2PZMA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
LVPRGSHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 107
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzmA00
3ONFA 3PP8A 4J3FA 5L53A 3IDSA 4NI5A 1GCOA 1JTVA 1ZO8A 1B8UA 3KBOA 4GAEA 1I2ZA 4L76A 4XJTA 5JDCA 1HL3A 1HDZA 1X0VA 2PY6A 1H93A 2GN6A 2X23A 3I52A 1X0XA 1H5QA 4OO3A 4CMKA 1NWCA 1PS0A 3QWAA 1H9AA 2VNSA 2BI8A 2EXXA 2P68A 4R3NA 2AQKA 3VH3A 3P5SA 3NYWA 1UP6A 4YAJA 3OHSX 4K26A 2FWMX 1DLJA 3QWHA 3JQ7A 4XDYA 1BW9A 2Y1FA 2ZTLA 1B3RA 4HX5A 1HTBA 4NJMB 1CETA 4WKGA 3KRTA 4C4OA 1DIAA 4TKMA 4NDNE 1UAYA 4XYMA 4DVJA 1VJTA 4ZQGA 3DFZA 2BFOA 4IINA 1U3VA 4QUKA 4K6CA 1UXGA 4KUGA 2IXAA 4YBZA 1V3UA 3D1LA 1Y8RB 3RC7A 4CR7A 4BKUA 4E32A 4EUFA 5GZ1A 4J4BA 4S3MA 1XQ1A 1AXGA 3DZFA 1MFZA 1JLLA 1OI7A 1SOWA 2UUPA 4QX6A 3GN1A 1UDCA 4J1NA 3H65A 5JYEA 2CF6A 3PHIA 3QSGA 3WNVA 1W6UA 3B20A 1P1HA 4MVJP 3CPSA 2X4GA 1PJCA 3B6ZA 1IE3A 3GPIA 5JDCC 4I08A 3UH1A 1NQOA 4LRTB 4CM1A 3IQDB 4OQYA 1CIVA 3F3SA 4CQMD 1ONNA 4HFJA 2WM3A 3ZNOA 3EUWA 1KVUA 1KERA 2Q2VA 4ALLA 3F5QA 1GTMA 2X9GA 3RFTA 1HDRA 3DBLB 3E5RA 3LU1A 4XQEA 3E6AA 5T64A 4B4UA 1NAHA 3AUAA 5F3RA 3B1FA 3F4LA 1HSOA 3R3SA 3UKOA 2HAEA 3GG2A 4IMRA 5G2OA 3BTVA 4ALJA 1T24A 3GVCA 4J16A 1U3UA 2DBZA 3D4PA 3A06A 3Q3CA 3HDHA 1ZEMA 3DWFA 2X9VA 2OUIA 2GN8A 2C7VA 4Y6SA 3UN1A 4BGIA 3TL3A 2UV8A 1LDYA 3DAPA 2O2SA 3KOUA 4PG8A 4QSMA 5A9RA 1YH3A 1PQPA 5K6AA 4YWJA 2FPGA 3F9IA 2CMDA 4WLOA 4LMRA 4A2CA 1J0XO 1SMKA 4GI2A 1E1NA 1PWZA 1WW8A 2Q4EA 1WWKA 2I3AA 5FI3A 1LLDA 4CMCA 3FTNA 1XGKA 3MJSA 4JXKA 4FIZA 3IJPA 3TOXA 3G1TA 3ASUA 2E37A 5TJHA 1Q0HA 3JSAA 3RD5A 1F8GA 5BSEA 4DPLA 3K73O 3OJOA 4MVJE 1EQUA 2C54A 4I9NA 1O89A 2E48A 4B3JA 2VHVA 4XX0A 3NT5A 3DOJA 3S2IA 3ZU4A 1P0CA 1GYPA 5KJ6A 3KEOA 1LX6A 2EGGA 4UVEA 1HKUA 4YT4A 5C3MA 1JKIA 4BQPA 4BO5A 4RQUA 4KOAA 2IZ0A 4RLHA 3U62A 5CG2A 2ILTA 4M89A 4UVDA 4URFA 1EUZA 3KTDA 1OAAA 3WOHA 1DHTA 4IXTA 2NU6A 2UDPA 2Q45A 3UUWA 3DZGA 1I30A 4PLFA 2YHIB 1P44A 4FJ1A 1LC0A 2HKIA 4D41A 1X15A 3IP3A 2EW2A 1P9LA 1ADGA 2B83A 2ZQZA 1KEUA 3NTOA 4HFNA 3A4VA 4UUOA 4XQGA 3VZQA 2VWGA 3G0OA 3DBHA 5IFLA 4H7PA 3R3JA 1YB5A 1N5DA 2O3RA 3RUDA 1C0IA 4MVJI 4J9UE 4MP6A 3OEYA 3U0BA 3INTA 3OECA 4R4JA 3L0DA 1KY4A 4WCFB 5L7WA 5HTOA 3GEMA 4YA6A 5HA5A 1VRWA 3V2HA 1AUPA 3QVSA 1W8DA 5DP1A 3ZNPA 4EZBA 2O3JA 4WE3A 5JC1A 1E7MA 3PHGA 1P1FA 4E2YA 1RM5A 3WWZA 4BUCA 3U09A 1XCBA 3H3FA 1YQGA 3KB6A 3JQCA 2I65A 4J49A 1H6DA 3KSUA 3BMOB 1HZZA 3RJ9A 2IE0A 3P19A 4AJ4A 1LC3A 3FR7A 4W99A 4FBGA 1BDBA 3C7AA 4HNGA 4ZU3A 2VYND 4DWVA 1NYTA 3I6QA 3TN7A 2EJWA 1O8CA 4BV8A 3JQ8A 3ZHYA 1MV8A 2BFMA 2GPTA 1U4SA 3DBLA 3PIIA 4F6CA 2G76A 5ENVA 3WSVA 1ZK2A 1ZK3A 3JYLA 4JBHA 5L95A 1R4NB 5DN9A 2V65A 1GEEA 3K5PA 1EBUA 1TXGA 4GLOA 4N7RA 1T2CA 5F21A 4IMPA 2Y1DA 4BNFA 1T1SA 3OJLA 4CMEA 4BO6A 4GWGA 1K2WA 4O63O 2VNAA 1LEHA 3RU7A 3OP4A 1LTHR 1XHLA 1FJHA 4YT5A 3OQ1A 1C14A 4BNKA 3HN7A 2VWHA 3I9OA 4YTEA 4BMVA 2W8ZA 3GGOA 3W4IA 3ZHZA 1Y8QA 1E6EA 1VSVA 1F12A 1IPEA 5G0SA 5THQA 4BNMA 4PGFA 1GADO 1E5LA 5T6BA 2VT3A 4OKIA 4BO8A 1N8KA 1JAXA 3G17A 3GNTA 4XCVA 1I32A 4YAGA 1ISGA 4CR6A 1XELA 3H2ZA 1XKQA 5CEEA 2GF2A 5CDTA 4WNIA 2VN8A 3T7EA 5JY1A 4UULA 3ONDA 4EYEA 3GAZA 3HZZA 2Z95A 4WLUA 1WMAA 3P2OA 3UF0A 5IZCA 3FHLA 3ZWBA 2NV6A 2PD4A 1GQYA 3ST7A 3DB2A 4A10A 3V2UA 3DMTA 3GN2A 4D46A 4OQZA 3UAGA 4RJTA 3ADPA 4ESOA 1E6UA 3IL2A 1UXHA 2PH3A 2NTVA 3JYQA 4NFSA 2NACA 1XIVA 3NTQA 3OQ6A 3RFXA 1D3AA 1M67A 3PHHA 4IDFA 1MG0A 1HETA 3U4CA 1C1DA 5A5FA 1PU2A 3GVIA 3CEAA 4BO9A 2OOSA 3GK3A 4IJWA 5A02A 3HADA 1ID1A 5LDGA 3KYCA 2C2YA 2HRZA 3OM9A 1GUFA 1VLLA 3ZCXA 5B4UA 2DU8A 5ES3A 3ZI0A 2PD6A 3ZWCA 1E7SA 3ZU5A 2X0NA 2I66A 5GMOA 3TDKA 1SZJG 4Y67A 1HDOA 4B4VA 4BB5A 2ZATA 3NRCA 4XGNA 3HSKA 3CINA 3AU8A 4NHEA 5JDIA 1PL7A 3EGOA 3ONEA 3AFNA 3TZ6A 1FMCA 3EYWA 3NV9A 1GUYA 2EV9A 3E9NA 1QYCA 4EJ0A 3FN4A 3P2YA 4FGSA 4Q3AA 3VVCA 4PLWA 4AJ1A 2JCXA 4GKBA 4B7UA 4ZRMA 1P31A 4CV1A 2VRBA 4G5HA 2NVUB 2W2KA 2NM0A 5COQA 1XEAA 4J4TA 1LSOA 4BO3A 1HDYA 2I3GA 3GZNB 1ZKMA 2O3SA 2GYYA 3HNPA 3STHA 1W73A 4CMIA 3N58A 2EEZA 4YJFB 4W6ZA 4RPHA 5K6AC 4DRYA 2ZIZA 3FR8A 2DC1A 5JO0A 3ZW9A 4R01A 3IKVA 4UVGA 5T8KC 1TA4A 3RUFA 5DOZA 3RBXA 2PKQO 4E30A 1HLDA 4J43A 4IJVA 4ND2A 5DBGA 1XU7A 1XA0A 1GR0A 4BO0A 4J7XA 1P77A 2D5CA 3BA1A 4W82A 1WMBA 1LQUA 1EUCA 2W2LD 3ANNA 3ICPA 5JY6A 5LC1A 2PGJA 3PLRA 1YQDA 4DPMA 3C7DB 3PZBA 5T67A 2Y1GA 1LU9A 4Z6KA 4ZVVA 3S55A 5FFFA 1QORA 1CF2O 2YV2A 4E6PA 4DQXA 1P33A 1PQUA 4DUPA 1Z45A 3JYNA 2I5PO 1N9GB 2GZ1A 4GMGA 4HP8A 4LCJA 2ET6A 3WIDA 1G1AA 4CLOA 5G0VA 4R5MA 3VC7A 2Y0DA 5JLAA 2B35A 2RBEA 3VPFA 3EZYA 2A94A 1SCUA 2E6UX 4GVXA 4TZTA 1QYVA 3ITDA 1PS9A 5A1TA 2DFDA 4JGBA 3Q11A 4LN1A 2FR0A 4JN6B 1DO8A 5AOVA 4PN3A 1B16A 1Z7BA 3GMSA 3H8VA 4BQRA 3TJRA 2XXJA 4E3ZA 1NP3A 3CSDA 5I7FA 1GU7A 3Q6IA 3E9QA 1ZJYA 4I8XA 2FPPA 4TSKA 3WQQA 4RCVA 2ZB4A 4RGBA 3ZV4A 4UUMA 3ZWAA 4MDHA 5U9CA 4BKPA 4LISA 5CEFA 3LT2A 5JXWA 1GZ6A 1EE9A 4H15A 5JAQA 4AJNA 5J23A 1N2SA 4QECA 1IPFA 3FNHA 4MINA 1VL6A 4XGIA 4CLXA 4D3DA 4OGWA 3RI3A 3RUHA 1P1IA 3O9ZA 3VPSA 1U5AA 3C8MA 2JFHA 3JQ8B 2GZ3A 1LUAA 4ZQBA 4U7WA 5G0UA 4BNGA 5JBIA 3JQAA 1ZEJA 2CVZA 1E1MA 3B70A 5IDQA 2Y05A 1YOVB 3A1NA 2XXBA 3DBVO 5COBA 2YDYA 3C1AA 4YRDA 1DAOA 3H9EO 3E9MA 4EDFA 4TMFA 3BMNB 1NHGA 4FGWA 1I5RA 3WWYA 2JFFA 4L0QA 3MOIA 3WNQA 1IL0A 3GLQA 4IDDA 3L6DA 1NQAO 1PZEA 4NQZA 3DXFA 3I9JA 1DFHA 4E13A 2DAPA 1VE9A 2VYNA 4XZ3A 1E7YA 4ZGWA 3ZWVA 3PWSA 4L9RA 1GPJA 2GERA 2X5KO 1GL3A 1YL6A 5CP8A 3WGQA 1HLPA 2NU7A 3EY4A 5ILGA 1U1IA 3WGYA 1E6WA 4FFRA 2P5UA 3L4BC 5H82A 4DXHA 1J4AA 4NJOA 4EEZA 3I9MA 2X86A 1IZ9A 1T2AA 1BG6A 1V6AA 3LSYA 4YJGB 3JQFC 3UCEA 4A03A 3I5MA 4IJKA 4L4SA 4TRNA 4E2WA 4GX2A 1BHSA 1PGOA 2VWQA 3F1KA 4WNCA 4A0SA 4CMAA 1MB4A 3RKUA 4FFNA 3OQBA 3DHEA 2DPHA 5HS6A 1I8TA 3IUSA 3K8ZA 4YJHB 3SC6A 3M1AA 3VOSA 4II3A 2OGUA 3BAZA 5HRUA 1DC3A 1K5HA 2X8LA 3K92A 4CLRA 3NJ8A 1O5IA 4HFRA 4ND5A 3GAFA 5TC4A 4GQAA 1MFPA 3KYCB 2HRBA 3RIHA 1DIRA 1YDWA 5I9LA 1UP4A 2NLOA 4XKJA 1C1DB 4CMHA 3RC2A 2Q4BA 1A7KA 1WDMA 3JQEA 5B4TA 1C0KA 3QV1A 4F46A 3TWOA 4BNVA 4FS3A 1EZ4A 3ENKA 4CJXA 3JQ9A 2YUTA 4CMGA 4M87A 4Y6PA 2ZB7A 1KEVA 3FF4A 1LJ8A 2NU9A 2B4TO 2BGMA 4EGFA 1NQTA 1R4MA 3AOEA 1NWHA 1A4UA 3A28A 1F14A 4KTVE 5KJCA 4YQYA 1NVTA 2X22A 2Q2WA 2Q3EA 1EUDA 2OL4A 3O4RA 1DJQA 1PEDA 3FSRA 1QYDA 1U4OA 3K31A 2BFAA 4KQXA 4Q9NA 2V6FA 4F3YA 4CLEA 4J1TA 1GZ4A 4XJSA 4KTTE 5AYVA 1NFRA 3W8DA 2YW9A 3MJCA 1OZAA 3JD1A 5AXDA 3E18A 2CD9A 1T26A 3QVWA 1M76A 2RHCA 3AWDA 5C7OO 5I9NA 3VPHA 1LRKA 4ZJUA 1LLCA 2OBNA 5EPOA 3ZHXA 4JK3A 4J91A 1QKIA 1O95A 1XWFA 1D8AA 3WGOA 4CMBA 1NFFA 5ER9A 2X0RA 1KVQA 1NX6A 1ZMTA 3NT2A 4CM9A 1PX0A 1RJWA 1ZW1A 4IIVA 3FWNA 1F0YA 2FOIA 4BNLA 3W6UA 4YACA 2Y0EA 2PH5A 2IXBA 1ONPA 2JHGA 2VCYA 2Z5LA 3PLNA 4L4XA 5HBRA 4EUEA 3DZKA 5GZ6A 3PHJA 4B8WA 1P45A 1DEHA 1KY5A 3RJ5A 4B4WA 1MXHA 2ZCUA 4HFMA 4TZKA 5EINA 5L7TA 4D0RA 4ND4A 3OJEA 2Q1UA 1S7CA 1A71A 4N54A 2DM6A 1R0SA 3JQFA 3F4BA 1EVIA 5JO9A 1ADBA 4BGUA 1CERA 4A73A 3H3JA 3PPIA 3JQBC 4Q3EA 2DBQA 2CY0A 2NTJA 3PDUA 4WUVA 4Z3KA 1BWSA 3KV3O 4PCVA 5AXBA 4NBVA 1IOLA 3DR3A 4BNZA 1KYQA 3IOYA 3MJVA 4XQCA 3TNLA 3PZRA 1B15A 1HYEA 2CF5A 3NX4A 1YB1A 4TRMA 1E3SA 3I4CA 1ZK1A 1LDGA 3ANLA 1OC4A 2GO1A 4LW8A 3WGHA 6ADHA 4FFPA 4E0BA 3IMFA 1Y81A 5LDHA 2EF1A 4BKQA 2HJRA 2X1HA 3H5NA 4X54A 5LCXA 3GZNA 3FPLA 2QRLA 3H4VA 3R0IA 4INAA 4R1SA 2OP1A 2PV7A 4EW6A 1B8PA 1IHXA 1WAMA 2ZTVA 3OICA 3OIGA 4TQGA 4DLBA 5G4LA 2EG9A 3S2FA 5U1PA 3EHEA 2OFPA 3I6IA 4Z9XA 3WMXA 3WTBA 2O2YA 4MKZA 3RFVA 3NKLA 4R51A 4AJPA 4DLAA 4M1QA 4JNKA 3JQ9C 4KDEA 3T7CA 2DTDA 1VI2A 3CKYA 2O23A 2EKPA 4FD3A 4Z3DA 4FC6A 1PJ3A 4ND3A 5B37A 4NK5A 4RPJA 2I99A 1NHWA 1Q7CA 1YO6A 5DNAA 3W4JA 5I7EA 1ZK0A 4D42A 1KVSA 1WPQA 3KYDA 2PGDA 3PI7A 5KWEA 2JAHA 5ADHA 2HCTA 1WNTA 1DOHA 3JQGA 4M86A 3TF5A 3U5TA 4FFMA 4PLHA 3GVHA 3G79A 1B3BA 1SB8A 4AL4A 4W7HA 3CTMA 1MGOA 1KVTA 4JJFA 3ZWNA 3ZNNA 1Y9EA 1ZK4A 3H9GA 5TQVA 4WCFC 2P4HX 4Q3BA 4CQLB 1PJQA 3OF2A 4ZN6A 4GKVA 2Q1WA 4CM3A 2VYVA 4WOKA 2DKNA 4HUJA 4RVHA 2AHRA 2EERA 3TRIA 3I3OA 3H9UA 1VC2A 1JA9A 1JVBA 1N1EA 1G0NA 3V8BA 2I76A 2NQ8A 3RUAA 4NZ9A 3GR6A 4CPDA 4CLHA 3GGPA 3QHAA 3PGXA 3L6EA 4PG4A 1YQXA 3INGA 3PYMA 2JFGA 4ITUA 3RU9A 4J6FA 4CLRB 1MLDA 1NNUA 4L74A 3ANMA 1E3JA 4OXYA 1DXYA 2GZ2A 3TPCA 3WS7A 4IZHA 3ROQA 3PJDA 1ENOA 2EWMA 4K1LA 2CUKA 4OOEA 1NPYA 4CV0A 2O7QA 4MVJD 2IYPA 1Z82A 2VT2A 1HSZA 2EGHA 4M55A 3TZHA 1IY8A 2CZCA 1ZFNA 2Y68A 3C1OA 4YRAA 4FOOA 3IC5A 1JW9B 2GRAA 4IXWA 4LSWA 4KP7A 2P2SA 4RDHA 1DC6A 1HWYA 1KC3A 2NADA 2VHXA 3AU9A 3W6ZA 2LDXA 3GGGA 2C07A 1KIFA 3ROPA 3TOZA 3AY3A 5BR7A 2J5KA 1KBZA 3RKRA 4BNYA 3W8FA 4PLZA 4ZQFA 5IZ4A 4YJDA 1M6WA 4JQCA 5HS4A 1K6JA 2VRCD 3JD4A 4BNJA 1CEQA 3QWFA 2YJZA 3G3EA 2QZ9A 4O6VA 4RVFA 1LSSA 4J0FA 4KWIA 4Q3CA 4BV9A 4GBJA 3GFGA 3BMOA 1GUZA 1W4ZA 1A9ZA 2ZKLA 3HDJA 3ZH2A 4YR9A 5KCZA 1XLTA 2IZZA 5GY7A 3BTUA 3Q2KA 3BTSA 2VHWA 3ITKA 3OJ0A 4WASA 2BMAA 4AICA 2FY8A 1X1EA 4E5NA 4FOSA 1LA2A 3QIVA 3WDSA 1E1LA 4R41A 1WXDA 2Q1TA 4PG7A 2E49A 4IQ8A 3TFOA 3O8QB 3LT0A 2VRCA 4CLDA 3WBFA 2VTEA 3WJAA 5L51A 4CMJA 4YJFA 4O5OA 3CMMA 3PXXA 3E1KA 3ZGYA 3MTJA 4HV4A 4QFCA 4GL4A 4MPDA 4FFLA 3NDIA 2J3IA 4P4GA 4PLVA 5CDUA 3H9JA 4OJNA 4Z0HO 4OIMA 3E8XA 4CM5A 5T5QA 2V6GA 3W8EA 3AM3A 5DP2A 4XEHA 4FC7A 3S8MA 4DL9A 2B69A 1VSUA 3I1JA 4MVJG 1Q1NA 3GQVA 4U5QA 4D3FA 3GHYA 4HADA 3GMDA 4B7CA 3INRA 1QYXA 2C82A 4S1VA 4CMIB 4DPKA 2GUGA 2RCYA 4MOWA 4CQLA 1KETA 4RVDA 2Y1EA 3VHRA 1LRJA 1X7DA 2FZEA 1CJCA 1SO8A 4PLGA 4M49A 3RASA 1NPTO 2OMEA 3EAGA 4GPD1 4IDGA 2FRDA 1RM0A 1Q7GA 2ZB8A 4LVUA 4CM6A 4JCOA 4D79A 1GYQA 1NM5A 3VKVA 4L4RA 4LRSB 2QRJA 4A27A 4BB6A 1SAYA 5EL0A 2UAGA 1NBOA 1E3EA 1VL8A 2NWQA 3U49A 2NVWA 1MUUA 1DFIA 1U8XX 1UDAA 4IQGA 4RQTA 5THKA 5TT1A 5ICMA 2HO5A 1KS9A 5KTKA 1CQJA 1Y5MA 3VPXA 3GDOA 2O7SA 5I9MA 2V6MA 3B1KA 3LQFA 3R1IA 1Q2XA 1E3WB 3PRJA 1DSSG 2B5VA 1PGJA 2YYYA 3K6JA 4RV9A 4WOJA 1QRRA 3GPDG 4PIVA 3D5TA 5G4KA 1LDNA 1OBFO 3WFIA 2XPCA 2A35A 4OM8A 4R1NA 1Y8RA 5IN4A 1EQ2A 1R15A 3OA2A 3OEWA 4PVCA 1Z73A 5TT0A 1QSGA 1R66A 1GPDG 1HZJA 1ISFA 1QG6A 4FDAA 3JCZA 4CR8A 2NSDA 4U6SA 5ITWA 5F5LA 5JCXA 3DTYA 4W9NA 3M6IA 3ZDFA 1Y7TA 5ITVA 2BELA 1PGNA 1NVMB 5CAEA 1TT5A 4Z0PA 1KVRA 4H3VA 5A3JA 3DZIA 2WJPA 1K6XA 2PZLA 4MIYA 1PSDA 3QJ5A 5JCJA 4CODB 1I10A 5AXCA 4RPKA 4JIGA 3D3WA 2WTBA 4XIYA 1Y8QB 1DAPA 3JD0A 4FJ2A 4DC0A 3C85A 4F45A 1B26A 1DC4A 1ADFA 5A3VA 4K6FA 5KKCA 1JQBA 3AUSA 3IIEA 1NASA 1XSEA 1ENZA 1SPXA 5C7LO 4YEDA 3N7UA 3NTRA 3OIDA 4PG5A 5EN4A 2SCUA 4D0SA 3UW3A 4ZQHA 1ZSVA 2RAFA 4MP8A 5BSGA 3GA0A 5JFOA 3DBRB 1VPDA 4RL6A 4WCDA 1PGPA 1B8VA 3ZU3A 4ZQEA 3DHNA 1ENYA 4LK3A 3VH4A 1EMDA 1FK8A 1T2EA 4CM8B 1ISJA 1CRWG 2A9FA 3JTMA 2FHSA 3W4KA 3ENNA 4DIFA 3OSUA 2E82A 1IULA 1XQ6A 3PFWO 2G17A 4LMPA 4WPGA 1N7HA 1P74A 2F1KA 4FN4A 4MVJM 4BNUA 5L4SA 4RO0A 4IJUA 5DBIA 2HSDA 5TF4A 3ABIA 3MWDB 1MX3A 1T2FA 4C7JA 2QHXA 1YDEA 2X58A 1V8BA 3E82A 3BMQB 3QVTA 2VQ3A 4IM7A 1M66A 1UZLA 3ADOA 1ZMOA 1ARZA 1UXKA 3K9QO 4BOYA 3GHHA 3VZRA 3ZV6A 2NTNA 4CUZA 1JDJA 1RM4A 1C0LA 2PK3A 5FF9A 4E2XA 1J6UA 3OMLA 1YKFA 5FYDA 2ZK7A 4HXYA 2DFVA 3ZZNA 1NXQA 2PNFA 1LSJA 1LNQA 1Y6JA 4XIJA 4E12A 3V1UA 1HDGO 5A06A 2HLPA 4DBZA 2YHIA 4XR4A 3L6OO 2DLDA 4ZRNA 4I5FA 5KVVA 3TZCA 4B3HA 3LDHA 3GC6A 1YBAA 3SC4A 2H6EA 3I9KA 3WB9A 1G0OA 5EESA 5TJ9A 2D2IA 4B3IA 4BMSA 2WE8A 4NU6A 5JPIA 4MIOA 2R00C 3I23A 3WQRA 4KDFA 2OO5A 3T4EA 4ROSA 3GF4A 3QW2A 5F5NA 3DFUA 4R9SA 2BGLA 1ADCA 3GUYA 5ENDA 2LDBA 2GCGA 2VZ8A 2TMDA 4Q3DA 1Z6ZA 2H1SA 4KQWA 4NK4A 5T8KA 3DOOA 3KEQA 4YYZA 1LRLA 5K9ZA 4NBRA 4OKNA 1TLTA 4DIBA 4JROA 1KOLA 4E4YA 3UOGA 3BMQA 3ON5A 1UH5A 4N5MA 2QG4A 3PQDA 4I9UA 5A9SA 2B0JA 2D1YA 1OFGA 2AQHA 4TVBA 1PIWA 2D4AA 3MJ4A 5KIAA 1BVRA 1A7AA 3VVBA 2GDZA 3D4OA 3ULKA 4BO4A 3Q2IA 4UEKA 1YJQA 3EDMA 3C1TA 2EIHA 4CM4A 1U2DA 3BHMA 3GFBA 2BFPA 1ZNQO 3ICCA 1H94A 2AEJA 3LF2A 2AMFA 5KNLA 2CDAA 1H0KA 1T2DA 3HJAA 5MGBA 1JN0A 2IYOA 3WGZA 1W0CA 3WX0A 1HYGA 4MP3A 3RBZA 1BVUA 4R16A 1MA0A 1KC1A 1DIHA 2FR8A 2J5RA 2Q2QA 3BHIA 5BSHA 4RZIA 5CEJA 2HK9A 3C7CB 4AJOA 4BNIA 5FI5A 2R6JA 4P4LA 3ROKA 5B12A 1PJTA 2HUNA 3C24A 3COSA 2WYUA 2PR2A 1VKOA 4IS3A 4U0KA 2WSBA 4BS9A 2R2GA 1ZCJA 3HE3A 2C29D 4GSKA 1DFGA 5FWNA 1EDZA 4YPOA 3KETA 2J8ZA 4ALKA 3NEPX 1AXEA 3Q9UA 4WLVA 3MTGA 3X2FA 1E3IA 4IBOA 5JNLA 1P1JA 2WMDA 3HB4X 5TNXA 5JCJD 5KJ1A 1I3NA 5DF1A 1PZFA 1BGVA 4W4TA 4WLEA 3DEYX 1ZXLA 4ONEA 5AVOA 4CUKA 2FSSA 3G1UA 3ZN2A 3GG9A 4OAQA 5L45A 2VZ0A 3VZSA 3ZWYA 3V2GA 3DTTA 4E5YA 1H9BA 4J2OA 5C37A 1YBMA 5JC8A 3PTZA 3PJFA 3U9LA 2CVOA 1TT5B 2XAAA 4I1IA 1R16A 4AJHA 1JVSA 1DRWA 4BNHA 3WQSB 4RLSA 1OC2A 2IEBA 1HE4A 3D3WB 3FRJA 4PFJA 5C5IA 1PZGA 4J0EA 1YGYA 4DMMA 3UVEA 1XU9A 2P91A 3S2GA 4NPCA 1GV0A 4JJIA 1LLUA 1LSUA 1YJ8A 3NDJA 3HFGA 2O4UX 4HWKA 1N92A 3WLEA 5L40A 3D64A 2Q46A 4PVDA 4P22A 1X7HA 4FSHA 2DQ4A 4HNHA 1F17A 1A4IA 2Z1NA 1U3WA 3FCOA 4AJIA 3AI2A 3U4IA 1H2HA 1F8FA 2P9GA 3KUXA 1H6CA 3CMCO 3ETDA 1EBFA 4XYLA 4XYEA 3WYCA 4BL5A 1K89A 1SNYA 3NGLA 3ORFA 4WK6A 4BO2A 3D0OA 4FW8A 5JDIC 3F6YA 2AEMA 1E3LA 1M6HA 2RIRA 5L4NA 4JBGA 1QLHA 3CH6A 4FFOA 3RC9A 1CWUA 1F06A 3ASVA 5L3ZA 1WLYA 4BNNA 2GD1O 4HBGA 1B2LA 1K6IA 4R5HA 4UVHA 4ALNA 1A5ZA 4J4HA 4P8RA 1QR6A 2BKAA 3BMCA 1QV6A 1HYHA 4CL8A 5JMPA 3E03A 2DTXA 4CM9D 2Y93A 1SB9A 5EQFA 3AUTA 2DBVO 3QRWA 4IY1A 3ZV5A 3B1JA 1V9LA 3RSHA 2PTGA 3L77A 1ULSA 1BRMA 3HQ4O 4KZPA 4R1TA 1MC4A 1R6DA 4CL3A 1FDTA 3MJTA 2X6TA 3MOGA 4BMNA 1N1GA 4EI2A 1ISIA 2P9CA 4N5LA 4IDEA 2WD8A 4WLFA 5CPFA 5TGDA 3DAGA 3GVXA 3M1LA 3H6KA 4WCFA 1E92A 3P7MA 4JP3A 4KMSA 1MC5A 4OSOA 2C0CA 2O48X 5A4DA 2CVQA 4YAEA 3WFJA 1I33A 1M2WA 1Q0LA 1HE3A 2B37A 5MDHA 1ZBQA 4N5NA 3AY7A 1FDUA 3GDGA 3SBOA 4D43A 4YJGA 3TL2A 2ZCVA 5IJZA 1R4MB 1UXJA 2O3UA 4RF5A 5ICSA 3GEDA 1QP8A 9LDTA 4RVSA 1RWBA 2RH8A 4OYRA 1P0FA 4ND1A 5IXYA 1LI4A 1RPNA 3FWZA 3DHYA 4DQVA 3NDRA 4AG3A 4H16A 1ORRA 2QW8A 1NTOA 1FF9A 4RPLA 2EW8A 4U6QA 1L7DA 5T57A 4AJEA 5KVQA 2GN9A 2D8AA 3GY0A 5BNTA 5BNFA 2ZYGA 4FB5A 1DIGA 3U4HA 4QO7A 3KVOA 4AJ2A 8LDHA 5A9SB 3Q0EA 3D3EA 1PZHA 4OL9A 4AJLA 1C1XB 4GMFA 4J90A 5TX7A 2GASA 3N74A 2GLXA 2EKQA 1EFLA 2FP4A 3JQ6A 2CDBA 5AXAA 3K30A 1TEHA 5HM8A 2V6BA 3DO5A 3F47A 3OA0A 4CV3A 1QV7A 1BXKA 4D45A 3QWIA 4WEQA 3VTZA 3QP9A 1V0JA 1X14A 4RZHA 2AA3A 4D3SA 3ZWWA 2VUTA 4R54A 2JHFA 3S2EA 4BVAA 1DLIA 2JL1A 3K2EA 5CG1A 3JQBA 4CLOB 2VOEA 5TIIA 3T4XA 1FDWA 1YOVA 1BXGB 3I9NA 2O50A 1H6BA 3KXDA 3UHAA 2B4QA 1ZZEA 3C3XA 1E1KA 1R37A 1AE1A 2DTEA 4NNJA 3WICA 9LDBA 4IUYA 4DMLA 2HU2A 3KSZO 4OHUA 4K9DA 4MIEA 2R00A 2W4QA 1EEHA 2VTDA 1I24A 4YT2A 1T25A 1GV1A 1NPDA 3DMTC 3WR5A 4A5OA 1P3DA 2YZ7A 1VKNA 2WD7A 3BXXA 3Q1LA 5F1OA 3WGGA 3PGJA 5GZ3A 3RWBA 1XDWA 4LSMA 3IJRA 2YY7A 4Z0TA 4MO2A 3UFXA 2VHZA 3EMKA 1QXSA 3ROMA 3BHJA 1MXFA 2I9PA 1PL6A 2BH9A 3HDQA 2VHYA 3EVTA 3AI1A 2JCYA 4PRLA 4XGKA 2VWPA 5DCYA 3HDYA 3JQDA 5CHEA 2PZJA 3RVDA 1U7TA 4TRJA 2HDHA 5TRTA 3MCVA 3FD8A 4CM8A 4PLYA 4EJMA 4XYGA 3WG9A 1Z75A 1DBVO 1PJLA 5TSDA 3SJUA 1YB4A 2X7HA 1U2GA 4QQRA 1B7GO 2ZTMA 4J9VA 3TFQA 4I5GA 4YXFA 4ZICA 5EIOA 1C3VA 1SOVA 4MKRA 3F46A 1P1RA 1YRLA 4BNTA 4ALMA 3TZKA 5TS3A 7ADHA 3AK4A 1YONA 4GWKA 2YV1A 2Y1OA 2Z1MA 4UEJA 2A92A 1GFSA 2AQIA 4NR0A 3UGKA 3LC7O 2PKRA 3BMCB 3GNSA 4ILKA 2OXIA 1PR3A 2YDXA 3RQSA 1VJ0A 4O1MA 4NJMA 1IUKA 1MP0A 3DAFA 4MKXA 5JAIA 2P5YA 2D3TA 1D1TA 2AE2A 2B5WA 4AJKA 3GT0A 1D7OA 4JP2A 4WGGA 2EHDA 2HMSA 4JJGA 4NMHA 4J1SA 2O4CA 1R0KA 3GUCA 3PYLA 3KLPX 1TB4A 4RPGA 3CZMA 4UREA 1T4DA 5F1KA 1HEUA 1ZH8A 1U5CA 2C20A 3I83A 3JD2A 4D7AA 3V1TC 4CQMA 3FBGA 1Z74A 1C1XA 5TLSA 1WZIA 4E2ZA 3DQPA 1O0SA 4DC1A 4NIMA 4BNWA 1B14A 5DOVA 5H81A 3PWKA 3GRKA 3QWBA 4R9RA 1NR7A 2Q1SA 2CFCA 2XOXA 3DL2A 3Q9NA 1UDBA 3AY6A 4UUNA 5A9TA 1PR9A 3I9LA 1Y9AA 1PJBA 1LDBA 3SVTA 1VM6A 1FDSA 5IXSA 2HMUA 1BMDA 2V7PA 2QYTA 1PJ2A 3R6DA 3GNQA 4MJLA 1NFQA 4EJ6A 3DDNA 3JQGB 2AG5A 4GX1A 4NBUA 3RUIA 4UAGA 2BD0A 2QX7A 3WBBA 4UUPA 3WIEA 5U4QA 5JW6A 5JE8A 3VDQA 4R69A 4BKOA 3SXPA 1SEPA 2O3QA 2WWRA 3GH3A 3KYBA 3OIFA 4XB1A 3GZ4A 4E31A 1YWGO 3L4SO 1BXZA 4UEOA 4YAIA 2DPGA 2X9NA 1EK6A 3KZVA 5DZSA 2GNAA 3JYOA 3QQPA 3GEGA 3VKUA 2ZYDA 1EVYA 2HK8A 2W98A 3JV7A 4L75A 3EK2A 4RF3A 3LLVA 3ZU2A 5KOIA 5DT9A 3RROA 2ZJ0A 2UUOA 1I3KA 2WD7B 4A7PA 4P4NA 4QFDA 1I2BA 1UP7A 4K28A 5KVSA 1S6YA 3VH2A 4NH4A 1QYWA 1X1TA 1C0PA 4OSPA 3VZPA 1J49A 3RUCA 4CUJA 1G6KA 3V1YA 3EZLA 4R1UA 1H6AA 3FNGA 1E7QA 1L1FA 4PZEA 3O03A 1V3TA 5G0WA 3ETGA 4W7IA 2NUAA 5DCUA 3PHLA 3CZRA 4WLNA 2P4QA 4Y8VA 3SLKA 3LK7A 5A5EA 1EVZA 1D1SA 2Y66A 2H9IA 3QVOA 5EMHA 4BGVA 3BTOA 3L9XA 4NU5A 4PZCA 2QYSA 4Q3NA 4BO7A 1PTJA 1L7EA 4QTZA 1WZEA 3IUPA 3V5NA 1GZ3A 3L9WA 4TKLA 2AW5A 1X13A 1DHRA 4XDZA 5IAAA 1D4FA 1YL7A 2WYVA 2OP0A 5BQFA 3WGTA 1HF3A 3HG7A 4XR9A 3AW9A 2I6TA 4PZDA 2JJYA 4U8GA 4DBVO 5I8WA 1SBYA 1HDXA 4A26A 2ZJ1A 3U4DA 2G1UA 3PQEA 2NVBA 3JQAB 2ZB3A 5IZCC 2GGSA 1O6ZA 1I2CA 4NFYA 4PRKA 3H9QA 1JWAB 3WLFA 1ZSNA 3CXRA 1QMGA 1X7GA 2E4AA 4BIIA 2W90A 1Z7EA 2AXQA 3EW7A 3JYPA 4XA8A 4XRRA 2W2LA 2Y99A 1XR3A 4EUHA 4OXNA 1JKJA 5L9AA 3ZNQA 1Q0QA 4F6LA 4EEXA 4CM7A 2ZYAA 5F1PA 1DJNA 1U28A 4XWYA 3AM5A 1RYEA 4FQ8A 3MWEB 7MDHA 1ISHA 4XB2A 1IB6A 3NUGA 3EC7A 3QLJA 3ETEA 4FR5A 4LGVA 2X0IA 5BT9A 3GVPA 4KWHA 2FSVA 2OBYA 3DC2A 1U3TA 3TQHA 1HE2A 3FBTA 4C7KA 1AHHA 3K96A 1JWBB 1GY8A 2WYWA 2C5EA 1ZVMA 3O8QA 4LCEA 5HWSA 2OZPA 4E5PA 4DREA 2X5JO 2JD0A 1J5PA 1DDOA 1R4NA 1PQWA 4G2NA 4KUEA 3VAZA 2VUUA 4E21A 3WYEA 1RKXA 4BHTA 2DVMA 2BI7A 3NJ4A 4IDBA 1JU9A 2YV3A 5A03A 5CDSA 3O26A 3TSCA 4N18A 2AQ8A 1BSVA 4G65A 4L8VA 3GOHA 4PLCA 1I3MA 4HKTA 5A05A 4UVIA 2C5AA 4Z9FA 4E5KA 5CDYA 4WEOA 3ZWPA 2PGLA 3DBHB 4B7XA 1LLQA 3BZUA 4E33A 4MVJA 2I67A 3MEQA 3M2TA 4M8SA 1TT7A 2DUUA 2YQ4A 3F5SA 1T4BA 2HMVA 1DPGA 3HWRA 1E5QA 1A9YA 1E3WA 2EJVA 2JD1A 1NR1A 2PA3A 3QA9A 5ER6A 1VL0A 2G0TA 4QEDA 1UJMA 3WXBA 1TI7A 3LT4A 2C7GA 4W9NC 5G4KB 2CSUA 4DTIA 2WDZA 2DUWA 1ZSYA 4L73A 1DB3A 2PZMA 3WGIA 4R3WA 3QE3A 2RHRA 3ZV3A 2HQ1A 2GR9A 1FXSA 6LDHA 2FN7A 4RF2A 1EFKA 3IP1A 1PL8A 1XG5A 4B4OA 4CM4B 2NQTA 1RYDA 3WTCA 3GRPA 4OMUA 1DRUA 2Q49A 4BNXA 2D5AA 4LVCA 2NNLD 3SJ7A 5JSFA 3A14A 1OOEA 2BRUA 2J6IA 2JAPA 1E7RA 4XD2A 1PGQA 2O3TA 2FMUA 3VTFA 3OJFA 3AUUA 2AEFA 2PKQP 2XF8A 5JAMA 5BNIA 1N9GA 2UYYA 1BTOA 2X5OA 1I01A 1TVEA 2UVDA 4BO1A 3PQFA 1N7GA 4RORA 5K0ZA 1SC6A 2QIOA 3BMNA 1UXIA 1R12A 3H7AA 1E7WA 4YCAA 5DDIP 4NFHA 3IKTA 5IG2A 2CDCA 4IDCA 3U3XA 5EERA 1LBEA 1E0DA 1P1KA 1U9JA 3A9WA 4FPXA 4TWRA 5EJ2A 2D59A 2B36A 3ZWOA 4J7CA 3RAJA 3JD3A 4OH1A 2X0JA 5H83A 3L4BA 3LYLA 3NGXA 5I7VA 5DCWA 1A72A 1E77A 1JKFA 1KEPA 2WE7A 2FR1A 1YVEI 4JX8A 2H63A 1CDOA 4JBIA 1GCUA 2FPIA 5B1YA 4Y9DA 4NBWA 5DBFA 3VPGA 3HB5X 4I5DA 1QLJA 2J3HA 4O59O 3PEFA 2YFQA 3MZ0A 2GN4A 3X2EA 3UCFA 1Q7BA 1ML3A 4CQMB 1Y1PA 4PG6A 4ID9A 4XYBA 2HMWA 1M75A 2EP7A 4M54A 1VJ1A 1EDOA 3OETA 2J3JA 1ZIDA 3PIDA 1EE2A 2OHXA 5IDWA 4RVUA 3ZW8A 3ZWMA 2POQX 4IQ0A 3NT4A 4ALIA 3AFMA 2PZKA 5EQDA 1WDLA 1R0LA 2D0IA 4DIOA 4GX5A 2H5LA 1ZJZA 4QO8A 5FEUA 1H2BA 1AHIA 5C7IO 4KUHA 3VH1A 1HT0A 2Y0CA 3H5AA 4D44A 1A27A 1OMOA 3E48A 3WJ7A 2JD2A 4WECA 4MVJH 3MJEA 2BLLA 1AGNA 3UCXA 1SEVA 4GGPA 1BDMA 2HMTA 4TROA 4YAKA 1CQIA 4G81A 4JLWA 1LDMA 3PYXA 2B4RO 1KEWA 3L07A 4AFNA 3DZJA 4IIUA 4IDAA 5IDXA 1GQQA 3LT1A 3AOEC 1AN9A 4J7UA 1HRDA 3WYBA 4YQZA 5L4LA 3HHPA 4RF4A 3H2SA 3M2PA 2NU8A 1PJSA 4CV2A 3UXYA 4RVGA 1FDVA 4I5EA 4WJZA 1YBVA 3AOGA 3OFSA 5AQ1A 1O94A 1RM3A 4DA9A 2Q50A 5CFZA 2EP5A 3QVXA 4ZHSA 1WP4A 1IHYA 2W2KB 1UR5A 4I9HA 5B4VA 3PJEA 3O38A 1UAGA 1ISMA 1MG5A 4YB8A 1NAIA 3K2BA 4Z9YA 5KJFA 2IZ1A 5COAA 2BHLA 3S1LA 4GVLA 2ZTUA 3JQAD 3SEFA 1V35A 3DBRA 4GX0A 1PWXA 2HJSA 2CNBA 2C2XA 2WEKA 3NAQA 1DIBA 3OBBA 3CUKA 3D4NA 3LZ6A 1ULUA 2YQ5A 2IODA 3GDFA 3PJGA 3PWZA 4MVJF 5L7YA 3WSWA 5KKAA 5CPBA 2JCVA 1T1RA 4Y6RA 3VDRA 3SLGA 1LXCA 2EKLA 4DYDA 1U8FO 2Y67A 2G5CA 3FNFA 3PVZA 1GDHA 3AJRA 4ZA2A 3HFSA 1DRVA 2QRKA 5KVCA 2G82A 4YRBA 2VUSA 4Y98A 3LC1O 4XRGA 3CE6A 3W1VA 1U7HA 3AI3A 1HE5A 1JAYA 3PFFA 1BW9B 1XYGA 4GGOA 1YL5A 4II2A 1EVJA 1V3VA 4ZD6A 5DULA 2PLAA 1UZMA 2RH4A 4OOFA 1ONOA 5JS6A 1UUFA 4IGFA 2JKVA 4BKRA 2QZZA 3DZBA 2QQ5A 4GSLA 2TMGA 5ILOA 4B79A 4QXMA 2PWZA 5I8ZA 1GD1O 3D5QA 3HN2A 1GAEO 1PS8A 4PLTA 4E5MA 5IF3A 1NQ5A 3DMYA 4GH5A 4TVOA 3LF1A 1YXMA 3TZQA 3H5RA 3RBVA 2IRWA 4Q39A 4BGEA 4P38A 2FZWA 1YE3A 4IPTA 4OXKA 4AVYA 2P9EA 1K3TA 2AG8A 2PD3A 3BYZA 2C59A 4IS2A 1WVGA 1DC5A 3LLSA 4EBFA 3PDJA 4YVFA 1YS4A 4IGEA 1B0AA 3ZHBA 4XQ9A 3FPCA 1BXGA 4IZIA 2Q99A 3DZHA 3OH8A 3IAHA 3FNEA 1EK5A 2A4KA 5KJEA 4DGSA 4RDIA 2BGKA 2Y1CA 1PJ4A 5G0TA 3PK0A 4O0LA 3AM4A 1O9BA 1ZXBA 2HK7A 1NVGA 4GLLA 4DLLA 2BF7A 2GSDA 4J1QA 3KM0A 1IYZA 3KYDB 3BIOA 3KHUA 3FTPA 5CDGA 3UICA 1I3LA 3FI9A 4NG5A 1HXHA 2VZ9A 3HUDA 3KSDO 3I4FA 3IS3A 4DYVA 4PLPA 1I0ZA 2AE1A 3RUEA 2J3KA 4YJHA 1WDKA 4QT0A 3WMWA 4AJJA 3CIFA 1ZUD1 2IEDA 3KO8A 4DQUA 3ZWXA 5JYDA 3RC1A 2DT5A 5IN5A 2NVUA 4HY3A 3RCBA 3D7LA 2ZQYA 5A04A 1GEGA 2YHUA 4YT8A 3JQ7B 4U0JA 1GYRA 3E5MA 3LC2O 2IDZA 4EITA 1GQ2A 2VYVD 3EVNA 3SX2A 2DBRA 4TRRA 4J2HA 4YDRA 1HDCA 1K0UA 3G49A 2F00A 1UZNA 4FCCA 5IDYA 1CYDA 4B8ZA 3KLMX 4NBTA 4FJ0A 5BSFA 5JMWA 1IZ0A 2VOJA 3LVFO 2OORA 1LQTA 8ADHA 1LDEA 3QY9A 1Y5RA 4R68A 2YFHA 3DONA 3F1LA 1ENPA 1I36A 4CMEC 2J5QA 2PFGA 3DOCA 5I7SA 5JAZA
chains in the Genus database with same CATH superfamily
1R6XA 4BYGA 7ABPA 2GEUA 1NF2A 2LW7A 5JUWA 4HGNA 2Y0BA 5AVJA 1B8UA 4L76A 5GONB 1BEZA 4G1CA 3ZJYA 1ULZA 2DFNA 1EYZA 3H7IA 4Q4DA 5CK4A 5KINB 1HDZA 2E85A 3L8DA 5JSUA 4KAXA 1NVVQ 4D9MA 1NWCA 1PS0A 1ZOOA 1EDBA 1H9AA 4UNPA 2P68A 5IM4A 4MO9A 3L1KA 2NO7A 2AQKA 2HSJA 3VH3A 1QZTA 2RGGA 2W6IA 3JU3A 2F8TA 3JVVA 5ALUA 5BN1A 4XDYA 4F0JA 3WDKA 4ZK2A 4HDAA 2PUHA 3USZA 4HBZA 2LCIA 1K6EA 4LJ9A 2XTAA 4EQ6A 5AHRA 3H1FA 2AJDA 5K20A 2H7YA 4L6CA 3L4JA 4WKGA 5REQA 3IAFA 3L1HA 3ZXYA 1MABB 1SCKA 3FOCA 4ZQGA 4EY8A 5LZ2A 4JYZA 1YQWA 4YP9A 1UBOS 3TEFA 3T0IA 1ZRSA 4E09A 4IGKA 5JCXA 2BBWA 2VSNA 3L1VA 1MX9A 5ALIA 1H3EA 3AEXA 3NHMA 4K6CA 2WB4A 2WAYA 3OE5A 4FBMA 4QG7A 5EZQA 4E32A 4EUFA 3D1LA 1Y8RB 2V5UA 4X60A 4CR7A 4ZVQA 3HDVA 1RI4A 2AC7A 4J4BA 4OQPA 2G09A 1X3SA 2Q21A 2XH8A 4X24A 1OI7A 1SOWA 5B1DA 1JMYA 3IAS6 4X1KB 3EXEA 2FW9A 1CHDA 2IT1A 1W6UA 1YVDA 5JVDA 4MVJP 1DS6A 3BWMA 3CPSA 5CX1B 1U7ZA 3SF8B 3KVYA 3QUSA 4HOYA 1E5DA 1NLFA 1CULC 1KU6A 3GPIA 1I7PA 7AT1A 1KK2A 4YRJA 4UAJA 4HTAA 2P6MA 2R4QA 3R3YA 3EVFA 3AIMA 4OKSA 5KYNA 3VO9A 4UE6A 4B6JA 1J00A 1GTMA 2JA2A 2QX8A 3OZRA 1CRLA 5TGZA 2G40A 3DBLB 3TLYA 3LU1A 4MTCA 2GKSA 5T64A 2QLMA 1NAHA 3AUAA 4E03A 4B75A 2ACKA 3NHPA 4F86A 2PKEA 2BKXA 3DDUA 1Z62A 2QIPA 4QU9A 3W3AA 3JATA 4M0CA 3L6RA 5G2OA 1AZWA 3QFFA 2P4SA 3L8CA 4YUZA 5C81A 5LA6F 3MXOA 3PHBE 1U3UA 3DL7A 4J16A 4FBLA 2C9DA 2E4WA 2N9UA 4BLQA 4A1OA 2OVFA 1XA3A 3PFIA 4KE9A 1Z8FA 3GJTA 3KIPA 3S6JA 5HKKD 3ETJA 4D25A 5CLLA 1YJCA 2GN8A 4JXXA 1YE5A 3BEDA 4D4KA 3KOUA 4GKAA 3OY2A 4TQ9A 1SH7A 1NULA 1PJAA 1V95A 1FRZA 4L8WB 4KOEC 1R00A 1H3NA 2FPGA 1WU7A 3AG6A 3F9IA 2HSZA 4C3ZA 2QD5A 4A2CA 4BQFA 5J58A 3QLUA 1IWOA 1DO0A 1N2CB 1I3OA 1Q21A 1CUDA 1WW8A 2Q4EA 2I3AA 2CZGA 1B6RA 1DBPA 1KJWA 4LZLA 1XGKA 2HBZA 3IJPA 3NVDA 1S9HA 1EJ0A 4LZNA 3RK1A 4KXFB 1A50B 1Q0HA 1FXWF 3EC1A 3JSAA 3Q9SA 4GD3Q 3UWSA 1UKBA 2B9EA 3R7WA 5FRDA 4G0VA 4MV9A 2WRZA 3LECA 1Z0IA 2J0EA 1XDZA 1O89A 4I9NA 5I3CA 2GEJA 3KB1A 4XX0A 2DG2A 2DY1A 3LWDA 1P0CA 3EMBA 2C2HA 1THGA 1LX6A 4I1RA 2W6ZA 4TN5A 1AB5A 4UVEA 2ONCA 3GFSA 4EVIA 2QRMA 3T5PA 1E1DA 3PNVA 2HTEA 5C46F 2NX2A 4NLLA 3DVSX 5AUNB 2C77A 4RQUA 2ESRA 3Q8MA 3EIHA 1JHXA 3C2QA 1NUHA 2IZ0A 4GLJA 4RLHA 4CKXA 4UE2A 1TK3A 4HEHA 4RETA 3X1YA 4LWPA 4M89A 1RLMA 1CVIA 3JPWA 1QBKC 3G0IA 5D85A 5H0IA 1EUZA 3EJ6A 3OPXA 1DHTA 3RG8A 2UDPA 3X44A 1KJQA 3DZGA 4BB5A 5JXGA 2JLWA 1YMUA 3AL2A 4QXOA 2VPPA 3B2EA 5AJZA 5E6UA 1E5XA 5I5GA 1T5TA 4D41A 4DZTA 4MKFA 3JWEA 3VKHA 3OM0A 1L5VA 2B83A 1WA5A 3NTOA 4OAPA 4PHCA 621PA 4KQEA 2CYCA 3AB7A 1PFKA 5DV9A 5LZ5A 3RVMA 1GGVA 3NTUA 3DBHA 4HDRA 3LC0A 4QJBA 1N5DA 4Q4HA 4HB0A 2QDKA 3H18A 3I2FA 3OO0A 4R40A 5KQRA 1NQWA 5H3HA 1L5YA 4G84A 3INTA 1NVXQ 1SUCA 1T6NA 3OECA 4V1CB 1E9SA 3KSAC 2BFCA 3NW9A 4AURA 1W0JD 3GEMA 3GD7A 4KFRA 1XZNA 2IEAA 2QTMA 1VRWA 3EWNA 4FDTA 5DT2A 1YQEA 2Q4DA 3AB8A 1YQQA 2LCFA 3QVSA 1K75A 4PTYA 3ZJ5A 1W0KA 1O0BA 3ZNPA 3W8NA 5JC1A 1JBEA 3BXZA 4AF7A 2LP4Y 4JDPA 3U3RA 1AK1A 3PHGA 4GMDA 1P1FA 4E2YA 1JSXA 4MWCA 3WWZA 5FNVA 4PNPA 3JAKB 3WYGA 3H3FA 2H4JA 4YGYA 1YVPA 1JECA 1Y34E 4NXMB 1QGYA 1EFPA 2ZUUA 3JQCA 5G40A 1SELA 2H06A 2A6PA 1A4RA 5LXTA 1S2IA 4G1VA 5FUYA 2F8SA 3KSUA 1UAAA 2DOKA 2IE0A 1NJSA 3LQ2A 1X9IA 3MK31 2P40A 3P19A 4AJ4A 4OHYA 3R09A 5E7IA 5EE0A 1XMPA 4PSKA 5CA1F 3C7AA 4ZU3A 1SIWA 2X9LA 1C8BA 3I6QA 3I01M 1JIQA 3TN7A 3JALA 2EJWA 3BWDD 1A2KC 1DX4A 4KVZA 1MV8A 2GPTA 4OP3A 1U4SA 2FMKA 1YR2A 2WBLC 3P2MA 3D59A 5I48A 2X7JA 4F6CA 2G76A 3EXIA 4GM0A 2CMHA 1ZK3A 2ZVQX 3JYLA 4M6WB 4NYMR 2ZUSA 1W49A 2NZXA 4RHUA 5FFNA 5HZHA 2ZZNA 2JEOA 1EUCB 2VNHA 1UIMA 1NT4A 2MSNA 2OTCA 5CB4F 2JGRA 1GEEA 3LE8A 1EBUA 3G13A 1MW8X 2IYNA 3TYXA 3KQKA 2Y1DA 3O8OA 5IKEA 3OJLA 4CMEA 1CUXA 2VNAA 3G1WA 2FZ4A 3KU1A 4JC4A 4YP1A 3OP4A 1LTHR 3P9QA 4PQYA 2BEUB 4UMFA 2Z4SA 3S1SA 1XHLA 1AQNA 1K0FA 1LPSA 2AZMA 1EVQA 3OE4A 3Q15C 3QYAA 4I1YA 4WUTA 3V7WA 5IEBA 2G9UA 3I58A 3WGNA 3WLMA 3LRTA 4KXWA 2XSZD 5I7OA 3TQFA 3DGFC 5EQTA 5GOTA 2W8ZA 2CKDA 2MU1A 3NG1A 1E6EA 1U2GC 1VSVA 1F12A 3PC8C 1RP1A 1QHSA 2G4CA 1LPBB 3MINB 4TM8A 4U7GA 4X0EA 4GOKA 4Q48A 4RYLA 2YQZA 1NUSA 2N75A 5AM1A 4BNMA 1V2HE 1E5LA 1WUIS 5T6BA 3ZH9B 2VT3A 4OKIA 1TUIA 3B2NA 4LYDA 1JAXA 2NV2B 3QNMA 5AW2A 3BC1A 3GNTA 4MS1B 1ISGA 3G59A 4LXIA 5FWXA 5LYJB 3VR6H 4EZEA 5ITZB 1PE0A 3DDHA 3TQQA 3D8BA 1VE1A 2WUWE 3IBCA 1XMXA 5CEEA 3T9BA 5CDTA 2QMYA 4WNIA 3F7MA 4JUCA 3T7EA 4JGGA 1JG1A 4EYEA 3NNNA 3G5AA 1MAWA 3HUFA 1ZP6A 3ZWQA 1Q74A 1WMAA 1ZGHA 3CNBA 2VJPA 4JSYA 2DERA 4Y2GA 2R6HA 4OQMA 5IZCA 4K9MA 2ZRJA 4JLMA 3A05A 3QKSA 2QG9A 4H9GA 3SK0A 1RAEA 2BHNA 1D4AA 3X1JA 2JBAB 1RMQA 4K81B 5JJ5A 4OQZA 7REQA 4UHBA 5IT0A 2MINB 3ADPA 4FWBA 4ESOA 2Z57A 4B8YA 3DD1A 2C5LA 1T4GA 4OLFA 4JY7A 1NTRA 4O1HA 4B09A 1HFWA 3E9CA 3PHHA 2GESA 1JIKA 4KC0A 4JKYA 1C1DA 3BBLA 5A5FA 1YA8A 3GVIA 4BX9A 1GL6A 4PSCA 2HI0A 2OOSA 2YWHA 4IJWA 2YZKA 1MJHA 1T5HX 1MC8A 2EZUA 2PS0A 5AHWA 5LDGA 5HGXA 5K8IA 5LM3A 4UFNA 5DU2A 1IJKA 3E35A 4BX3A 5LNK6 2X0NA 4JUBA 3TDKA 3EQ2A 3D31A 4EUSA 2KJQA 2QRVA 4B4VA 2ZATA 4XGNA 3JPYA 3G2MA 5JDIA 3VSEA 2HCBA 3EGOA 4NCXA 3SOZA 2WA2A 2V3VA 4KGXA 1OKKA 1FMCA 4CN8A 1XHEA 2EV9A 2WHEA 3LPLA 3NM5A 2Y2UA 4UEQA 2J0UB 4EJ0A 3FN4A 3P2YA 1T9GS 2JCXA 1JI0A 5T6MA 3VGJA 4B7UA 2A9PA 2EEPA 1CUZA 2VRBA 3HU1A 4IDQA 4F85A 1QH1B 4CF7A 1QGZA 2NW6A 4EATA 3GZNB 1L5ZA 3CNLA 1ETUA 3TVTA 4EHJA 1A8UA 2XLCA 5BV8A 1W73A 2QGZA 1CVRA 3DHVA 2ZI3A 4DA4A 3Q0TA 3FR8A 1F4LA 4MGKR 4CKWB 2GEVA 2V5VA 5JO0A 2AVNA 2D3WA 4UVGA 1TA4A 4LWOA 4QVIA 3ORYA 4RA6A 5EPEA 3HEBA 1SY7A 1ZC3A 4RYDA 3WIOA 2GZRA 1PFYA 1U4NA 2IEIA 2OCKA 2UYQA 1WMBA 1B2RA 4U3JB 4XSHA 1UK8A 3BSWA 1ZVKA 4P4UA 2OAQ1 3GT4A 2QNRA 1A69A 2Z1DA 5AKLA 4DPMA 3CZQA 5C8ZA 3BXPA 1LVHA 3P9ZA 3BM5A 5TQ2B 1OLSA 2OHJA 4G5FA 3PQCA 5CFQA 1P33A 1PQUA 1XKXA 1JIIA 3R6LA 2B82A 4A8JB 3JWJA 3JYNA 4DUPA 4OHPA 1PK7A 1TCAA 3HUEA 4JA0A 3TPZA 2GBCA 2GZ1A 4HP8A 3FNQA 3MHPA 1YQTA 3CEHA 1VBNA 4GNKA 4J29A 1OROA 1XAHA 3COPA 1ZLYA 2GBLC 2L0XA 2X2EA 3UA4A 5DTJA 4AS2A 5G0VA 1MX1A 1P8JA 2XUFA 1P9RA 4R5MA 5H5JA 3H2JA 1K4YA 2B34A 4NBKA 2IEYA 4P4SB 4LAFA 4JQYA 3RWOA 3EZYA 4ZAXA 3ODPA 1C3OB 1G5TA 3TZBA 4BAUA 1WD7A 2DH5A 2PRIA 4OL0A 5SY9A 4CU2A 1JEQB 2EQAA 4JGBA 4R8RA 1UDWA 2HCRA 3DE6X 2GNPA 4YGXB 4ZAVA 9MHTA 2QLNA 4JN6B 3D8RA 4US1R 1U2DC 2HZ7A 4B76A 3Q85A 3ILVA 1I7LA 1Z7BA 4OJMX 1QIFA 5EIBC 5AVYA 5ADVA 1UMBB 3Q3VA 1NP3A 5KNCH 2DY0A 5CTAA 1H2AS 5KOYA 3Q6IA 4MRRA 1NNEA 5IBQA 4EA9A 3SP1A 1X7YB 1RXSA 5AI9A 1DTEA 1WDTA 4ZV9A 4LECA 4RGBA 4RIHA 3WQQA 4M0KA 3C3BA 4EG5A 1Y9DA 2RHBA 2G1JA 2VEDA 1NP7A 4EQ6B 4DV2B 4MDHA 4G5OA 3RTGA 4E46A 1KORA 2JBWA 5IBPA 4R0NA 2PMFA 1ZD2P 3LT2A 2IH5A 4PSDA 2I34A 4FZVA 2WI8A 4ZCPA 4JMLA 1Q6ZA 1J0AA 4QC2A 1KP2A 1N2SA 3NLLA 3O8LA 5DGIA 3TKAA 4COOA 3FNHA 1RQLA 4XGIA 4CLXA 4NYJR 5CBPA 5B30A 2V4MA 4RLFA 1OLOA 3LRXA 4FKZA 3RUHA 4N1AA 4AKTA 3O9ZA 3VPSA 1N32B 1V11B 3C8MA 3LWZA 4QG3A 1BEUB 3ZD8A 1UWVA 2ATCA 5IT9A 2FPPB 2JFHA 2GZ3A 3GQBA 3BJMA 3VHXB 4ZQBA 4HVCA 2JFVA 4BNGA 1RMYA 2CN1A 2FPLA 3JQAA 4KVAA 2K4MA 1EA7A 3B70A 2ZROA 5L6LB 2AN1A 5EHNA 1VXOA 4O33A 4CDGA 1NUTA 4ZT3A 2ZBVA 1IY1A 2CUTA 1M83A 2XXBA 3OQPA 3C1AA 421PA 4YRRA 1DAOA 3R9KA 1N6RA 3RARA 4RS3A 1G1MA 3OT1B 5FYQA 2PYDA 1T8SA 2Q3DA 3BMNB 1TM3E 4ZV7A 1I5RA 3BKWA 5IRCD 2JFFA 4L0QA 4AT1A 4FR0A 4XPIB 3NIDB 3BXEA 2GM4A 1NQAO 4Y9UA 4NQZA 4WZAE 5HRAA 2R0QC 5KSPA 2O19A 1PZXA 4E13A 2PUBA 2DAPA 4M9XA 1MAUA 4O2LA 1E7YA 1N5OX 4NCKA 3IDAA 3QY0A 3BQMB 5EWLB 2GERA 1GL3A 5CP8A 4REQB 2FYTA 2XUZA 3VMFA 3WGYA 4YI3A 3QFRA 4FFRA 1WXGA 1SC1A 3L4BC 3R3VA 4XWKA 4DXHA 3FFXA 3P26A 3MELA 2OM6A 1B8OA 4NJOA 2WWYA 5AVTA 3N87A 3W5JA 5TGTA 121PA 4ARVA 1V7QA 2V7WA 4ND8B 2Z8XA 3AQIA 3LSYA 3UCEA 2WIBA 5CDHA 3DT6A 1VG8A 4IJKA 1W8IA 3CNEA 2QSYA 2E87A 2VWQA 4L0MA 1K4MA 3PF8A 1SUSA 4WNCA 4N0QA 4CMAA 3K6SA 4UMDA 3T1OA 2VBGA 1ZJJA 3OQBA 1DUIA 2R5WA 4AC9A 5HS6A 3IUSA 1PUIA 1WHSA 2OYSA 3L7AA 1EPUA 3OOHA 4YJHB 1C29B 3CH5A 4R3UC 3CRZA 3OEHD 1K5HA 3K92A 4L78A 1PFUA 1YS7A 2CLIB 3DNPA 5SV2A 3V8NA 4C22A 2P6RA 1L5SA 2XLBA 1QCDA 2QN7A 4ND5A 4E7OA 1JPVA 4F60A 3HI6A 4XW2A 1VL5A 2WG2A 3C74A 3RIHA 1XTTA 1XC7A 4BLUA 1DIRA 2Q3FA 2LR0A 1YDWA 2E4VA 5BQOA 1N6OA 1C1DB 1ZC4A 5EKUA 5AW8A 2HM7A 4HVTA 3G2LA 4MRMB 1Z34A 2IP1A 2VZLA 3OHPA 5FLYA 1A7KA 1JLRA 4MUFA 4NULA 5B4TA 2AL7A 2XMSA 3QV1A 4BNVA 3FB4A 3QE0A 5J2TA 4OX9B 3UEOA 4WESA 1EZ4A 5DX1A 1DX6A 2JLZA 4FXOA 1A9RA 3DBIA 1PWHA 2I4OA 4BJ3A 4CJXA 3LMKA 4CMGA 4M87A 1Z2EA 2C42A 4KQCA 4MV8A 4NZYA 4Y6PA 1L7RA 5AK4A 4F12A 3FPFA 3G88A 1BWQA 2Q27A 2B4TO 2BGMA 5K4AA 2HBRA 4Z7JA 3B2QA 1R4MA 1PR4A 2J07A 3ZDRA 2K5UA 1A4UA 3GYBA 3T5AA 5HF5A 4R2LA 4HVLA 5J3JA 1NVTA 2YICA 3RE1A 1NVKA 1L3IA 1T8WA 3DOFA 2RH9B 3IMCA 3AEZA 4HRYA 1EUDA 1HY3A 4LGCA 2OL4A 3O4RA 5EJ4A 1PEDA 3UB2A 3FSRA 5CT5A 1N8SA 2B8JA 2OE2A 4KQXA 4Q9NA 3UMFA 2I4LA 1EFRA 3ZHUA 3ZCSA 5K8JB 5DMXA 4Q6BA 1WETA 1TW2A 4ZOEA 4IIJA 3QXGA 3W8DA 3MJCA 2W4MA 1K68A 1VBKA 2BMFA 3GRCA 3HY4A 4N65A 4NSNA 2CD9A 4ZVTA 4CKWA 3MLAA 5EI5A 1JE0A 4F21A 3A1VA 4QRDA 2JZCA 1Y3DE 2CBXA 4ZJUA 5EPOA 1TF2A 3LBNA 4J91A 3BQ9A 2XUGA 4EHIA 1A9TA 4GZMA 4IV0A 1YS6A 1VRCA 1ZINA 2V7EA 2JFZA 2C9CA 4C6TA 4CEHA 4U7JA 4Z4CA 4GE3A 1PSWA 1RHRA 4CM9A 4JLKA 5GPBA 1BJRE 2FWNA 2F9FA 3SYTA 4D8YA 1T5IA 2AXPA 2EZ4A 2I1WA 2FOIA 4BNLA 1JFSA 2BE9A 1S4QA 1U9CA 1YRYE 2PH5A 3ORQA 1BX0A 3UTDA 1RI1A 3PLNA 4JYPA 1KSJA 2C9OA 3OPMA 1BS1A 4MGYR 1M73E 1E3TA 4BTVA 4L4ZA 3PHJA 5CB4B 3DOUA 1J0DA 2PMEA 2CB9A 1P45A 5EJ6A 1NV8A 1MTOA 1T35A 4HFMA 5EINA 2CMFA 5L7TA 5JVDB 3KAKA 3TRHA 5AI4A 4I1VA 3AM1A 1IUPA 4ZTZB 2PH7A 2G04A 2PDAA 5K3CA 3TIGA 4GI7A 4HI0E 1YI0A 5ALXA 4G85A 1I6KA 1NZFA 2OZLA 1DCKA 2YIDA 3FZYA 5JO9A 5HDQA 3TXXA 3L0YA 5CFLA 5JT1A 1XVIA 1RCFA 1XXLA 1UDXA 2GARA 2JJ1D 3JQBC 1ZH2A 1KY2A 2H2AA 4Q3EA 3JWPA 4HQLA 2PVCA 3PUZA 4XIFA 5DTIA 5C3UA 4Z3KA 4NBVA 3VKGA 1BCSB 1AV7A 4X3OA 3C6ZA 1IJEA 1XTQA 3D6MA 2B1IA 2DFLA 3QF4B 3T3PB 4BEBA 4RTLA 2ZYHA 2DECA 3FHCB 2HSWA 4EHHA 4QE3A 1A5TA 4ZVPA 2H4HA 1B15A 1DAEA 1ACMA 2ZRPA 1YB1A 5E7JA 1EUYA 1E3SA 1P39A 1ZK1A 1LDGA 1P2GA 5B7QA 3LXMA 1DKUA 5FPSA 1GPUA 3RLIA 3OKCA 3WGHA 4JU8A 3MINA 1JA1A 4FFPA 3AEKA 3ZNOA 1GKLA 3LHFA 4A0HA 1E2GA 5D5PA 2HJRA 2CMGA 3UJCA 2GYVA 5CYOA 3LQYA 5FOSA 5LCXA 3LTEA 3GZNA 1V1RA 3NO4A 4RJJA 1U9ZA 2EJCA 3IV9A 2O2ZA 5KYTA 3AF6A 2BYTA 1VB3A 2OP1A 3P9KA 4OU5A 1AKEA 4B3TB 3HP4A 4OXRA 3D3KA 2BC9A 3G8YA 5J4HA 5G4LA 2KMLA 5LMZA 1M2NA 1GA4A 1U0SY 5LFAA 3ILXA 4YDHB 3EHEA 2M9MA 2OA0A 1A7UA 1W75A 1EX7A 2IK8A 3A36A 3HCNA 4Z9XA 1RZVA 3B1WA 4MKZA 3RFVA 1K92A 4R51A 1ORTA 2OFOA 3IT1A 3SQDA 4AJPA 3QJYA 4DLAA 4RD0A 1SHUX 2Z5GA 4KDEA 3UANA 2CWWA 2LBPA 3O8RA 1POWA 2GPWA 2V7QA 1P19A 3T7CA 3CKYA 4RTQA 2EKPA 3CRW1 4FD3A 3RAFC 1PJ3A 1OR8A 1PP4A 4BFUA 1SD1A 4U7PB 2CDRA 4QLOA 4UEWA 5IVPA 1NHWA 5J63A 2Y9PB 1G41A 1I0IA 1G20E 2CD7A 2H51A 3AHEA 3C6XA 2WSLA 3L7LA 1K98A 1NVEA 3RTBA 4BP3A 2ZJZA 2JAQA 2JFQA 2AN4A 2A1UA 4EYKA 4MA4A 4GUDA 4PFQA 2PGXA 4UJ3A 4YR7A 4I4TF 2Z43A 4I4TA 3JQGA 8ATCA 3PCTA 3TF5A 4KSCA 4PPQA 3GVHA 2NZJA 4BC1A 2BY4A 4JNCA 1V37A 4AL4A 3R3WA 1QVVA 2GPJA 3CTMA 1ZMRA 1SHZA 4W5RA 4JJFA 3ZWNA 2V1UA 3BFPA 3ZNNA 5GWXA 5FDFA 4WCFC 4YRTA 4CQLB 2HRDA 4WKCA 3ZDBA 5BR1A 1KP3A 5EHXA 4YP5A 3CBQA 4GKVA 2Q1WA 3FIUA 5B1SA 5JAHA 1J8FA 4R8MA 4DZRA 4L6AA 3SWWA 3U1BA 4Z8YA 4WOKA 3SE7A 3TQOA 1SUAA 2AHRA 4QSHA 4EB0A 2W42A 3BD8A 1NBAA 2QAGC 3S1AA 4X97A 3EVCA 2V54A 4OBEA 4CWAA 3I04A 4LXTA 1N1EA 4BTEA 3PT9A 3SZUA 5K0JA 2QU8A 3AV0B 2I76A 2FRDC 3QI2A 3QLEA 1DAKA 3RUAA 2GXQA 3FE2A 221PA 2O0MA 2VJOA 3O9MA 4AY3A 3I5UA 4MV7A 3PGXA 4DJDC 2QSJA 3L6EA 3X1MA 4CT0A 5BSWA 3BWEA 4ZIRB 3ZEAA 5HIAA 2XY4A 4ITUA 3KKLA 1C4OA 1NW4A 2DHQA 2FUKA 3RKSA 2VP2A 1E3JA 2FEWB 1QK4A 2GZ2A 3AR6A 3CE9A 3JYHA 4M2LA 3RGWS 2PBRA 2FPWA 3WS7A 3QUCA 4WNAA 4CG0A 1P17A 1TU0A 4PO9A 3ROQA 3PJDA 4UZFA 5LQAA 4FHEA 2EWMA 1C5KA 2CUKA 4RL4A 1Z2CA 3K0HA 1NRXA 4MLPA 3U7IA 5GV7A 3EIXA 1XV5A 2NXWA 5HKOA 3PQ2A 1R18A 2EGHA 2X6RA 5AM5A 3FMGA 1YRBA 2BLNA 1N34B 1J5XA 1KMHB 2MSDB 1FNDA 1XMSA 5DNYB 4PYOA 3M9WA 4LYAA 5HQ3B 4G8CA 4N0DA 2P2SA 2Q9UA 4OLHA 3Q7TA 4PHTA 1FFDA 1HWYA 2BCEA 2VHXA 3BGSA 4FE3A 2JARA 4O4HB 2G8NA 1E5VA 4EUNA 4BLVA 2C07A 3TOZA 5C1IA 3WISA 4OIFA 2XZPA 4H7FA 1KBZA 3TBHA 1V7CA 3QW4B 4RKYA 3RKRA 3W8FA 4PLZA 4ZQFA 1JDVA 3J80A 1M6WA 4WZ6A 3RG2A 5IHPA 1EIWA 1CUUA 2AN9A 2D8MA 1QNFA 3E3MA 3SF0A 1R10A 2PX4A 2FWAA 3N05A 3E5HA 5LOVA 3RS7A 2GCOB 4FFBB 2WTUA 4J0FA 1WUKS 1CX9B 4DEYA 3NHJA 4V0LA 2QUKA 5DK4A 1RTKA 2ZSHA 3SZLA 2ZKLA 4S2UA 3B3QA 2H2DA 5KCZA 5HUQA 1YACA 5IFKA 3NWEA 4H1VA 4BFZA 5B5SA 1UKZA 2SCUB 1UK9A 3ITKA 3O4IA 3OJ0A 4AICA 4EGJA 2J9XB 2R87A 1ESEA 3CEPB 1EZZA 2QPTA 3ITNA 4F2PA 1EWTA 1ZNYA 1W52X 3BD7A 3L05A 3Q2OA 3WDSA 2X15A 1OAOC 4R41A 5E0OA 4R84A 4EFNA 1JQ5A 3TFOA 1UC9A 2E49A 4QM6A 5KAPA 1FP4A 3TRJA 3AC0A 3EFEA 5FULA 1HRKA 1ZLXA 3WBFA 2IZ7A 4CLDA 4ZI3A 5CITA 3MQFA 4KO2S 5IKPA 2Q3LA 2GEDA 1EAMA 3WYNA 4HV4A 1G8GA 2A57A 3ZDYB 3PGA1 4V0KA 4G4GA 3FXAA 4RV5A 1SM4A 5JSYA 3SHFA 4B80A 4EHLA 5FJJA 1VJ5A 2DR0A 5MN6A 4Z53A 5A5GA 1BCSA 3E8XA 4OIMA 4CM5A 1UJ6A 5T5QA 2V6GA 3IERA 3T9FA 3VRHA 3E7WA 5B3AA 1PVOA 4FC7A 3E15A 3I1JA 4D3FA 3RVLA 2FZ5A 4C0LA 3KOWA 2O20A 3KOOA 5AJYA 2PUFA 1RWKA 2YW2A 3CF0A 4L72A 1RE0A 1DQYA 4CMIB 1FYXA 2GUGA 2RCYA 4A6DA 5IW8A 1KETA 2XAUA 2P30A 3TLZA 5KBYA 2Y1EA 5E1BA 1MIOA 2ZXFA 3TUZC 4G9BA 8ABPA 1F0NA 1TM2A 2IXDA 4X00A 3EAGA 1E8DA 2YWRA 4GPD1 4D79A 2ZB8A 1YK0A 5M04A 3C3CA 4R2KA 1J23A 2G1PA 5HOEA 3MSXA 4LRSB 2QRJA 3IAS1 5EL0A 5CR9A 1KYIA 4KXYA 2QAJA 4ND6A 1DP4A 1VL8A 2NWQA 5IC6A 4C7OA 1QPBA 4JU9A 1UDAA 4E1VA 4M22A 3VOTA 4EBFA 4AF6A 2HO5A 1KS9A 1NJGA 3BIWA 1P80A 1CQJA 1LVUA 4KLRA 3GDOA 1WDWB 4URUR 3DBOB 5I9MA 1HV8A 3LQFA 1CUWA 2H00A 1Q2XA 1E3WB 4B7AA 2Y77A 3Q7PA 2PUWA 2B61A 4W5WA 1PI3A 3UHOA 4WOJA 3F71A 2UYCA 2HBYA 3B1VA 1Z4MA 1GITA 3D5TA 3L49A 2BFBA 4N7JA 2FOLA 4B82A 5IN4A 4R1NA 1V8PA 3NWOA 5ILQA 3DNMA 3G89A 3GPCA 1R15A 3OEWA 4HH4A 4O3FA 4R1PA 1H8ED 2GN2A 1R66A 3M6XA 3PUIA 2C84A 1GPDG 3UUEA 4URZR 1F8UA 1IONA 1HZJA 2J0UA 2WM9B 1XDBA 1ZOPA 2BE7A 2VHCA 1U3FA 1VRVA 3GLHB 2E2WA 4FDAA 3SD7A 5G53C 1O6FA 2NSDA 4QPPA 4YASA 4MEJA 1G9SA 2DR2A 3O47A 3A6JA 5AP9A 2VHEA 1ZOIA 3C4JA 2OYRA 4B3CA 1KFJB 1PGNA 5IJ9B 3N6RA 2DFTA 3V32A 4CZ2A 4DMCA 4EA7A 4QNRA 1KVRA 3IP8A 2WJPA 1CRZA 4QDZA 2PZLA 2ZYWX 2WKWA 3F5MA 1SBIA 4MIYA 3FAZA 3MWEA 3Q7EA 3DJFA 4HTFA 3OU7A 4TMXA 1FDIA 3OCWA 4BFXA 3MCWA 4MQBA 4PO1A 3SPXA 4BEWA 1FZQA 3DMHA 4JIGA 4QHTA 4Y1RB 1M1YB 2PM8A 4S12A 4RD6A 4DC0A 4ZVNA 1M5UA 2HNAA 3VAAA 3AHJA 4F45A 1B26A 4YV7A 2OGSA 2BBTA 3DTVD 1HT3A 5DGHA 4AP6A 1V39A 2FX3A 4BU1A 2BSQA 1WCIA 1J20A 4CIVA 2YZMA 1J9ZA 4MWGA 4RNCA 5JEDA 1CDZA 2OKCA 3NAMA 3TXYA 4DIKA 2W2XA 3VMMA 4ZEMA 3QPBA 4P7JA 4U00A 2QD3A 2I91A 2Q4RA 4CF6A 5M3BA 1N2ZA 4AI6A 3LDGA 3LCVB 3NRJA 5DM2A 4EI8A 5C7LO 1JSLA 1G291 4BN4A 1DAMA 1EGVB 2VRNA 3IAM1 4PG5A 3ZVNA 2QTTA 2X77A 2YFKA 4D0SA 4OQ4A 3BB1A 1U2EA 2RAFA 1SKYE 4MP8A 1B0ZA 2ETXA 2Q1YA 5DYTA 1GCIA 2FN4A 1QHFA 2VK1A 3GA0A 2VP3A 1LNSA 3L6CA 3R3XA 2G77B 1SUDA 4NNOA 4Q93A 1Q7RA 1I7SB 2GHTA 1DTWA 2PXXA 3ZY3A 3W2FA 3DHNA 5CXQA 3W0LB 4NE2A 1KQGA 1FK8A 1FC0A 4MDEA 1TO2E 3IEVA 1H5UA 3SSOA 2XZLA 3HC7A 4FGZA 3FDIA 3KZMA 2GNOA 4TV8B 3HB7A 4JP8A 3OSUA 5LN1A 1KIMA 5F2EA 2C7OA 2VNJA 1RJGA 4K8RB 1G9TA 3A9VA 2G17A 4GE0A 3VDXA 4LMPA 4WPGA 3PU6A 3I0MA 4G4SP 4J94A 4KKXB 4W7SA 4BWFB 2J6CA 4IRXA 1VSBA 1T0HB 3B5EA 1LCIA 1SVNA 2PRYA 4ASUA 2XQGA 2Q3HA 4I3GA 2BRUC 3QMPA 3DDZX 2H5EA 3N2YA 1A8SA 1MX3A 3CZAA 4B32A 5CT4A 3BGOS 3GO4A 3LBFA 2X58A 3E82A 2OESA 2N46A 4RAOA 2JW5A 5IP5A 4HEA1 5IWCA 2VQ3A 5AR1A 4E22A 3ICEA 4EGQA 1ARZA 1UXKA 2QJRA 3MWYW 3D8NA 1GNRA 1KYYA 1MB3A 2HQRA 1QQ7A 2CHVA 1EG7A 3K9QO 4QUIA 4ER5A 3FOFC 1LS6A 1XP5A 2NTNA 1OCEA 4Q66C 1NM5C 2AFIB 1RM4A 2WSSA 1OW3B 1ZWLA 4Q9AA 2VDLB 4RK0A 5FF9A 4G1EB 1FMLA 1YKFA 4X1YB 2W70A 2XRYA 2ZB2A 3NDPA 4DLXA 1W96A 4P84A 4RH3A 3TTTA 1YZVA 1NXWA 1UM9A 2CFOA 4GRDA 4YALA 4E12A 2JLCA 2FZVA 1CUIA 3NHAA 1EXDA 1ZHHA 5G02A 4P1ZA 4AKHA 5FQOA 4I6JA 2AG0A 2XE8A 3OPYA 4ANFA 1E2FA 5FADA 1USVA 1XRPA 4I5FA 2PKYX 2Q28A 1WB4A 3PPYA 4F71A 2BGIA 2ZIEA 1N0VC 2XHEA 3LDHA 5AW0A 1SHKA 1Z2AA 3GC6A 1HPLA 3OOEA 4L95C 4QGFA 4DY6A 3QVJA 3SC4A 1APBA 2H6EA 1MW9X 2JGFA 2CVHA 3OPVA 4U7HA 4DWWA 3PNSA 1G0OA 1HQCA 1OILA 4HWOA 4FYMA 2R8ZA 4B83A 1WUTA 4FYHA 4B3IA 1TYDE 3GQBB 5I5EA 2WKPA 4NU6A 4WBXC 3GLIA 3D43A 3GJ7A 4KDFA 4ARSA 2AYZA 3T4EA 4U7DA 1VMIA 2BSAA 2WP0A 1XDDA 2AI1A 3DFUA 2BGLA 2WFLA 2WDPA 4L5CA 2VBFA 2ZRIA 4ZYVA 2E4ZA 1PNRA 2FOXA 3GUYA 3LCJA 2LDBA 3VU0A 1E4OA 1M10A 1JXAA 2H1SA 5FI0B 2ZWIA 3D6TB 4N3AA 3VQTA 4DT1B 4NL4H 3LUFA 4ARUA 4KGDA 4Q4LA 3ZR4B 2CSXA 5A4IS 2CL6X 1MCZA 3WB1A 3ON5A 5DVZA 2OB2A 3V4ZA 4NEGA 3FKSD 2QG4A 4W8GA 3BIJA 2B30A 4YPFA 5A9SA 3O92A 1N3IA 3ERCA 4P3YA 2D1YA 4PXYA 5AJXA 4TVBA 4DKXA 2D4AA 3IHLA 3FPAA 3LP6A 1R6UA 4CFSA 4DUGD 5KIAA 2GDZA 1L7VC 2PL9A 3AJ8A 4BO4A 3HU5A 4AQDA 3EDMA 2H1VA 2HLDA 3C1TA 4FGLA 4B33A 3EYAA 1U2DA 4C4YA 2BFPA 1E9EA 2C04A 4RACA 3KNZA 3C14C 1TYBE 3LF2A 1HQYE 4TXMA 1H0KA 1T2DA 4PZLA 5B58T 3WGZA 4U7FA 1EVLA 1FBTA 3WX0A 2XKJE 4DCPA 1YT5A 4FU0A 1IEXA 2X2PA 3OQJA 1BX3A 1KC1A 1S2LA 2J5RA 4PBSA 3T7TA 3BDVA 4NCAA 1Y33E 2IX9A 4NAHA 3D02A 1ECCA 5SY6A 3GRUA 1UADA 2R6DA 2DCUA 3OG9A 1CKEA 2PQ6A 3LO8A 5AICA 3O8CA 3I32A 4NATA 4P4LA 1H23A 1FW8A 1T10A 2FMXA 4M76B 5B12A 3MHTA 1T6XA 2QYHA 2SHKA 4FWTA 4ZYYA 2Y76A 3EG9B 1QP0A 2WYUA 3DO6A 1TZKA 3HKEA 4HEJA 3EPHA 4D9KA 2IPMA 1RW4A 5AKEA 1ZCJA 3HE3A 2C29D 1DFGA 5L3SB 1N25A 1RZRA 4OG2A 3ANTA 4CKBB 2GHIA 2POCA 2HNKA 2J8ZA 2YHSA 3UY4A 4ALKA 4CG2A 1EFCA 5JD6A 3TD6A 1AXEA 3KVNA 2FPKA 3Q9UA 4K40A 1X1AA 1KY3A 5K3FB 3MAAC 2A0UA 2C78A 1E3IA 3ENQA 3UAXA 2VBIA 4IBOA 4P7BA 1P1JA 5D3MB 3WLAA 5JCJD 4TL7A 1MN6A 5DF1A 2YYAA 3TIXB 5A3SA 5KJ1A 4W4TA 4IFIA 4UNNA 3QKSB 5C5DA 5FO1A 1Y7LA 2JFXA 5FBHA 3SHVA 3G1UA 4KH1A 2VYCA 4OAQA 4AX8A 1KQPA 3BUSA 5JCOA 3WWPA 5L45A 1BXRB 4EI7A 4X91A 1EP3B 3V2GA 1YBMA 1A9PA 3PTZA 1NF9A 3L3BA 3R9XB 2XAAA 2A0KA 3C6QA 1R16A 2QQFA 3C5HA 1LS1A 1L8XA 1W46A 2RB5A 4J3JA 4OGLA 1W30A 4V38A 3RRBA 5JJCA 1GU0A 4UD6A 4A82A 2MMCA 3WQSB 4BX8A 1M0SA 3D3WB 2VDPB 1TF5A 1YR1A 2O8VA 3IEUA 4PFJA 1G21B 4UTZA 3RIXA 1W35A 5C5IA 5C34B 4ZOLF 1SKQA 3UVEA 3K09C 3OSZA 1PV4A 5CIWA 4ZZ2A 4TYMA 1Z88A 4JITA 4YCBA 4B2IA 1YJ8A 4IJMA 1JUDA 2AB0A 4IWXA 4QRIA 5HTKA 1IH8A 2ODPA 5LB2A 2BGGA 1NBME 3QX8A 2RE8A 1KI3A 4EX7A 4ZKEA 1DWUA 1Y3AA 3ITEA 5DNCA 2Q46A 4PVDA 4P22A 4CFZA 1K5DA 1ECBA 1CNMA 1T1JA 2BL4A 1F17A 2GMWA 3N8IA 1WXXA 2BEUA 3ZEIA 1U3WA 3FCOA 3IILA 4FHZA 3U4IA 4G8DA 4HJXA 4URWR 4AJIA 4BP8A 2J9ZB 2P9GA 4F1KA 5JZOA 3RYCA 4XYLA 4REMA 1TCCA 4BL5A 2AUTA 4DUGA 3BE8A 4FW8A 4C6HA 3GPLA 2I6XA 3P9IA 2XB6A 4RE6A 3I5AA 4RSGA 5CLIA 5KNDD 5J2UF 3OO1A 1NJ2A 2WHPA 3F6EX 1HURA 4OHCA 4QDOA 4DG9A 1NRJB 3HBFA 1NQVA 1CWUA 4IFEA 3MAJA 4X8MA 3DYVA 2HN9A 2CVPA 1WZNA 3M3DA 3EDQA 2ST1A 4FCVA 4JLUA 1WLYA 1WHTB 2BFNA 1BDIA 3LOPA 2I6FA 1CQJB 5HKAA 3HO6A 1UMKA 5BVHB 4HBGA 1VMAA 1G6Q1 3FCSB 1K3UB 3AERA 1GZDA 2C31A 1ZH0A 2J3DA 3CUEF 3H1EA 4W5NA 5TPZD 4J0HA 2AGVA 1F51E 1FNSA 2FQYA 2HPAA 3AR3A 2BKAA 5GJVC 4XFKA 3CZ4A 3A9CA 1QV6A 1NX9A 4FP9A 2Q6OA 1RQPA 3EWSA 1D2NA 4CM9D 3T3HA 5J2TB 3EPJA 4G1FA 2Y93A 5G41A 3BK7A 3U3KA 4UOEA 1G8YA 1XOIA 3RSHA 1ULSA 2XJ4A 4ZANA 2D1TA 4AZWA 5EMNA 1MC4A 1R6DA 5JI2E 1R9NA 2VQ6A 3MJTA 3O8NA 4GBED 2JGNA 3MOGA 5HM6A 1QQBA 1WSBA 1CQWA 4N5LA 3UH0A 4IDEA 2XQJA 3DAGA 1ODCA 5K8VA 1E92A 5B3JA 1DUVG 1ANKA