2PZKA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
SHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 107
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzkA00
1K5HA 2P68A 3ZV4A 4NFSA 5KNLA 2FHSA 3E03A 3LC7O 1KVSA 1TI7A 5KVQA 1RKXA 1GUYA 1KEPA 3PIIA 3H9QA 4GX0A 1C0LA 1EDZA 4GGPA 3AOEA 3PLNA 2VZ0A 1DJNA 2P91A 3C7AA 4IGFA 4M54A 3S1LA 4JGBA 1EVJA 1SC6A 3HJAA 1UDCA 2D3TA 4AJ1A 4F6LA 4RPGA 1KVRA 3AK4A 5L7YA 4HNGA 1YQXA 1Y6JA 1EFLA 1E3LA 1C3VA 1ZH8A 3AI1A 1FDVA 2BFAA 4Y67A 1B8UA 1B15A 1KY5A 5A03A 3L4SO 4W6ZA 3RBXA 4RVFA 1VL8A 1NPDA 2Y67A 2BRUA 4EUEA 2Y1FA 5H81A 2V6FA 4YJFB 3T7EA 4FFNA 4YT4A 2Y68A 5ER6A 3PDJA 5FI5A 1UXIA 1B7GO 5CEJA 4W82A 4Y98A 1P1KA 3TL2A 5EMHA 3CMCO 1ZFNA 4J2OA 2QRKA 3FBTA 2BI8A 1NAIA 4YJFA 3WLFA 2VWHA 3JQ8B 5KKAA 1J6UA 1B16A 2EP5A 2WEKA 4ZVVA 3AUUA 3ZZNA 4WLEA 2Y1GA 1PJLA 3GPDG 3PYLA 3W4IA 2EGHA 5JBIA 2QZZA 4FFOA 2Q4BA 3BTOA 3SJ7A 4YJHA 1LLDA 2CD9A 3GAFA 4W9NC 3ZV3A 1DAPA 5IG2A 2IE0A 3HDYA 4BKRA 3H5NA 1JDJA 3AY7A 2CF6A 3UH1A 1ENYA 1PIWA 4JN6B 4Z6KA 3L6OO 1B2LA 5U1PA 2EERA 5A04A 4GSLA 2NVUA 3TWOA 3QWIA 3H6KA 1HL3A 1N92A 4QX6A 2NACA 3OJLA 1PU2A 4R9SA 1R0LA 4HFJA 4CM4A 2BGKA 2VZ8A 3UN1A 4YRBA 1PZEA 2GNAA 5JCXA 4J1NA 3Q9NA 3AJRA 3Q1LA 4J49A 1Q0HA 4UEJA 3FNGA 7ADHA 4IDEA 2C7VA 2I67A 5HS6A 3GEGA 2B36A 3EZLA 5A9TA 2DT5A 3KV3O 2W2LD 4KUGA 3AY6A 3QV1A 3KSZO 4R1TA 5EQDA 1M2WA 4MPDA 2BD0A 4CQMB 2B4RO 4GI2A 1JVSA 3EYWA 3VPSA 3UAGA 4Z3KA 3OH8A 3ZWWA 3I9KA 1H9AA 4UREA 1KY4A 1DC5A 1I2CA 1PGQA 3GUCA 1M67A 4XR9A 2E37A 3UW3A 3JQAD 3ONDA 1F17A 3HUDA 1QV6A 1KETA 2HAEA 2W2LA 3B1JA 4BO3A 2JCVA 3IKVA 5BSEA 5IZCC 2FOIA 4TVOA 1F06A 1Y5RA 4CQMA 1KC3A 1W0CA 4CQMD 3GEDA 3GMDA 3IUPA 3LT4A 4U8GA 4EUFA 2OOSA 3I4CA 2JHFA 4A03A 5ENDA 1UXHA 2B5VA 2JCXA 3EZYA 3JD1A 1DHRA 1E7RA 4HUJA 3E1KA 1H2BA 1OZAA 1LBEA 4GQAA 4IDFA 4XIYA 1YDEA 2OXIA 1ONOA 3WFJA 1TT5B 1P77A 4NHEA 1HDOA 3G1UA 3INTA 1VJ1A 4LVUA 3TSCA 4K1LA 1AE1A 1HE5A 5A05A 3MJCA 3E18A 3ZH2A 2NVBA 5JO9A 5I7SA 2UUPA 3JQDA 3DZHA 1JTVA 1TLTA 3QWBA 4J6FA 2OORA 4ZN6A 1BWSA 1PJTA 4IS3A 4B4OA 2FWMX 4C7KA 1O8CA 3ZU4A 1LRJA 1ML3A 1BG6A 3DC2A 2G0TA 3PXXA 4PLTA 3MJVA 2FZEA 2W98A 4XR4A 4HFMA 2YHIA 3DBLA 5T8KA 1QV7A 2I66A 3VH3A 5KVVA 3RUCA 3CEAA 3RFVA 4CLHA 3MOIA 2PD6A 3G3EA 1YL7A 3C7DB 3FBGA 4A7PA 4R01A 4CR8A 2IZZA 1ZK2A 3MJEA 2DKNA 4E13A 1GDHA 4OXNA 1GQYA 4Q39A 1O6ZA 2D5AA 5G4KB 2FZWA 2Y1OA 1WAMA 4PG7A 2Y1CA 3PK0A 1N5DA 4N54A 2W2KB 1ISIA 1I32A 2XAAA 3I1JA 3K30A 2B4QA 3WSWA 3IKTA 5DOVA 2Y1EA 1AXEA 4FIZA 1XGKA 3KYDB 4INAA 4ZHSA 3R1IA 4YAKA 5JFOA 1HEUA 4KQXA 3FPLA 1Z7BA 2ZB7A 1DSSG 1UAGA 4ZQBA 1NR1A 4UUPA 4OL9A 2POQX 4QSMA 4D44A 3GDOA 3GY0A 4TMFA 1RM4A 2Q1TA 2FPPA 2DTEA 3V2GA 3CPSA 2AG8A 3KEQA 4BKPA 1N7HA 1LUAA 1U2DA 3GDFA 3R3SA 3N7UA 4RPJA 3MOGA 4YDRA 4D3DA 5AYVA 2GZ2A 2CF5A 4PRLA 2CFCA 3TZKA 3BTVA 3DMTC 3KEOA 4ID9A 2OO5A 2ZB4A 3I9JA 1Y8RB 3C1OA 3PFFA 3P5SA 2WD7A 3JSAA 3STHA 4M87A 5L95A 4BNTA 2OBNA 3LF1A 2JL1A 4JP2A 3I9LA 3VPHA 1JAXA 4AJNA 1Q7BA 3GN1A 4J91A 2NU8A 2EKPA 3AM4A 1NBOA 3U9LA 3HNPA 4CUJA 3PEFA 1YO6A 1N9GA 2AE1A 5CPBA 3S55A 4YCAA 3NAQA 1DRUA 4BO6A 2GSDA 1PR3A 1SEVA 1UXGA 3GMSA 1ZW1A 3PQEA 4BNNA 3ITKA 2FR1A 2YZ7A 3DFUA 5HBRA 2CUKA 4NNJA 4YJDA 3WGYA 1X0VA 1XELA 2ZTVA 1ULUA 4R51A 5KVCA 4C4OA 1SZJG 3M2PA 3MTJA 1N1GA 3U4CA 1ENOA 4UEKA 1H93A 3DTTA 3ZNNA 1V9LA 3G79A 3WIEA 3QE3A 3VZPA 1D1TA 4TZKA 5LDGA 1FJHA 4BNWA 3JQ7A 2WJPA 3L4BA 4MVJG 2O3RA 4MKRA 4WASA 4FPXA 4LSMA 4BIIA 2VRBA 1ZUD1 4OQYA 1BDBA 5GZ3A 1C0KA 2C82A 2DUWA 3CZRA 1E1LA 4ND3A 1H0KA 2FPGA 2O3TA 4RQUA 4F45A 3HB5X 2DQ4A 5JO0A 1I0ZA 4XCVA 3A14A 1HTBA 1IPEA 1NQTA 2I9PA 3PI7A 1TXGA 3ENKA 4PRKA 5DCYA 1CRWG 4OXKA 4CMHA 1HE3A 3H9JA 2VTDA 2G1UA 3JQEA 1ORRA 1Q0QA 4MVJE 4BVAA 4R54A 4E5NA 4PLWA 1A27A 4FS3A 4XEHA 3K96A 4OGWA 4J4TA 1ZMTA 1NVTA 2ZKLA 3K92A 1FDTA 3CUKA 4G5HA 2GF2A 4YA6A 4XKJA 4L76A 3E9QA 4H16A 3NJ8A 4I5DA 4DC1A 1VJ0A 1A71A 3WMXA 4BNIA 4HV4A 1VJTA 4OYRA 2NTVA 4YR9A 4GH5A 2IRWA 4PLZA 2G17A 4BNMA 2DLDA 1WPQA 2Q1SA 4ZQEA 3D4PA 3GOHA 4IS2A 5H83A 3DOOA 2HSDA 3NX4A 3SBOA 3GG9A 1E3JA 5T8KC 4ND1A 1CEQA 1LXCA 1E1MA 5MGBA 3JQGB 1EEHA 3M1AA 2HO5A 3FNFA 3HQ4O 4AFNA 1MX3A 3HZZA 3DEYX 3ZNOA 2HMWA 1ZJZA 1SEPA 1XCBA 2YDXA 3ZW9A 4BGEA 5AXDA 5BSHA 5KCZA 3WFIA 3VDQA 3T4EA 3I6IA 1PX0A 2UYYA 2BFOA 5EQFA 5F1PA 2DM6A 2AA3A 4B4UA 1T4BA 4FFLA 4E2YA 1YOVA 1U5AA 1I8TA 4IBOA 4CV1A 5DBFA 3DZJA 3BTSA 4URFA 3RU9A 2GD1O 2I65A 3AWDA 3S2EA 4D43A 5DNAA 4EDFA 1ISJA 3RROA 3W8EA 2AEMA 3GA0A 2FN7A 4BGUA 2PGDA 3RAJA 5JPIA 3AU9A 3BMCB 4FW8A 4CM7A 2CMDA 1BW9A 2BFPA 3WYCA 3NDJA 3AOGA 2WD8A 3EHEA 4GWGA 3F47A 3CKYA 3EK2A 1PJSA 3GH3A 4RDHA 3ROQA 2X58A 3T7CA 4YEDA 1DC6A 3JD4A 2O50A 1Y1PA 4XQCA 3DZKA 2VYVA 4YAEA 3OA0A 1B26A 2EW2A 5L4NA 1DB3A 2WYUA 2QX7A 2VWPA 3JV7A 1BMDA 1IHYA 4JXKA 2VOJA 4KMSA 4MP6A 3WTBA 1J0XO 2EEZA 1E77A 4CMJA 3FSRA 3HFSA 4RV9A 4YJGB 5C5IA 1XLTA 1A4UA 3MEQA 4QXMA 5EPOA 1O9BA 3BZUA 4AJ2A 4BKQA 1MC5A 4JCOA 1MXHA 3ZWOA 4UUNA 2JCYA 4AJ4A 4P4NA 1EE2A 1NQAO 2PGJA 1CERA 3ZHYA 5HM8A 2QYTA 3JYPA 3WGZA 1I24A 1VL0A 4J1QA 5CEEA 5JY1A 1DLJA 1ZSNA 1E0DA 1Y8QB 4YRAA 1VM6A 1ZIDA 2O7SA 3ROKA 5CFZA 1CF2O 2AQHA 2HRZA 3R3JA 1P1JA 1PZFA 1JW9B 4CQLA 2IYOA 2EP7A 3KYCB 2GDZA 1NWHA 3H8VA 1X15A 1YJ8A 1X7HA 2NU9A 2VN8A 2AMFA 1DRWA 4KWHA 4PLCA 3C1TA 4FJ2A 4PLHA 2O3SA 5ITWA 1G0OA 4YACA 3ULKA 1ARZA 3JQBC 3IIEA 2C20A 2UAGA 4OQZA 4ZJUA 3R0IA 4EGFA 1DBVO 3FWNA 3E82A 3I83A 4X54A 1H94A 2IXBA 3KSUA 5CEFA 4B3JA 1GU7A 4Q3EA 3PRJA 1ADBA 4FD3A 4U0KA 4BKOA 3VH1A 2AQIA 4D7AA 1H5QA 4Z0HO 4DQXA 1UJMA 4Z9FA 1XQ1A 3QVTA 1ZJYA 2X23A 2ZYGA 5JAZA 2C54A 2AE2A 4FR5A 4DMLA 2PKQP 2ILTA 4ZQHA 5K6AC 2GN9A 2OFPA 3OHSX 5DP1A 3H3FA 3HDQA 3ZU3A 5I8ZA 3Q2KA 3P2YA 4YBZA 5GZ6A 4Q3CA 1BHSA 1IE3A 3I9MA 4JBGA 4ALIA 1FDUA 3QY9A 4TRRA 3EDMA 3JQCA 3W8DA 3ICPA 4FCCA 4MP3A 4WE3A 3SXPA 3RUEA 3ZU2A 5CHEA 1PWXA 3H5AA 2X86A 4IDGA 5JSFA 3OETA 1ZVMA 2TMDA 5BSFA 4XGNA 5K0ZA 4PZCA 5IDWA 3KHUA 3LC2O 5L45A 1DJQA 4R41A 2EJVA 9LDBA 2YV3A 4QUKA 2A9FA 3CZMA 4A2CA 3PQDA 1YBMA 4I8XA 1P33A 1LTHR 5BSGA 5I9LA 3MCVA 4WNCA 2NQTA 1O94A 4R3NA 4O6VA 4KTTE 1UP4A 4XYGA 1HDGO 4I08A 5I8WA 3GN2A 5KJ1A 3G0OA 5AOVA 1GL3A 4QECA 1YH3A 1V0JA 1IUKA 1GQ2A 2YHUA 2ZYDA 4K28A 3TL3A 4FC6A 1NXQA 4J7CA 1ZSYA 3PJGA 3E48A 4B7UA 2X0IA 2NTJA 3GHYA 2WM3A 4WLOA 3WJ7A 4M8SA 3L6DA 3S2IA 2I3AA 3VAZA 2HMVA 3UKOA 1LI4A 4P22A 5KJ6A 4J0EA 3KUXA 2J5RA 3V1UA 3CXRA 3R6DA 3D5QA 1LRKA 1PJCA 3WR5A 2DPGA 1ZMOA 3UUWA 1SB9A 4TKLA 2P5YA 2RH8A 4JJIA 4CMCA 1A9ZA 2C5EA 5IFLA 3JYNA 1UZMA 1XU7A 2QQ5A 1EUZA 3L0DA 2HMTA 3LK7A 3SJUA 3RKRA 1NAHA 4FDAA 4GAEA 3L9WA 4WOJA 4DVJA 5CDGA 3QWAA 3DMYA 4WKGA 2X0RA 3L77A 4RZIA 2Q2QA 3W4KA 5KJFA 1DDOA 4LW8A 2J3KA 3LZ6A 3LVFO 1W6UA 1HDCA 3AFNA 5JE8A 3WMWA 2Z1NA 3ZCXA 2D5CA 3HN7A 4MO2A 4YXFA 3GZ4A 1IYZA 2Q4EA 3DMTA 1UAYA 2V7PA 3RFXA 4XB2A 1SMKA 3TFOA 5JMWA 4N18A 5JDCA 4BNKA 2DBRA 3HE3A 3ZV5A 1WDMA 3IP3A 4BOYA 2YHIB 4DIOA 3BTUA 1KYQA 3VPGA 3JD0A 3COSA 5FFFA 2JFHA 1WW8A 1YBVA 3IP1A 5I7EA 5IXYA 2TMGA 2O23A 4MIOA 4NJMA 4A26A 3RUIA 1LC0A 3QIVA 5JDIA 4CUKA 1U4SA 2V6GA 1ADCA 2Q99A 3OP4A 4JNKA 3IQDB 1YB4A 1EUCA 1U4OA 3JYLA 3RC9A 3V1YA 3ZWCA 3KRTA 4KP7A 4P8RA 4XA8A 4KZPA 3GNSA 3ONFA 4DLLA 5J23A 1YE3A 2AW5A 3CIFA 3OQ1A 1WWKA 2AEFA 3DBRA 4FQ8A 4KUEA 3TOXA 3H2ZA 4GMGA 5ILGA 2Q3EA 1KVUA 3MJ4A 3PDUA 4O1MA 4YAGA 4EEZA 2H5LA 2X9VA 4DWVA 5TT1A 3DQPA 3GAZA 4N5LA 3WGGA 4DPLA 1Z6ZA 4GMFA 1HKUA 1QR6A 3BXXA 4J3FA 1B3BA 1P45A 1Q0LA 2B35A 4PVDA 4CLRB 4AJIA 4NK5A 1N7GA 1IL0A 3TNLA 3GK3A 1BXGA 5FI3A 1LDNA 4E12A 4QO8A 3UICA 4QT0A 1T2CA 4YT5A 4J7XA 4JBHA 4CMBA 3H5RA 4EYEA 1TEHA 4NG5A 1E92A 3E9NA 3BHMA 3KM0A 1DO8A 1YB5A 3AM3A 3RI3A 4R4JA 1Z75A 3WX0A 4CMGA 1U3TA 2NV6A 3KETA 3GFGA 3ZWBA 2DU8A 1WZIA 4FJ0A 3FD8A 4DRYA 4DA9A 1PGPA 1PGJA 3CTMA 4E2XA 1VI2A 2CZCA 1HDZA 1Q1NA 1XWFA 3NRCA 1QYCA 2JAHA 3WLEA 1E7SA 1YS4A 3AUTA 3PHIA 2IZ0A 3PFWO 1XU9A 4BNVA 1R66A 4J1TA 3TZ6A 5CDTA 2IEBA 4MKZA 1J5PA 5EIOA 2J3HA 2FSVA 4PLYA 4Y6RA 4JLWA 1B8VA 2ZJ1A 1GCOA 3QP9A 1KEVA 1EE9A 4EBFA 4M49A 3KYDA 1HT0A 3ITDA 5THQA 3TZCA 1KC1A 2C2YA 3VTFA 4GLLA 4AJOA 4EITA 4MP8A 3G17A 4XRGA 4YWJA 4U6QA 4EJ6A 3AUAA 1ZEMA 2PKRA 4BNYA 3W1VA 2Y05A 3LLSA 3QRWA 1QP8A 3VKVA 4C7JA 4BB5A 3I9OA 5AQ1A 3FR8A 2PWZA 4TZTA 2PY6A 1WNTA 4F46A 1QYWA 1YQGA 5HS4A 4W7IA 3V8BA 4DLAA 4UVGA 4O5OA 4BNHA 1B0AA 2FMUA 4OAQA 1H6BA 2QW8A 5F21A 5AXBA 4NZ9A 5G0SA 1UH5A 2GCGA 2QRJA 4GGOA 3P19A 3UVEA 1V3VA 3GVIA 2DFDA 3F4LA 1BXGB 3DBLB 4TSKA 3Q2IA 5TGDA 2O7QA 3TZQA 4W9NA 3PQFA 1X7GA 2X9NA 2Q45A 4Q3BA 3NYWA 3RJ5A 4KOAA 3E8XA 5COQA 4CM1A 4RGBA 2YQ5A 3D1LA 1UDAA 1XEAA 3LF2A 3IC5A 3KYBA 4PLVA 3GEMA 1QRRA 2DVMA 1UXJA 1I36A 1C0IA 3BMQB 1HETA 4DXHA 3OSUA 4ZGWA 2B0JA 4ZU3A 2VTEA 1T2DA 2NVWA 3KSDO 3PZRA 4O0LA 3GLQA 1GR0A 5AXCA 3P7MA 1BVRA 1X14A 3OQBA 2VOEA 1NHWA 3OEYA 5H82A 3TPCA 3DTYA 4TROA 4DYDA 2IXAA 4K6CA 4TKMA 1DIRA 1BW9B 3KTDA 3DAPA 4H7PA 3I9NA 3DWFA 4XYEA 3QLJA 2X5KO 3RCBA 2VHWA 2IYPA 1SOWA 1V3TA 1VKNA 1UZLA 1LNQA 4I9UA 2OZPA 1NR7A 4A73A 5TC4A 1EK6A 4Y9DA 4BO2A 2A35A 3PWSA 1U5CA 1YBAA 1JU9A 3JQAB 3Q9UA 3ROMA 5JC1A 1T2FA 2PTGA 2W90A 2BLLA 2GGSA 4MVJA 4PG4A 3PGJA 1LLQA 3X2FA 2VNAA 5EERA 1DHTA 3SC4A 4Y8VA 4ALJA 1ZBQA 1DFIA 2DBVO 5JCJD 3EVTA 2D59A 1O5IA 4BMSA 1ZK0A 4NBTA 2BKAA 1L7DA 2C7GA 2RIRA 4BO5A 1SOVA 1PZHA 3DB2A 1NX6A 1SB8A 4B3IA 5A3JA 2PA3A 4IQGA 2A92A 2C29D 1U3UA 1FDWA 1M66A 3EVNA 2HMUA 4YVFA 3EGOA 2VHZA 1HF3A 4NBRA 1K2WA 3B20A 2ZQYA 3B1FA 4TQGA 5JC8A 4RVDA 4TVBA 3CE6A 5B4TA 3JQFA 4RORA 3GZNA 3IJPA 1YDWA 1V8BA 4PGFA 2IZ1A 3GGOA 3WQSB 4NR0A 1NM5A 2D8AA 1ISFA 3HG7A 3BIOA 1K6IA 1GFSA 5COBA 1IULA 4XQEA 3U4HA 3L6EA 3RQSA 4J9UE 2P4QA 2X9GA 3RUAA 4DTIA 2SCUA 4MDHA 1P1IA 4ONEA 1N8KA 2AG5A 3TF5A 1JKFA 3OIFA 1P44A 4HWKA 1GPJA 3M6IA 5LCXA 2AXQA 3Q11A 2HUNA 2WYVA 4I5GA 3F5QA 3LYLA 4D3FA 3GG2A 1Y9EA 4A10A 1GUFA 1DRVA 3SVTA 4CMEA 5DDIP 4PZDA 2Y0EA 1NQOA 2J8ZA 4ALNA 2I3GA 3D3WA 4RJTA 4PZEA 3GVCA 5HRUA 3PPIA 3ETGA 1ZEJA 1ZSVA 3HDHA 3NT5A 5A1TA 1VLLA 3AI3A 4XIJA 4XZ3A 1PZGA 3BMOA 4IMPA 1LRLA 1MFZA 3C24A 1FF9A 4RF3A 3CSDA 4E2WA 4UAGA 3FR7A 1OBFO 1VPDA 1A4IA 4NIMA 4UULA 4BKUA 4AJLA 1DOHA 2WMDA 2E48A 2NU7A 4KTVE 1F14A 3D3WB 2VUSA 4YPOA 1TB4A 4EEXA 1LSUA 2B4TO 4FBGA 2QRLA 2PKQO 2GUGA 3DAGA 1JKJA 4QTZA 4CMAA 3RUDA 2JFFA 1ONPA 2DTDA 3GDGA 5CPFA 5ICMA 2R00A 3MWEB 3JYOA 5IDQA 5C7OO 3RC2A 4IQ0A 1OOEA 3ZWPA 1Y8RA 1PR9A 4IZIA 3MJTA 4OKNA 1PJ4A 1ZK4A 5I9NA 1Y81A 1Z82A 5A02A 1PS8A 4JX8A 2AHRA 3FHLA 3ZW8A 1T24A 1PGNA 1W8DA 4M86A 5B4UA 4Z3DA 4WOKA 5L51A 1E3IA 1GTMA 2CSUA 4NBVA 2DTXA 3WXBA 4OOEA 3JQAA 5EN4A 2VRCD 4K6FA 4R5MA 3INGA 2Q46A 4FSHA 5GZ1A 4BO4A 5T5QA 1IZ9A 3BMNA 3JQFC 3OA2A 3EAGA 1E7WA 2GASA 4B3HA 5CAEA 4DBZA 4ND5A 2GR9A 3ZWYA 1C1XA 2GZ1A 3C1AA 1U7TA 1JN0A 4F3YA 2Z95A 3GNQA 2DUUA 4FFRA 1BSVA 1KIFA 2GERA 1IB6A 2QHXA 4BGVA 1M6WA 2ZTUA 3ICCA 4CL3A 2X7HA 5T57A 2PV7A 4N7RA 3JQ7B 2X0NA 1ZZEA 2HU2A 3O38A 3VZRA 4G65A 1I3MA 3PLRA 1U9JA 1KBZA 3U4IA 1PL7A 3QWHA 4UEOA 4XDZA 3RASA 5JAMA 3HDJA 1OFGA 1KS9A 2PFGA 3JQ9A 1E7YA 3MJSA 4R5HA 3FWZA 5CP8A 2BFMA 2FR0A 3A1NA 3LT2A 1OAAA 4BUCA 1ZXBA 1F8FA 4NQZA 1I3NA 2FR8A 2GN4A 4AICA 4OHUA 2HDHA 5TS3A 3VDRA 4RL6A 1SPXA 2HRBA 1E3WA 1KEUA 3HB4X 1B3RA 3WYBA 1EK5A 1PL8A 2OL4A 3BHJA 1LJ8A 5IDXA 5TRTA 1GEGA 1K6JA 3K6JA 1MLDA 3RBZA 4E5MA 5EINA 1ZXLA 1CDOA 1OMOA 4R68A 4J90A 4I9HA 4ZA2A 4BQRA 4IJUA 2JD0A 5K6AA 3V2HA 1YL6A 3F1LA 2NNLD 1M75A 3LSYA 5B4VA 1PQUA 3UF0A 4CM5A 4CM8B 5IZ4A 2O4UX 1PWZA 4A27A 1NASA 4JBIA 3KVOA 5L53A 1Z74A 1ZCJA 2P9GA 2VT3A 4WLVA 3BMQA 3OJOA 2ZJ0A 3C8MA 4NJMB 4H15A 3IJRA 1I2ZA 4MJLA 2Y0DA 4E31A 4EJMA 1LDYA 2CVQA 4WCFC 3OMLA 1ENPA 5JLAA 4RF4A 2VHXA 3WBFA 4CUZA 3VC7A 4BO8A 1M6HA 2O2YA 4GBJA 3VHRA 4EZBA 2Q1UA 1CETA 4FN4A 4CM6A 4N5NA 4ROSA 3F6YA 4OXYA 1X7DA 2OGUA 1P1RA 2BHLA 1BDMA 2VNSA 1Z45A 1AHIA 4UVIA 1O89A 1BRMA 3ZV6A 2ZQZA 1I10A 4RZHA 4ZICA 1J49A 4RO0A 1G0NA 4KUHA 5A9SA 1G1AA 1XYGA 3SLGA 1XDWA 1E1KA 6LDHA 3VVCA 1QLHA 4E30A 2VHVA 3PYXA 3AY3A 4MINA 3JTMA 3RU7A 4U0JA 2BMAA 5KTKA 4J0FA 1V3UA 4NMHA 4E2ZA 4WEOA 1U1IA 2X4GA 4QFDA 1XR3A 4L4SA 2VT2A 1RYEA 3D4NA 5COAA 4NJOA 3C7CB 3GGGA 5U4QA 1CYDA 2CY0A 4E4YA 5IXSA 4IXTA 3VZSA 3PVZA 3TJRA 3RC7A 2B5WA 1HDXA 4XJSA 1AXGA 4YQZA 4YT8A 2X0JA 3WICA 4HBGA 4ALMA 2JD2A 1HZZA 4DPMA 4D41A 3UXYA 1L7EA 1X1EA 4IJVA 2A94A 1D8AA 1GV0A 4NFHA 3PYMA 4PG8A 1AN9A 1V35A 1DC3A 2JJYA 3EMKA 5EL0A 1TVEA 2AQKA 1I01A 2YV2A 4YTEA 4LVCA 1P31A 3PHGA 1UDBA 2LDBA 2XXBA 4B8WA 3EC7A 4OMUA 2OBYA 4UVDA 4BB6A 4HNHA 1P9LA 3LDHA 4RDIA 3LQFA 3I5MA 4TRNA 5B37A 2AEJA 4CPDA 4Z0TA 3WWYA 1YONA 4E3ZA 1KOLA 3GVPA 1UR5A 2R6JA 1XSEA 3FTPA 2LDXA 5IAAA 3NTQA 4KDEA 1WXDA 2UDPA 3FPCA 4F6CA 1MB4A 1ISGA 3IAHA 4FJ1A 2RCYA 1NP3A 2VWGA 2EIHA 3AFMA 5DCUA 5ER9A 2EGGA 3HFGA 4FOSA 2X1HA 5T67A 1CIVA 4BMVA 4I5FA 1LA2A 1L1FA 1F12A 3K9QO 1O95A 2C07A 1CWUA 4UUOA 5DN9A 1KEWA 5JDCC 1XG5A 1A72A 2ZCUA 1I3KA 1EFKA 4PCVA 4CODB 4XQGA 2YDYA 1U8XX 1KERA 3QVXA 4IDDA 4OSOA 5JCJA 4PN3A 4OH1A 4CM4B 1ZNQO 1N2SA 1NYTA 1S6YA 1DFHA 2GZ3A 3GT0A 4CMEC 4HY3A 1RM5A 4A5OA 1N1EA 3GGPA 4BNZA 1Q7CA 2QG4A 1YQDA 2YFHA 4RF2A 2JFGA 3FRJA 2PH5A 4WEQA 1VRWA 3T4XA 1IZ0A 3FTNA 3K2EA 2B69A 3LT1A 4II3A 4EI2A 3ST7A 1EBUA 3S2FA 1LDMA 2WE8A 3IL2A 1T1RA 5TX7A 1M76A 1VC2A 4XDYA 2Q49A 4DQVA 1EVIA 2NTNA 2DFVA 2FP4A 3O4RA 5A4DA 1E6UA 5IF3A 2Q50A 3ZHZA 4RF5A 2I76A 2O2SA 3DFZA 1IHXA 4RPHA 5I7VA 1LQTA 2E4AA 2CDCA 3RD5A 4GPD1 2RBEA 3GPIA 1DAOA 4ESOA 3QWFA 4QQRA 4DL9A 2UV8A 2H1SA 2VUUA 2CDAA 2ZYAA 2D2IA 4MKXA 5IDYA 5LC1A 3UOGA 5DT9A 3GZNB 2O3JA 1JWBB 4HFRA 4QEDA 3VKUA 3HSKA 5JNLA 3PHLA 1GYQA 4CL8A 2JHGA 3VOSA 1N9GB 2D1YA 3DXFA 1F0YA 2PZMA 1WDKA 3G49A 3OIDA 3NGLA 4XRRA 3UFXA 3B6ZA 4RLHA 1C1DB 1H6DA 5L4LA 1HE4A 5JS6A 3NTRA 4UVEA 3L07A 2PH3A 1CQIA 5A5EA 3DZIA 3AI2A 1P0FA 5DCWA 1T1SA 3K31A 2B37A 3O03A 4NFYA 5KJCA 3D7LA 1E6WA 4ALLA 1MC4A 5FYDA 4L8VA 4LN1A 4IIVA 4LCEA 2P9EA 3BMCA 3ETEA 1HYEA 4YRDA 1Y7TA 4RVGA 1GPDG 1Y9AA 1YB1A 2BELA 1ISHA 1PQPA 1R4MB 2CDBA 3PGXA 2PGLA 1OC2A 1K0UA 4Q9NA 1GUZA 1I33A 1LSSA 3DHYA 4MVJD 1UXKA 4U5QA 3SLKA 1P1FA 2CVZA 3HADA 1P3DA 3OECA 5A9SB 1C0PA 5JXWA 2H9IA 3LLVA 2GYYA 3LC1O 4DIFA 3G1TA 4FGWA 5L9AA 3K73O 1LSOA 2XOXA 3QVSA 3U09A 2GN8A 2HLPA 3A4VA 2YFQA 2J3IA 1HRDA 1NPYA 1YWGO 1UZNA 3FCOA 4QO7A 5ILOA 2FRDA 1QSGA 5A06A 1U28A 1JA9A 3O9ZA 1R12A 4I1IA 1R0SA 1OC4A 3JCZA 3BHIA 4CM3A 3OQ6A 4D46A 3TZHA 2VCYA 1DIGA 4XD2A 4O59O 4BMNA 4RVUA 2QIOA 1IOLA 2WE7A 3DZGA 1PEDA 3GNTA 4K9DA 4PLGA 4RQTA 1AUPA 1NQ5A 3NEPX 3WOHA 5JYDA 4IDBA 1ZKMA 3FNEA 3QVWA 2PZLA 4BNLA 3C3XA 5KWEA 5DP2A 3O26A 1GD1O 3UCXA 1SBYA 2HJSA 4AG3A 1JKIA 4JP3A 3WG9A 4JQCA 1YGYA 5JMPA 4WECA 1ISMA 2EHDA 1SNYA 5CDUA 3UGKA 4BHTA 5IN4A 3Q3CA 2BH9A 5BR7A 4DGSA 1E5QA 5ADHA 4BV9A 3WB9A 5L4SA 3MWDB 3B70A 2W4QA 4P38A 5TNXA 1GCUA 3KLMX 1Y5MA 2HJRA 4MVJP 4N5MA 2WD7B 1ZK1A 4XGIA 4NDNE 2WTBA 5F5NA 1LLUA 2O48X 1LX6A 4PG6A 1RPNA 3WIDA 3AM5A 3ADOA 3ZN2A 3ZWNA 1E7MA 2P4HX 3WGHA 2Y66A 1CQJA 1QG6A 2VWQA 4Q3DA 2XXJA 5G4LA 3HN2A 5TLSA 1PS0A 1ZK3A 2HKIA 4S1VA 4G81A 1LSJA 5T6BA 2EF1A 4XWYA 1YJQA 1VKOA 2A4KA 4WGGA 5ITVA 3DZFA 1HZJA 2I99A 1R4MA 3D3EA 4R69A 3VH2A 3UHAA 4IXWA 1Y8QA 1WLYA 1GEEA 1PTJA 3W6UA 1ADGA 1U2GA 1O0SA 4CLEA 5U9CA 3DBHB 1C14A 4GX2A 1AGNA 4CMKA 4E5KA 3D0OA 3O8QB 5L40A 4ZRMA 1LQUA 1PJ2A 5BQFA 2O3UA 2Y99A 3NGXA 1D7OA 4FFPA 4J7UA 2XPCA 1ADFA 2DBZA 2HCTA 4KQWA 3DBHA 4Q3AA 4RPLA 7MDHA 3OBBA 3VTZA 5B1YA 3AW9A 1MP0A 4M1QA 4MVJM 2ZCVA 2GLXA 1U3WA 4BO7A 2ZTLA 5GMOA 3KLPX 3ONEA 3WGTA 3F5SA 5F3RA 3ZI0A 1QXSA 3DHEA 3NUGA 2X6TA 4BNJA 2I5PO 4D0SA 3QVOA 3VPFA 3ANNA 5CG1A 4FFMA 4WCFA 3OFSA 3OJEA 1K3TA 3GRPA 1MG5A 5BNFA 5TT0A 3V2UA 1FMCA 1U7HA 4IUYA 4R9RA 3VVBA 4S3MA 3GVHA 1DFGA 1H9BA 3E6AA 1YKFA 3DDNA 2YQ4A 2YJZA 3PJDA 4B8ZA 1W73A 4MVJI 2R2GA 1YOVB 4ND2A 3PP8A 2NSDA 4AJJA 3JYQA 3DBRB 4FC7A 1T2EA 1PGOA 4LMPA 5C7IO 1BXZA 4JIGA 2E49A 4YAIA 4CLXA 1JQBA 1FDSA 3ZWMA 3CH6A 1HE2A 1UP7A 1NFRA 1WP4A 1X1TA 2ZB3A 1SO8A 4JJGA 4E33A 3VPXA 1QORA 2GO1A 4I5EA 3RBVA 4AL4A 3NT4A 4RCVA 5L3ZA 2VHYA 4CLDA 3F4BA 4WLNA 4WUVA 4CLOB 5FEUA 3KOUA 3JQGA 1R6DA 4BS9A 1WDLA 3CMMA 3RWBA 4B4WA 3ZHXA 1HWYA 4L9RA 2ZK7A 3BAZA 1JVBA 1NVMB 2NADA 2VYNA 1P1HA 4ZRNA 4HADA 3WGIA 1Q7GA 4MOWA 1RWBA 4YT2A 3N74A 1GV1A 5L7WA 3LT0A 4IJKA 4XYLA 2DPHA 3PIDA 1S7CA 5IZCA 1EUDA 4RLSA 3TN7A 4GWKA 1HSOA 1Z7EA 4CM9A 3F9IA 4LRSB 3BMOB 4ZD6A 3UCEA 3I23A 4OKIA 4ZQFA 1MV8A 3U49A 3E9MA 1D3AA 1NFQA 2DBQA 1MFPA 3KO8A 3ZNQA 2B83A 5BNIA 4Z9YA 4J43A 4GX5A 3L9XA 2C5AA 4XYMA 1H2HA 2PD4A 2Q2VA 4J1SA 3AUSA 3JD2A 5ENVA 3FF4A 4G2NA 1H6CA 3WBBA 1PS9A 1Z73A 4L4RA 4OO3A 1ENZA 4CR7A 4PFJA 1WMBA 4RPKA 4M55A 4PLFA 5DOZA 5FF9A 4OJNA 4E21A 2UUOA 4IMRA 1QMGA 1E6EA 3H9EO 1HYHA 4P4GA 2G76A 1LEHA 2J5KA 1GADO 1A5ZA 5JYEA 2Z1MA 3ASVA 1E1NA 3DHNA 2YY7A 3RSHA 5CDSA 2HMSA 2HK9A 4GL4A 4XX0A 4LGVA 3WTCA 5F1OA 2O3QA 4BO9A 2J3JA 4J9VA 4L4XA 1JAYA 3TRIA 3KXDA 3QA9A 3NKLA 2GN6A 3GR6A 5F1KA 2XF8A 3DR3A 3FI9A 4CV3A 4LMRA 1QKIA 4CR6A 2O4CA 5CG2A 4A0SA 3MTGA 4WCDA 4Z0PA 3RUHA 2IEDA 4E5YA 3B1KA 3IMFA 3ZHBA 4YQYA 4XJTA 1VSVA 5G0WA 1OI7A 1ONNA 1T25A 2E82A 1VE9A 4WLFA 5EJ2A 2CVOA 1XQ6A 4O63O 1HDYA 4CMIA 2WWRA 5JY6A 4GX1A 1YL5A 3V1TC 1MG0A 1WMAA 4BV8A 4IPTA 2CNBA 4IDAA 3H9GA 4LRTB 2VYND 3A9WA 5DZSA 2X5JO 2Y93A 2QYSA 4PVCA 2WSBA 2EV9A 4AVYA 3PJFA 3H7AA 2NWQA 3Q6IA 1NHGA 1H6AA 4LK3A 3OF2A 2ZTMA 2RH4A 3S2GA 2D4AA 4E6PA 3IDSA 4GKVA 1DC4A 1EQ2A 5KJEA 3VH4A 2JKVA 2RAFA 1RYDA 1WZEA 3I3OA 3U3XA 3X2EA 3PWZA 2OHXA 3D64A 4PG5A 4WCFB 4B4VA 1E3SA 4DMMA 1T2AA 2GPTA 1C1XB 4ALKA 4QFCA 1AHHA 2X8LA 3K5PA 5AXAA 5IJZA 1R37A 3WGQA 1E5LA 1B8PA 1HLDA 1I5RA 1FXSA 4JJFA 1GZ6A 1HXHA 5TSDA 2PZKA 1R0KA 2OMEA 4W4TA 3RUFA 3MZ0A 2BF7A 5L7TA 2ZATA 3K8ZA 3EUWA 4YAJA 2YV1A 2DC1A 4MVJF 4OSPA 1QYVA 3S8MA 5C3MA 3FN4A 1QYDA 3AU8A 1PSDA 3IUSA 4J16A 3U5TA 2P9CA 3F3SA 3ENNA 3OICA 1FK8A 1ID1A 4CM8A 9LDTA 2C59A 3DOCA 5DBGA 2Y0CA 3U0BA 1V6AA 2FPIA 4B7CA 1SCUA 4DREA 2V6BA 1NPTO 2PLAA 4R3WA 4WJZA 1CJCA 1LDBA 2P2SA 3DONA 2X22A 1DIHA 1QLJA 3IS3A 4M89A 4YB8A 2ET6A 4Q3NA 1R15A 1JWAB 4IY1A 3VZQA 1E3WB 3EW7A 4B7XA 3SEFA 5KOIA 2Z5LA 1NNUA 1HSZA 3WSVA 2RHRA 2IDZA 3PTZA 5TIIA 1XIVA 4IDCA 5FWNA 2OP1A 3OEWA 1PJQA 5ICSA 2PK3A 1W4ZA 4KWIA 1NVGA 5A5FA 3L4BC 1I3LA 3ANMA 4NU5A 2OUIA 4IGEA 4FB5A 1EVZA 1D1SA 5KIAA 2IODA 5AVOA 4ND4A 2W8ZA 3TFQA 1T26A 2EG9A 3NDIA 3NDRA 4L74A 3GQVA 1GZ3A 2H63A 4R16A 1RM3A 3H65A 3BA1A 3E5MA 5A9RA 2NUAA 2NM0A 3WYEA 4W7HA 5JDIC 1GY8A 4OOFA 4RVSA 1GYPA 1UP6A 2E6UX 3QHAA 3EY4A 1BTOA 1XKQA 4WK6A 8LDHA 1GAEO 4DYVA 4HP8A 1E7QA 2VRCA 5DULA 2BGMA 3ETDA 3DZBA 4JK3A 3SC6A 2X5OA 2G5CA 4YYZA 3WQRA 4U6SA 4DQUA 1EVYA 1A7AA 3W8FA 4CQLB 5B12A 5KVSA 1MGOA 1UUFA 5T64A 1MUUA 3NTOA 1E3EA 3V5NA 4RVHA 4NI5A 4E5PA 3DOJA 4E32A 3WGOA 4WPGA 2VZ9A 3WNQA 2WYWA 1YXMA 4XQ9A 1P0CA 1GQQA 2EXXA 4Y6SA 4WLUA 1T4DA 3ZWAA 3JD3A 4YJHB 4BNUA 3H3JA 4YJGA 4GLOA 5HA5A 3F46A 3NJ4A 4CMIB 2D0IA 2C2XA 1HYGA 2GRAA 3ZWVA 3QW2A 5C37A 4EJ0A 1IPFA 1WVGA 3WJAA 3DO5A 3N58A 1VSUA 3INRA 5DF1A 3U62A 1EQUA 1U3VA 3M1LA 4TWRA 3A28A 3OJFA 4E0BA 5JAIA 1B14A 4DC0A 5I7FA 1NTOA 3WQQA 1PJBA 3BYZA 3K2BA 5BT9A 4NBWA 4FOOA 5F5LA 3ZDFA 1PJ3A 5BNTA 5K9ZA 4BQPA 3H9UA 1ZO8A 4WNIA 3TDKA 4L0QA 3PWKA 3ROPA 1EMDA 3OJ0A 5MDHA 4L75A 2EKQA 4B79A 4DIBA 2HK8A 1K6XA 1LC3A 1YRLA 3GRKA 1TT5A 3DL2A 4W99A 1NFFA 8ADHA 2YW9A 2Q2WA 3I6QA 4DBVO 3KBOA 5EESA 4D3SA 4JROA 5I9MA 3ASUA 3GUYA 4BO0A 4UVHA 1LDGA 3H2SA 3UCFA 4D42A 2G82A 4EW6A 3HHPA 1RM0A 1ULSA 3TQHA 5JW6A 1PL6A 2NQ8A 2BGLA 4XGKA 2F1KA 5DBIA 3A06A 1J4AA 2EWMA 5A3VA 5C7LO 2QZ9A 4NH4A 2PD3A 1HDRA 4AJEA 4D45A 5G4KA 4MVJH 1KVQA 2V65A 5THKA 3RFTA 1A7KA 4NU6A 4P4LA 2C0CA 2V6MA 1I30A 2PNFA 3IOYA 4XYBA 3WS7A 4HKTA 3OM9A 5HWSA 4K26A 4I9NA 3W4JA 4DUPA 3QSGA 2H6EA 4R1NA 1F8GA 1TT7A 3NV9A 3NT2A 4AJKA 4BO1A 3ZWXA 3ADPA 3WNVA 3Q0EA 1IY8A 4D0RA 3QQPA 1DXYA 4OIMA 4GSKA 4IJWA 4NPCA 3RIHA 1EBFA 3D5TA 2ZB8A 5TQVA 2J5QA 1YVEI 4CLOA 2W2KA 3FNHA 4J4HA 3PHHA 4ITUA 4AJHA 3AOEC 3ORFA 4IIUA 4KDFA 3C85A 4HFNA 5G0UA 5IN5A 3JQ9C 5HTOA 1U8FO 1EDOA 3WDSA 1JLLA 1DIAA 1DLIA 2Y1DA 3U4DA 2WDZA 1X13A 4ILKA 3CINA 1R4NB 5GY7A 1LLCA 2EJWA 4U7WA 1X0XA 5KKCA 2F00A 2RHCA 3KB6A 1GZ4A 5G0TA 5JAQA 4UUMA 3RVDA 1BVUA 4MIYA 3I4FA 1K89A 3GFBA 4TRMA 1QYXA 3ZNPA 5LDHA 3ON5A 1KVTA 5ES3A 3RKUA 3GHHA 4BGIA 3ZU5A 3LU1A 2FY8A 4II2A 2YYYA 1MA0A 1R16A 2AQ8A 1GYRA 3I52A 2PZJA 2VUTA 3BMNB 4IINA 3PZBA 3PJEA 5G0VA 2Q1WA 3W6ZA 1LU9A 4J2HA 4NBUA 3ANLA 4ZQGA 1LDEA 1SAYA 2JD1A 3JQBA 3TOZA 2DAPA 4DPKA 3O8QA 1DEHA 3GVXA 2ZIZA 2NLOA 4CV0A 4J4BA 4DLBA 4BNXA 3HWRA 1DPGA 2NVUB 2HK7A 4LCJA 3D4OA 4MIEA 2EKLA 1PQWA 3H4VA 4LSWA 2R00C 3ZGYA 5TJ9A 4AJPA 3JQ6A 1C1DA 4GKBA 1EZ4A 4OM8A 4CM9D 3RC1A 4FGSA 5G2OA 4IQ8A 2HQ1A 3KZVA 4R1UA 4BL5A 4NK4A 2UVDA 3DAFA 3KYCA 4TRJA 3SX2A 1MXFA 4GVLA 5TJHA 4Z9XA 1P74A 3DBVO 3RJ9A 2EW8A 1RJWA 1G6KA 1XHLA 3JQ8A 6ADHA 2VYVD 3WWZA 4HX5A 4PLPA 4LISA 4CJXA 4HXYA 1NWCA 2BI7A 2NU6A 4BNFA 4D79A 4CLRA 1BXKA 1VL6A 4H3VA 4BNGA 2VQ3A 3QJ5A 2PR2A 3F1KA 4R1SA 3GF4A 4XB1A 5CDYA 3M2TA 3E5RA 1DIBA 1HLPA 1D4FA 2J6IA 2FSSA 1A9YA 1XA0A 3OIGA 4IM7A 3P2OA 4IZHA 4L73A 1BGVA 3ABIA 4GVXA 1R4NA 4EUHA 1I2BA 2YUTA 3PHJA 4Y6PA 4PIVA 1TA4A 4CV2A 1Q2XA 3GC6A 5TF4A 2JAPA 2I6TA 2P5UA 2OP0A
chains in the Genus database with same CATH superfamily
3N3AC 2P68A 5DM2A 3ZV4A 4TS9A 2J41A 4BV2A 3CF4G 3ZCUA 4ZWNA 4DLWA 3LC7O 3Q0TA 1B6TA 2X5XA 4JH0A 3W9SA 1KVSA 3D6HA 2HX1A 3HJNA 1TI7A 1VYTA 4HDOB 5TS2A 1IM2A 1JQLB 1ZW6A 1RKXA 2QN7A 2JIMA 1KEPA 3VUFA 1W2GA 3H9QA 1VPEA 2BT4A 5DYNA 2Q9UA 3TAUA 5TQ2A 2CNWA 5E9AA 1U8ZA 3QELA 4K6HA 4V38A 4F6RA 2AXNA 3HJAA 2I2BA 3C5HA 2D3WA 1QBGA 1U0FA 2PX5A 2VTVA 3KKNA 4IIBA 4AJ1A 5D6NA 3UB2A 3BILA 5EWLB 3KKZA 4B85A 4X71A 4O3MA 4HNGA 4KAJA 1SG6A 3U48A 3ZE6A 4TMTA 1F51E 1C3VA 5CEEA 1XD8A 1E18A 1QHIA 3WI7A 3HMQA 4Y67A 4BLRA 3ZE2B 4F3CA 2OCDA 1KY5A 5A03A 4GOOD 3PRHA 5EIAA 1VL8A 4RY2A 2P27A 3BRQA 4RW0A 5IJXA 4YLYA 3CLRD 3BT7A 4KRGA 1NX9A 2Y67A 2BRUA 3FCCA 3ICVA 1I3CA 3MLAA 1ECGA 1ZRSA 1MQ8B 1ZBDA 1NP6A 2V6FA 4YJFB 2XUIA 3R7WA 5HUQA 4QUJA 5BV1A 1EFUA 3H11B 1CJBA 4JYMA 2ODNA 2V98A 2RK3A 5BVGB 3PDJA 4G4IA 5DK4A 2G1PA 2GKSA 3QITA 4FEAA 5PNTA 2QXUA 3TL2A 4WBNA 3HU5A 3RYFA 5FWAA 2BI8A 4YJFA 4RD3A 2ZR9A 3WLFA 1WUKS 2YVKA 1KTIA 1I3OA 1PG2A 2JGMA 3MW8A 1DTWA 2IYZA 2WEKA 3DZDA 4AIRA 4AZ0B 3KR9A 5LIPA 1XTIA 3PXGA 1SVIA 3CPHA 3M4JA 4DARA 1AX9A 1Q7EA 3FDZB 3I8OA 2CL7X 4D3ZA 4E22A 2XYRA 4M0PA 5BN4A 1U90A 2BKEA 4URUR 1G3RA 5IC5A 2Q7XA 5EIBD 2RHHA 1NP7A 3GAFA 2JCBA 4HQKA 5B5SA 3ZV3A 5JFTA 3ZVKA 1EFVA 4OBBA 3HDYA 2Y92A 4BKRA 3QF4A 3K3PA 1W25A 2QX9A 2ZAIA 1J9EA 2CF6A 3QUBA 2IV2X 2G9NA 3V46A 4JN6B 1YF3A 2IIPA 4GW3A 4BTEA 1B2LA 1SCNE 1EK0A 2EERA 4GSLA 4MWEA 3QWIA 3H7IA 4TL7A 4YY3B 1HL3A 4ODIA 4IV5A 4KE8A 4AMBA 4QX6A 3OTOB 1RCTE 5HIKA 2NACA 2FR8C 4HL6A 1PU2A 2G9RA 3T0GA 1W36C 1R9MA 3DEAA 2VZ8A 4LOIA 1J0AA 3F2VA 1S3FA 5FWXA 1KHTA 3R75A 3QPAA 1Q15A 2ZYRA 1RAIA 1ZOOA 1F0NA 1P2VA 1MTOA 7ADHA 2X8BA 4YAWA 1PZXA 2I3BA 2I7DA 2B36A 5BRJA 3DBOB 2CLCX 1XRPA 2DT5A 1Q0UA 1Z37A 2R8ZA 3MTDA 3OZVA 2W2LD 4FE7A 1R4AA 1GG9A 1Q17A 2PJZA 4Q66C 1JX6A 1M2WA 3V34A 5GJBA 1G4AE 3FSEA 3OWOA 4BLPA 3KZKA 5ALHA 2Q5OA 4CQMB 2CZGA 4M46A 5K7SA 3A6GA 4YX9A 3ETLA 3NJRA 3CW2A 3OH8A 3TLAA 3HP7A 3HZHA 4QUHA 3CPEA 2QXTA 1X1QA 3I9KA 4RK1A 4KYUA 2QLFA 4HH4A 2V9PA 3O8OA 4ZYYA 1PNOA 2QJFA 5EVJA 1PGQA 3ZXSA 1KAOA 3QFTA 4FIDA 2VNKA 2E37A 3UW3A 3ONDA 3KPUA 2UZ4A 5K8LA 5CA0A 2BGIA 2JCVA 1YS6A 3S44A 2WM2A 2CE7A 2QG9A 1XLTC 4D9BA 5IZCC 2RC6A 5JH7A 4M0MA 3TG8A 2BGJA 4DDMA 4ZVUA 1RQRA 4GI1A 2PGAA 1W0CA 2ZE8A 2MMCA 1ZD2P 4G2TA 5EZSA 2OOSA 2P1DA 5AW0A 5ENDA 3WGZA 1NBHA 1PT8A 4TMWA 4D57A 2X5NA 3PC7A 4AQDA 1E60A 2GRJA 3S1AB 1SKQA 2ZVQX 3QKTA 2FQWA 4EUEA 3NNDA 1YDEA 2XMRA 2OXIA 3TRDA 1ONOA 1R5OA 3H2JA 4NHEA 1ZM2A 1HDOA 4P5EA 2AD1A 1H05A 1I2DA 2HU7A 2OOKA 3INTA 2IW1A 4V39A 1ZINA 5DN6A 4A2PA 3S8YA 3NBAA 5SYAA 5BN4B 5EE5B 2XUPA 3EXG2 3MAGA 4LQLA 1YDHA 1GZUA 4L9WA 2HPZA 3R7BA 1OFIA 5I7SA 1P8AA 4IICA 3TLGA 1UBTS 6PFKA 2W0MA 5IT0A 1QR2A 3VHXA 3VSCA 4RTLA 4MYHA 2J3MA 4MDFA 4D4KA 3WA7A 2UZ3A 5AP9A 1Y4SA 2LKDA 3LPLA 2Q5EA 4DJ5X 2D2EA 2HFJA 4FSDA 1O8CA 3E4DA 2AFHE 2QVCA 5EHZA 5MHTA 1W4LA 3IE2A 4C6TB 3PSHA 3DC2A 2G0TA 1AGPA 4PLTA 4DBLC 2FZEA 4TZ6A 4HFMA 2YHIA 5T8KA 1XMVA 1X1AA 4ERXA 2H31A 4GC9A 3HB9A 3D6JA 3RUCA 4OB7A 1O4WA 3G3EA 4G07A 4Z4IA 2FNAA 2R96A 3VC1A 5KPDA 4PXYA 5C1PA 4AO8A 4GRIA 4CR8A 2A1UA 2FZLA 2G63A 3K1AB 4NBLA 2C4TA 5B1EA 5LD2C 2MSEB 4Q7QA 2CLIB 4QDJA 5FLEX 1WV0A 5FTLA 4DDKA 2YMLA 1O6ZA 2D5AA 4LBWA 5HE9A 5CHYA 2Q6KA 2Y1OA 3N5KA 2Y1CA 3B1XA 3PK0A 4N54A 1PJ8A 4EVRA 4QAQA 2C31A 1E2BA 5TR9A 3KU1A 1I32A 2D4HA 3PXEA 5JI3E 2CFSA 4N5IX 3K30A 1FJGB 1XB2A 3IPCA 3VI4B 2HZBA 4XWWA 2IX3A 1XDSA 2Q5HA 3EVCA 3KYDB 1NZJA 2E4YA 4INAA 4JJAA 3EXHC 1M73E 3C6ZA 5IKPA 4PO1A 4OHFA 4QG7A 3W2GA 4HZGA 5JFOA 1GNPA 4KNWA 2ZB7A 1PLJA 3TX2A 4TVSA 4PSCA 4DQDA 4EG0A 1YFJA 2GPYA 4UUPA 1QIMA 1RQLA 4QSMA 4FT2A 1EFHA 2C7OA 1RM4A 3O47A 3UOAB 1O96B 4RCZA 3LCMA 5AUOB 1Z2AA 4PHCA 2PX4A 4XRGA 5AMXA 4BP8A 1HG1A 1K4YA 3KOWA 3N7UA 4F38A 2C9ZA 4RPJA 1FUKA 4O4HA 3K4PA 5CFPA 1VQ1A 1FFEA 1ZC3A 1TTTA 2GSWA 2UZAA 4D02A 1UEIA 4PRLA 4G01B 3WGVA 4DNXA 2H2IA 3IPLA 3SIWA 1GFZA 1Q12A 3I9JA 5IH7A 1ECCA 3GLFE 1F0PA 3NHUA 2PXHA 2X0DA 2XMBA 2WD7A 2GK7A 2VDOB 4JD5A 3OCVA 3TTXA 1EWRA 4QLBA 3AEYA 2WUVA 4LSZA 3E84A 3KSAC 4BNTA 3ELYA 4MWBA 1F5NA 1RI5A 1U1CA 4EYSA 1JAXA 4G0UA 3QPVA 3A58B 5TMDA 1NOKA 2Z9CA 4MPRA 3DLAA 4K0RA 4QNRA 4TYMA 3HO8A 1EUYA 4CT4B 3HNPA 4TYQA 1YO6A 1S3SA 4LZZA 2PUEA 1N9GA 2AE1A 4GEGA 3FKSD 3L0IB 3VYSB 4N5DA 4CCWA 1QGUB 4IFIA 4PYQA 4A4DA 2BSAA 3N0TA 3UUFA 3MPUA 3GMSA 1ZW1A 4YO7A 1YR2A 3OAAD 4Z8XA 1CUIA 2HPAA 2YZ7A 1Z4NA 2JLBA 4P92A 1Q7RA 1KZHA 2O2CA 4JJZA 3NWOA 4HHEA 5AI8A 3WB1A 3HC7A 1YIOA 1X7WB 1Q0ZA 5NULA 3U44B 2QRVA 3K9WA 2G7MC 4K3UA 1SZJG 2BMWA 4C4OA 1MZVA 1WCIB 2R2AA 2XXAB 4LC0A 1K7FB 2WYOA 3EBOA 3GEIA 3PXCX 1COZA 4EJ2A 3EGVA 1H93A 1XZPA 4AK9A 2RB5A 3HNOA 1MVOA 1V9LA 1XPJA 1GNVA 1Y33E 2D1TA 3NNSA 4IQFA 4JL5A 2Z8ZA 4GM1A 4DSZA 3BBPA 4H1TA 3VZPA 2XB9A 1EXDA 4QBIA 1FJHA 5LMZA 4GOMD 1VMKA 3JQ7A 3KJZA 4JB8A 4DCMA 2WJPA 2EFJA 3B5JA 5K6TA 4WASA 2O8FA 3EQZA 4LSMA 2VRBA 5AI9A 5G41A 1YR9A 5AQEA 3EWNA 1BDBA 4I46A 1SVSA 4O4JA 1C0KA 1WIWA 1E8MA 4EHIA 4ND3A 3C87A 4TS1A 4G5YA 1Y37A 2FPGA 2O3TA 2W2TA 4L0CA 3UAVA 4BP9A 4F45A 1PV1A 1IJBA 1NDHA 1XK7A 3V7YA 3VJMA 2IH5A 1I9GA 1GCAA 1I0ZA 4F86A 1TADA 4QFMA 4ZI2A 1IPEA 1JNYA 1TXGA 1WOYA 2OFWA 1JHYA 1G64A 2VTDA 3JQEA 4KO1S 5ARDA 4S1PA 5FHQA 1DTWB 5BSUA 2R8RA 3TLKA 4BVAA 3DNPA 5ED4A 4PLWA 1A27A 3AR6A 4DQKA 5JJKA 1T43A 2QYOA 1E2MA 4P4SB 5KS2A 3EC1A 4J4TA 4RGVA 2Q5JA 4B33A 1SR8A 1A4XA 5C9ZA 3DL4A 3IPYA 3QBDA 1M54A 1UF9A 2QTCA 2N47A 3TKLA 4Y6GB 3E9QA 3U6KA 2B21A 1RRPA 4W1RA 4YJKA 5IASA 4JCCA 5I7RA 4DSOA 2JCSA 1VJ0A 2NZYA 3SHOA 4BNIA 1B00A 1VJTA 4I1RA 1J70A 3LL4A 3P2EA 4UAUA 4YR9A 2CVPA 2NYUA 1SVWA 5FYQA 2IRWA 2WAAA 3FZEA 4HQ0A 3NRBA 3WL5A 3UC5A 2DLDA 2Q1SA 4V0NA 4L3WA 3UWKA 3MG9A 1PWHA 4OHXA 3GOHA 3RRNA 4ZYVA 2PWAA 2H4YA 1IVYA 1I51A 3SBOA 2YWDA 1QS0B 3GJ7A 5KC9A 1TU0A 1HURA 2WAMA 3E7DA 2HWYA 1EEHA 1NXOA 1D5WA 3FNFA 3I4LA 4GR4A 2OTCA 4AFNA 1MX3A 2V7QA 3M4ZA 4ZARA 4PTZA 4ZT2A 5SZKB 5JRDS 1IOVA 2O8CB 2P1RA 3R7FA 1M1NB 2Y6UA 2V74B 3O73A 1N2ZA 2YDXA 3ZDYB 1HL7A 3ZGXA 3ELBA 4UTRA 2A0FA 2BM0A 3JRWA 5BORA 1Z8FA 1U1DA 1NGSA 2V0NA 3Q7TA 3WFIA 4RENA 1JDSA 3I6IA 1DQRA 3PQ3A 2YWHA 4RSMA 2UYYA 1S2OA 5DJ5A 1VE3A 4MCAA 1AKVA 2JNWA 1CUFA 1NI4B 1JYEA 2XX3A 3KSMA 3CZAA 4Y9UA 4LBVA 2AA3A 1MN6A 3NH6A 1Y98A 4X1KB 3TIVA 2VF2A 2YYAA 3ICWA 1G7RA 1T2UA 1R74A 2FW0A 4FFLA 1U5AA 4P58A 1I8TA 4IBOA 5CM2Z 2A5YB 3Q6MA 4B9AA 4FYXA 3A0RB 2QAJA 3T7KA 5KBYA 3UK2A 1BVHA 4PZAA 3JPYA 1YTUA 3S2EA 1JQAA 1M6YA 4MLPA 4WJLA 2ZYHA 3S1SA 1ZD5A 2D7CA 2FN7A 2H7YA 2R65A 2WTNA 2PGDA 1KR5A 2WF9A 5EMKA 2WYHA 1R0ZA 1VA5A 3RAJA 5JD5A 4P36A 4Q18A 1M0TA 3G6WA 3WYCA 4G86A 1F4LA 4MYSA 3FYTA 2WD8A 4DQ0A 5A62A 4ZTUB 1T0PA 4RE6A 4JB0A 5JCOC 2VTBB 3IEVA 2VQSA 4RDHA 3CRW1 3ILXA 3QM1A 4YEDA 4PU0A 121PA 1SCDA 1GNTA 1MNAA 3HGMA 3IALA 1A2BA 2PBLA 4LJ4A 5G3ZA 4E14A 2F3QA 5M34A 4MQUA 1B26A 1Z5PA 1GRQA 2H7CA 2B92A 4I4LA 2QX7A 2OGWA 3ADCA 5KSYA 1ESCA 1BMDA 1OIVA 2H17A 2OFXA 3EASA 2NZ2A 2W6JA 2XD9A 3B3JA 2W6ZA 3W6NA 1AA6A 3FSRA 4MV7A 2VDNB 3P20A 3D8TA 4RV9A 4EELA 1XVIA 2JGFA 4MGIR 4YLGA 2D5LA 2FE4A 4YCDA 2XVZA 3O93A 5D7BA 3WYDA 2UXBB 2QAIA 3RFUA 1JQEA 1Z28A 5AK5A 5BQ5A 3FHCB 1MXHA 4UUNA 5BWBA 3WAJA 4AF6A 5HM8A 3ZHYA 3HXTA 2ZR7A 5EIWA 2QZSA 1ABBA 4EUNA 3T3MB 3P9IA 3ROKA 4UNSA 5KVAA 2HRZA 4R98A 1ZLYA 3EVZA 2F3UA 3LS2A 2RHWA 4HNAA 4CQLA 1R0BA 2VAVA 4KN8A 2ZJAA 1NT4A 4LWQA 4OD0A 3GJ0A 4QUEA 5ESDA 5FOTA 3X1KA 5TVGA 3KYCB 6GPBA 3OQNA 3L5KA 3SZGA 3H4MA 4OP3A 5FO0A 1YJ8A 1A0OA 4MYRA 3L7LA 1QUEA 4DMUB 1P2SA 2G88A 4KBFA 4O4JB 1NV9A 1OZFA 2OMKA 4UDYX 1EH5A 1T5SA 1YJ5A 2ODTX 3ULKA 1ZS9A 1ARZA 2PKYX 3PEWA 1KIAA 4E4TA 3H1TA 2W2VA 3NVMB 2NO9A 3JAWA 3VO8A 4G4GA 1XDZA 5EJGA 3Q8MA 4ZJUA 4RSRA 3WZLA 4DVGA 4EGFA 1IBLB 1N75A 1RI2A 1G8AA 3FWNA 3N2IA 3C7TA 3I83A 2H65A 3QNUA 3QYPA 4MSUA 1DJOA 4B3JA 1GU7A 3DBIA 3FNIA 3BG5A 1R9GA 2WC1A 1ADBA 3KV1A 3WLPA 4E5UA 5KYTA 4DJDC 1NXPA 3VH1A 2AQIA 3BQ9A 4GS5A 4Z0HO 4DQXA 1UJMA 3MJDA 3Q3JB 2ID4A 2B9VA 4YRLA 3EDYA 3SY8A 3KHKA 4DJEC 5FPPA 1PUJA 1TVMA 3V8MA 4JBXA 5LQAA 3LXXA 3JTEA 2ILTA 2XVXA 4Y2VA 1V1MB 4O02B 4Q1AA 4TMXA 4B83A 4ACAA 3MTIA 3H3FA 2C7RA 1O96A 1XAGA 3Q2KA 3TIFA 5K8TA 3CF6R 3EIXA 3QBEA 4TMYA 3C15C 4JMPA 1BHSA 4HWRA 1U2GC 1UJ2A 1OREA 3UB4A 1EGVB 4TSFD 3QBVA 4TYNA 3N2NA 4TRRA 1RZRD 2GYUA 1MB3A 1CKEA 2BMEA 5HGJA 4DCNA 4C07A 5JSFA 3BEOA 4OPMA 1AZLA 1PWXA 3H5AA 3QMWA 4IDGA 4J6EA 4DRXB 4ZHQB 3GJZA 4GKKB 1ZVMA 4KRYA 3D02A 5ERXA 5TXGA 4TTRA 3THWA 5HKKD 3KHUA 5EJAA 3OQMA 5B6PA 1CQZA 4N65A 4YP1A 4YH1A 1ATIA 2FFAA 2FLWA 4GT1A 4JI4B 3A70A 1LI7A 4Y2TA 3OO1A 3W79A 3CLHA 1P33A 4LOKA 2ROQA 4JB2A 4INJA 4YRIA 4ZVQA 2YV4A 4R3NA 1D6JA 4DV6B 2QUBA 1UP4A 2CB9A 2FSFA 5I8WA 1LGYA 1XQYA 3OTGA 3GN2A 3MMZA 3FSGA 2XH8A 3HV0A 5AOVA 5EZ6B 3HABA 1GL3A 4QREA 4BFTA 2JAXA 1QM5A 4QECA 1V0JA 2OAP1 3MWDA 3V2IA 1ZGZA 1RRVA 4J7CA 3UUGA 3WY9A 3EIUA 3A31A 1G2OA 2HC9A 4AIIA 2RE8A 2OXRA 4PY2A 2QTWB 5AKJA 1ZONA 1YRWA 4CG3A 1DJMA 3U7JA 2NTJA 4HJXA 2XKBA 1PW5A 3L6DA 4IHQA 1THGA 3S2IA 4BFWA 3ZIAD 4F93B 1JT2A 3AZQA 3UWSA 4BJ6A 5FWDA 3R5JA 1EVEA 2J5RA 4ZI7A 3PE3A 2VSOA 2F43A 1G5QA 3D5QA 2VSNA 4V0SA 1YHNA 3U1VA 2XWPA 1W5TA 3ZV7A 1FNSA 3UAYA 1ZMOA 4C0BA 4LX0A 4LPKA 3UUWA 3WDLA 4TKLA 2RH8A 4V24A 4CMCA 2NPIA 1UZMA 2QQ5A 2HMTA 5K0TA 2WTMA 4WOJA 5CA0B 3N8IA 2ZRNA 1P0MA 2ZU6A 4TLBA 1JSCA 1KK2A 2II6A 4S2EA 2OC4A 4ZV4A 1OWOA 4U5XA 4Y1GA 3W4KA 3DVLA 1BU8A 4XIGS 1DDOA 2C97A 5BMOA 3UMRA 2V1XA 4IYJA 4BU1A 4C03A 5F2EA 1H1TA 3P2IA 2QN2A 3LVFO 3QPDA 4LNUA 1HDCA 3AFNA 3SXJA 4FR2A 2Z1NA 4MV9A 4F91B 3ICEA 3KXLA 2ECQA 1K8RA 1QO0A 3HN7A 3N6XA 3OHMA 4MO2A 3PUKA 3ZCXA 3C8HA 2O2IA 4F1KA 1G3QA 1SELA 1XXHE 3EFHA 3ZWQA 4EG4A 1SMKA 4GE3A 4FHEA 5E7MA 5JDCA 5JMWA 4EO9A 2DBRA 1CP3A 2OBLA 2ZBPA 4BX9A 1I4EB 2H2GA 1U8TA 4BOYA 3BWEA 3MHPA 3W2FA 1XTZA 1CFJA 3FRHA 3VPGA 2YFKA 3P0HA 1HT1E 4HLQB 2UUCB 3NHWA 1XCMA 3RS9A 2TMGA 3H75A 3MCUA 5JJIA 3WL7A 5K0CA 1LC0A 3I0NA 4FNAA 4JT2A 4EX6A 2H08A 3VV2A 1OI2A 3S4YA 3GEPA 1ADCA 4YR7A 4WXYB 2Q99A 4JNKA 3IQDB 1K88A 1EUCA 4I6JA 1U4OA 2R5FA 2WUWE 1GKKA 2YVQA 2JA2A 3N5CA 1I80A 4JL6A 3SVZA 4XA8A 4P8RA 1IQPA 4MROA 4N6NA 1X74A 5CT6A 3U1TA 1FSPA 1AN0A 1EPUA 1MQ9A 1QHHB 3MMPA 3EZ2A 3THRA 3USZA 5CT5A 2GK4A 5JSUA 3M5DA 2H16A 4FQ8A 3RRMA 3URMA 4AY5A 4EUKA 1ZOSA 5HNKA 2Q9BA 3TLZA 3UV6A 4BMOB 3KSBC 1QV9A 4EEZA 3W2EA 3C3CA 4V1CI 3RK0A 4DWVA 5JNWA 1J1IA 5GJVC 1UFRA 3TVTA 3WGGA 4DPLA 1HOTA 4BEWA 4GMFA 4DCSA 4D0LB 3E1GA 4H35A 2B35A 4PVDA 4WAUA 3TR5A 3I5AA 3PD7A 1ZN2A 4M1SA 6REQB 4XD7D 2BEJA 1GZVA 2PUTA 1F8UA 2QSUA 3GK3A 1D2GA 1O95C 4C76A 4CETA 2Y6VA 1P9NA 4LV6A 4EARA 1V9CA 4B3FX 3EG9A 1NQVA 3MHTA 2J5BA 1AXRA 2VJOA 3LBIA 4AF7A 4CKCA 4F2PA 3AXSA 1EVKA 1V16B 3HA3A 3LPNA 3H5RA 4EYEA 2WOJA 4W8HA 2V5AA 3FMPB 1ZN9A 2VK1A 2GPNA 4NDZA 3E9NA 2IT1A 1TO2E 4O2LA 1DO8A 1ES9A 3JRXA 4EF5A 3M3HA 3QVVA 1MB0A 4LMBA 4R4JA 4DHWA 1F1BA 1R0YA 3RAFC 3PDIA 1V37A 1WZIA 3FD8A 3G2OA 4DA9A 4JGIA 1PGPA 3MIIA 5DRYA 1C2YA 2FP4B 3W6OA 5BSVA 5JZMA 3DT8A 2J9YB 2PVPA 3R74A 1HDZA 4S1TA 4ENUA 4ESVA 1TTQB 1PG5A 4KH1A 2ORWA 3BD7A 3N9IA 1Z06A 1R27A 3GARA 3PHIA 3BFJA 3O8NA 4MPPA 2PH1A 1SQ5A 2WHEA 3AFGA 4MS3B 4RA9A 3M1YA 4TT3D 3RSFA 2P9FA 4ZZ2A 4BNVA 5HFNA 5JISA 5KREA 4Y6QA 5CDTA 2F1RA 4TYWA 1RP7A 2QR2A 3ZWDA 3OE1A 1J5PA 1PSZA 3ORRA 4BZXA 4HDRB 4CIBA 2WJYA 2FSVA 4EPVA 4D3YA 3P9NA 4PLYA 3MNFA 2IHVA 2D2XA 2HEIA 1EGMB 1IUOA 2FEXA 1IHUA 2A5JA 2W2QA 2ZJ1A 3DA8A 3OX4A 3QU4A 4L8GA 4ZO6A 4E07A 5A4AA 4GYKA 4RL4A 3SQNA 5J40A 4I55A 4JUCA 3HBMA 4EBFA 1HT0A 1W4RA 2FW1A 1MBZA 3EPRA 4G24A 5DNUA 3HJFA 4HTFB 2WIGA 4RACA 2YWRA 1W48A 3GGJA 3GJ6A 4GLLA 1W581 4B3SB 1F6WA 1T9BA 3G17A 2JW5A 4U6QA 5FPQA 2GN0A 4HCJA 4JR0A 2PKRA 4FE4A 4H7DA 5J3JA 2WUDA 5AUQA 2ZE6A 4J0IA 1MRZA 1B23P 2GJ9A 3VKVA 3BRWA 3E27A 1ZD1A 5H1YA 4E6EA 3A3YA 4ZCQA 1GLGA 3OE4A 3R5KA 4TZTA 3DWEX 1SIUA 2QM7A 1WNTA 5IWCA 3C3JA 1YQGA 4O2RA 1SKUA 5HBGA 2OZKA 3BJRA 1G3UA 4O5OA 2CHFA 4DLYA 2DERA 1PI3A 1FQKA 3KL4A 5AXBA 1KF0A 2PSEA 3VU9A 1VI5A 3BERA 5HDBB 3MGGA 4L6CA 1KFJB 5DM60 1XTSA 2FZCA 1E0SA 4JFAA 1V3VA 4H17A 4S1WA 4BLQA 3SJBA 4PPQA 1P4AA 3EWAA 3QLUA 3T06B 4B43A 3DPIA 2J85A 4N0QA 2SICE 5TGDA 2O7QA 1GILA 3TZQA 3LTEA 4JNCA 2OBMA 3IDFA 3QZUA 2Q45A 4ER7A 2FVYA 5BVHB 1WW3A 3RJ5A 1U0EA 4JLVA 5JQGF 1V6SA 1T34A 2A1UB 3A32A 3D1LA 3EIEA 1PDWA 2IFTA 3HM2A 3LDAA 1DEXA 3CC8A 3LF2A 2IW3A 3KYBA 4LS3A 2DSTA 1HKHA 4BECA 1UXJA 4H7IA 1H9CA 1R8JA 2AJ8A 1KI7A 1UBSB 2QI9F 3CJRA 4ZGWA 3KJNA 1T2DA 1YQEA 1A8IA 4O0LA 4KAFA 2HA7A 2Z04A 3A9TA 1D2MA 3P0EA 5AXCA 1BVRA 2GA8A 1G6HA 4LDQA 5F7OA 2QR5A 2W2PA 1NVUQ 1NHWA 3BF7A 3OEYA 3T38A 5A3QA 1E1QD 3T1HB 2V7WA 4TROA 5ARCA 2IV3A 3U3JA 2VA9A 1BW9B 1H0HA 4QXQA 1TGYA 4YIHA 4H7PA 1EP3B 1POXA 3UPUA 2GCEA 2BEVB 2VHWA 1AQYA 2AI1A 3PNKA 1R0WA 4OAOA 2PZEA 3I2HA 3IAUA 4N12A 3DAOA 4OQXA 3AFOA 4A73A 2P65A 1EK6A 3PNPA 4WZAE 4AW9A 3O84A 3PWSA 5B3LA 1JI0A 1T2FA 1ETHA 3M6FA 4MVJA 4PG4A 3VR1A 4OQLA 1N5LA 1LLQA 1NVAA 3B6EA 2CBZA 4BVEA 1BHQ1 2INGX 2OXFA 5GONB 2E1RA 2D62A 2RCNA 1Y3BE 4OMFG 2Q8QA 1KE2A 4EW2A 5JCJD 3M6AA 3F9RA 3CVWA 1FU7A 2VRNA 4FDTA 1CTQA 3V4SA 1CE8A 1SOVA 3DB2A 1K6MA 4LOLA 4J03A 2QR3A 2NZJA 3OEEA 4O2BF 3WLSA 4B3IA 2VRWA 5A3JA 4W5TA 1Q1ZA 1AKMA 2FWBA 2EKDA 3EIQA 4P2BA 4UM9D 2QLBA 3L02A 2V9CA 4EGAA 4PYLA 2QQEA 3PDHA 2HMUA 1RR6A 2DY0A 3WO1A 1JKJB 3M70A 1HF3A 2P2NA 3B20A 2PUFA 3B1WA 1Z5NA 3B1FA 4TQGA 3CONA 4O2BA 1Y4ZA 2ZW9A 3NC4A 5B4TA 3JQFA 5I4BA 1W85A 4GPBA 1KJYA 4WDQA 2V6IA 3DCNA 3VR5H 5IF9A 2Q3FA 3HCBA 4LOJA 3C2QA 1V26A 4IXDA 4DT1B 3A25A 1BXRA 2IF0A 1K7CA 3DE3X 4L15A 2QG6A 3GGOA 4EHLA 1RW4A 2J87A 3NWBA 1A8UA 1HFKA 1TX4B 1UPXA 1P91A 1ISFA 5AW1A 1SBIA 1O6BA 4CIAA 2JJ1D 4Q4AA 3HYLA 3AZOA 4XQEA 3QF4B 3L6EA 5BSWA 2ZR8A 3R0VA 4J9UE 4DTIA 2LNDA 2P9TA 1MNQA 1P1IA 1OZ0A 4ONEA 1YK1A 4FTWA 2YY6A 1Z18A 1MDBA 4U3JA 3WLTA 3HUTA 3OIFA 2CMFA 2RARA 4GLJA 4DR7B 3L6BA 3Q11A 3S40A 2A0YA 3GJRA 3IBCA 1JLLB 3LFTA 4FCWA 2FOXA 2JDID 4I5GA 1RLTA 1QIDA 1YZFA 4INOA 1G5HA 3UHOA 2DWPA 1AURA 3F97A 5DHQA 3GG2A 4FE3A 2WHPB 4MCIA 4BLTA 3SJAA 3VRHA 5DNWA 2DB3A 1JEDA 4TLAA 3N7AA 2ZLBA 4JI6B 1I2MA 3P9SA 3VFDA 5SZIA 2P8JA 1WMDA 4NYMR 1EM8B 2F3SA 4PZEA 4N40A 2OWDA 3ETGA 2NGRA 4EKEA 1NXXA 3VKGA 1IQ0A 4L2IA 1V4NA 4N3NA 1VLLA 3AI3A 3RAPR 4L3OA 5A1TA 3COJA 4W5OA 4UMFA 1P7ZA 4FLFA 2A3RA 3C6KA 4YQFA 5ADWA 1F2DA 4RF3A 5C35A 1OBFO 2Z2KA 1A4IA 3LCCA 5T4FA 4NIMA 1JZQA 3FJ1A 4UULA 2ZJFA 3TUJC 4BRSA 5EJEA 2WMDA 2Z3VA 1G8MA 1Y8ZA 2HHLA 2OCKA 2NU7A 4UBKA 4D9CA 3KQOA 1F14A 1N2IA 3D3WB 2HIGA 2VUSA 3BIFA 2OAGA 3QUCA 4YPOA 3KIPA 1TB4A 4IQ4A 4DW8A 1X2BA 2IOHA 1XZCA 4FBGA 2QRLA 2PKQO 1BH2A 3VSBA 4TN1A 1G20A 2ZR0A 1SVOA 2BZGA 3SKXA 2WTAA 2LE0A 4DIKA 1HC7A 2JLYA 3IB6A 2JFFA 1ONPA 4PTLA 1RC8A 1B6GA 3MINA 5IVDA 5IDQA 1D2AA 1YHZA 1OOEA 1Y4UA 1VTKA 4YYEA 5MN5A 1MO6A 4LF7B 4G0XA 3H9CA 4IZIA 4UASA 4L02A 3K6SB 3ZVMA 1ZK4A 4OI2A 1Z82A 4PAQA 4JX8A 1QWOA 4QDTA 2ZRQA 3FHLA 3V9PA 1M0WA 4XFJA 5K20A 1XCOA 4XW2A 2X77A 2XZTA 1IN7A 1E3IA 1SC4A 1E6CA 5F64A 2OHHA 1VECA 3IIJA 1C3JA 3RYCA 4EYOA 1NJGA 2PQMA 4DBLE 1F4VA 2IIBA 4PO9A 4PBRA 4FUQA 1B76A 2ZAMA 2J9ZB 2B7BA 3JATA 5EN4A 3G0CA 2VRCD 2JAWA 1T1EA 3INGA 5DV9A 3KDAA 1CIJA 3VGPA 5KI6A 4DV3B 1A5TA 3SYRA 1IZ9A 1S7GA 3ZZMA 1TA0A 1A8QA 1PLKA 5THXA 4AS3A 5HOQA 3ED5A 3FG9A 1YJAA 4UOZA 1HYBA 4ND5A 2Z57A 4EHHA 3UHFA 3K0CC 5AOAA 2FPOA 4LC9A 3VQTA 2XE7A 2V4MA 4Z4GA 4MGHA 3BCSA 3OIWA 5ALSA 3LWDA 4D56A 4HDQB 1DKRA 4OJQA 4QQFA 1BSVA 2HIMA 3KZMA 5CXSA 3KYJB 2QHXA 2XKAA 5E6SB 1H2RS 4QXRA 2X7HA 3PUHA 1DQZA 1GPNA 4H1UA 2QD5A 5IRCD 3JQ7B 3KWLA 3O38A 4P5PA 2V4UA 2C2OA 3IAAA 4ZQIA 3UTCA 4XDZA 4JC5A 2EJTA 5B1IA 1QPGA 5EKDA 3G0BA 1C7ZA 1YE5A 4RTKA 1I7DA 2F6RA 3BFPA 4Q3LA 4M7WA 4B48A 3KQHA 2IYSA 1W29A 3MJSA 1LB1B 1TQ6A 3DEHA 1XTJA 2GEJA 1GKIA 3HUUA 1PAUA 1YFZA 2I0FA 4TXMA 4CKWB 2AVDA 1RKQA 4EZIA 1DTSA 5IFKA 2IE8A 1KZ4A 1NW5A 1ZXBA 2Q8NA 3TH5A 1F8FA 3ROGA 5JUWA 3AJAA 1USKA 4L9SA 1NDUA 2DYKA 5LKAA 3TIIA 1TO6A 4XDHA 5IEBA 2WPDD 5JYCA 1GU0A 2ZJ3A 4M8LA 3SYKA 4RL6A 3VDRA 1SPXA 4JT4A 3KAJA 1EE1A 2HRBA 2IP4A 1E3WA 1E2PA 2I29A 3HB4X 1B3RA 2GVZC 1WP9A 3B3AA 2P9ZA 2C7BA 3GP3A 2EX0A 3QLVA 1PL8A 3S3TA 3SXUA 5ITZA 1LJ8A 4S04A 3IIMA 1GEGA 4A2WA 4ZYXA 4DXAA 1K68A 4J29A 3RBZA 3TQFA 2P6OA 5EXPA 3K0FB 2BFCB 1ZGBA 3D0QA 4Q9DA 2JFQA 5ITSA 2QSYA 1AMNA 4F9EA 5IMBA 1WF3A 2VIIA 2HGSA 1WABA 1MOZA 2FETA 2AOTA 4Z86A 1VA4A 4MK4A 2QW1A 5CW1A 3F1LA 1P75A 4WBNF 4LXHA 1M75A 5YASA 1IBMB 1PQUA 2QAGA 1P80A 2ATIA 3DS8A 3I2YX 9GPBA 3U7QB 4A27A 2Y76A 1HO3A 2GBGA 4D9MA 5AVTA 4O4HB 3ESZA 5BPFA 5L53A 1UT6A 4HAVA 1ZCJA 3BIWA 4G3XA 3PNQA 4WLVA 3RVQA 2K7FA 1NNSA 2XBLA 2I4OA 2JHCA 1LTKA 3BMQA 3UG6A 3SC2B 2PKEA 3G82C 3VYTB 2Y0DA 4E31A 4EJMA 3E35A 1JDPA 4Q7MB 2CVQA 1MR3F 3ANXA 5CLLA 1ENPA 2H54A 4LE0A 4RWEA 5K3AA 2ZIFA 5E4JA 4ARZA 3VC7A 1W0JD 4A91A 2O2YA 1P60A 2NX2A 3MLBA 3VHRA 5B58T 1DXOA 2Q1UA 5D5QA 2MSNA 2HZ7A 1S2NA 4EKNB 4FYKA 4MQ4A 1M10A 2QVBA 3BKWA 1JI3A 3ISTA 1BDMA 1I7NA 3NFRA 1Z45A 3BJEA 4EKIA 2HV8A 4UVIA 1E8NA 2FJPA 2ATXA 3ZV6A 3WRYC 2LVBA 1KO7A 3GAMA 1PDVA 1AGYA 1GNRA 1I10A 1V48A 3DLIA 4V2IA 4BLWA 4P54A 1YHYA 5TARA 1P0QA 2GEBA 2EFDB 1QJCA 1P7PA 3VVCA 1QLHA 1VPLA 5E9WA 1QFYA 2VHVA 3B38A 3AY3A 3CR8A 4KSYA 5ICEA 4DLRA 1KYWA 1MAWA 3RU7A 4U0JA 4UTVA 2ZYWX 1JHXA 1QFSA 3LHIA 1ZWLA 4UHHA 1TYCA 3EUEA 4J0FA 4OQPA 4PGHA 3IAXA 2HSJA 4NMHA 2QMUA 3KQMA 5CT9A 4WEOA 1QFXA 1TM3E 3OMXA 4TX1A 4L4SA 4OHBA 3T12A 4MUFA 1RXEA 3T4PA 3VDMA 1L5VA 5B7NA 1MJNA 2XDAA 4QGGA 1WV1A 2VBGA 2NAFA 2V3VA 5AI0A 4NJOA 5KSZA 2AZXA 3WKCA 4GPTA 1NW8A 2CY0A 1J2EA 2DQSA 2OHGA 3AL3A 3VZSA 3MRXA 4DLZA 3LQ1A 4YRPA 3RSLA 1TZCA 1G5PA 4YQZA 2BBSA 2GPAA 4YT8A 2ZBVA 4K88A 5C8XA 5U4XA 1QGZA 3OZBA 4G23A 3V7WA 8ABPA 4HWOA 1HZZA 5BN5B 4OM7A 3SZRA 5CA1B 5HUHA 1V47A 2CXSA 1GGEA 4MAAA 2GD6A 5AHWA 1EAMA 2QMHA 4XM0A 2EFCB 3SOPA 1D8AA 1GV0A 1VIMA 4NFHA 3PYMA 1QGOA 5CFOA 4EJSC 1B6RA 1S2MA 1TJPB 1ZM4A 2ZIGA 3EMKA 5KO2A 1X80B 1TVEA 2G40A 3CF0A 4ISCA 1I01A 4P3XA 1U9CA 2IX9A 3H1GA 1UDBA 1NUTA 4N9WA 2LDBA 1VKRA 4ZEMA 1J07A 1XYYA 3KXIA 2J31A 3VVLA 2OBYA 4F7DA 1Y6QA 4BB6A 3WAGA 3AR5A 3IRVA 3LDHA 4HNHA 2WICA 3LQFA 3O3OB 4M8KA 2AEJA 1Z7GA 4RDIA 3RJMA 1VBMA 1R8QA 1LVGA 4OBEA 2G3YA 1OLUB 3ROZA 3D8SA 5IU6A 1WHSA 3GVPA 2R6JA 2HIHA 5K0FA 4LF6B 4Q4JB 3K2IA 3ANTA 5IAAA 3FYHA 3ENWA 4KDEA 4ARIA 2XE8A 4MS4A 3KR0A 4DWJA 1U8AA 3BVPA 1TIBA 5DWQA 3ZQUA 2RCYA 4HUTA 4UTZA 5DCUA 1KRHA 1PF7E 4OFWA 2PUCA 3HFGA 3TVYA 1AZTA 3IOCA 2X1HA 2EBHX 1CIVA 1FLNA 3LUBA 1HG0A 1E1QA 4YDHB 5TQ0B 5C4MA 1L1FA 4CGZA 1DXHA 2I33A 2YZMA 4XFDA 5JPCA 2GJ4A 2C07A 4KI7A 1T9AA 3I0ZA 2EOAA 5JDCC 1O0CA 4RD1A 4Z7OB 1XG5A 1A72A 3A2MA 3LUHA 4LTNA 1EFKA 4PCVA 4UBLA 2H2WA 5TDHA 1RXUA 3OG9A 4FOPA 3FCSB 4X61A 4ZVNA 4H4DA 1Z36A 3I76A 5JCJA 3ZC3A 5FUWA 2B7LA 3ER6A 2DWUA 2YVLA 4G25A 4IDHA 4OHKA 4CM4B 1YZTA 1JR3D 3GRYA 1QKJA 4MB2A 4DR2B 1NYTA 1CQXA 1DFHA 1K06A 2GB4A 2RAVA 2VO1A 1N1EA 5L6MB 1RZ3A 4BNZA 1Q7CA 5DLDA 1HV8A 2F90A 2O7NA 3FXAA 3FCAA 2NSHA 2PH5A 2FPLA 1XZAA 3H0CA 2FJUA 2XUHA 1JFFB 3FTNA 3RHFA 4CF6A 3TX6A 1XNJA 2POCA 1QQ7A 4ND7A 4M1EA 5KUTA 1WQ1R 1L4UA 2WE8A 2Y1WA 3D59A 1M76A 2M2IA 1GTVA 2YNMD 1JG7A 2ABWA 2Q49A 1G3MA 2QJTA 1EVIA 1VKJA 4I1OA 2GRUA 2NTNA 4K9NA 5A4DA 5EE1A 1KR2A 3GMTA 5FT9A 4RF5A 2CHEA 1CR4A 1G66A 1CUDA 3RD5A 4E70A 2BTEA 4OMDA 1ST3A 2HO4A 3GPIA 3S7ZA 3B60A 4MICA 4BZWA 4D3XA 2A2ZA 4YMIA 2AW3A 4DL9A 1FNNA 2CDAA 2ZYAA 4REOA 1PFQA 2D2IA 5FBHA 2PL9A 1A5SB 4FKBA 4M60A 3TTVA 3R77A 5LC1A 3ROEA 3MD0A