0JA 3VPSA 4FBGA 1TLTA 3WXBA 3UXYA 4ND5A 1CYDA 1NQ5A 2HRBA 2PK3A 1E5QA 3RC1A 3UVEA 3PK0A 4MKXA 3AW9A 4KOAA 4CLHA 1U28A 2VZ8A 1DAPA 3K8ZA 5ILOA 2GN6A 3FNHA 3D3WB 3RUAA 2JFGA 1PL7A 2FHSA 1ONPA 4P4NA 2PGJA 4PN3A 3G0OA 2FY8A 3MJCA 3PJFA 4J0EA 3SJ7A 3GMSA 2Q4BA 2HJRA 2ZTVA 1HYHA 3GEGA 4E5NA 4PLCA 4BV8A 4E30A 1KETA 4CR6A 4AG3A 1PWXA 5G0TA 1GQ2A 3WJAA 5A06A 4INAA 3PQEA 1Q0HA 5L45A 5TJ9A 1IZ9A 1VPDA 4IBOA 2DFVA 2H6EA 4BGEA 5TLSA 1LLQA 5FWNA 3ZWXA 3GNTA 2IXBA 4Y98A 3LLSA 2PNFA 4KMSA 3H6KA 4O1MA 4OGWA 2DBRA 1O95A 1OAAA 4D41A 2PH3A 4L4SA 4NJMA 1NVMB 1IULA 3Q9NA 2WE7A 4CLOA 4CMGA 3SLGA 1AN9A 3ZNPA 2NM0A 3HQ4O 4IDCA 5JYDA 4WUVA 4IS3A 5CPBA 1H6BA 1DC3A 3AI1A 5IDQA 4FPXA 2Y68A 1JN0A 3IJPA 2BFMA 4YTEA 2F1KA 2Q2VA 1E3JA 3NEPX 3UCFA 3ZV4A 1SMKA 3S2IA 2PD6A 2PA3A 3I4FA 5FYDA 4BVAA 5F3RA 1SZJG 5ITVA 2G82A 2GUGA 5ER9A 4N18A 3PDJA 1F8FA 3CTMA 4E5MA 1YDEA 4R69A 4UUPA 5KVVA 3GOHA 2Z1NA 1P45A 5EQFA 3ZWPA 1XU9A 4NIMA 1T1RA 4WLNA 3TZ6A 4CV2A 2Q45A 5I7FA 3ONEA 3PWZA 3DTTA 2G76A 2ZCUA 4JIGA 3Q2KA 4CQLB 1R37A 3PQDA 3JYPA 3M1LA 2WYUA 1WW8A 4IMRA 5CG1A 3EW7A 1BXGA 3QWBA 4JBIA 1DC4A 5DCUA 4ZN6A 3WB9A 1GADO 5EIOA 1M2WA 1LRJA 2C5AA 1XHLA 4HKTA 3HDQA 3GZNA 2WM3A 3KLMX 5TSDA 5B4UA 1HEUA 1O89A 3EAGA 2R2GA 3INRA 1BDMA 5A9TA 4GLOA 4FW8A 1W8DA 4JGBA 4S3MA 1P1IA 1DSSG 5JMWA 1V3VA 4ND2A 2OMEA 2QRKA 1NHGA 1U5CA 3MJTA 4K9DA 2I6TA 1ENPA 1WAMA 5HRUA 1GPDG 1E3SA 4A03A 1YS4A 2BELA 2W90A 2PZKA 1A7AA 1YJQA 4D3DA 3ROQA 4PG6A 2ZYAA 4IXWA 2AQHA 4PLWA 2BKAA 5ENDA 4DMMA 2X5KO 3C3XA 4PLPA 2NTNA 1Q0QA 3NV9A 4W99A 4YQZA 4YQYA 1WWKA 3FTPA 3H9JA 4GL4A 3ZNNA 4ALNA 3PZRA 5EPOA 4CJXA 4O5OA 4DQVA 4CM4B 1U4SA 3PLNA 2SCUA 5L4NA 1E1KA 2A35A 1NTOA 5G4LA 3NRCA 2P4HX 4NBUA 5HS6A 4JQCA 1QLJA 3IQDB 3S2FA 5JDIC 2O3TA 3GPDG 3WLEA 4BKOA 3DQPA 2NADA 1RYEA 3VKUA 2OORA 2RH4A 5I8ZA 3AU9A 1CJCA 2JD2A 2CDBA 1PGNA 4I5DA 3PLRA 3W4JA 1DB3A 3L0DA 3EVNA 4XEHA 3DOOA 1YBAA 1G6KA 3HNPA 1PZEA 3TL2A 2VHZA 5U4QA 3ST7A 5ADHA 5TF4A 3G79A 2ZCVA 3ZNQA 5G2OA 3HZZA 3JQGB 1LUAA 3DO5A 3F6YA 1C1XA 4IIUA 4YRDA 1R6DA 2DBVO 3CZMA 3OQ1A 2H1SA 3ADOA 1A9ZA 1TT5B 4FOOA 2NVUB 1ISMA 3WGZA 4B4WA 3OQ6A 3WNVA 1QR6A 4AJNA 1ISGA 2NV6A 2HRZA 2NUAA 4YJGB 1DLIA 1I24A 4JROA 2YYYA 3VHRA 2V6FA 1LU9A 1NBOA 2QG4A 3CZRA 4PRLA 3Q0EA 5L4SA 3AFNA 5GZ1A 2B37A 2I67A 2VHWA 3A1NA 4AL4A 2EKPA 4N54A 2FWMX 1I3MA 3O8QB 4BKQA 1HLPA 3KTDA 4ZHSA 2NU6A 2QZ9A 3PVZA 4CM9A 2A9FA 4K6FA 2VZ9A 1CF2O 3RUCA 2VWPA 3GG2A 4FFMA 3OA0A 3GK3A 2V65A 5C7IO 3HB5X 1DRVA 4GH5A 3MOGA 3I5MA 4A73A 2CY0A 3WGQA 1PJSA 2JD1A 3JQ8A 4XYEA 4DLAA 3VPFA 1P74A 2AG5A 1X13A 3RC9A 4YJDA 2O4UX 2Y0CA 2WD7B 3VZRA 3AY3A 3PXXA 3DC2A 2V6GA 5JXWA 1NPTO 2ZKLA 5IG2A 3RAJA 3JYNA 3FPLA 2AHRA 4YT8A 3CKYA 1LNQA 1EDZA 2NLOA 3JV7A 4ITUA 3HN7A 2C7GA 3DXFA 4EDFA 7ADHA 3ZH2A 2UVDA 1M6HA 2NSDA 1MC4A 3JQ7B 4FFRA 1ARZA 1DAOA 4KQWA 1GTMA 2DTXA 2RHCA 1XIVA 1I01A 3HG7A 1GEGA 2IRWA 4YA6A 4JBHA 2HDHA 3AM3A 2CDAA 3JQCA 4P4GA 1YH3A 3U4CA 1P0FA 3ONDA 4DL9A 4O0LA 4J43A 2DPHA 4Z3KA 1VI2A 2P91A 1EBUA 3ADPA 3OH8A 3VH1A 1TEHA 4B4UA 3KUXA 4WGGA 2O23A 5KTKA 1W0CA 2RBEA 3NDJA 5A4DA 3MEQA 2HUNA 2G0TA 2PLAA 3C1OA 3JQBC 1ONOA 4GAEA 3BMOB 3F3SA 4P8RA 4B8WA 4TMFA 1GZ3A 1QMGA 2CF6A 1X7GA 3F4BA 1BMDA 2WJPA 2QIOA 3PHJA 4RLSA 2FPGA 1XLTA 1R0KA 3RUFA 5COBA 3RWBA 4RL6A 5CDGA 4Q3EA 3IIEA 4IDAA 4PLVA 2O3QA 1ORRA 1OC4A 4BO5A 4CLEA 2GNAA 2AEMA 2E49A 5CAEA 5LC1A 3PTZA 3E5MA 4M55A 4ZRMA 3LC2O 3NDIA 1HKUA 3OJFA 1JQBA 4GPD1 1F06A 5DZSA 2E37A 1XELA 4CQMA 5KVQA 1LRKA 1BXKA 3I83A 3NJ4A 1M76A 3JQDA 4M8SA 3CINA 4FN4A 3ZWOA 1H2HA 2FSSA 2B83A 4NFYA 1EUDA 1KS9A 2PH5A 2VWGA 3QP9A 1N2SA 2DLDA 4D44A 2FPPA 1OZAA 1DC6A 4FC7A 2UUOA 4W6ZA 5A9SB 1NFQA 5BQFA 1CERA 1VL8A 2PD3A 2YHUA 1KOLA 4M89A 3UHAA 4CM8A 4RGBA 4OYRA 2VYVD 4EI2A 3JSAA 1P1JA 2IZZA 2Y1CA 4YT2A 2X4GA 1ZVMA 3OMLA 2Z5LA 4XCVA 3JYQA 2ILTA 1C0LA 1GR0A 1N8KA 4IDDA 4MVJI 5BNFA 5THKA 3ROKA 5FEUA 4E21A 2FZEA 2VN8A 4NK5A 4DWVA 1VKOA 4P4LA 5A05A 1CWUA 3ZV5A 4XGKA 3TN7A 3FBGA 1JVBA 3TDKA 1ZK0A 4NQZA 3E48A 1U4OA 3NAQA 1CQIA 3DBRA 5TC4A 3V8BA 5K6AC 4R1UA 1K3TA 1Z6ZA 2B69A 2X5JO 1UZMA 1Y5RA 3FSRA 4EUFA 3C24A 2NACA 1UZNA 1GCUA 4G5HA 3VDRA 4BO3A 4CMIA 4CR7A 2QRLA 1GDHA 1GV1A 1RM3A 2QHXA 3DL2A 3M1AA 5ITWA 1WDMA 3HJAA 3D5QA 4UVIA 4DLLA 4IGEA 4DREA 2VTDA 4E4YA 3I6QA 2ZQYA 1CIVA 5BSGA 2VHVA 1VJ0A 1LJ8A 4ND1A 1E3WB 3WGTA 3GLQA 1PZGA 4ZJUA 3HHPA 3JTMA 3A9WA 3M2TA 1GUZA 3VVBA 5TIIA 3RI3A 2Q1WA 3U4HA 3UW3A 4RVHA 2Y93A 4DA9A 1N1GA 1AGNA 3QWFA 3H9GA 5ER6A 1HL3A 3GY0A 2WE8A 5F5NA 3CPSA 1ZUD1 2P9CA 3D7LA 2HMVA 4DRYA 4IY1A 3TL3A 4UREA 1WDKA 3L9XA 3GPIA 3OECA 2IE0A 3S55A 5JY6A 4RVDA 1T4DA 4NFHA 3LYLA 4DVJA 1K0UA 3DBHA 4CUZA 1H9AA 4F6CA 2VT3A 2HO5A 1BDBA 2CMDA 2RAFA 4M54A 1NAIA 3VPGA 4R01A 3BMCA 4A5OA 4EJ0A 2GGSA 5CDYA 3DAFA 4AJ2A 4XWYA 3ZGYA 1ISIA 3LT4A 4W9NA 5JSFA 3DBLB 2O2YA 4JBGA 1A72A 1DOHA 2PTGA 1UXGA 3TRIA 4DC0A 2FPIA 3F9IA 2JCXA 4BNJA 3R3SA 3DMYA 4J3FA 2ZJ1A 4D79A 4K1LA 4XYMA 5AXCA 3P5SA 3WGGA 3P2OA 2D59A 3FTNA 4Z0TA 5KWEA 4MDHA 3ETGA 5F5LA 1LRLA 1MG0A 3ZU5A 1ULSA 4KWHA 3TZCA 1GU7A 2PZLA 3AUTA 4D42A 4BNMA 4R1TA 2EEZA 2O50A 3B1JA 3E03A 3ITKA 1QYVA 4FDAA 4GX0A 4ZQEA 4ALIA 1PJCA 3W6UA 4Y6PA 3NGXA 1A27A 4M1QA 1PZHA 5HA5A 4L4RA 1NXQA 2I66A 5DOZA 1PQUA 3U62A 1Y9AA 3EK2A 4OH1A 1I2ZA 3ONFA 1X15A 1VSUA 1MGOA 2ZTUA 1NVTA 3BHIA 2J6IA 3C1TA 3GC6A 4NBVA 1C0PA 5DT9A 3B20A 5I9NA 2VRCD 5JMPA 3JYLA 1FK8A 1E0DA 3QIVA 5KJFA 4NBTA 3PHLA 1Q7GA 4RVSA 2FMUA 5I7VA 1Z73A 1Q7CA 4WCFA 3KYBA 1H94A 4MVJG 2DAPA 4O59O 1IPEA 1LQUA 1WXDA 1E77A 2XPCA 4J9VA 5G4KB 5MDHA 3F47A 3SC4A 3NKLA 1HYEA 3AI3A 3KSZO 3PYMA 4FD3A 2CVOA 4J1SA 1PTJA 4ALLA 1UAYA 1G0OA 2UAGA 2X0NA 4FFNA 1CRWG 2X9NA 3C1AA 3JD2A 1MFPA 1QG6A 5ICSA 3CUKA 4BMNA 3LSYA 1LX6A 4NK4A 3H5RA 3RJ9A 1AE1A 1DBVO 2I3GA 3T7CA 1D7OA 3ZHZA 4R68A 3ZW9A 3TPCA 4PG8A 1C3VA 4OXYA 1X1TA 4I08A 3RASA 2YV1A 4FOSA 3G3EA 4E0BA 1FXSA 3QV1A 1E1MA 3T4EA 3JQAD 1T2FA 2DVMA 4B7UA 1VLLA 1SOWA 3S1LA 4DPKA 3EVTA 4FCCA 3IMFA 3DZGA 4JN6B 1HE4A 2Q3EA 1DEHA 2X86A 1X0XA 1A71A 3WOHA 4CM3A 4BB6A 3RC7A 1T1SA 4AJEA 3RU7A 3AUAA 1JVSA 3JD4A 3ZWVA 4CV0A 4GX2A 2OBNA 1ENYA 4KDEA 4YPOA 2WYWA 1KVQA 2YHIB 4QO7A 2B4QA 4WOJA 1B8UA 5L7YA 1R4MB 2FOIA 4CM5A 2ZB3A 1NFRA 1QYDA 1H6CA 2WSBA 3EUWA 1J49A 2NTVA 3ZWCA 5GZ3A 2DC1A 4EEXA 3LVFO 1EVJA 1BW9A 3L4BA 4ZICA 1QV6A 2Y1EA 1I33A 3JCZA 1XDWA 4OKNA 3RBVA 5KIAA 1QYCA 4GKBA 2EJVA 2HMTA 1KVRA 1NFFA 4J2OA 3HDYA 1O94A 4PZDA 5COAA 1LI4A 3GFGA 3PYXA 4YACA 3SXPA 2D2IA 4AJLA 4Y9DA 5DULA 3TNLA 2JAHA 2HK9A 1ZNQO 2PKRA 5A03A 1MG5A 4CMBA 2HAEA 4LCEA 4RLHA 4CMHA 3Q11A 3DAPA 1EFLA 4FFPA 3PIIA 3WTCA 4Z9FA 1E1NA 1PX0A 4TQGA 3FI9A 2IODA 4PLYA 1NQAO 2EF1A 4JNKA 2IYPA 4E5KA 5IFLA 4WLOA 4NU5A 3JD0A 2P4QA 4XB1A 4O63O 2O3SA 1S7CA 3D3WA 1VE9A 4UEJA 1LDGA 3WIDA 4ILKA 5C3MA 3Q1LA 1KVUA 3PYLA 1I2CA 3OM9A 1EMDA 1G0NA 3N7UA 1QP8A 3WGIA 1PQWA 1IPFA 3GA0A 4FS3A 4GX1A 3K30A 1ZSVA 1ZXBA 1Y1PA 4J4BA 2PFGA 4JJFA 3BMNB 5LDGA 3V2GA 1K5HA 2P9EA 1RM4A 3AM5A 3PPIA 2Y1FA 4IGFA 2AQ8A 3IUSA 2Y66A 3LQFA 3BZUA 2VNSA 2HKIA 1RM5A 1T4BA 2BD0A 1W73A 2VYND 2ZTMA 3WG9A 1H0KA 3C7DB 1FJHA 1P1RA 1O0SA 2YV3A 3ENKA 1WDLA 3ASVA 3LK7A 3JYOA 4I5FA 3SLKA 1SEVA 3OIGA 1GL3A 4NHEA 1R0LA 2FR8A 4IDGA 5IAAA 1JTVA 5L40A 2I5PO 3H7AA 1BWSA 5CEJA 5JFOA 1LBEA 1EUZA 1WP4A 1E6UA 3CEAA 2JCVA 4MVJA 4FQ8A 2VNAA 4HXYA 4BMSA 4AJHA 2I3AA 1XA0A 1JA9A 4RQTA 1UXJA 3A28A 2WMDA 3IOYA 4E32A 2EGGA 2O3UA 3H5AA 4MO2A 4LISA 2DQ4A 4AICA 5KJ6A 1ADGA 2O48X 3IP1A 3ZWBA 2OFPA 4YJFA 4IXTA 2EIHA 5DP2A 1C0KA 1KYQA 5DNAA 5A9RA 1QKIA 3ZV3A 3QW2A 4WEQA 5KVCA 2IDZA 2NU9A 4BO8A 4LMPA 4Z9XA 2NQ8A 4OQYA 1HETA 2ZJ0A 3A06A 4RDHA 1TXGA 1NVGA 2FR1A 1IY8A 3TOZA 2VUSA 2FP4A 5L4LA 4B8ZA 2JFHA 2JD0A 4XA8A 4CQLA 1Y81A 1HE3A 3QWHA 1E7YA 1PGOA 4QT0A 5C37A 4XX0A 2B5WA 2J5RA 5TQVA 1FDSA 1ZO8A 3NT2A 1H2BA 3OJOA 4E2ZA 1LDEA 3GVXA 2YW9A 1BRMA 4PZEA 3SVTA 3W4KA 2R00A 4BNZA 1IHYA 2E82A 4OXKA 4UEKA 4Z0PA 4J4TA 3VH4A 5B12A 2XAAA 4CMEA 4CPDA 2JHFA 1WVGA 2JL1A 3VH2A 1FDTA 2BFOA 3DZKA 5EL0A 1H6DA 2WD8A 4QQRA 2O7SA 2YFQA 4E3ZA 3N58A 4RJTA 4M87A 3FNFA 3I9LA 3JD3A 5H83A 1I32A 2PGDA 3EDMA 3WGYA 1AHHA 2YQ4A 1ZEJA 1ZK1A 1ENOA 1LA2A 3I9MA 4FFOA 5DBIA 5AXAA 2ZIZA 1B2LA 3AM4A 1SBYA 3RBZA 3KRTA 2Q46A 4AJKA 3H9EO 3KETA 1ADBA 1Z7EA 3WQSB 4BGIA 2EW8A 4YAIA 5A5FA 1UP4A 1ULUA 1GEEA 4CM4A 5AOVA 2AMFA 2CDCA 1PWZA 3UGKA 3WBBA 2D3TA 2DFDA 4BO2A 4WLEA 4RPLA 3JQFA 4AJJA 3VZPA 5KNLA 4YXFA 4KTTE 4KP7A 4NJMB 4PIVA 3E1KA 3PZBA 3RFXA 4HWKA 3QVTA 2AXQA 4UEOA 3LC7O 2GO1A 4ZA2A 1B26A 1MUUA 3TJRA 4F3YA 1PR9A 1Q7BA 5L53A 5U1PA 1GUYA 5HM8A 3V1UA 4ONEA 1PJ2A 4TZTA 4MIEA 5A1TA 1OC2A 4CL8A 1Y8QB 3Q9UA 3GNQA 2NVWA 5HBRA 4IJWA 1P1HA 2Y0EA 5JDCA 3V1TC 3AOGA 4YAJA 1PJLA 4DMLA 5IZCC 1XYGA 3E18A 1VL0A 2W2KB 3NJ8A 3PWKA 2C07A 3G1TA 3HN2A 4MVJH 2AA3A 1GAEO 4M49A 4R41A 1BG6A 2O7QA 3D64A 4XJSA 4E2YA 4BNFA 1N9GB 2PZMA 3JQGA 1RWBA 1T2EA 3FR7A 2PKQP 4HNGA 3FD8A 4JLWA 2Y1OA 3ZHBA 4PG7A 2RIRA 2W8ZA 1ZMOA 4B3HA 3GZ4A 5EQDA 4U5QA 2GRAA 1U2DA 4IS2A 1XCBA 3BXXA 1BXGB 3U5TA 1GYQA 1EBFA 2XXBA 4YBZA 2OOSA 3WYEA 4G2NA 4N5NA 3GZNB 3PJGA 2UDPA 1SEPA 4URFA 3WJ7A 3I9KA 1K2WA 1YXMA 4Q39A 3B1FA 3ANMA 4Y6SA 5KJEA 1SB8A 5B1YA 3O8QA 3AU8A 3F5QA 2IZ0A 2CNBA 4NMHA 3HWRA 3OEYA 1DIRA 4HFJA 4BQRA 2D4AA 3EZYA 2YJZA 1J5PA 4MKRA 4L75A 4UUNA 1DXYA 2DKNA 4GSKA 3ZU2A 4ND3A 4ALKA 1HSZA 1LLDA 1OI7A 1TVEA 3FRJA 2VWHA 2GZ2A 1EVIA 1SAYA 4FJ1A 3AK4A 1TT7A 1QRRA 3NTRA 3WFIA 2FN7A 3KYCB 3VH3A 1AXGA 2B5VA 2C5EA 2WD7A 4LK3A 1N1EA 3BA1A 2Y1DA 3AUUA 4QFCA 3K9QO 4YAGA 4GWKA 2TMDA 4B4OA 3IJRA 2GN4A 3DMTC 3MJVA 1VKNA 2XOXA 3H2ZA 3E9QA 4E5PA 1B7GO 4YT4A 3OIFA 3QVWA 4MIOA 4RO0A 5T8KA 2D1YA 3GNSA 3I9JA 4PGFA 5T5QA 4R1NA 1W6UA 4JK3A 1E7SA 2HMUA 3SJUA 4YDRA 3ANLA 2G5CA 3BMQB 3ZWYA 1EZ4A 4TRMA 4YYZA 3W8EA 4BNVA 3DBVO 1EEHA 3VVCA 3DZBA 4BO9A 4AJIA 5MGBA 3H4VA 5TS3A 1UDAA 1I8TA 2VUUA 1Z7BA 4XDYA 3STHA 4BNNA 4XYBA 2E6UX 3WSWA 4E5YA 3W8DA 2JCYA 3MJ4A 4UUMA 4CUJA 3MJEA 2B4RO 1I3LA 4JJGA 4BMVA 4I9HA 5JNLA 3EHEA 1ZW1A 3H65A 2AQKA 2AG8A 3JQ6A 1Z82A 1UZLA 4A7PA 4MVJE 4CODB 2W4QA 1ZK2A 1XU7A 4E33A 1U3WA 3VZSA 2WYVA 3I6IA 3V1YA 1U9JA 3DDNA 4R3NA 2P5UA 2YFHA 1R4NA 4XIYA 3DFUA 3GUCA 2X6TA 3DB2A 3OJ0A 1FMCA 4RF2A 3RUDA 4PCVA 2ZTLA 1ZKMA 1IOLA 1P77A 5IDWA 2YZ7A 2DBQA 3GDOA 1BSVA 1FF9A 2TMGA 1QV7A 2FR0A 3AY7A 1T2AA 4U6QA 1IYZA 5IDXA 4XGIA 1NPYA 2X5OA 2X1HA 3ZNOA 1WNTA 2BHLA 4RPJA 1E6WA 1U7HA 5KKCA 4WE3A 2AEFA 3ORFA 2NNLD 3MWDB 4IMPA 3VPHA 4LN1A 1Z45A 4WOKA 3JQ9C 1U3UA 1E3IA 3GN2A 2GR9A 2CUKA 4WCDA 1Y8RB 2IYOA 4WASA 2DTEA 1LLUA 4LMRA 1A4UA 2VQ3A 1M66A 2Q99A 4DIBA 1D3AA 2JHGA 4HBGA 3EC7A 2HU2A 3ZWWA 4DC1A 1XWFA 2D0IA 4FGWA 4Z6KA 4BNIA 4C7JA 4IIVA 3ZWAA 5CPFA 1Y9EA 2O2SA 3HFSA 4GMGA 4C7KA 1KIFA 1E3LA 2GLXA 4YCAA 3W4IA 4AJOA 4NBWA 4BUCA 1D8AA 3AOEC 3EYWA 2J8ZA 3PDUA 3D4PA 5EESA 5BSFA 4RVFA 3DAGA 2EKLA 3INTA 4GI2A 1NQTA 3M2PA 1HDZA 4IJUA 1B14A 1ZFNA 2BFAA 2JFFA 2GN9A 1KVTA 3K2EA 4BGUA 4DPMA 2XXJA 2DUWA 1GYPA 4ROSA 4LVUA 4XYGA 4KUEA 3QSGA 1B8PA 1EQ2A 3QWIA 2P68A 4Y8VA 3MJSA 3UCEA 5JC8A 1D1SA 4DPLA 4OL9A 2R6JA 4B4VA 4RQUA 4BNXA 4QSMA 2GPTA 2VZ0A 2VHXA 1RYDA 3RJ5A 1UDCA 3QA9A 4PZCA 3DOCA 4CMJA 3GAFA 4BO7A 2UYYA 3WQRA 5JY1A 1HTBA 3SX2A 1E3WA 3BYZA 1SNYA 1YL6A 5EMHA 3VDQA 2AE2A 4A10A 1YBMA 2XF8A 3C7CB 3LDHA 3QQPA 2ZATA 1DFIA 4NDNE 4NR0A 4C4OA 5L51A 5IZCA 3MOIA 1ZJYA 3L4SO 2Z95A 3DZHA 5K9ZA 3MTJA 4GVLA 2EHDA 1DRWA 2HLPA 4MIYA 3CSDA 1DHRA 4I1IA 1LC0A 4RDIA 3WS7A 1GFSA 1UH5A 3ETDA 2X9VA 2QW8A 3I1JA 4LRSB 3OHSX 4YRBA 2EWMA 2X0IA 4Z0HO 5KJ1A 3WGHA 1MA0A 2PD4A 3DZFA 1YQDA 3E8XA 3RUIA 2GERA 1ID1A 3PEFA 4IUYA 3RQSA 3CMCO 5JDIA 4GQAA 2I76A 3K5PA 5AVOA 5TX7A 1ADFA 4HFRA 2O4CA 4B3JA 1R0SA 3DBLA 3FWNA 4L0QA 4NG5A 1Z74A 4JXKA 4WK6A 4XB2A 4BO6A 4G81A 2HK8A 4MVJP 3QVSA 3D1LA 2H63A 4CQMD 1Z75A 1A9YA 5H81A 4CM7A 4DYDA 2YV2A 3KSDO 1UP7A 1P44A 2VWQA 2HJSA 4YAKA 3D4NA 3MTGA 3OJLA 4Z9YA 2Q1SA 4WJZA 2ZK7A 1V35A 4XJTA 3U09A 1YB4A 3W8FA 4EUHA 1C1DB 1ZK3A 3BHMA 2Q2WA 2VOJA 5T64A 5I7EA 2VRBA 5AXDA 3WX0A 1X0VA 1WZIA 3GMDA 3OBBA 4AVYA 1K6XA 1ZJZA 1HE2A 2GYYA 4BNGA 2Y0DA 4CLRA 4W4TA 3U4DA 1V8BA 1VRWA 5IXSA 4R1SA 3GQVA 3Q2IA 3GRPA 3W6ZA 4D7AA 4FFLA 4GGPA 5DBFA 1EE9A 2J3HA 4RF5A 4L8VA 3CIFA 4MJLA 1L7DA 2CF5A 3O26A 3PGJA 1UR5A 3QRWA 1P33A 4ZVVA 5L95A 4BS9A 1AUPA 1J6UA 1YDWA 5F1PA 5JAZA 2ZB8A 2NU7A 1IL0A 2GZ1A 5COQA 3V2HA 4RVGA 4RZIA 5EERA 5JYEA 3OIDA 1QLHA 4OIMA 5TRTA 4ID9A 3ZWMA 3MWEB 2BI8A 5DDIP 3RKRA 2A92A 1Q1NA 3PGXA 4R5HA 3LU1A 4NFSA 1VJ1A 3KYDB 4LVCA 2A4KA 4RF4A 4ZGWA 4DUPA 2HSDA 3ABIA 2EERA 1NNUA 4CV1A 4RPKA 5FF9A 4ESOA 4DBZA 4BOYA 4A2CA 1EQUA 3DBHB 4HP8A 3R3JA 3UCXA 2X9GA 1KEVA 3NGLA 4JP2A 2Q4EA 3DTYA 2P2SA 6ADHA 3JQAB 3BMCB 3KO8A 4XDZA 1AXEA 3MCVA 3S2GA 2GN8A 2BGMA 3WR5A 4KTVE 4BIIA 5I9LA 5IDYA 2JKVA 3G49A 1X7DA 2YHIA 2QRJA 3EMKA 1ZSNA 4YAEA 1EFKA 1ONNA 2ET6A 1IUKA 4KQXA 1R4MA 4BO0A 3NT4A 4IQGA 3ROMA 5JW6A 3TFOA 1XSEA 4IDEA 4ZD6A 5IJZA 4PLTA 3AI2A 1LDYA 2PWZA 3TQHA 5T57A 5U9CA 2I99A 4TRNA 2Q2QA 4MOWA 1X1EA 1NWHA 3JQBA 4R9SA 5G0VA 3U3XA 4AJ1A 5CDTA 4Y67A 3WBFA 3WYCA 1WZEA 3I52A 1IB6A 3RD5A 4TSKA 3ZU3A 1DO8A 8LDHA 4NZ9A 1NQOA 1EK6A 1F17A 3B6ZA 3ZV6A 3WTBA 1TB4A 2W2LA 2PZJA 4YRAA 2E4AA 2W98A 4L4XA 1CEQA 4ZQGA 5L3ZA 1C0IA 3X2EA 1XR3A 3ZI0A 4FR5A 4Z3DA 2GSDA 5JAQA 1Y6JA 4JP3A 5JS6A 3L9WA 4D43A 5TJHA 4PRKA 2H9IA 1GCOA 2J5QA 3GGPA 5FI5A 4UUOA 3QY9A 4I9NA 1EVYA 1V3TA 5A3VA 5JCJD 2BF7A 4YJHA 3D3EA 1R16A 2C59A 4KUGA 5L7TA 3E9NA 3BMNA 2H5LA 3I9OA 3GDFA 3X2FA 3FF4A 4D46A 4RORA 2DTDA 2PKQO 1NASA 4RF3A 3WFJA 2Z1MA 1VC2A 2I65A 1UUFA 1UAGA 3U49A 1J4AA 4LRTB 3WIEA 2GDZA 2P5YA 3I3OA 3FHLA 1U8XX 4J90A 4RPGA 2AW5A 2FZWA 1T2CA 3DEYX 1P3DA 1B15A 3WNQA 1XG5A 2ZB7A 1JAXA 1DC5A 3C8MA 4UAGA 1JDJA 1O5IA 5ES3A 3RROA 5G0SA 3LZ6A 4IJVA 2G1UA 3N74A 4BNTA 5K6AA 4CMCA 1E6EA 3M6IA 3C7AA 2Y99A 5DP1A 4IDFA 1XQ6A 5BNIA 4II2A 3FWZA 1GZ4A 2OXIA 1ZIDA 3KBOA 3H8VA 3A4VA 1H9BA 3WMXA 5B4TA 5B37A 3NTQA 3UAGA 5GMOA 1KVSA 1YE3A 4E6PA 3GR6A 3CXRA 3KEQA 4PG4A 1PJBA 1V9LA 2GZ3A 2NWQA 4PLGA 4J7XA 5C7OO 4DIOA 4ZQBA 4H7PA 5JBIA 3V2UA 1I3NA 1I2BA 4A26A 1PS0A 5GY7A 1PL6A 4IZIA 1YOVB 1JKIA 1D4FA 1KBZA 1DJNA 4XQ9A 4W82A 3CE6A 1CQJA 1V0JA 2EKQA 2PV7A 4P38A 3LC1O 1B0AA 1ADCA 5GZ6A 4DXHA 2NQTA 3F5SA 1GY8A 4A27A 1EK5A 1GV0A 3TFQA 1YJ8A 3IAHA 3L6EA 1GZ6A 3T7EA 4QXMA 3HSKA 2QYSA 4IQ8A 1YL5A 4CMAA 4LW8A 4UULA 1YL7A 4ZQFA 4MP8A 1MV8A 3UICA 1M67A 4CV3A 4TKLA 1DRUA 2WTBA 5LDHA 5I9MA 5EJ2A 3H9UA 4BNLA 5A5EA 7MDHA 4BNKA 3K96A 4AJ4A 2GASA 4BHTA 1EDOA 3GAZA 3K2BA 4XYLA 2CZCA 1DIGA 1P9LA 1UJMA 1WMBA 3NYWA 1YQXA 3SEFA 3ASUA 3GRKA 2J3KA 4BKUA 4RVUA 5KOIA 3B70A 3P7MA 5F1OA 1ZEMA 1A7KA 1E7RA 1PU2A 4D3FA 1PQPA 2BRUA 3RVDA 3ON5A 3C85A 1O9BA 3GVHA 4E31A 3AUSA 3Q3CA 3DWFA 4FJ0A 5B4VA 3IP3A 3ZHXA 4IPTA 3KSUA 4E13A 4EBFA 4GGOA 9LDTA 1YB5A 1UXKA 5AQ1A 3H3JA 1DIHA 1PGJA 3H2SA 2YDXA 1B8VA 1ZBQA 3ZZNA 5HWSA 1VM6A 1VJTA 1XGKA 1YBVA 2HMWA 2P9GA 3IDSA 5KVSA 1Y8QA 1KY5A 3FPCA 4OAQA 4B7CA 3FN4A 2C7VA 4OO3A 4UVHA 2OP0A 4Q3BA 4YJFB 1QYXA 2W2KA 3BIOA 1E3EA 1GPJA 1YWGO 1I0ZA 2EV9A 3S8MA 2WEKA 4JX8A 1SOVA 4HV4A 1U2GA 1N9GA 4Q3NA 1F0YA 3TZHA 4GKVA 1N7GA 1NR7A 4FC6A 4ZU3A 1NYTA 1LDNA 3FCOA 2Q1TA 5DCYA 2VT2A 4L74A 4XQCA 3ZCXA 4QEDA 4O6VA 2RHRA 3G17A 4MVJD 5H82A 5CEEA 4KUHA 3KZVA 4BGVA 1I10A 3QE3A 2DM6A 2Y1GA 4CLOB 2G17A 3B1KA 4NH4A 4HADA 3VOSA 4NBRA 1W4ZA 1HSOA 1U3TA 3WDSA 1N5DA 4TROA 4OQZA 3UFXA 1BXZA 1F14A 4YEDA 4NI5A 2IXAA 4BV9A 4PVCA 4ALMA 5ENVA 3UOGA 3OETA 2EP5A 4F45A 4J4HA 4U6SA 4WLFA 4OKIA 1QXSA 3GHYA 3OA2A 5THQA 4NU6A 4DTIA 3S2EA 5DOVA 1ZZEA 1TT5A 3VPXA 3EGOA 2B0JA 1YB1A 5CEFA 2NVUA 1YO6A 5BNTA 4NNJA 1HDXA 1VL6A 5A3JA 1SB9A 5EINA 2A94A 1PJ3A 1LDBA 3KYCA 4OOEA 1LSUA 2OBYA 1BHSA 3FBTA 2BGKA 2YDYA 1NAHA 4H16A 1LSSA 4GWGA 4YJGA 1YVEI 1YONA 2D5AA 2C54A 3F46A 2EGHA 5DBGA 4E2XA 4MP6A 4HUJA 5JPIA 4MPDA 3IS3A 2YQ5A 4R51A 4BQPA 3PFFA 1L1FA 3NT5A 3PHHA 2E48A 3BMQA 5TGDA 2DT5A 5A04A 2EG9A 4BNYA 4CLXA 5A02A 5IN4A 4J1TA 4K26A 5JO9A 4I8XA 2J3IA 5BR7A 1MLDA 3O4RA 4EZBA 1A4IA 1SPXA 3UKOA 4D3SA 1RKXA 5TT1A 1U7TA 3FNEA 3HDJA 5DN9A 2DPGA 1IE3A 2ZYDA 4BO4A 2OHXA 1UXIA 2V6MA 4XZ3A 3QVXA 1LC3A 1NX6A 3UN1A 1N92A 3GVIA 1LQTA 4HNHA 4UVEA 1ZK4A 3F1LA 3ICPA 3DHYA 4II3A 4BB5A 1FDUA 4XR4A 1PJQA 4DIFA 1JLLA 4EUEA 4QO8A 1P0CA 3GVCA 3RFVA 5TT0A 2DU8A 1OBFO 3JQ7A 3QLJA 4KDFA 1KY4A 3HE3A 1ZCJA 4NJOA 3JQEA 1FDVA 3SC6A 1RM0A 1U5AA 4J7CA 4W9NC 3RBXA 5C5IA 1Y5MA 1KEPA 4XQEA 1HDCA 3ROPA 4ALJA 1DIBA 3DFZA 3K6JA 4LGVA 3AY6A 5JC1A 4S1VA 2X22A 1YQGA 5AYVA 4OSOA 3PP8A 4YR9A 2X0RA 1NR1A 4EW6A 2B36A 4MKZA 3WWZA 1SCUA 1MXHA 4RV9A 3U4IA 3BTSA 1K89A 5IXYA 2RCYA 1BVRA 1HDGO 3AJRA 3CH6A 4YVFA 5L7WA 3WSVA 2GF2A 1C1XB 2HQ1A 3HB4X 3I9NA 3U9LA 3BMOA 2D8AA 1ISFA 1DIAA 1HDYA 4BNWA 4J1NA 1MP0A 5DCWA 1Y8RA 4TRJA 1IHXA 1JU9A 2Y05A 4MP3A 1J0XO 4MVJM 1MXFA 2AQIA 1ZMTA 3WLFA 4PLHA 2CVQA 4R4JA 4JCOA 2CSUA 3E6AA 3GG9A 2VYVA 2OO5A 1HYGA 3OEWA 1UXHA 4OHUA 1QSGA 2CVZA 3WGOA 4U8GA 1HZJA 4QX6A 1K6JA 5EN4A 3VZQA 4HX5A 3P19A 3U0BA 1P1FA 5C7LO 3OFSA 1OOEA 4WCFC 3ITDA 1YKFA 3IL2A 1O6ZA 1Q2XA 4L76A 4CM1A 4XD2A 3R1IA 1KC1A 1JAYA 4U0KA 3TF5A 4CMKA 5JCXA 4F46A 1BTOA 4FSHA 4GVXA 5A9SA 2BFPA 3LF2A 1UP6A 4MINA 3LLVA 4UVGA 2PR2A 3JQ8B 4IZHA 4E12A 1LSJA 3R0IA 4HFMA 5HS4A 1EUCA 4R9RA 1NHWA 1M75A 4W7HA 3LT0A 3LF1A 4PG5A 3TWOA 3ETEA 3DONA 3O03A 3VKVA 3GDGA 9LDBA 1LDMA 4L73A 1JKJA 1QYWA 1TA4A 1F12A 3ENNA 3GEMA 1PZFA 4CM9D 4BNUA 3KV3O 3RSHA 3GF4A 1L7EA 2ZQZA 2OL4A 3NUGA 4GMFA 4L9RA 1MC5A 3WICA 1WPQA 4IINA 1MX3A 2EXXA 1GD1O 5J23A 1R4NB 2Q50A 3KXDA 3MZ0A 2AEJA 4EJ6A 3PWSA 1YRLA 1HDOA 4WKGA 4H15A 4WEOA 1XQ1A 1X7HA 2QX7A 4RPHA 1DPGA 2J5KA 2HMSA 1E7QA 2C20A 1XKQA 4DYVA 2X7HA 1Y7TA 4XRRA 1HZZA 3PFWO 1LEHA 1DHTA 4DQXA 3L4BC 3QVOA 1PS9A 2JAPA 4J6FA 4TVOA 4TVBA 5TNXA 2QZZA 3RUEA 3UF0A 3ZU4A 4QFDA 3H9QA 2CFCA 1HT0A 1XEAA 3WWYA 1JKFA 2CD9A 2POQX 4Q9NA 1JW9B 3ZW8A 5CG2A 5CDUA 2C2YA 3ULKA 3NDRA 4F6LA 5FFFA 4MVJF 3TZQA 3INGA 3QJ5A 3GGOA 3EY4A 4WLVA 1DJQA 1YGYA 3KB6A 4J49A 1SO8A 1LTHR 1PIWA 4P22A 4Q3DA 4I9UA 5LCXA 3GVPA 4X54A 1R15A 1GQYA 3WQQA 1E7WA 4J2HA 3TSCA 2I9PA 4CQMB 4UVDA 3IC5A 3OJEA 1NM5A 4GLLA 3DHEA 3DZIA 1EE2A 3VTFA 2HK7A 1C1DA 3QHAA 4QUKA 1B3RA 1HE5A 1E7MA 4K28A 4AFNA 4TRRA 5G0WA 1G1AA 4G65A 3RFTA 3L77A 3GGGA 1LLCA 1B16A 1OFGA 4DLBA 4WPGA 3OQBA 4GBJA 5BSHA 3PJEA 4CM8B 3HADA 3VTZA 1GYRA 2Y67A 1MB4A 3GEDA 3GFBA 4TZKA 4EITA 4GX5A 4BNHA 4HFNA 2OGUA 2BGLA 4FJ2A 1R12A 1ZSYA 3E5RA 5AXBA 1E5LA 4OMUA 2VRCA 3TZKA 1SC6A 3K73O 4XIJA 2NVBA 5I8WA 4R16A 5BSEA 1JWBB 5I7SA 3PQFA 1ISJA 3WYBA 1RJWA 2D5CA 3LT2A 3BTUA 1AHIA 5G0UA 3KLPX 4D0RA 3VC7A 1C14A 1PS8A 3DOJA 1PGPA 3DBRB 3W1VA 2O3RA 2RH8A 8ADHA 4OJNA 3UUWA 4EEZA 4WNIA 4B7XA 4W7IA 1OMOA 4XGNA 3KM0A 2X23A 1ZH8A 4FIZA 4OOFA 4IQ0A 2B4TO 1UDBA 3F4LA 1HDRA 4J9UE 4CUKA 4KZPA 4LSWA 3RC2A 2DBZA 3KYDA 3PIDA 4CMIB 1F8GA 1JWAB 2PGLA 3E9MA 4LSMA 1MFZA 3DMTA 3EZLA 2VCYA 4IDBA 1EVZA 3K31A 1P31A 2PY6A 3H5NA 1H93A 3ANNA 1NWCA 1KEUA 3RUHA 4HY3A 2IEDA 2BLLA 1PEDA 3CMMA 2EJWA 4ND4A 3ZHYA 2ZB4A 4PFJA 3JQAA 2OP1A 3NX4A 1ENZA 4CLDA 4R54A 3RKUA 1T24A 4B79A 3Q6IA 2B35A 3AFMA 4XR9A 2LDBA 3VAZA 4J0FA 5G4KA 4Y6RA 2UUPA 1DFGA 4JJIA 3PHIA 2BH9A 3IKVA 5K0ZA 3T4XA 3COSA 1PSDA 1U1IA 4XRGA 1BVUA 2J3JA 2FRDA 3L07A 3D5TA 4WLUA 3GH3A 2R00C 3BAZA 5CDSA 2OUIA 1R66A 2VUTA 3I23A 1KERA 4CMEC 2VTEA 4TWRA 3ZDFA 4DBVO 4PVDA 4PLFA 3OICA 5JCJA 3FNGA 3LT1A 4LCJA 1TI7A 4D45A 3UH1A 4K6CA 1RPNA 1U8FO 4XKJA 4AJPA 5JAIA 1N7HA 3E82A 3PI7A 1V6AA 3OF2A 1QORA 4OSPA 3KOUA 4CLRB 1O8CA 3SBOA 2C0CA 1NP3A 1M6WA 4DGSA 3P2YA 3OSUA 4PLZA 1I5RA 1ML3A 4DQUA 1HXHA 2UV8A 4CR8A 4IJKA 3JD1A 2OZPA 4EJMA 4OM8A 2F00A 1X14A 2GCGA 1D1TA 3RU9A 1FDWA 4Q3AA 3OP4A 1U3VA 3GUYA 4J16A 4QTZA 3JQFC 5IZ4A 3AWDA 1LXCA 2IEBA 3G1UA 3BHJA 4KWIA 5FI3A 2V6BA 3JQ9A 1A5ZA 4R5MA 1HLDA 2LDXA 4EYEA 4RCVA 2YUTA 2C82A 4N5LA 1B3BA 1DLJA 2QQ5A 5JDCC 3D0OA 2O3JA 5IF3A 4J7UA 4QECA 4FB5A 1E92A 2IZ1A 2BMAA 2VYNA 3GN1A 4IM7A 2C2XA 2DUUA 2HCTA 4N5MA 1V3UA 4J91A 4CL3A 5HTOA 2ZYGA 4N7RA 3KEOA 4OXNA 3ICCA 3AOEA 3DR3A 1GQQA 4XQGA 4WCFB 4B3IA 4FGSA 4TKMA 3V5NA 1H5QA 1I30A 2NTJA 4RZHA 2GD1O 1T2DA 1H6AA 4I5GA 1T25A 1KC3A 2FSVA 5CFZA 6LDHA 4ZRNA 2BI7A 5CHEA 3RIHA 1Q0LA 2WWRA 1IZ0A 1PR3A 4H3VA 3PRJA 5ILGA 3IKTA 1BGVA 3RCBA 3A14A 1PL8A 5KKAA 4BO1A 5T6BA 3L6DA 2EW2A 1CDOA 3DZJA 3WMWA 5JAMA 2WDZA 4CM6A 4E2WA 4M86A 1ZXLA 3ZN2A 1I3KA 1CETA 1WMAA 5KJCA 1LSOA 2Q49A 2EP7A 1S6YA 4BKRA 5JLAA 1PGQA 1ISHA 2JJYA 3F1KA 3KHUA 1YOVA 1PJ4A 1T26A 4A0SA 5JO0A 3HDHA 1DFHA 3GHHA 4R3WA 4BL5A 2X58A 3H3FA 4BKPA 4NPCA 4U7WA 1WLYA 3ZWNA 1PJTA 2V7PA 4WECA 5L9AA 4Q3CA 3I4CA 3BTOA 1HWYA 2Q1UA 1P1KA 1I36A 1HRDA 2VOEA 4D0SA 3R6DA 3HFGA 3TOXA 1NPDA 3KVOA 1KEWA 4GSLA 1DDOA 5T8KC 1GUFA 2QYTA 2AE1A 2X0JA 3NTOA 1VSVA 2C29D 1BW9B 4EGFA 3IUPA 1E1LA 5KCZA 4WNCA 3O38A 3K92A 4YJHB 4YWJA 5IN5A 2VHYA 3GT0A 5ICMA 3HUDA 3DHNA 5F21A 2W2LD 4YB8A 5CP8A 3FR8A 3PHGA 5JE8A 3BTVA 5BT9A 4I5EA 2YY7A 5F1KA 3PJDA 5DF1A 5T67A 4ZQHA 3D4OA 2X8LA 1K6IA 3O9ZA 3L6OO 3QWAA
chains in the Genus database with same CATH superfamily
4GKJB 2CHQA 4YT5A 3D6TB 4U0JA 3VPSA 1L4NA 1TLTA 2YFYA 2OQRA 5IHPA 1JP7A 3H2GA 4ND5A 1CYDA 2HWYA 3D81A 1JIVA 3LO8A 5CM8B 3SIPA 2XNHA 3BCHA 1ODSA 3P27A 4MDYA 4MGKR 4WN9A 3PK0A 4KPYA 3GJTA 1GXSA 3E3MA 1CJKC 4AUEA 3H87A 1U2SA 2ZYVX 4ARCA 5A1JA 4RMGA 1E3QA 2A9VA 3TAUA 2D2XA 2I87A 2JAXA 3IUQA 2Y71A 3IIIA 4F2DA 3DF9A 2JFGA 2FHSA 3JZDA 1PF7E 3AB3A 3C41J 4N6OA 3PNLA 4KB5A 2O8VA 3EG9A 1WU7A 3NEJA 2FY8A 2PYDA 3GMSA 3DLIA 1XD9A 1PZNA 2ZTVA 1HYHA 5MN5A 1W34A 1M6VA 1CJBA 3F3KA 4PLCA 4BVEA 5HRAA 5E9AA 3H19A 2IC5A 2LIPA 2MSWA 3A3KA 1V4NA 3SQNA 1MRSA 1SCIA 1WUYA 3AHIA 1CR2A 5G0TA 2BM8A 2PSHA 1A1SA 1OF1A 4PX5A 1WL8A 1U2EA 3R0JA 1I14A 5TJ9A 5KX5F 5KYKA 4RGQA 3DLCA 4QM7A 2WNSA 3GCGA 3STVA 2X1MA 2H6EA 2OLJA 3G0BA 4UDXX 2DPXA 4B74A 5HGXA 1VJCA 3BD7A 5CNMA 4WY8A 1G5PA 4B3BA 4KMSA 1L7RA 2QZSA 4O1MA 3QE2A 2DBRA 3UHOA 3LFHA 2A8YA 1VHTA 1F2UB 2PH3A 4WL0A 4YX9A 1JNYA 4O02B 2G36A 4LRYA 1TU4A 1K63A 1Q22A 3P9RA 4CLOA 1TUBB 2NUBA 3VPDA 4ER3A 1Y4ZA 4WUVA 1Y5LA 4RKRA 2ATXA 2Q62A 4BECA 4L3VA 1JJIA 2X6RA 4P53A 5KSZA 2YKGA 2I4MA 1JN0A 3JAWB 1LPNA 1O97D 2BFMA 4FHFA 4KXUA 1EBBA 4DEXA 1QHGA 4J07A 1DZ3A 1W9HA 1SMKA 5B58T 3M6FA 3SYRA 2PD6A 3I4FA 3K0BA 3P97A 5CIWA 5FOVA 5FYDA 3WGUA 2XSZD 5TMEA 1SZJG 5ITVA 2G82A 1I94B 3C16C 1L6IA 4JLOA 4HX9A 2CLFB 2IU4A 4RD1A 4E1BA 4XM0A 3ESDA 5KVVA 3OT4A 2BFCA 4A6XA 4WMLA 3RRNA 3DT6A 5KC9A 3A6DA 4CV2A 2Q45A 1NN3A 4Y6OA 3HVJA 2GETA 3HKCA 2PZGA 2PQ6A 2CLDX 4JIGA 5CLHA 3ZE6A 4BMYA 4AB1A 1SZDA 2SNIE 2VNIA 1QIFA 3HMQA 4RHEA 5LKAA 2XCSB 1GSIA 2C42A 4H2DA 3EBOA 3EW7A 1J8DA 2RB4A 5DCUA 4GMXA 1TFUA 1F9EA 2OCDA 2JVIA 5EIOA 4MGIR 4BX2A 1R50A 2QRQA 4KQ6A 2QY9A 2WSYB 4DJ5X 3GZNA 5BN4B 3THOA 5IVKA 1JQ5A 1FUEA 1MVOA 4KODA 1FU7A 3UV7A 1JR3D 4ZPJA 2WM3A 3TXXA 2VLIA 5B4UA 2XA2A 2N9UA 4ON9A 1SKYE 4YV2A 3KXKA 1UKBA 1GA1A 2BW0A 3MTAA 4S3MA 3W5CA 2QBYB 2C8LA 3NXSA 1LB1B 1V3VA 2WTMA 3GP3A 2OMEA 2QRKA 4DLSA 5JMWA 1GZHB 4N5HX 4UM9B 1OTXA 2OWDA 1C2TA 4QFBA 5DH9A 3WFZA 3I04M 4A03A 3EA4A 1A7AA 4Q34A 4XIFA 3IHLA 3ROQA 1QTRA 4UHFA 1FSSA 5GOTA 4PLWA 1ZL0A 2EFCB 3IOMA 4Z4QA 4K87A 5KHOC 3KZCA 4MR7B 3A4LA 2PAFA 5IMBA 1E69A 3SYMA 1MAUA 1Q0QA 3PGLA 1WWKA 3H9JA 3ZNNA 5J5CA 4HAZA 5EPOA 1IFXA 4E09A 3FDXA 1VI6A 5BNWA 4L16A 4CM4B 3AL0C 2V4UA 4Y1FA 1NTOA 5G40A 3NRCA 2PSSA 3U81A 2ZSKA 4RH3A 3M81A 1X7YB 4HDMB 4JQCA 1JPUA 3AETB 4Z86A 3S2FA 4MK4A 1VL5A 2YWXA 5CW2A 4HGQA 3QOYA 3TLCA 2O3TA 3VJLA 5IUKC 5BR8B 1GAJA 1Z18A 3TPZA 3DQPA 5K3CA 2XD4A 3UWMA 3K0KA 4LGCA 3WLEA 4AY6A 5P21A 4LIPD 2GCNA 4JQYA 2CDBA 5AOBA 3IP8A 4H0FA 4DG5A 5I4IA 4QPDA 3L0DA 1IBKB 1T6BY 4XEHA 1FY2A 5CX4A 1G6KA 6PFKA 1PZEA 3TL2A 4CTOA 3GLKA 1Q3TA 2OLKA 4IJ6A 5U4QA 5B7PA 5CA1A 4Y1GA 3ZNQA 4WOPA 4E6EA 2O8EB 1RW4A 4JP1A 3HZZA 1HQKA 1JG4A 3JQGB 4I8DA 4P5PA 4BFVA 4X64B 4HDSB 4ZYZA 3IXMA 5AKZA 5K8TA 1QZUA 2PVCA 2R6CA 4YRDA 4AX8A 1KFEB 1XK7A 1AZWA 3RRMA 4Z7NB 2FEOA 3KLNA 3OQ1A 2H1SA 3QF7A 1RPAA 3GJ0A 5IJ0B 3A9RA 5DASA 4K88A 5H02A 5JNUA 1BHQ1 2VJLA 3MXTA 2Q29A 1ATIA 2XLCA 4Q18A 4LTNA 3RIGA 3P94A 1KDOA 1T1JA 4W9MC 3G9TA 1YS2X 1N3YA 1D2CA 5EZYB 3WHKA 3OQ6A 4QASA 3WNVA 1SULA 3EZ6A 4DNQA 2PQ2A 4NPHA 3L4KA 1J0DA 2XCIA 3WIOA 2NV6A 1HURA 1WEKA 2HRZA 1LWOA 2NUAA 4JROA 4J3JA 4Y9UA 3VHRA 1NU8A 2V6FA 3VR2A 4F85A 1NBOA 2QY6A 2W2TA 3WC4A 1XHEA 2QN6A 4MYSA 4WKOA 3LHKA 2EKPA 2H1HA 1YAJA 3PUJA 2FWMX 1I3MA 1HLPA 1OGYA 3IDQA 4R1PA 2IHJA 5GJWC 4CM9A 2Q1YA 4EFKA 3KELA 2VO1A 5JNWA 3FOFC 4LHVA 3T1HB 3LCJA 2BYTA 4QARA 3DNPA 1MC1A 1X80B 4IEEA 3W2HA 2MYTA 3RUCA 3FMGA 3WGMA 1KPGA 1D2MA 3ZHOA 5B36A 2OT3B 5L6MB 5EE5B 2QPTA 2W2VA 1ZNWA 4RD0A 4WDRA 4PSDA 5BSTA 1JYSA 4I1PA 2ZSJA 4GH5A 4YV1A 4TKUB 2G5PA 2AN5A 3A1CA 4PYIA 3ZOZA 4BB0A 2ST1A 2CY0A 3WGQA 1PJSA 2JD1A 5ITZA 1P74A 2UUBB 2O54A 1KO5A 4LGMA 4B85A 1AQJA 5K8LA 1UOPA 2ZANA 3OCUA 3OKFA 3AY3A 4UEQA 3PXXA 4BWYA 1TMYA 3DC2A 4J75A 5E4YA 2AFIB 4INZA 5DNDA 4ZICA 8GPBA 4BEJA 5IG2A 3FPLA 3ZXSA 2OGWA 1N2CB 2YVKA 3OM8A 5IF9A 5LXTF 1H2YA 1ZJJA 1EDZA 1Z26A 2Z2KA 2A3NA 3BQNB 3JV7A 2AZ4A 1YU9A 2OCGA 3CF4A 4E1VA 1ATZA 5IKMA 5C35A 4KR2A 3HU2A 2BF4A 4HB3A 1JGTA 3LW7A 3C3CA 5HKBA 3VR4D 2HGSA 1M6HA 2NSDA 1MC4A 1GL9B 1F8XA 1KYVA 3T41A 1ARZA 2FW1A 4KQWA 1AV6A 4EA9A 1CRPA 2WNHA 1I01A 3HG7A 3KR9A 2IRWA 5CVDA 4YA6A 4EGAA 2ZBFA 1WCYA 3E35A 1G3UA 1KJYA 1QM5A 2CVPA 4D8XA 4ENUA 4WX2B 3JATA 4MS1B 1L7MA 3KG2A 3ONDA 4DL9A 3OU2A 1Z2OX 4W6QA 5KWIA 3NZEA 4J43A 3THYA 3JWGA 3CJQA 5EIFA 2P91A 1RQ2A 1R3DA 1VSTA 1T8YA 2K5UA 4ECEA 2G4CA 3HP7A 3O3OB 4GNRA 1TEHA 3ETNA 3KUXA 4ZOEA 2O23A 1UPBA 2V7QA 5GWXA 4JT4A 5A4DA 1XMVA 3PR3A 4C2UA 2OCBA 4CIDA 2HUNA 3NB0A 2G0TA 4CKCA 2WA2A 2IXFA 2YJ4A 3C1OA 3LY5A 3LCUA 2ODNA 3BMOB 4P8RA 4COOA 4KGXA 1GZ3A 2W6OA 1W5EA 1DBPA 2MT9A 5KNDA 3F4BA 3H0KA 4C89A 2B6NA 2WJPA 3PHJA 4QYTA 1EP1B 4RLSA 3QBVA 2REQA 2IYWA 3AGPA 3KZKA 5FHRA 3UAVA 1Z63A 3IR5A 5K4GA 2WUFA 3AR3A 4P33A 4RL6A 3HGQA 2DY1A 1FS4A 3NIFB 4LY9A 3TD9A 3SDZA 4WOCA 3UIEA 1N5MA 1DCFA 4BNDA 4PLVA 1JILA 1ORRA 2O3QA 2QXUA 2YN2A 2CXUA 2IZOA 4QOSA 3RSGA 4BO5A 4YUAA 5K0BA 3PTZA 4FFSA 2Q5HA 3HWX1 4KW7A 3SR3A 3NDIA 1HKUA 2I4RA 4DF3A 5ADWA 3L43A 1QCCA 3HBMA 2E37A 1EH5A 3QXJA 1XELA 2IF2A 5KVQA 5LJIA 3I83A 3ZWOA 2GZAA 1M76A 3FZNA 3JQDA 2REXB 4FN4A 3KFXA 1H2HA 5A0FA 2B83A 3Q7SA 4L8YA 1ZI6A 3LGSA 4YRIA 1J56A 3M3HA 5IK2A 3GJSA 3QP9A 2D1SA 2NYUA 3ESRA 1OZAA 1SELA 2EJBA 1DC6A 4RS4A 2HHAA 4DHEA 4RCYA 5BPFA 3STWA 2YVUA 3QHPA 5FUXA 4IYJA 4EKEA 3Q9SA 1CERA 1ETUA 1RXUA 1UK6A 4BU1A 1VL8A 5AW6A 2PD3A 2YHUA 2WKWA 1KOLA 2HNKA 3AV3A 4AWBA 4CM8A 5CFNA 2QT1A 1JEQA 2CMHA 3HP4A 5JQGB 2HQRA 1DAHA 1P7CA 4OYRA 3ICQB 3TM5A 3IUJA 3JSAA 3NBXX 3QKWA 3BEDA 4EI2A 1CDDA 2QD2A 2QVBA 4AYTA 3OMLA 1LBSA 4DM4A 3PCRB 3OZCA 2BFNA 4YRSA 4JL6A 2GPJA 2WMNB 1FYWA 3ZDBA 2ZCJA 4WKBA 3R7DA 5J58A 3EIWA 5BNFA 5KI6A 1JSCA 1YS6A 1XFAA 1GZUA 1W6RA 4MVJI 2EVWX 1JU3A 2JLQA 4TQUS 2FZEA 1GR1A 1LW7A 2IKSA 3EISA 2ZFUA 3HLKA 2DB3A 4P4LA 2VF5X 3JQQA 2G8NA 2GAJA 5CM2Z 5GV8A 1ZK0A 5FA6A 4MROA 5K6AC 4OG2A 4CCYA 5HZHA 1KI6B 2CDRA 2IYUA 5ALWA 2BMVA 1C3XA 1Z6ZA 2B69A 2C88A 2PCJA 2R751 3Q12A 1DKLA 4BQEA 1NVUQ 4LOKA 3FSRA 4LJYA 4MS4B 4Q66C 4YAOA 1PN3A 1RI4A 3C24A 1G8FA 3D59A 2FDXA 4JBXA 4K1XA 5IJAA 3RS2A 3KAKA 4BO3A 4NLLA 5EUQB 3UB4A 4CMIA 3CZQA 4GOJA 4DIMA 2RHDA 1KFCB 2CWDA 4HNUA 4DRZA 4XPIA 2ZI9A 4Y0NA 3SKVA 1BVHA 3MQ2A 4XD7A 5KVCA 3V4RA 4NAHA 2P0AA 4DLLA 2AVNA 2HIGA 4EYGA 4ESVA 4IGEA 1HO3A 5AOAA 1C9KA 1NKVA 3CRW1 1MRNA 3CWZA 1OZFA 2YC2C 1BEUB 5FBRB 2VTDA 3ZLUA 1EGHA 5JAHA 2ZQYA 3LYAA 3E7PA 2J9GA 2V96A 1E3WB 4MPPA 4DDUA 2RJ3A 3VSAA 4QGGA 3WGTA 1L6RA 2CYBA 2RCNA 4HAVA 1U80A 5BUQA 1SZCA 3UK6A 3HHPA 4S0ZA 1D2EA 1LBIA 4FONA 4KK4A 1GUZA 1RHQA 2AR0A 1MAWA 2Q1WA 3U4HA 2BP7B 3UW3A 4EW2A 4UMEA 1XD8A 1OWNA 3T34A 2OV3A 5EQJB 4DA9A 4PYJA 5AIAA 4CW7A 1II9A 1N1GA 4J94A 5BWMA 1HL3A 3GY0A 2WE8A 1Y6GA 1QHEA 1EX9A 2J3MA 2WFZA 3CPSA 4HDKB 2IS1A 4FDUA 4CCAA 2VZEA 1NLYA 4IY1A 2AX4A 4UREA 5D3QA 3WLKX 4DRYA 3LFUA 1GSAA 5ECGC 2JJ2A 4MB2A 4C0JA 1LF5A 2O20A 3S55A 3LQQA 1VLMA 4RVDA 3TTYA 4NFHA 3VMMA 3LYLA 2XUAA 3L1JA 5E3HA 5HKAA 1K0UA 2OVBA 2YZGA 3DBHA 2F8LA 2RI6A 3IBGA 4OBXA 4OATA 2VT3A 4OI4A 3NH9A 2CEAA 2RAFA 3GJQA 3VPGA 4I55B 4Q4JB 2VDVE 4EJ0A 5MFZA 3NDBB 3K1AA 3QU7A 3CXUA 4D97A 5D7BA 1ISIA 3DR5A 3JZAA 3WWDA 4XWAA 1LY1A 4M1YA 1NL3A 3MBIA 4U6NA 5K99A 4QTUB 1BKDR 3T4PA 4EG0A 2JCXA 1OWOA 3L1KA 1XZ8A 2V0GA 3DMYA 1TEZA 1V8PA 4D79A 4WSOA 4XYMA 1K7FB 3FDZB 1AZLA 2D00A 3M82A 1AKTA 2D59A 2I1QA 4H1UA 4Z0TA 5FOTA 5F5LA 5LNK1 2OV1A 4LHXA 2PZEA 1CZOA 3ZU5A 1K5DA 3AT1A 2YICA 3F98A 1I1HA 1GU7A 2PZLA 3AUTA 1G4UR 3B1VA 3BH7A 3LBAA 1AF7A 1ZH6A 3QPWA 2O50A 1MB2A 3E03A 4XSGA 1QYVA 1VIAA 2DHCA 3KTAB 4ZQEA 1AA9A 2Z6QA 3TUJC 1EAYA 4GHWA 3NGXA 2ZIWB 4B0OA 1A27A 5F3WB 1WF3A 3BWCA 3JSXA 1VKZA 1L4GA 1L7PA 1NXQA 3L0CA 4LOAA 5DOZA 4ZMBA 1E98A 1Z0AA 3EK2A 4OH1A 2DCUA 4FI3F 4BC0A 4C7BA 1X15A 4ENTA 2VTBB 1X19A 1X1SA 1MGOA 4LC9A 3BHIA 2J6IA 4YAUA 3C1TA 2BT4A 3KBBA 4NBVA 1KRWA 2VT7A 1AKNA 2GCOB 3T5BA 4BE9A 1PYOA 3CX7A 1EWKA 2ODEA 1WF6A 3U17A 7ABPA 3D7NA 4RVSA 3O2JA 5B1HA 3RREA 1WULS 3QUAA 8ABPA 3QTLA 4NAUA 4BTLA 2FUG6 1Z7WA 1MB3A 3AR4A 1Z68A 5CVCA 1ZJ5A 5H4HA 3EIHA 4ANFA 1IPEA 4JNCA 4YRZA 2WFLB 2FMTA 4HVTA 4RGYA 2H1RA 1NNSA 2ZVDA 3EPRA 4B9AA 4LYDA 3CUWA 4EMUA 1RU3A 3HJCA 2F1JA 3AI3A 3OQOA 2P4EA 4UCQA 1AKEA 3BK1A 1XZAA 4BE4A 1SHJA 4BLUA 1OH6A 5JRJA 2X9NA 2WUWE 4NU0A 4ZCQA 2P7IA 1II8A 1QG6A 1DADA 3HFJA 2OHOA 1S9DA 3ECSA 3AHJA 1UMDA 1GARA 1AE1A 4EQZA 1T9KA 2BTEA 2QD1A 2C92A 1JIUA 2VJYA 3CHYA 3G0DA 3MAGA 1DWPA 1U7PA 4I9GA 1TM2A 4QYWA 3BFPA 3OFKA 2P79A 3OPYB 3G7UA 4HGRA 4ZO9A 3C6YA 3TPCA 4GKKB 4YJ2B 1SUBA 5NULA 3PLAE 2YV1A 5KNCD 5K3DA 2AJBA 4MW5A 4R2KA 3TDMA 3WLOA 3UWPA 4DDKA 3BRCA 3JQAD 1JLMA 1WX1A 2TECE 4RSHA 2QGNA 4B7UA 1JIKA 2BGUA 3S1LA 1AG9A 4DPKA 5HQ3A 3BZBA 3H83A 5LWQA 2O1WA 5EXTA 1O7JA 4D4LA 2X86A 1ZD9A 4C4PA 4AJEA 3CY6A 5BWLA 5IJXA 3AUAA 5EJ8A 3JD4A 3ZWVA 3ZDZB 1TJNA 3V1KA 3TVTA 2KS6A 4CV0A 2OBNA 5C32A 2XGSA 3L7KA 2J9FB 4WA7A 4KDEA 3SGLA 1P8JA 3G5LA 3PHBE 4UTVA 4QO7A 4JFAA 4DABA 3OZ7A 4P4SA 2G72A 3IMEA 1B8UA 1YB7A 4UEWA 5L7YA 3WGVA 3M1IA 2GCEA 5B3JC 3BMXA 4OHFA 4L4YA 1PT6A 2FX5A 2VYFA 1J49A 3EUWA 4OQQA 3T0GA 4C4RA 3S68A 4EY6A 2PG3A 4DLKA 5GZ3A 4TTRA 4DN6A 1NG9A 3S5JA 1EVJA 4D9JA 1BW9A 1EK2A 3L4BA 1BWRA 1QV6A 3CKKA 1I33A 2WJ3A 1XDWA 3JCZA 3LRPA 4I66A 1KI2A 4IDHA 1QYCA 4OKNA 1FEZA 2UZIR 1TQ4A 2EJVA 2HMTA 2EOAA 3K16A 4Z9BA 5E1DA 1NFFA 1U8CB 2W0SA 3ORQA 1MABB 4D4HA 3SXPA 1SKQA 4LHYA 3ZZ0A 2DFTA 3T7JA 1M0EA 5J63A 2QWXA 2AXEA 3VR6H 3DW3X 5DULA 1QX3A 4C29A 3BRWA 4EQ6B 1ZNQO 2PKRA 5DNEA 3TQRA 3T1TA 4CMBA 5L4NA 2Z4SA 3V6LA 4RLHA 4RMHA 2RFLA 5I9BA 4WI1A 3DAPA 1EFLA 1XRPA 3KJXA 1HQCA 1I1OA 1KMNA 4G01B 5BYBA 4F84A 1U0GA 1PX0A 3CM0A 3DDCA 3NR2A 4IOKA 4C4YA 3PQ5A 1XPRA 4DRXB 1W49A 4KNVA 2BR5A 3PITA 5BQ5A 2EF1A 3AHCA 2EZ9A 3K0AB 4JNKA 1ZU5A 1ZIPA 2I7DA 3QI7A 4WCVA 2GYUA 3ILXA 4L22A 2TSYB 1S7CA 3CT4A 4NBSA 1SRQA 2OHJA 3DT9A 4HX2A 5HIIA 5C3MA 2HA0A 4ILKA 3N86A 4NAVA 3KHTA 2ATEA 2VHQA 3BIWA 1T2VA 3GGDA 3OM9A 2ZYHA 1G0NA 5C4IA 3SQOA 3WGIA 4CHGA 1ZH4A 4HH0A 1PT5A 1U2ZA 2QTWB 3I9V6 3C1UA 3OSZA 3NVAA 2W93A 4A2PA 3CUVA 5A5GA 1E63A 3JZFA 1BD4A 2AFHB 3BMNB 3GLHB 3MIZA 4JJFA 5LDGA 2P9EA 3UNXA 1UJBA 4NEHB 4QLAA 2LW7A 4IGFA 2Y1FA 2ZJBA 5AJWA 1DL5A 1IAVA 1ZMBA 2CNNA 1H4TA 2XMCA 1RM5A 5IDVA 3WG9A 1W73A 2ZTMA 3I8OA 3ENKA 1P1RA 1RXWA 1WDLA 1SEVA 3OIGA 4XX1A 1WKBA 1GL3A 2ZBRA 1MQ9A 5FPTA 3UJPA 3I45A 1N4AA 1DE0A 2I5PO 3B78A 4UDNA 4ZAGA 3H7AA 3EEQA 3W78A 2P8SA 2BEWA 5CEJA 5JZBA 2Z3WA 2D5BA 1EUZA 3BXPA 4D26A 2CWWA 1XZHA 3JASB 4Y1RB 5F9MA 1LS6A 1HR0B 3FW1A 2F64A 1C7RA 2NUPA 2VR1A 1V5GA 2VNAA 3BFVA 3OC0A 4FQ8A 4AS2A 3LNCA 2R44A 3FCEA 3KVRA 1XA0A 4RQTA 1XZIA 1C2YA 1Z33A 2QU8A 4F5WA 3IOYA 5ETJA 4G37A 2EGGA 2IHUA 3H5AA 1UDRA 3PQ7A 2I71A 2ZULA 4MO2A 1VZ2A 1XQWA 1V11A 1HMYA 4KX3A 4Z54A 2BM9A 4CG0A 3IP1A 4JLKA 2X7JA 5DP2A 1P0QA 1JR3A 1YZGA 2I7TA 1I7PA 2A1TS 2F3UA 4L8LA 1XQYA 4QU9A 4EELA 5DSXA 2B0CA 3EDQA 3G82C 4HZUA 3RUPA 3VVMA 3H11B 2IDZA 3ZV3A 4OJTA 2A7QA 2HYDA 3ZBPA 1Z0DA 1HETA 1YJCA 4ZWNA 3H2KA 1UAAA 1SVLA 4LMBA 4RDHA 2F2TA 2FR1A 3H0CA 1JEYA 2QXTA 2BFEB 2F4NA 4GRDA 4MGZR 3KZNA 2JFHA 4RELA 3PXBA 4D9NA 4A3SA 1Y81A 1BKSB 3OI7A 4JIMA 1VJ5A 3IRUA 3QWHA 2AKYA 3IH5A 3RTCA 5B3KA 1K6EA 1S96A 1RXIA 2ZE5A 1UIRA 5EIXA 3R7LA 5LSAA 4KYVA 4BAUA 1OB5A 4OHYA 7MHTA 3MLBA 4O8ZA 2YXBA 3ASZA 2NOAA 3ZUGA 1ZAYA 1G3IA 1Q95A 4X61A 1LDEA 4I1RA 2YZNA 3LRTA 5FIUA 4HNRA 4WZBB 3D4IA 2E82A 5EEGA 4UTNA 1AUQA 1RHKA 3QYJA 2JHFA 1WVGA 3ASYA 4KWTA 3AVQA 3A1TA 3MAJA 3UJ8A 4G0VA 3L7BA 1FYDA 3DZKA 3O2SB 1JEJA 2I62A 1RD4A 1SXHA 5EL0A 3LDGA 1QUFA 4S1PA 3WXMA 4E3ZA 4XTCS 4G0WA 3K5IA 3IUEA 1NUUA 4M87A 3JD3A 2JI6A 4AKSA 1TK9A 4EF5A 3Q8MA 1FP7A 5LQKA 4JC5A 2ZUWA 5H83A 1I32A 4OAOA 4Q4HA 2ZXFA 4N5DA 2WVAA 5IYZA 1AUVA 1WXXA 1WMFA 2MYUA 2YQ4A 2RGYA 1ENOA 4FFOA 4JS0A 5DBIA 1U90A 5AXAA 4S04A 2ZIZA 2PUCA 1B2LA 2PJDA 2RI1A 4AJKA 4FCVA 1WXIA 1OD6A 4LY3A 2JJ1D 2P9JA 1R0ZA 1UK7A 1YIOA 1Z7EA 3MTDA 2X9LA 3WQSB 1WXQA 4UNQA 4BGIA 3RG8A 1HZZC 1TZ2A 2EW8A 5FOSA 3L0IB 4M0EA 2FYTA 1WCIB 2C9DA 2DMRA 5FTKA 1UP4A 1KE1A 1GEEA 5K5EA 3L0OA 3IEVA 1SVSA 3TR5A 3IX7A 2CDCA 1J23A 4EPVA 2D3TA 3VOBA 4RPLA 1OROA 3JZIA 1D1PA 3EVAA 3VZPA 3DL0A 2FP3A 1U0OC 4NJMB 4YXFA 5EPUA 3PZBA 2IYXA 4FLEA 4UU7A 2AXQA 3TJRA 2XXAA 1B26A 5CJJA 1PR9A 2OAEA 3PI6A 4GR5A 1FDRA 4MV1A 5U1PA 5LQRA 3ORSA 4TZTA 1Q7EA 5H3HA 2RDMA 1ZNXA 3J7TA 5J59A 2ZQ5A 2I2BA 3SZMA 1DEAA 3LIPA 3TNDA 3GNQA 4IILA 4IJWA 4ZTZB 1JFTA 4I4CA 4IGAA 3V1TC 4FNOA 4CZ2A 2FUKA 4YAJA 4DMLA 1Z6YA 3TTUA 5IZCC 4UM8B 2YIVX 3SNHA 4MI9A 2C07A 1JECA 4MVJH 4YUYA 2OM6A 3FGNA 1WQ4A 3NOOA 4XJSA 3BOSA 2A33A 3L7NA 2C7BA 4FE7A 3L02A 4HH1A 4OLFA 4IUBS 2I2DA 4WBNB 1T2EA 2W6JA 3L8DA 3OLCX 4GW3A 3DM5A 4DR6B 2Y1OA 4M9SA 1QGAA 4AW9A 3F7OA 1PT8A 3O5AA 3UUEA 3DUFA 3L0SA 4IDPA 5DXJA 1FX0A 2GEDA 2O7VA 1U2DA 4PQEA 2CEKA 1CKEA 1FB5A 1WHTA 1FS6A 1ZCBA 3TI7A 5IBPA 1ZA1A 3BXXA 3FSJX 1BXGB 3U5TA 3NHUA 1GYQA 721PA 3MD9A 3VDMA 1N57A 3K1YA 1N7IA 4QZVA 2ONYA 4RXUA 2QL5A 3ONVA 4OXRA 2ZJFA 1KP9A 1ZS9A 2CE2X 3PGMA 1L9XA 3N76A 4MB0A 3EIFA 2J30A 3DFFA 4I6EA 2IW1A 1AO0A 1L7OA 3PJGA 4ML3A 4R2HA 4Z49A 3SLRA 3LKZA 1PE0A 2YOHA 3KD3A 3MT9A 4BLQA 1B6RA 1YZTA 2QD3A 1VHDA 1XOIA 2WTXA 2FLVA 4HEA1 1AUOA 1TF5A 5IEBA 1E6KA 4QXRA 3O95A 5BR1A 3QITA 3NOXA 1U3DA 4LFCB 1F1BA 1IHDA 2VDKB 4HFJA 5D3MB 4BQRA 4AKGA 3GXBA 4JKYA 4UUNA 5KMGA 5GJBA 1DXYA 4ZODA 4MUEA 4RZSA 1C7ZA 4YGXB 2TMKA 3C70A 1A5TA 4ND3A 3TIIA 3OD5A 4G0MA 1JPNA 1OI7A 1TVEA 3BE5A 2EFYA 3KP1A 2GZ2A 1X8LA 3L8YA 5DMXA 5E4FA 1GUDA 2LIVA 5CFMA 1JAZA 1VECA 4Y30A 3PS9A 5FD8A 4TYPA 4RHUA 4EUSA 1AXGA 4JX9A 1N1EA 1SHLA 2VTVA 2AOTB 4MLPA 1WBBA 1GQSA 1HPLA 3ISJA 3CLTC 3K9QO 4PQGA 4KIUA 4YAGA 4GWKA 4D96A 2JLBA 3Q3EA 3M89A 1NJGA 4KIWA 1XTPA 3T9FA 4F4DA 4PO9A 4E5PA 1LVUA 4LTMA 1LPBB 1VDMA 4TS4A 4YRCA 2X3FA 1JB9A 2SCUB 3DFMA 3OIFA 3LWNA 3QVWA 4RO0A 1Z5PA 2D1YA 3I9JA 3P9PA 1ZGJA 3QY0A 4PGFA 4PZAA 3AB7A 3AEKB 3RFFA 4YALA 3K9LA 3U3ZA 1E7SA 3PD1A 2GBIA 1BIFA 2A1IA 4DSZA 4DR1B 2ZRQA 2H5EA 4F5ZA 3ZWYA 3DCIA 2EZUA 4KLZA 1NF3A 4YR7A 1AB5A 1YR7A 2QTVA 3BF8A 1EA7A 3BXFA 1U0TA 3H1BA 3HCWA 3O8LA 1IIRA 4OGGA 3W8EA 2IUUA 4B75A 3EXG2 1W88A 3X0DA 1NIPA 4MCJA 2CNDA 2KMLA 4FE4A 1ZGGA 5EKSA 3PD7A 3F96A 4OGKA 3F6BX 5GJCA 3MD0A 1RKUA 2CHEA 3MYYA 3P52A 1C7JA 4PYQA 2E6UX 2GZDA 4XFKA 3JWIA 3W8DA 3MJ4A 3HSSA 1NMZA 1E9DA 4CUJA 4PEVA 5B6IA 3P96A 1RC8A 4PFSA 4ZOLA 3SR4A 2B2XA 3AYZB 1FRQA 3VVLA 4HRAA 5TDHA 5JV5A 1QOQB 1TM4E 1JA1A 1IN1A 3O7WA 2HA6A 2HCJB 4I9HA 1A9TA 5JMTA 2ZRNA 3R8FA 3UYKA 4E22A 4DLNA 3JQ6A 4GU5A 4A7PA 4MVJE 4O4HB 2W4QA 2GJSA 2AWOA 2WHRA 1XU7A 2QL9A 4KO8A 2PGXA 1QGUA 1U3WA 3NBUA 3VZSA 1QVAA 3DVAA 4EX6A 1LNSA 4EECA 4WFJA 4ARSA 5ESDA 2P4SA 3WP1B 3DDNA 3K2QA 2P5UA 1QR2A 2ZZKA 1R4NA 3STTA 3R9XA 3ESQA 1NXTA 1QHHA 1ZWKA 3GUCA 2Q7OE 5F2NA 4TTTS 4KAXA 4CDRA 1YC2A 1UMKA 2Q4RA 4PCVA 5AKLA 2ZTLA 1ZKMA 1XDDA 1P77A 4P84A 4ES6A 2Q0SA 4ZK6A 3OLZA 4UCFA 5SYMA 4CN9A 3ZJ4A 2IP4A 4IWYA 3UPTA 4ZIRA 3K4HA 1AY0A 3UMVA 2FR0A 3AY7A 5FFNA 3OLQA 1FSGA 6Q21A 4XGIA 5DW3A 2WZBA 3HH8A 4ZDKA 2NU6B 2X1HA 1JR6A 4IZOA 1JEOA 4H7DA 5TMDA 3QFRA 4P54A 3L84A 1GOTA 1JQAA 1ZBDA 2XITA 2PDAA 1FE8A 3IT1A 1GFWA 2WIJA 3ZQ6A 4WOKA 2Q2OA 3JQ9C 3U31A 3A25A 4YRLA 2UVPB 4ND8A 5ALDA 4WCDA 1H2FA 4AZ3B 1OGJA 3DPUA 5BN5B 1WVIA 1AKWA 1RS0A 3LL7A 2VQ3A 4QOJA 5AM2A 1B00A 4AKIA 1D3AA 1OFUX 4HBGA 3QX8A 2HU2A 3AZPA 5EAIA 1D4OA 1XWFA 4G8BA 1WZCA 2VP5A 2YVAA 3WSTA 5TQ0A 2JANA 3FA2A 1CP2A 4D8WA 1I6KA 1KIFA 4R0MA 5CB4F 2HYIC 3HJGA 4BFZA 3KU4A 4PFQA 4MYCA 3VSDA 3VYTB 4EARA 2ZYRA 5EWMB 1I6WA 4BUCA 3EYWA 1RHRA 2J8ZA 3PDUA 4IAOA 3D4PA 2DECA 5D51S 4NICA 3S2SA 2CK3D 4YUWA 3DAGA 4JLBA 4GI2A 3IR6A 4HGYA 2PUVA 1NQTA 4U5XA 2ZBGA 4YP9A 3M2PA 4EGJA 1HDZA 5EIHA 3I5YA 2WZQA 1RBMA 1ZFNA 1KSJA 3SSNA 1N3IA 2BFAA 2PXHA 2JFFA 2GN9A 1KVTA 4OXQA 3EPJA 2YIJA 4OB6A 4ABYA 4PPFA 5CFOA 2FSVC 4UUBA 4P3OA 2J46A 2EP8A 2VPTA 4G89A 4HZGA 5G02A 3ENVA 3QSGA 5ULLA 3SQMA 4FZJA 3BERA 4Y8VA 5LUBA 3UCEA 2WTUA 2J7PD 1D1SA 1EUCB 1SJ9A 1EESA 1UBOS 4EF6A 4ZCSA 3AKDA 4OL9A 3H2YA 3ZVMA 4C3OB 2QX4A 4B4VA 4OYHA 4KXMA 1HQDA 2PVPA 1RHUA 4PGHA 1SM4A 5JXHA 4G4SO 4C4ZA 4CKEA 5L8VA 3EYAA 5I3CA 3AJDA 4KL8S 1PFGA 2J9XB 2VZ0A 4ZKEA 5GONF 2VHXA 1RYDA 3VU3A 2WT9A 5C52B 1Q44A 3KKQA 1UIMA 5HGJA 1PR1A 1QBGA 5FUWA 4CMJA 3CB2A 3GEEA 2UYYA 3OURA 2XYHA 3V8MA 5LP6B 3IUBA 3AB8A 2DEUA 3BXHA 4MA5A 3KT6A 1J06A 1JDSA 2CNWD 2YYSA 3LDHA 4YECA 2C96A 1DFIA 4UBIA 3N5CA 1BS2A 1UFVA 4NR0A 1AJEA 4C4OA 3HSYA 5A5VA 4V0SA 5CBPB 1BN7A 4YRRA 3MOIA 3T7TA 4LYAA 1WXEA 1ZJYA 3L4SO 1JALA 1ST2A 1TYZA 1V9SA 4ESHA 2ZSIA 3A9SA 2EHDA 4M37A 1DRWA 5D01A 4MIYA 2P3SA 1DHRA 1QVVA 2WWIA 1BGWA 2A30A 4L5IA 4RDIA 3WS7A 2DPYA 1UH5A 3B48A 1OYOA 2JA2A 2X9VA 3I39X 1OBOA 4EDHA 4FBMA 2OK7A 4Z0HO 2O6HA 1CUEA 2YMLA 1MA0A 5ALJA 4ZEXA 4DT1A 2Q7XA 3KEGA 1H69A 3E8XA 1PRYA 1O96A 3NALA 3R41A 1ID1A 3EJWA 4L27A 3WHPA 2LRHA 3KWLA 1YD7A 1SURA 5CW1A 1E2QA 5F4BA 4GQAA 3K5PA 1MO4A 3NATA 4DQKA 4BNGA 1UPXA 1NXXA 2Z6VA 4X3OA 2WJYA 4YUVA 1CY7A 3D3NA 3DBLA 3S1AA 4B3JA 3FWNA 3NWBA 5F2EA 1UBMS 4WK6A 4KI0A 3NPAA 1DJLA 2HK8A 4G81A 1EGQA 1OWLA 4MVJP 3CF0A 3SY8A 2RE8A 1NRWA 1D09A 2ZWPA 3HCDA 5I6DA 2YNMD 4X66B 4B17A 2B20A 2YV2A 3F6CA 3KSDO 2QMZA 1UMCA 3IOEA 4BAZA 4Q01A 2P9HA 2HJSA 2Y9MB 3VC3A 4B3CA 1KZGB 3D4NA 1WUIS 3MTGA 1Z0UA 5CVEA 2P11A 4NCHA 2DFKB 1XZDA 2IJGX 1YS9A 4D98A 4FYKA 5C4MA 3R7FA 2RD2A 3JVEA 1ZN2A 1RYFA 1NBAA 4GSYA 3HU1A 1GGNA 1Q1BA 3BHMA 4Q19A 4RJJA 3U7EB 2ECPA 2YS6A 3IAM1 2AC4A 1KRXA 3OJXA 2AR9A 3WX0A 4F97A 3GMDA 1WZIA 2DJ5A 3FMFA 3OBBA 3EDRA 4D4GA 1XKTA 4RM3A 1K6XA 1GTL1 1XXHA 2DGDA 1KWKA 3U4DA 2UKDA 4ARAA 3SM9A 2ZUBA 3M6MD 2V0NA 1RQLA 4G23A 3CW8X 4QAQA 5D5HA 5J1TB 4LNUA 4UXJA 3LVBA 3GQVA 4HQLA 3IIKA 3M3DA 4B8YA 2H57A 2YZMA 4QDXA 2BWJA 2FPLA 5CT4A 1EE9A 3LBYA 2Y77A 3IHWA 3CIFA 1T5BA 3GJXC 3M70A 4S12A 3F2VA 3ZTWA 3O26A 4DA6A 1QU3A 2JFNA 4D5EA 5KNCA 1QGOA 3A1DA 1AURA 1P5ZB 3GT4A 5EZQA 4WHMA 4AS3A 1J6UA 1H2XA 2VP9A 4ZVQA 5HIJA 4TQ9A 4DCGA 5CVJA 3KQQA 1ZGCA 1IY0A 3KQVA 4OL0A 1SZPA 5COQA 3HFRA 5JYEA 3LQYA 4YLEA 4EVQA 2W2MA 3DOIA 3LUCA 2JBHA 4WDQA 2HB6A 2Q3BA 4OIMA 1BX1A 5EJ4A 3K35A 3ETJA 3GRUA 2BSAA 4P83A 4BN4A 1AKRA 3I42A 4BPBA 3RKRA 2HIHA 5IJWA 2I33A 2BKEA 2WF5A 3LU1A 3QNWA 4HMPA 3KYDB 5BV2P 1QIGA 2C61A 1TRKA 1KAQA 4X9XA 3BB4A 1UZAA 1W5AA 4Q15A 2HSDA 4Q7EA 1ITZA 3W9BA 4CYMA 5LD2B 2EERA 4C05A 2R8RA 2FFQA 1G9TA 3BGSA 1NNUA 1P2UA 3N6XA 2J4FA 1G60A 1DEXA 2EJCA 1E9RA 3MBOA 1NVVQ 1V25A 2HY7A 4HP8A 5JZVA 1IG3A 3UCXA 2WAMA 4J6EA 5AK5A 2LE0A 4M8KA 5C1BA 4NS1A 3C48A 5JZ9A 1UMBB 1GZVA 2XA1A 2YJNA 2B1IA 2D62A 3Q7PA 1DOAA 3IIJA 3QPDA 1EB9A 2H4XA 2BGMA 4XDZA 5HBGA 3M83A 5BT8A 4BIIA 2R8OA 1T3TA 5I9LA 1T0HB 3N2KB 3TCXB 3LX8A 1Z2DA 4EG3A 4YCJA 2IOYA 1GILA 4C87A 5DYTA 2ABWA 1SQ6A 3AG5A 4KO1S 3HU3A 2R6HA 2ET6A 3BIXA 3R0ZA 4E5SA 3NT4A 4IQGA 5JW6A 4YPFA 1XSEA 3NBAA 4IDEA 1YVPA 2JRLA 3V1NA 3RSLA 2PWZA 1KZ6A 4YGYA 4H4CA 1QGDA 3ABZA 5JVDB 4MOWA 4LY0A 1X1EA 2FUCA 5H0IA 2LCQA 4TXNA 5G0VA 3U3XA 3WL8A 1JYFA 3PT9A 2X41A 3PD0A 3WBFA 3NCHA 1QRTA 1NONA 4P80A 5JD6A 1RTTA 1U3CA 1A8PA 1D0SA 4B3FX 1NDUA 1F17A 3B6ZA 3ZV6A 4F2HA 4F93B 2F59A 2PZJA 5C5DA 1NX9A 4D57A 5BUSA 3EULA 2IPAB 4ZT7A 2E4YA 5IW8A 3MMZA 2WMOB 3U3RA 2DSNA 1SXJE 2C7QA 1FYVA 2R86A 4CFYA 3B6IA 3A26A 1GITA 3E27A 4JGGA 4QNMA 2E4AA 2W98A 3HUFA 4IX9A 4TTPA 3NI2A 1C0IA 2XB9A 3N70A 1D04A 2ZRMA 3BE8A</