2PZUA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzuA00
1TQOA 4NDXA 3MEHA 4IUNA 4DU9A 3U9OA 1EY5A 5IGBA 4HMIA 2F0HA 4I65A 5CV6A 1SYCA 4ZQ3A 3DMUA 2RDFA 3SK5A 1KDCA 4KJOA 2PZTA 4DFAA 1NUCA 3EROA 5I6WA 2KQ3A 4ZUIA 3MVVA 3S9WA 3MXPA 4K8IA 5CGKA 4QMGA 3EVQA 5IGDA 1STGA 5I9PA 1JOOA 5IIFA 4PMBA 3DHQA 3D8GA 2PYKA 3OMGA 4N9TA 1SYGA 3C1EA 4NKLA 2F0VA 1EY9A 4ODGA 5F2DA 4KV6A 5HURA 1EQVA 2F0EA 4K5XA 1EYAA 5I6YA 2PW7A 2EYOA 4N9PA 5IOCA 3TMEA 3OSOA 5C6AA 5KYIA 3NQTA 4B9XA 5E3FA 4F8MA 2HQEA 5KIXA 4J6HA 2OF1A 3SHLA 1KABA 3D6CA 3HZXA 1EZ8A 3QB3A 4KTAA 5DEHA 2EY2A 4KY7A 1EY8A 3SK8A 4R8NA 3V2TA 1AEXA 2F0QA 2WACA 3P1HA 1RKNA 4YIJA 2NUCA 4KHVA 5E1FA 2F0JA 3P75A 2EY6A 4K5VA 4B9WA 1F2MA 3ITPA 3MHBA 5EGTA 5KYLA 3QOJA 1STHA 4KY5A 5DAUA 2O4XA 5KGUA 1EYCA 2M00A 2EYMA 4RKBA 5CR3A 4KD4A 3SK4A 5K5PA 3BDCA 4ME5A 2KHSA 4KD3A 2RBMA 2SNMA 3BDLA 3ERQA 1EY0A 4QB4A 3SXHA 4EQOA 5C4HA 3SK6A 1A2UA 1EZ6A 2F0LA 1SYDA 2F0NA 3NUCA 4K8JA 3LX0A 3OMCA 1EY7A 3D4WA 4S3SA 3T16A 1A3VA 4E6IA 2F0DA 2PZUA 1ENAA 2ENBA 2OEOA 3D4DA 4ZUJA 5J1ZA 3TP7A 3SR1A 1STBA 3E5SA 5JOBA 4K14A 1SNPA 1F2ZA 2EXZA 1EY6A 2SOBA 3HEJA 2EY5A 3NXWA 1A2TA 3MZ5A 2F0FA 4QF4A 4RKLA 4K5WA 4OL7A 2F0SA 4WORA 4K2LA 2PW5A 4NMZA 5CV7A 5IGEA 2F0UA 3T13A 4DF7A 4ID6A 4HMJA 4WRDA 5ISRA 2F3WA 3PMFA 3QOLA 3R3OA 4NP5A 5CV8A 1F2YA 2F3VA 1SNMA 5C4ZA 2F0OA 2PQEA 2F0KA 3EJIA 2SNSA 4K6DA 4KY6A 1JORA 5CC4A 5HGTA 2F0MA 1TR5A 2EYHA 4PMCA 4DGZA 1KDBA 2EY1A 5I9OA 2F0TA 4J1MA 2LKVA 1KDAA 5CV5A 5C3XA 1SYEA 2PZWA 2F0PA 3NK9A 4H7BA 5EKLA 3VA5A 4F7XA 1U9RA 1A3TA 1SNCA 4EQNA 5JAVA 3NHHA 1EY4A 4EVOA 4MIUA 3NP8A 5IGGA 1JOQA 4HTHA 4KJNA 4IALA 1IHZA 1STYA 3C1FA 5J22A 4EQPA 1KAAA 2F0WA 4G57A 1SYFA 1SYBA 2QDBA 3H6MA 3TP6A 5C3WA 1STAA 5IGFA 5EKKA 5KRUA 4TRDA 5IGCA 4PNYA 1NSNS 5CV9A 5KEEA 1EYDA 5CV4A 1SNDA 5C5MA 3TP8A 2EYLA 1JOKA 2EYFA 1ENCA 2EYPA 2F0GA 3OWFA 1STNA 5IODA 5J39A 4IZ8A 1SNOA 5C5LA 2F0IA 2EYJA 1II3A 4K2KA 4LAAA 5NUCA 2RKSA 3RUZA 1TT2A 1A3UA 1SNQA 5M9OA 2OXPA 3TP5A
chains in the Genus database with same CATH superfamily
2NVYB 5LHY1 5C4JB 3TS2A 1VQPA 2F0HA 3PO3G 1BCPB 5C4XG 3A55A 2MO1A 5A35A 1K8AC 2KQ3A 3FKIB 2Q2UA 2KCCA 3VR2A 2BH2A 1ICFB 4FNFA 5IIFA 5I9PA 5C3EG 4APVA 2K04A 2IL8A 4FF1A 3PUXA 4OHJA 1SYGA 4WJ4A 1G8ZD 2BCOA 4DAYA 2F0VA 2O2LD 4A3KB 2JA7G 3U4ZA 1Z47A 4P73A 3PO2H 5ELEA 1N36L 1I4PA 3HS0C 4DV4L 4IN3A 1YBYA 3NPPA 4RMFA 3X3NA 1T9HA 4DR7L 3VR3A 1Y1VG 1AZQA 3CCVA 1PRTC 1IW7D 4A3MB 2WIIB 5DLQE 4XDXA 5JEAJ 1L1OB 3EFXD 2SNMA 5C4HA 1EY0A 3SXHA 2F0LA 2KHIA 4KMUC 4YCWA 2PZUA 4CJ0B 3H3VC 3K81C 2UXDL 2D5DA 1PYWD 4K5WA 2F0SA 1E2WA 1U4LA 2VL6A 2IHEA 2WAQB 2L4NA 2H1EA 4XIGS 3G71A 2YV5A 3S2HB 5BN5A 4CGYB 2KUMA 4LF9L 4KN7C 2V1CC 4A3IB 1I4XA 2NTTA 4IOAA 1I94L 2JA9A 4HTHA 4KJNA 1IHZA 2A6ED 4O2DA 3STBD 4YHHL 4B3ML 4B3SL 4ABNA 1TWCH 2ZT9C 1CFMA 2NB0A 1EYDA 4J8QA 3K7UC 1G6ZA 1SNDA 2KEDA 2NVXB 4MN3A 5CBEE 4C3JH 2EYPA 4JI4L 2MHVA 3PO2G 3HOUB 2XRQD 1R4QB 1Q46A 1S3OA 1D1KA 2OQKA 2PO4A 2GVBA 2FHTA 4BY1B 1O80A 3PUWA 1CQVA 2RDFA 2VS1A 1U4RA 2NVTH 3EROA 3DM1A 3L2PA 3GTQB 1TXYA 3URYA 1TS4A 3E0JA 4RGTA 1G6PA 3C3LA 3MFYA 1Y8PB 4NKLA 2L9HA 1X9NA 3ERSX 1YNJD 3HOXH 1T5EA 2F0EA 1EU4A 4FO2A 4A3BH 1WYDA 3JAME 5LL6X 3S1RB 1H9SA 1RHPA 1YIJA 4C2MB 4JC0A 2R93H 1JR0D 1HZAA 1F9QA 1EZ8A 3SK8A 1N9WA 2JA7B 1RJTA 1NMFA 4AYBE 5KNBA 1K83H 1TWAH 1N33Q 4G4KA 3FHWA 2F03A 4A3DB 2BA0A 2YTVA 4IUUA 1VQ5A 1ICWA 2B2YC 1YJWA 2CW0C 5M5WB 4OIJA 4QUCA 1Q7YC 1Z7TA 2F3IA 3H3VH 4ZUJA 5EAYA 3K7AH 1SNPA 3TEHB 5JJKA 2Z4HA 3S1MB 2UXBQ 5E4XA 1EWHA 5LMUQ 4I7ZC 1O7ZA 1N34L 1O7IA 1NR4A 1S5DD 2KCTA 4C3JG 2SNSA 5T1IA 1U4PA 4DN4M 3K5OA 1A8VA 4DGZA 1KDBA 3U50C 3CC4A 1SMYC 5GROA 5DNFA 1EWIA 2PMZB 1SNCA 4FF4A 2K6AA 4OXPA 1Y69U 1JOQA 1K3BC 3GDEA 3NENA 3HOYH 1EEID 3B6YA 2QDBA 3U9SA 1F77A 3S16B 3M7GA 1R9TB 5ELCA 3A8IE 1QJOA 5KEEA 2JA6H 4OEMB 3HOXG 4GKJQ 2CFMA 4JI8L 3EIVA 3GTGH 2VB3X 1CT1D 1TWFB 2FINB 4RWSC 3KBGA 1JWSD 1II3A 4IUVA 2AWOA 2EJMA 1CKNB 1AZPA 2R93G 1EY5A 3M3YB 4J15A 2E2DC 1J6QA 2IJ0A 3PO2B 4BXXH 3S9WA 1QB5D 4BS9A 5IYCH 1VMPA 2IT1A 2VNUD 1STGA 1HH2P 3ICEA 3L3OC 1RTOA 1P8LA 4RFBA 2VXWA 3I90A 3OHXC 4OELB 1EY9A 3CCMA 3PF5A 1XPRA 4X6AH 2JA8H 4JI2L 5D65A 4DUZL 3FMCA 2AUKA 1GUOA 3KFUA 4GOPC 1SFOB 2EPBA 2JA5H 5JEAH 3HG9A 1WI5A 3R93A 1IBKQ 4C3IB 2F0QA 3HKZE 3PIP3 1AE3A 5IP9H 3PF4A 4WFN3 2JSOA 4S3SA 2XRSD 1C48A 3JAMc 4P2CB 2F4IA 3T4AC 5JVG3 1NR2A 3HOYG 4JI6L 2QEXA 1LTLA 3S1NH 2F0FA 2LFNA 1YITA 2MJ8A 1BOSA 1K0SA 3V05A 5ISRA 5CV8A 2JA6G 2HQLA 3RLNA 2ALYB 2F0MA 3KJOA 3T56B 4PMCA 1TWCB 5CMDA 5M3MG 4J1MA 1PHJA 1LT4D 3D6WA 1FJGQ 1FNUA 1DXMA 3NHHA 4KKUA 1Q86C 4C3JB 3D0FA 3C1FA 4JI3L 4HEDA 1KAAA 2F0WA 1NJIC 1KD1C 4H0LC 4TQUS 3TP6A 3PIPA 1A0IA 3F2BA 4RGNA 1JJCB 2WB1B 5DM63 2L55A 4PNYA 2NTSA 4LFAL 4OGQC 1HUMA 2MQHA 4IZ8A 4DNRB 2NZOA 2DUDA 2RCNA 2ZTEA 1YJ9A 3S17H 4IPDA 4LFCQ 3OIQA 3E9IA 2JA5G 1TWHH 3GTMH 2IX3A 2UUCL 5JEAG 3HOXB 4DV6L 4A3BB 1Q8KA 5EJWA 1XXGA 3JC66 4R4OA 5IP9G 2KCNA 2R93B 3C46A 1NCVA 4BBRG 1SDFA 4HIKA 1KAWA 4KV6A 2B39A 2N3SA 1TWAB 1LTRD 4KI0A 1PRTB 3NQTA 3TZDA 2CH4W 4POGA 4ZK9B 5KNCA 2DJFC 3QB3A 1M1KC 2ICIA 4JBWA 4DUYL 1TVXA 1OXVA 2HCIA 3BYYB 1KRTA 1PH1A 1GO3E 3OYYA 1NY4A 4XQJA 4X64Q 3QJYA 1STHA 2VZAA 2A68C 4Y7NH 1TIID 4OO1H 5I4DA 1BCPD 1FGBD 4WJWA 2HHHQ 2RHQB 1YZ6A 2A6HD 2KA7A 1YJNA 2EZVA 1CUKA 4TVAB 3CCRA 2E2IH 1H9JA 1W6JA 1LV9A 4PZ8A 4BA1I 1FNVA 3MFGA 1B44D 3W2DA 2CVRA 1K73C 1GUSA 1BBXC 4UDUC 3MZ5A 2K01A 4QY7A 5M5XH 2PW5A 2PQAB 5CORA 3E0EA 3QOLA 3PMFA 1YHAA 1MHWC 3DEPA 2EVBA 3J7AV 2F3VA 4GN3B 1VCIA 2B2YA 1EQQA 3G7LA 4JI5L 1CHQD 1V9PA 2F0TA 1KDAA 5CV5A 4OWTB 3NWSA 1S5FD 3DWQA 3CCJA 1HZCA 1DZ1A 2K50A 3GTGB 1CM9A 4QL5A 2HIVA 1J5EL 1IBML 3KLWA 3M4QA 2OWOA 4HIOA 2G5DA 1F9RA 2QCPX 1PH3A 3GP7A 2ZJRA 3S2DH 4G7HC 5IYDG 3CXCA 3I4MB 3OWFA 2LY7A 5ELBA 1QCBD 4HIMA 4JI7Q 2B2TC 2TSSA 1IKMA 3RZDH 2E5LQ 1X54A 4R1JA 2IW3A 1G2TA 3I70A 5CV6A 5BR8L 2D9UA 4HCEA 2CHBD 1VQOA 2JA8B 4DK0A 3TN2A 4DR3Q 4LF6L 2R92H 4PZ6A 4WJ3M 1V1PA 3RMHA 3CHBD 1X3QA 4H13C 3PV0A 4HCSA 4OO1G 1JB7A 4GZYC 2JA5B 1IBLQ 4ODGA 2EOTA 2Y0SB 4F87A 2M2LA 1KNAA 1PDQA 3PUVA 4B9XA 4DR4L 4A3JH 1C4QA 4CDDC 1MSHA 3LGJA 4P72A 4GKKQ 3K58A 3DEOA 3OTOL 5D14A 5JPMC 2HCCA 2VQEL 1QVCA 4JBJA 5KNDA 1B9MA 4IJHA 3P1HA 3VR6A 2NUCA 2F0JA 3R2TA 1I3QH 2ZTDA 4FXGC 3F8TA 3BVZA 5DAUA 4L5RC 4RKBA 3S1NB 3RZOH 4L8JA 4PZ7A 5IYBH 1UWVA 1TS5A 3SK6A 3NTIA 4KKSA 5C0XJ 3W5OA 1N36Q 2K1BA 1ENAA 2B8FA 4DV4Q 1BVSA 3VR5A 1KHIA 2EXZA 2F52A 4DR7Q 1PZJD 3G6EA 4NB3A 4WORA 2YTYA 1JE5A 4NMZA 5C4XH 4UAIA 3UDFA 2UUBL 1ZKOA 5C3EH 1MJCA 4ZKBB 1DCZA 1BDOA 3GQBA 1TR5A 1V1PB 2KECA 1HTPA 3TREA 2FJ2A 4R4TA 3CCSA 3SE0A 1EFID 2UXDQ 4HR7B 1FGUA 1QZGA 1A3TA 4LF7Q 3A7AB 1SBBB 1QVFA 1VQCA 4FF3A 2E2JH 5GAEC 1RIPA 1UEBA 4HN7A 2R92G 3S17B 3PUZA 4NXML 4GLAC 3CMEA 5IWAL 4JOIC 1IW7C 3F1ZA 5IGCA 5JJZA 1ZEQX 1Y14B 2XVSA 1TWHB 2K52A 4CKEA 4IQZA 1RODA 3OWEB 1JWUD 2WP8J 4LFBL 1IYVA 1SROA 1YNND 3X3MA 5E4WC 4DV0L 4A3JG 1A3UA 4ZKCB 4R8IA 1L0XB 2NN6H 3N52A 3PGZA 4GS3A 4A3FB 1VQMA 4BBSG 4YHHQ 4MZ9A 4B3MQ 4B3SQ 3K5NA 4HJ7A 1CTMA 5GADC 1A62A 4QMGA 2OTJA 3M9BA 3NTKA 1EQTA 1BF4A 4PMBA 4GOPB 1O7YA 3OW7A 1J9OA 5G3LF 4JI4Q 1V8QA 4JG2A 5IYBG 1VS0A 1EYAA 1MKHA 5IOCA 1B8AA 3TMEA 4NW2A 2CWPA 2MPMA 2J0TD 4QIWB 1RDPD 1LTBD 2R61A 4Y7NB 1KABA 1ESFA 4O0AA 1PH5A 2A6EC 2IX1A 3STBC 4RHRA 1D5MC 5GAHC 2L1BA 2F4VQ 1JE4A 4K5VA 3ND9A 2JEAI 2ID0A 3CQZH 5C44B 1PTOD 5M5XB 1ASZA 1TS2A 2L12A 4YCVA 3NUCA 1RD9D 3K6OA 1EFWA 2VUMB 4M8AA 1UUPA 3Q24A 2BE5D 4ZLTF 3NELA 3S1QH 1X6OA 1MBYA 1QZHA 2ASBA 1QWYA 3T1HQ 5FLXc 1GJXA 4K2LA 3W1GA 3CC2A 3JAML 3TBIB 5IGEA 3F2DA 2NWGA 5IT9c 2UU9L 4NXNL 4X62L 1VQ8A 2N49A 5C4ZA 1SNMA 4Y52H 2ZM6L 5FJ8G 3A0JA 3T1YQ 4HAEA 2I46A 4DV2L 4C56C 2J7ZA 2K14A 2KBNA 2I0QA 5I9OA 1WTQA 1E24A 2GA4B 3I3CA 1UEAB 3SGIA 2PZWA 3GTJH 4OIKA 2NN6G 3CPFA 4A3EH 4X3SA 4UP9A 1PYSB 4IALA 3M7NA 2B2UC 2AQ3B 5J22A 1X3PA 1N34Q 2LMCB 1EU3A 2HDMA 3F2CA 2D62A 5EBDA 1CSQA 3JAMi 2Z0SA 2PI2A 2K33A 2UXCL 4IPCA 1KLUD 2K5HA 3O13A 5BN3A 2EIFA 4ME3A 3WDNA 2ZJPA 1K9MC 1TWGH 3K80C 4N8X1 1VQAA 2Q2IA 4K2KA 5LMNL 3C2PA 3AFPA 1A15A 2F3WA 1GXDC 4IUNA 4DAYB 1U0LA 1SEBD 1WVLA 5AJ3L 1PXUA 4ZUIA 3H15A 4A3JB 2CQAA 4DR2L 3IFTA 1CI3M 1A63A 2IX0A 3H3VI 1PTOF 5I6YA 1G51A 4DV3L 3H0GH 1MD2D 3VYRA 2B2TA 3R8BA 3L7ZC 2OF1A 4JI0L 3Q22A 4JI1L 3RZOB 4PG3A 1EY8A 4P74A 1CK1A 1AEXA 1PH2A 4KN4C 1WD0A 2C5CA 5C0XH 3H91A 1H9MA 3PCOB 1B3AA 3HOVB 4JPBW 3Q6SA 3IKJA 4KHZA 1GM5A 4KD4A 3PO3B 4JI2Q 5C4XB 4R4CA 4LWCA 4DUZQ 3BZDB 3LX0A 3T16A 3J7ZC 4A3EG 4RH6A 1L2FA 2JK8A 5C3EB 1CQFA 4XQNA 3CF5A 5GAGC 3J80c 1LTTD 4JV5L 3PQIA 4XXEA 2SDFA 1GOZA 4OL7A 1BKBA 1VDZA 3EQLC 1GD7A 3T13A 4DF7A 3J7AF 1HUNA 2BDOA 4FVMA 1UE7A 1B3QA 2E2JB 3KLSX 1Q82C 3VDYA 2B2VC 2X69A 2EY1A 2E75C 1YVCA 1Y1VB 1G91A 2ZXRA 2QGQA 1LT5D 3TDQA 3HOZH 4A93G 2R7FA 4C3HH 2G9DA 4XQQA 1XNQL 1LTID 2UUAQ 3EBEA 2PPBC 1DOKA 1Y1WH 1SYFA 1STAA 3QO2A 5KRUA 4TRDA 4G7OC 2EQSA 3CCUA 5C5MA 5COYA 4IJLA 1I6HB 3HRZC 1FR3A 1ZXTA 4OONA 5EPJA 3H0GG 3MTSA 4BY7H 1K8MA 3TP5A 1EYGA 1SXTA 1PH9A 4JI3Q 1QNUA 1IZ6A 3UE0A 1KDCA 3FDTA 1OXXK 4AH6A 1VQHA 3H94A 5C0XG 1V1QA 5CGKA 1H9SB 1HTLD 2L0CA 3ZYYX 4AYBG 2PNHA 3G48A 4MTNA 4LFAQ 4JOIA 3DHQA 3GTPH 2WKCA 3KYHC 3GV3A 3OSOA 1NBWA 5M3MH 4AQYL 1UE6A 3KF6A 2UUCQ 2DN8A 3UDIA 3SHLA 2RF4A 5DEHA 4P71A 2JXMB 4R8NA 1EOTA 4LF8L 4DR1L 2B2WC 3RNUA 4KHVA 1BBWA 1M8AA 3S1QB 3ITPA 2EJGC 4ILWA 3BDOA 1W6KA 1QILA 2JYOA 4R9WA 1WTPA 1EOVA 4FYDA 3HOZG 2ENBA 1GVPA 4C3HG 2B63H 1Q3LA 3FP9A 4K14A 1F2ZA 2BH8A 1V1OA 3DWAA 4RGMA 1Y1WG 4OX9L 5LMNW 2V4DA 1E22A 1XMOQ 3GTJB 4XYQA 1B4OA 3RLFA 1F2YA 4HIDA 3H09A 3KDFA 1XX8A 2K5DA 5K36H 4BBRH 3U58A 4Q5VA 2I5MX 1M90C 1LABA 2EXDA 1E0BA 1GHJA 1HNZL 4BY7G 4LF4Q 3S14H 3N6RA 1VQIA 1WCMH 5JVH3 2CCZA 2F0PA 2XWBB 2DNEA 4EVOA 2HUGA 4QJFA 1AN8A 3G6JB 5A2QE 1EIGA 2QF7A 3NBIA 5M3FG 3KF6B 2E76C 2WV6D 1F2LA 3AYHB 3KBXA 3BVMA 2DNCA 1Q12A 4LF5L 4JI5Q 2NVQH 1B7YB 2A6HC 2GVAA 1HNWL 4LMQD 3RUZA 2H4OA 1X3GA 2KHJA 4X65L 4IUQA 1D8LA 4A3GH 4IO9A 1J5EQ 4JBKA 2B2UA 4JBMA 3HKZG 2LS01 4Z9CB 3H0GB 4OO1I 3EN2A 5IGDA 3S24A 3FEWX 1I5FA 3ONAB 3I8ZA 4B3TL 1F9SA 1WTVA 2NVTB 3UE1A 2RQXA 1HNXL 4IURA 4AYBB 1KQSA 3KDFB 5BR8Q 2B63G 1EIYB 2EY2A 1P16A 4KK7A 1I50H 1B50A 4LF6Q 2R7ZH 3K59A 5FO9B 4C1NI 1PVOA 1RKNA 4YIJA 2JE6I 5E1FA 5IP7G 1VQKA 3MA2B 3MHBA 2I07B 5E7NA 3K57A 3KK7A 5K36G 1EYCA 2DY7A 2M00A 5K5PA 2A69C 1QOHA 5M5YH 1EUJA 4ME5A 4GKJL 3BDLA 1E2ZA 3ERQA 5IYDH 4LNQA 1B70B 2G9HD 4B08A 2F0NA 4RHSA 1WCMG 1K83B 1NNXA 1ZYRC 2VQFQ 1LTGD 4A76A 1KLGD 2KJXA 1S40A 1KC8C 2AKWB 3E5SA 5JJIA 1K0RA 2YTXA 1JT8A 1X56A 2ZXPA 5CYUA 4QF4A 3NBHA 3MC0B 2OT2A 1BO0A 3CW2C 1E7ZA 4EGVA 1XNRL 3HOZB 4C3HB 2PQEA 2F0KA 3K7AB 4KY6A 1Y1WB 1YNXA 4IFDJ 3BS1A 3K0YA 4JK1C 5CBAE 4QQBX 1SR3A 1NTGA 5C3XA 2VW9A 4H7BA 4A3GG 1EY4A 2X6GA 5HGQA 1OXUA 3I4NH 4KHPQ 1PFBA 1IBKL 1HZ9A 1SYBA 2K5VA 2KVMA 3OW2A 1PH4A 2UUBQ 1HZBA 2NVYH 4GNXA 4LUVA 5C4JH 1Y8NB 2KEEA 1E2VA 3HOYB 3ND8A 4N8FA 3S15H 2B2VA 5EKIA 1HFNA 3NSWA 1H9RA 3IFDA 4A3CH 4CJ2C 4DU9A 3MEHA 2KENA 2JA6B 3TSSA 3Q23A 4A3KH 2PZTA 2R7ZG 4NXMQ 3AU7A 5L37A 2K05A 2RVLA 1X3EA 2N8NA 5IWAQ 1B2TA 5D3IB 5M3MB 1KRSA 1W3SA 1SE3A 2MFIA 3LNNA 3NBHB 3KOJA 5FO8B 4K5XA 1N32Q 2RHSB 2BDNA 3HKZB 1JQYD 4IUPA 2IWHA 3K8AA 2GN5A 2A73B 2HQEA 4DPGA 1I4HA 4A3MH 4ZAIA 4JYAL 3GO5A 5DM73 3T51B 1LM0A 4YWKA 3V2TA 3KUPA 2L11A 3SDZA 2ZXOA 5HY6A 2XNAC 4L5SA 1PLFA 4B9WA 2DJGC 3CPWA 1G2SA 3P20A 5KGUA 4CBVA 2K75A 4RGOS 3SK4A 1PH8A 4CDEC 4FXDA 2RBMA 1BCPF 3GTLH 4CDFC 1A2UA 1B9NA 1SYDA 1MJEA 1LUZA 1CZWA 1TY0A 1UAPA 1HCZA 4LFCL 1QG7A 2JJQA 1STBA 4BBRB 3KLSA 2KCMA 2O5IC 1EY6A 3I4NG 5FLXE 2VB2X 3BG3A 2ZJQA 1K3RA 4RKLA 4BBSH 3S14B 2B2WA 2XTIA 5IT9E 3IAYA 2A8VA 1XMQL 4NP5A 3TZUA 1D5XC 3AFQA 3EJIA 2Z1CA 4DV5L 5FKAC 2YU9H 2R6GA 3FKIG 1Z9FA 2NN6I 2WAQE 1VF5C 3Q0AA 1S72A 4A3CG 2LKVA 1I4RA 2E8GA 1VQGA 5EBCA 2NVXH 4A3KG 4FP5D 1PYBA 5JPNC 2NVQB 1OTCA 1OXSC 1HQMC 4NXNQ 4X62Q 5EKKA 3OOCA 4CDCC 3CCEA 4BA2I 3HKSA 3NWTA 2ZM6Q 4BY1H 3CP0A 2K5QA 1PTOC 4HSVA 1QVGA 1XJVA 1BXTA 5C5LA 3GTQH 2C35B 4K0KL 1X65A 1WFQA 4LAAA 2RKSA 2BE5C 4L5QA 3K5LA 3CC7A 4A3MG 3J7A5 3K5MA 3SEBA 1ASYA 1DOLA 5JJLA 4DFAA 1VQFA 5I6WA 1TKWB 4X66L 4K8IA 4LUZA 3S1RH 4F88A 2UXCQ 4G7ZC 3OMGA 3GTMB 3C1EA 3TQYA 3W1BA 4YY3L 2R7ZB 5FJ8H 2QKIC 3J81E 5LMNQ 2WAQG 3WOFA 1GKHA 4LF9Q 2I5HA 4GLXA 4DR6L 1WTOA 4A3DH 2LXJA 4V190 3D6CA 1I94Q 3FPPA 2A74C 1CA6A 1B1ZA 4DR2Q 2AMCB 1XYIA 3I55A 1PFNA 3BZCA 5FK9C 5CR3A 2EYMA 2QDLA 5KYLA 3BDCA 3S1MH 1A6XA 1CA5A 1DOMA 4JI7L 2F0DA 4V0BA 2E5LL 1I6VC 3J80E 1L1OA 1VF7A 4IFDH 1QUQA 4DR3L 1VQ6A 2HIXA 4ID6A 5GQOA 2JQOA 1WD1A 4FF2A 2E2IB 4BY1G 1F9PA 1U5KA 3F2UA 3A8JE 2F1MA 2ATWA 1LACA 1I4GA 5HGTA 3OPOA 1Q1BA 3BU2A 1HR0L 1H95A 1R9TH 3QIAA 1PA6A 3HOWH 2K5NA 5ELFA 4DAMA 2Q2TA 1OO9B 3NEMA 3AEVA 4JV5Q 5JAVA 4GKKL 2K4KA 2Q8IB 3ULLA 3S15B 1RF2D 4TKOB 1TWFH 4G57A 1K8OA 5IGFA 4DV1L 4DV7L 2CWAA 2B8GA 2HT1A 2TMPA 2PMZE 3M3YH 4JW0A 4DKAC 1PTOH 2EYFA 1ENCA 1YNJC 4OWXB 4O1NA 1SNOA 3TRZA 1VMCA 1NE3A 3A54A 5I2YA 1IL2A 4A3DG 3E9HA 2OXPA 1BR9A 3TS0A 3S2DB 1XNQQ 1SYCA 3RN2A 1HPCA 5C0XI 2QA4A 2LSSA 2N55A 1SLJA 1NUCA 4C1NK 3WWVA 1W2BA 5BN4A 3MVVA 3Q8DA 4CJ1B 3RZDB 3I7FA 4FXKC 5LL6S 1SFOH 1QUQB 1EL0A 3E3XA 1HJPA 5HURA 2L5TA 2B3GA 4YCUA 4C3IH 4N9PA 2R92B 3IRBA 5KYIA 3CRLC 1SJED 4DAPA 5E3FA 3D4RA 2Z4IA 3SVMA 4LF7L 4KY7A 4A93H 3GTLB 3I73A 4IFDG 3M85A 3FPUB 1KNEA 1D1IA 2Z6KA 1GUWA 3P75A 2EY6A 5IE8A 4YWMA 3FVQA 4KY5A 2O4XA 1MI2A 3L9AX 2LXKA 4JI8Q 4EQOA 1PV4A 4Q0FA 4BBSB 1XTCD 3PSIA 3S16H 4K8JA 3J81c 2XWJB 2M9VA 4AQYQ 3HOWG 4IUTA 1PFMA 4E6IA 4DR5L 1I3QB 4ALPA 4QGUA 2VY3A 2YU9B 2SOBA 3MXGA 4LF8Q 3CU7A 4DR1Q 4PMWA 1RCVD 1LTAD 2F0UA 1D2BA 4B3RL 3R3OA 3GD7A 1M4VA 1O78A 1LO5D 3RD4A 3QWNA 1ONLA 3DXJC 2EDGA 1S5ED 3A8KE 3VYTA 3DWPA 4IPGA 4OX9Q 3ULJA 2MGSA 3T53B 4HJAA 2FMCA 2RSNA 2QW7A 3MAQA 3DUZA 1V43A 2F4VL 1PRTD 4GNXC 1LTSD 1J8IA 1NSNS 3PIO3 3I4OA 1JMCA 1LLRD 2O5JC 1KXLA 5J39A 2F0GA 5IODA 4C3IG 1HNZQ 2F0IA 3V96A 3BYTB 1MGSA 3KF8A 4L6TB 4LW1A 1SNQA 2WB1E 4NDXA 5IGBA 2YYZA 3WOEA 4BWGB 4JI6Q 4KJOA 4IPHA 3T1HL 4PV1C 1DM0B 4ZCKA 4DXFA 2A1AA 3EVQA 1JOOA 2R3ZA 3A74A 4LF5Q 1CKNA 2DGYA 3T1YL 1NMGA 5A2QL 1VQLA 1T5XD 4U673 1HNWQ 1PFSA 2PW7A 2EYOA 4X65Q 1D7QA 3CKIB 2J4XA 4X3UA 2IHFA 5T1GA 3W3AA 1EIFA 2RSOA 1FNWA 4DAVA 2PNRC 1HR0W 1ESRA 3BJUA 3BVGA 4OWWB 5M3FH 1F2MA 1HQRD 1RTNA 2BOSA 4HSPA 3UDGA 4B3TQ 1LT3D 3PIOA 2RA4A 1I4QA 4U68A 4KD3A 1Y8OB 2A5HA 2N88A 3BZKA 4QB4A 4L63B 1HNXQ 3ULPA 3OMCA 1EY7A 3D4WA 1MSGA 5H1SE 2WB1G 1D5ZC 1S4ZA 1UNSA 3D4DA 2AHOB 5J1ZA 3TP7A 3CQZB 5JOBA 1E3PA 4ZYSA 1BQQT 4DV6Q 2DY8A 1G291 3EA6A 4P75A 3VYSA 3KF8B 1JJ2A 3LWUA 1JICA 5CV7A 1VQ7A 3I2ZA 4PQXA 2Z6BA 3RR5A 2N78A 2Z8LA 3HOWB 4WRDA 4XT3B 2MNAA 1AH9A 1PRTF 1ILQA 1S5CD 5AFWA 1JORA 4A3BG 3GV6A 3QG1A 1FVIA 1TS3A 1BBUA 1XTDA 4I7AA 3R2IA 4KKTA 4EX5A 1JC7A 4F7XA 3QR8A 1U9RA 1PTOB 4YWLA 1PMRA 4XTCS 1VQ9A 1LYLA 3HGBA 2NZHA 3I4MH 3RLOA 4DUYQ 4EQPA 1SSOA 3OIPA 1WTXA 1XNRQ 4A3EB 2EJFC 5IP7H 1GUTA 4IOCA 2OCEA 3TP8A 1STEA 1ET9A 5I2XA 4JVZA 1PH7A 2CW0D 1EIHA 4R4IA 4UPAA 1DGSA 4ZRZA 3GTKH 1TQOA 4HMIA 4I65A 1JCKB 1XWEA 1DYQA 2K7VA 4ZQ3A 1HA6A 2JEBI 3NQIA 1TWGB 1KIXA 2WFWA 1PZKD 1HFGA 1N33L 1ENFA 1XPOA 3KJPA 2K28A 4A93B 3AB9A 1BCPC 4H44C 2WKDA 5F2DA 2NYZD 5D3DA 1K8GA 2JN4A 1DD2A 3MEFA 1KL9A 3HFZB 1WTHA 1SMYD 4UP7A 4F8MA 3AMUA 5EPLA 4O42A 1GUNA 1SMXA 2AWNA 1IBMQ 2UUAL 2Y0SE 2UXBL 3M4OH 5LMUL 1SE4A 5ELDA 4UP8A 2OQ0A 5EGTA 3A56A 3A5UA 2KHSA 1WOCA 2H5XA 4LUOA 2ICEC 1AP0A 3GTOH 2HDLA 1SAPA 1B53A 2OEOA 4JYAQ 1ILPA 5FLMH 3I4MG 3NXWA 3VR4A 1A2TA 4BXXG 1O7LA 5EQ0A 1L1OC 5IYCG 3MXUA 3PUYA 5FO7B 1VQDA 4ULLA 2FFKB 2E2HH 2JA8G 1ET6A 1SJHD 4UHVA 3UDXA 3RN5A 1RL2A 3MWYW 2EYHA 1LT6D 2Z9HA 3M4PA 1IXRA 1EEFD 1VQ4A 1PZID 4DR4Q 3HP3A 2PQAA 1HHVA 1SYEA 3UI2A 5EKLA 3VA5A 3OTOQ 2C9OA 4EQNA 2VQEQ 2L15A 4MIUA 3NP8A 1U4MA 4H02A 1STYA 4DNIA 2Y0SG 2B29A 1KTKA 2IPKD 1EQRA 5C3WA 2OTLA 2AQ1B 1GHKA 2ZTCA 1TU2B 1XMQQ 4HJ5A 4A75A 4DV5Q 1S5BD 1DJRD 1L0YB 1Q81C 4DK6C 1JOKA 4A3FH 1JB3A 1STNA 2NZ1D 4RCNA 2AUJD 5FLXL 1FD7D 4HJ9A 1R4PB 1X3FA 5IT9L 3CCQA 4RA8A 3IL8A 1Q8IA 5M9OA 1FL0A 3VA7A 3DM3A 3A5ZB 4R4QA 4RAUC 5J3BA 1SE8A 3CAMA 1Z6HA 3MXPA 4BY7B 1XMOL 5IY0A 1L0WA 2XIWA 3D8GA 4A3LH 2K5WA 3D3RA 3DLLA 3FRPB 3KLRA 4FDBA 4X3TA 2ES2A 3I72A 4K0KQ 1EWCA 1EQVA 3CD6A 3FKIH 3E6ZX 5M3FB 4DK3C 2BA1A 4LF4L 5KIXA 4J6HA 3GTPB 5FLMG 1SE2A 4QCLA 4KTAA 2CQOA 5C44H 4HJ8A 1UE1A 2CH4A 4X66Q 2JP1A 1VQEA 2Q2HA 4AIMA 2WACA 2E74C 1HA5A 2EE1A 2Z6KC 2VUMH 1C9OA 1XPUA 1BUVT 4QIWE 2HD3A 1D6EC 3QOJA 4YY3Q 1Q90A 1SN8A 2Q8TA 3CCLA 4LFBQ 4CKCA 3ER0A 2QILA 4XT1B 4DV0Q 1C8CA 4DR6Q 1X55A 3SR1A 3M4YA 3P7JA 1FJGL 4NPSA 1C7YA 1GUGA 1OXTA 2D0OA 1X32A 3J81L 4JCVE 2IY5B 1TY2A 4MNOA 3VYUA 4UY8C 2B63B 4DXGA 4A3FG 2A69D 4K6DA 1K28A 4RG1A 3L0OA 1UE5A 1YNNC 2SEBD 1ZYRD 1IYJB 4CKBA 4GNXB 4MHEA 4XYOA 1YHBA 1E1TA 2NBFA 4K6LA 2PCFB 3S2HH 1Q1EA 3H6MA 3J81i 3GTKB 1WCMB 1WJJA 1QNKA 5CV9A 1CHPD 4M1UB 3J80L 5CV4A 4A3LG 1BNZA 2A68D 2EYLA 4GN5A 4A3IH 1NAPA 1DONA 1CKOA 1AFPA 2EYJA 1HR0Q 1AW7A 4GN4B 2VQFL 1SRUA 4DK1A 3J81j 3U9OA 1H9KA 2Q8RE 5C44G 3DMUA 3SK5A 2AQ2B 2XSCA 1AE2A 4RCOA 3U4VA 4DV1Q 4DV7Q 2VUMG 4X3KA 3HOUH 2UU9Q 4LJZC 5EPKA 2KOLA 2MUYA 1WTWA 2X6LA 1JJGA 2RDHA 5G3LD 2RDGA 1C0AA 2PYKA 4N9TA 4A3GB 4X64L 4DV2Q 3J80i 1N8RC 5FOBB 3M4OB 4DNTB 2HHHL 4EQ5A 1CZGA 3I56A 5C6AA 1JWMD 3K0XA 1PH6A 3HOVH 4IFDI 2D0PA 3HZXA 4GOPA 3PO3H 4KHPL 1QE6A 3MXNA 1WTRA 3GTOB 1IL8A 3LWEA 2MP1A 3I91A 3J7YW 4C2MH 3NE5B 4LK1C 1I50B 4KLKA 3CMAA 2JA7H 1EZ6A 1IKLA 2FMMA 2QEJC 3AQQA 1VQNA 1A3VA 2XN9C 2R7DA 2E2HB 1E1OA 3HEJA 5M5YB 2K03A 2EY5A 5AJ3Q 3I4LA 4GLVB 3ZJYC 3CRKC 2PI2E 5M5WH 1IYUA 1Y1VH 4HMJA 2XGTA 4CHTB 1YI2A 1MIUA 4A3IG 2F0OA 1HRJA 3G4SA 1YHQA 5CC4A 1HXYD 3NTHA 4A4IA 1N32L 4DR5Q 2K32A 2RCFA 4DV3Q 3A7LA 4MTKA 3NK9A 4DA2A 2WINB 2I5LX 4JI0Q 1VQBA 1VQJA 4JI1Q 2D2CC 5IGGA 1I6HH 1FYCA 3HOUG 1ML0D 4B3RQ 1YEZA 1CSPA 2P5ZX 4POFA 2CKZB 3D31A 5ELOA 4L5TA 3I4NB 3MXNB 5ELNA 2FXQA 2A19A 1IBLL 1CKMA 5TSSA 4QUFA 4TSSA 5NUCA 1TT2A 2MO0A 3HOVG
chains in the Genus database with same CATH topology
2NVYB 5LHY1 5C4JB 2F0HA 1BCPB 3A55A 5A35A 2KQ3A 3FKIB 2KCCA 3VR2A 4FNFA 5IIFA 5I9PA 2K04A 2IL8A 4FF1A 3PUXA 4OHJA 1SYGA 1G8ZD 2BCOA 4DAYA 2F0VA 2O2LD 4A3KB 1Z47A 5ELEA 1I4PA 3HS0C 4IN3A 3NPPA 3X3NA 3VR3A 1AZQA 1PRTC 1IW7D 4A3MB 2WIIB 4XDXA 5JEAJ 3EFXD 2SNMA 5C4HA 1EY0A 3SXHA 2F0LA 4KMUC 2PZUA 4CJ0B 3H3VC 2D5DA 1PYWD 4K5WA 2F0SA 1E2WA 1U4LA 2WAQB 2L4NA 2H1EA 4XIGS 3S2HB 5BN5A 4CGYB 2KUMA 4KN7C 4A3IB 1I4XA 2NTTA 4HTHA 4KJNA 1IHZA 2A6ED 4ABNA 2ZT9C 1CFMA 2NB0A 1EYDA 4J8QA 1G6ZA 1SNDA 2KEDA 2NVXB 4MN3A 5CBEE 2EYPA 2MHVA 3HOUB 2XRQD 1R4QB 1D1KA 2PO4A 2FHTA 4BY1B 1O80A 3PUWA 1CQVA 2RDFA 1U4RA 3EROA 3DM1A 3GTQB 3URYA 1TS4A 3E0JA 4RGTA 3C3LA 3MFYA 1Y8PB 4NKLA 2L9HA 1YNJD 1T5EA 2F0EA 1EU4A 4FO2A 3JAME 5LL6X 3S1RB 1H9SA 1RHPA 4C2MB 1JR0D 1F9QA 1EZ8A 3SK8A 2JA7B 1RJTA 5KNBA 4G4KA 2F03A 4A3DB 2BA0A 4IUUA 1ICWA 2B2YC 2CW0C 5M5WB 4OIJA 4QUCA 1Z7TA 4ZUJA 1SNPA 2Z4HA 3S1MB 5E4XA 1EWHA 4I7ZC 1O7ZA 1NR4A 1S5DD 4C3JG 2SNSA 5T1IA 1U4PA 4DN4M 3K5OA 4DGZA 1KDBA 1SMYC 5DNFA 2PMZB 1SNCA 4FF4A 2K6AA 1Y69U 1JOQA 1EEID 2QDBA 3U9SA 1F77A 3S16B 3M7GA 1R9TB 5ELCA 3A8IE 1QJOA 5KEEA 2VB3X 1CT1D 1TWFB 2FINB 4RWSC 3KBGA 1JWSD 1II3A 4IUVA 2AWOA 2EJMA 1AZPA 1EY5A 3M3YB 2E2DC 2IJ0A 3PO2B 3S9WA 1QB5D 4BS9A 1VMPA 2IT1A 2VNUD 1STGA 3L3OC 1RTOA 4RFBA 2VXWA 3I90A 3OHXC 1EY9A 5D65A 3FMCA 2AUKA 1GUOA 1SFOB 2EPBA 5JEAH 3HG9A 3R93A 4C3IB 2F0QA 3PIP3 4WFN3 2JSOA 4S3SA 2XRSD 1C48A 4P2CB 2F4IA 3T4AC 5JVG3 1NR2A 2F0FA 2LFNA 2MJ8A 1BOSA 3V05A 5ISRA 5CV8A 2F0MA 3T56B 4PMCA 1TWCB 5CMDA 4J1MA 1LT4D 3D6WA 1FNUA 1DXMA 3NHHA 4KKUA 4C3JB 3C1FA 4HEDA 1KAAA 2F0WA 4H0LC 4TQUS 3TP6A 4RGNA 2WB1B 5DM63 2L55A 4PNYA 2NTSA 4OGQC 1HUMA 4IZ8A 4DNRB 3OIQA 2IX3A 5JEAG 3HOXB 4A3BB 5EJWA 1XXGA 2KCNA 2R93B 3C46A 1NCVA 1SDFA 4KV6A 2B39A 1TWAB 1LTRD 4KI0A 1PRTB 3NQTA 3TZDA 4ZK9B 5KNCA 3QB3A 2ICIA 4JBWA 1TVXA 1OXVA 2HCIA 3BYYB 4XQJA 3QJYA 1STHA 2A68C 4OO1H 1TIID 5I4DA 1BCPD 1FGBD 4WJWA 2A6HD 2KA7A 2EZVA 1H9JA 1W6JA 1LV9A 4BA1I 1FNVA 3MFGA 1B44D 3W2DA 2CVRA 1GUSA 1BBXC 4UDUC 3MZ5A 2K01A 2PW5A 5CORA 3PMFA 3QOLA 3DEPA 3J7AV 2EVBA 2F3VA 1VCIA 2B2YA 3G7LA 1CHQD 2F0TA 1KDAA 5CV5A 3NWSA 1S5FD 3DWQA 1DZ1A 3GTGB 1CM9A 1F9RA 2QCPX 3GP7A 4G7HC 3I4MB 3OWFA 2LY7A 5ELBA 1QCBD 2B2TC 2TSSA 1IKMA 2IW3A 1G2TA 3I70A 5CV6A 2D9UA 4HCEA 2CHBD 2JA8B 4DK0A 3TN2A 1V1PA 3RMHA 3CHBD 1X3QA 4H13C 3PV0A 4HCSA 4OO1G 4GZYC 2JA5B 4ODGA 2EOTA 2Y0SB 4F87A 2M2LA 1KNAA 1PDQA 3PUVA 4B9XA 1C4QA 1MSHA 3K58A 3DEOA 5D14A 5JPMC 2HCCA 5KNDA 1B9MA 3P1HA 3VR6A 2NUCA 2F0JA 3R2TA 4FXGC 3BVZA 5DAUA 4RKBA 3S1NB 4L8JA 1TS5A 3SK6A 3NTIA 4KKSA 5C0XJ 2K1BA 1ENAA 2B8FA 3VR5A 2EXZA 1PZJD 4WORA 4NMZA 4UAIA 1ZKOA 4ZKBB 1DCZA 1BDOA 3GQBA 1TR5A 1V1PB 2KECA 1HTPA 2FJ2A 3SE0A 1EFID 4HR7B 1A3TA 3A7AB 1SBBB 4FF3A 4HN7A 3S17B 3PUZA 1IW7C 5IGCA 5JJZA 1ZEQX 2XVSA 1TWHB 4CKEA 4IQZA 1RODA 3OWEB 1JWUD 2WP8J 1IYVA 1YNND 3X3MA 5E4WC 1A3UA 4ZKCB 4R8IA 1L0XB 2NN6H 3N52A 4A3FB 3K5NA 1CTMA 4QMGA 3NTKA 1EQTA 1BF4A 4PMBA 1O7YA 3OW7A 1J9OA 5G3LF 1V8QA 1EYAA 5IOCA 3TMEA 4NW2A 2MPMA 2J0TD 4QIWB 1RDPD 1LTBD 2R61A 4Y7NB 1KABA 1ESFA 2A6EC 2IX1A 4RHRA 1D5MC 2L1BA 1JE4A 4K5VA 3ND9A 2JEAI 2ID0A 5C44B 1PTOD 5M5XB 1TS2A 2L12A 3NUCA 1RD9D 3K6OA 2VUMB 4M8AA 1UUPA 3Q24A 2BE5D 4ZLTF 1MBYA 1QWYA 1GJXA 4K2LA 3JAML 3TBIB 5IGEA 2NWGA 5C4ZA 1SNMA 4HAEA 2I46A 4C56C 2J7ZA 5I9OA 1WTQA 2GA4B 3I3CA 1UEAB 2PZWA 4OIKA 2NN6G 4X3SA 4IALA 3M7NA 2B2UC 2AQ3B 5J22A 1X3PA 2LMCB 1EU3A 2HDMA 2D62A 5EBDA 2K33A 1KLUD 3O13A 5BN3A 3WDNA 4K2KA 3C2PA 1A15A 2F3WA 1GXDC 4IUNA 1SEBD 1WVLA 1PXUA 4ZUIA 4A3JB 2CQAA 3IFTA 1CI3M 2IX0A 1PTOF 5I6YA 1MD2D 3VYRA 2B2TA 3R8BA 3L7ZC 2OF1A 3Q22A 3RZOB 1EY8A 1CK1A 1AEXA 4KN4C 1WD0A 2C5CA 5C0XH 3H91A 1H9MA 1B3AA 3HOVB 3Q6SA 3IKJA 4KHZA 4KD4A 3PO3B 5C4XB 3BZDB 3LX0A 3T16A 4RH6A 5C3EB 1CQFA 4XQNA 1LTTD 4XXEA 2SDFA 1GOZA 4OL7A 1VDZA 3EQLC 3T13A 4DF7A 3J7AF 1HUNA 2BDOA 4FVMA 2E2JB 3KLSX 2B2VC 2X69A 2EY1A 2E75C 1Y1VB 1G91A 2ZXRA 1LT5D 3TDQA 2G9DA 4XQQA 1LTID 2PPBC 1DOKA 1SYFA 1STAA 3QO2A 5KRUA 4TRDA 4G7OC 5C5MA 5COYA 1I6HB 3HRZC 1FR3A 1ZXTA 5EPJA 3MTSA 1K8MA 3TP5A 1SXTA 1QNUA 1KDCA 3FDTA 1OXXK 3H94A 5C0XG 5CGKA 1H9SB 1HTLD 2L0CA 3ZYYX 3DHQA 2WKCA 3GV3A 3OSOA 2DN8A 3SHLA 5DEHA 2JXMB 4R8NA 1EOTA 2B2WC 4KHVA 1M8AA 3S1QB 3ITPA 2EJGC 4ILWA 3BDOA 1W6KA 1QILA 2JYOA 4R9WA 1WTPA 4FYDA 2ENBA 4C3HG 1Q3LA 4K14A 1F2ZA 1V1OA 3DWAA 4RGMA 2V4DA 3GTJB 4XYQA 1B4OA 3RLFA 1F2YA 3H09A 1XX8A 2K5DA 5K36H 4Q5VA 1LABA 1E0BA 1GHJA 3N6RA 5JVH3 2F0PA 2XWBB 2DNEA 4EVOA 2HUGA 1AN8A 3G6JB 5A2QE 1EIGA 2QF7A 3NBIA 2E76C 2WV6D 1F2LA 3KBXA 3BVMA 2DNCA 1Q12A 2A6HC 3RUZA 4LMQD 2H4OA 4IUQA 2B2UA 2LS01 4Z9CB 3H0GB 4OO1I 5IGDA 3FEWX 3ONAB 3I8ZA 1F9SA 1WTVA 2NVTB 2RQXA 4IURA 4AYBB 2EY2A 4KK7A 1B50A 3K59A 5FO9B 4C1NI 1RKNA 4YIJA 2JE6I 5E1FA 3MA2B 3MHBA 2I07B 3K57A 3KK7A 5K36G 1EYCA 2DY7A 2M00A 5K5PA 2A69C 1QOHA 4ME5A 3BDLA 1E2ZA 3ERQA 2G9HD 4B08A 2F0NA 4RHSA 1K83B 1ZYRC 1LTGD 1KLGD 2KJXA 3E5SA 2ZXPA 5CYUA 4QF4A 3NBHA 3MC0B 2OT2A 1BO0A 4EGVA 3HOZB 4C3HB 2PQEA 2F0KA 3K7AB 4KY6A 1Y1WB 4IFDJ 3BS1A 3K0YA 4JK1C 5CBAE 5C3XA 4H7BA 1EY4A 2X6GA 1OXUA 1PFBA 1SYBA 2KVMA 1Y8NB 2KEEA 1E2VA 3HOYB 3ND8A 2B2VA 5EKIA 1HFNA 3NSWA 1H9RA 3IFDA 4CJ2C 4DU9A 3MEHA 2JA6B 3TSSA 3Q23A 2PZTA 3AU7A 2K05A 2RVLA 1B2TA 5D3IB 5M3MB 1SE3A 3LNNA 5FO8B 4K5XA 2BDNA 3HKZB 1JQYD 4IUPA 2IWHA 2A73B 2HQEA 1I4HA 4ZAIA 3GO5A 5DM73 3T51B 3V2TA 3KUPA 2L11A 3SDZA 2ZXOA 2XNAC 1PLFA 4B9WA 1G2SA 3P20A 5KGUA 4CBVA 4RGOS 3SK4A 4FXDA 2RBMA 1BCPF 1A2UA 1B9NA 1SYDA 1CZWA 1TY0A 1UAPA 1HCZA 1QG7A 1STBA 4BBRB 3KLSA 2O5IC 1EY6A 5FLXE 2VB2X 3BG3A 4RKLA 3S14B 2B2WA 5IT9E 3IAYA 4NP5A 3TZUA 1D5XC 3EJIA 2Z1CA 5FKAC 2R6GA 2NN6I 1VF5C 3Q0AA 2LKVA 1I4RA 5EBCA 4FP5D 5JPNC 2NVQB 1OXSC 1HQMC 5EKKA 3OOCA 4BA2I 3NWTA 2K5QA 1PTOC 4HSVA 1BXTA 5C5LA 4LAAA 2RKSA 2BE5C 3K5LA 3K5MA 3SEBA 1DOLA 4DFAA 5I6WA 1TKWB 4K8IA 4F88A 4G7ZC 3OMGA 3GTMB 3C1EA 2R7ZB 2QKIC 3J81E 3WOFA 1WTOA 4V190 3D6CA 3FPPA 2A74C 1CA6A 1B1ZA 1XYIA 1PFNA 5FK9C 5CR3A 2EYMA 5KYLA 3BDCA 1A6XA 1CA5A 1DOMA 2F0DA 4V0BA 1I6VC 3J80E 1VF7A 4IFDH 4ID6A 4FF2A 1WD1A 2E2IB 1F9PA 3F2UA 3A8JE 2F1MA 1LACA 1I4GA 5HGTA 3OPOA 1Q1BA 3QIAA 5ELFA 1OO9B 5JAVA 2Q8IB 3S15B 1RF2D 4TKOB 4G57A 1K8OA 5IGFA 2B8GA 2TMPA 1PTOH 2EYFA 1ENCA 1YNJC 4O1NA 1SNOA 1VMCA 3A54A 5I2YA 2OXPA 1BR9A 3S2DB 1SYCA 1HPCA 5C0XI 2N55A 1NUCA 4C1NK 5BN4A 3MVVA 4CJ1B 3RZDB 4FXKC 5LL6S 1EL0A 5HURA 2L5TA 4N9PA 2R92B 5KYIA 3CRLC 1SJED 4DAPA 5E3FA 3D4RA 2Z4IA 3SVMA 4KY7A 3GTLB 3I73A 4IFDG 3M85A 3FPUB 1KNEA 1D1IA 1GUWA 3P75A 2EY6A 3FVQA 4KY5A 2O4XA 1MI2A 3L9AX 4EQOA 4Q0FA 4BBSB 1XTCD 4K8JA 2XWJB 2M9VA 4IUTA 1PFMA 4E6IA 1I3QB 2YU9B 2SOBA 3MXGA 3CU7A 4PMWA 1RCVD 1LTAD 2F0UA 1D2BA 3R3OA 3GD7A 1M4VA 1O78A 1LO5D 3RD4A 1ONLA 3QWNA 3DXJC 2EDGA 1S5ED 3A8KE 3VYTA 3DWPA 2MGSA 3T53B 2FMCA 2RSNA 3MAQA 3DUZA 1V43A 1PRTD 1J8IA 1LTSD 1NSNS 3PIO3 1LLRD 2O5JC 5J39A 2F0GA 5IODA 4C3IG 2F0IA 3V96A 3BYTB 1MGSA 3KF8A 4L6TB 1SNQA 4NDXA 5IGBA 2YYZA 3WOEA 4BWGB 4KJOA 4PV1C 1DM0B 4DXFA 3EVQA 1JOOA 2R3ZA 5A2QL 1T5XD 4U673 2PW7A 2EYOA 3CKIB 2J4XA 4X3UA 5T1GA 3W3AA 2RSOA 1FNWA 4DAVA 2PNRC 1ESRA 3BVGA 1F2MA 1HQRD 1RTNA 2BOSA 4HSPA 1LT3D 2RA4A 1I4QA 4U68A 4KD3A 1Y8OB 2A5HA 2N88A 4QB4A 4L63B 3OMCA 1EY7A 3D4WA 1MSGA 1D5ZC 1S4ZA 1UNSA 3D4DA 5J1ZA 3TP7A 3CQZB 5JOBA 4ZYSA 1BQQT 2DY8A 1G291 3EA6A 3VYSA 3LWUA 1JICA 5CV7A 4PQXA 2Z8LA 3HOWB 4WRDA 4XT3B 1PRTF 1ILQA 1S5CD 5AFWA 1JORA 3GV6A 3QG1A 1TS3A 3R2IA 4KKTA 1JC7A 4F7XA 1U9RA 1PTOB 1PMRA 4XTCS 3HGBA 4EQPA 1SSOA 3OIPA 1WTXA 4A3EB 2EJFC 1GUTA 3TP8A 1STEA 1ET9A 5I2XA 2CW0D 1EIHA 4ZRZA 1TQOA 4HMIA 4I65A 1JCKB 1XWEA 1DYQA 2K7VA 4ZQ3A 1HA6A 2JEBI 3NQIA 1TWGB 1PZKD 1HFGA 1ENFA 2K28A 4A93B 3AB9A 1BCPC 4H44C 2WKDA 5F2DA 2NYZD 5D3DA 1DD2A 1SMYD 4F8MA 3AMUA 5EPLA 4O42A 1GUNA 2AWNA 1SE4A 5ELDA 5EGTA 3A56A 2KHSA 2ICEC 1AP0A 2HDLA 1SAPA 1B53A 2OEOA 1ILPA 3NXWA 3VR4A 1A2TA 1O7LA 5EQ0A 3MXUA 3PUYA 5FO7B 4ULLA 2FFKB 1ET6A 1SJHD 3MWYW 2EYHA 1LT6D 1EEFD 1PZID 1HHVA 3HP3A 1SYEA 3UI2A 5EKLA 3VA5A 2C9OA 4EQNA 4MIUA 3NP8A 1U4MA 1STYA 1KTKA 2IPKD 5C3WA 2AQ1B 1GHKA 1TU2B 1S5BD 1DJRD 1L0YB 1JOKA 1JB3A 1STNA 2NZ1D 4RCNA 2AUJD 5FLXL 1FD7D 1R4PB 5IT9L 4RA8A 3IL8A 1Q8IA 5M9OA 3VA7A 4RAUC 1Z6HA 3MXPA 4BY7B 2XIWA 3D8GA 2K5WA 3D3RA 3FRPB 3KLRA 4X3TA 3I72A 1EWCA 1EQVA 3E6ZX 5M3FB 2BA1A 5KIXA 4J6HA 3GTPB 1SE2A 4QCLA 4KTAA 2JP1A 2WACA 2E74C 1HA5A 2EE1A 1BUVT 1D6EC 3QOJA 1Q90A 2Q8TA 4CKCA 4XT1B 2QILA 1C8CA 3SR1A 3M4YA 3P7JA 1GUGA 1OXTA 1X32A 3J81L 1TY2A 3VYUA 2B63B 4DXGA 2A69D 4K6DA 1YNNC 2SEBD 1ZYRD 4CKBA 4MHEA 4XYOA 2NBFA 4K6LA 2PCFB 1Q1EA 3H6MA 3GTKB 1WCMB 1QNKA 5CV9A 1CHPD 4M1UB 3J80L 5CV4A 1BNZA 2A68D 2EYLA 1NAPA 1DONA 1AFPA 2EYJA 1AW7A 4DK1A 3U9OA 1H9KA 2Q8RE 3DMUA 3SK5A 2AQ2B 2XSCA 4RCOA 4X3KA 4LJZC 5EPKA 2KOLA 2MUYA 1WTWA 2X6LA 2RDHA 5G3LD 2RDGA 2PYKA 4N9TA 4A3GB 5FOBB 3M4OB 4DNTB 1CZGA 5C6AA 1JWMD 4IFDI 3HZXA 1QE6A 3MXNA 1WTRA 3GTOB 1IL8A 3LWEA 2MP1A 3I91A 3J7YW 3NE5B 4LK1C 1I50B 1EZ6A 1IKLA 2FMMA 2QEJC 1A3VA 2XN9C 2E2HB 3HEJA 5M5YB 2K03A 2EY5A 3I4LA 3CRKC 1IYUA 4HMJA 4CHTB 2F0OA 1HRJA 5CC4A 1HXYD 3NTHA 2K32A 3A7LA 3NK9A 4DA2A 2WINB 2D2CC 5IGGA 1FYCA 1ML0D 3D31A 3I4NB 5TSSA 4QUFA 4TSSA 5NUCA 1TT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQO A;  4NDX A;  3MEH A;  4IUN A;  4DU9 A;  3U9O A;  1EY5 A;  5IGB A;  4HMI A;  2F0H A;  4I65 A;  5CV6 A;  1SYC A;  4ZQ3 A;  3DMU A;  2RDF A;  3SK5 A;  1KDC A;  4KJO A;  2PZT A;  4DFA A;  1NUC A;  3ERO A;  5I6W A;  2KQ3 A;  4ZUI A;  3MVV A;  3S9W A;  3MXP A;  4K8I A;  5CGK A;  4QMG A;  3EVQ A;  5IGD A;  1STG A;  5I9P A;  1JOO A;  5IIF A;  4PMB A;  3DHQ A;  3D8G A;  2PYK A;  3OMG A;  4N9T A;  1SYG A;  3C1E A;  4NKL A;  2F0V A;  1EY9 A;  4ODG A;  5F2D A;  4KV6 A;  5HUR A;  1EQV A;  2F0E A;  4K5X A;  1EYA A;  5I6Y A;  2PW7 A;  2EYO A;  4N9P A;  5IOC A;  3TME A;  3OSO A;  5C6A A;  5KYI A;  3NQT A;  4B9X A;  5E3F A;  4F8M A;  2HQE A;  5KIX A;  4J6H A;  2OF1 A;  3SHL A;  1KAB A;  3D6C A;  3HZX A;  1EZ8 A;  3QB3 A;  4KTA A;  5DEH A;  2EY2 A;  4KY7 A;  1EY8 A;  3SK8 A;  4R8N A;  3V2T A;  1AEX A;  2F0Q A;  2WAC A;  3P1H A;  1RKN A;  4YIJ A;  2NUC A;  4KHV A;  5E1F A;  2F0J A;  3P75 A;  2EY6 A;  4K5V A;  4B9W A;  1F2M A;  3ITP A;  3MHB A;  5EGT A;  5KYL A;  3QOJ A;  1STH A;  4KY5 A;  5DAU A;  2O4X A;  5KGU A;  1EYC A;  2M00 A;  2EYM A;  4RKB A;  5CR3 A;  4KD4 A;  3SK4 A;  5K5P A;  3BDC A;  4ME5 A;  2KHS A;  4KD3 A;  2RBM A;  2SNM A;  3BDL A;  3ERQ A;  1EY0 A;  4QB4 A;  3SXH A;  4EQO A;  5C4H A;  3SK6 A;  1A2U A;  1EZ6 A;  2F0L A;  1SYD A;  2F0N A;  3NUC A;  4K8J A;  3LX0 A;  3OMC A;  1EY7 A;  3D4W A;  4S3S A;  3T16 A;  1A3V A;  4E6I A;  2F0D A;  2PZU A;  1ENA A;  2ENB A;  2OEO A;  3D4D A;  4ZUJ A;  5J1Z A;  3TP7 A;  3SR1 A;  1STB A;  3E5S A;  5JOB A;  4K14 A;  1SNP A;  1F2Z A;  2EXZ A;  1EY6 A;  2SOB A;  3HEJ A;  2EY5 A;  3NXW A;  1A2T A;  3MZ5 A;  2F0F A;  4QF4 A;  4RKL A;  4K5W A;  4OL7 A;  2F0S A;  4WOR A;  4K2L A;  2PW5 A;  4NMZ A;  5CV7 A;  5IGE A;  2F0U A;  3T13 A;  4DF7 A;  4ID6 A;  4HMJ A;  4WRD A;  5ISR A;  2F3W A;  3PMF A;  3QOL A;  3R3O A;  4NP5 A;  5CV8 A;  1F2Y A;  2F3V A;  1SNM A;  5C4Z A;  2F0O A;  2PQE A;  2F0K A;  3EJI A;  2SNS A;  4K6D A;  4KY6 A;  1JOR A;  5CC4 A;  5HGT A;  2F0M A;  1TR5 A;  2EYH A;  4PMC A;  4DGZ A;  1KDB A;  2EY1 A;  5I9O A;  2F0T A;  4J1M A;  2LKV A;  1KDA A;  5CV5 A;  5C3X A;  1SYE A;  2PZW A;  2F0P A;  3NK9 A;  4H7B A;  5EKL A;  3VA5 A;  4F7X A;  1U9R A;  1A3T A;  1SNC A;  4EQN A;  5JAV A;  3NHH A;  1EY4 A;  4EVO A;  4MIU A;  3NP8 A;  5IGG A;  1JOQ A;  4HTH A;  4KJN A;  4IAL A;  1IHZ A;  1STY A;  3C1F A;  5J22 A;  4EQP A;  1KAA A;  2F0W A;  4G57 A;  1SYF A;  1SYB A;  2QDB A;  3H6M A;  3TP6 A;  5C3W A;  1STA A;  5IGF A;  5EKK A;  5KRU A;  4TRD A;  5IGC A;  4PNY A;  1NSN S;  5CV9 A;  5KEE A;  1EYD A;  5CV4 A;  1SND A;  5C5M A;  3TP8 A;  2EYL A;  1JOK A;  2EYF A;  1ENC A;  2EYP A;  2F0G A;  3OWF A;  1STN A;  5IOD A;  5J39 A;  4IZ8 A;  1SNO A;  5C5L A;  2F0I A;  2EYJ A;  1II3 A;  4K2K A;  4LAA A;  5NUC A;  2RKS A;  3RUZ A;  1TT2 A;  1A3U A;  1SNQ A;  5M9O A;  2OXP A;  3TP5 A; 
#chains in the Genus database with same CATH topology
 2NVY B;  5LHY 1;  5C4J B;  3TS2 A;  1VQP A;  2F0H A;  3PO3 G;  1BCP B;  5C4X G;  3A55 A;  2MO1 A;  5A35 A;  1K8A C;  2KQ3 A;  3FKI B;  2Q2U A;  2KCC A;  3VR2 A;  2BH2 A;  1ICF B;  4FNF A;  5IIF A;  5I9P A;  5C3E G;  4APV A;  2K04 A;  2IL8 A;  4FF1 A;  3PUX A;  4OHJ A;  1SYG A;  4WJ4 A;  1G8Z D;  2BCO A;  4DAY A;  2F0V A;  2O2L D;  4A3K B;  2JA7 G;  3U4Z A;  1Z47 A;  4P73 A;  3PO2 H;  5ELE A;  1N36 L;  1I4P A;  3HS0 C;  4DV4 L;  4IN3 A;  1YBY A;  3NPP A;  4RMF A;  3X3N A;  1T9H A;  4DR7 L;  3VR3 A;  1Y1V G;  1AZQ A;  3CCV A;  1PRT C;  1IW7 D;  4A3M B;  2WII B;  5DLQ E;  4XDX A;  5JEA J;  1L1O B;  3EFX D;  2SNM A;  5C4H A;  1EY0 A;  3SXH A;  2F0L A;  2KHI A;  4KMU C;  4YCW A;  2PZU A;  4CJ0 B;  3H3V C;  3K81 C;  2UXD L;  2D5D A;  1PYW D;  4K5W A;  2F0S A;  1E2W A;  1U4L A;  2VL6 A;  2IHE A;  2WAQ B;  2L4N A;  2H1E A;  4XIG S;  3G71 A;  2YV5 A;  3S2H B;  5BN5 A;  4CGY B;  2KUM A;  4LF9 L;  4KN7 C;  2V1C C;  4A3I B;  1I4X A;  2NTT A;  4IOA A;  1I94 L;  2JA9 A;  4HTH A;  4KJN A;  1IHZ A;  2A6E D;  4O2D A;  3STB D;  4YHH L;  4B3M L;  4B3S L;  4ABN A;  1TWC H;  2ZT9 C;  1CFM A;  2NB0 A;  1EYD A;  4J8Q A;  3K7U C;  1G6Z A;  1SND A;  2KED A;  2NVX B;  4MN3 A;  5CBE E;  4C3J H;  2EYP A;  4JI4 L;  2MHV A;  3PO2 G;  3HOU B;  2XRQ D;  1R4Q B;  1Q46 A;  1S3O A;  1D1K A;  2OQK A;  2PO4 A;  2GVB A;  2FHT A;  4BY1 B;  1O80 A;  3PUW A;  1CQV A;  2RDF A;  2VS1 A;  1U4R A;  2NVT H;  3ERO A;  3DM1 A;  3L2P A;  3GTQ B;  1TXY A;  3URY A;  1TS4 A;  3E0J A;  4RGT A;  1G6P A;  3C3L A;  3MFY A;  1Y8P B;  4NKL A;  2L9H A;  1X9N A;  3ERS X;  1YNJ D;  3HOX H;  1T5E A;  2F0E A;  1EU4 A;  4FO2 A;  4A3B H;  1WYD A;  3JAM E;  5LL6 X;  3S1R B;  1H9S A;  1RHP A;  1YIJ A;  4C2M B;  4JC0 A;  2R93 H;  1JR0 D;  1HZA A;  1F9Q A;  1EZ8 A;  3SK8 A;  1N9W A;  2JA7 B;  1RJT A;  1NMF A;  4AYB E;  5KNB A;  1K83 H;  1TWA H;  1N33 Q;  4G4K A;  3FHW A;  2F03 A;  4A3D B;  2BA0 A;  2YTV A;  4IUU A;  1VQ5 A;  1ICW A;  2B2Y C;  1YJW A;  2CW0 C;  5M5W B;  4OIJ A;  4QUC A;  1Q7Y C;  1Z7T A;  2F3I A;  3H3V H;  4ZUJ A;  5EAY A;  3K7A H;  1SNP A;  3TEH B;  5JJK A;  2Z4H A;  3S1M B;  2UXB Q;  5E4X A;  1EWH A;  5LMU Q;  4I7Z C;  1O7Z A;  1N34 L;  1O7I A;  1NR4 A;  1S5D D;  2KCT A;  4C3J G;  2SNS A;  5T1I A;  1U4P A;  4DN4 M;  3K5O A;  1A8V A;  4DGZ A;  1KDB A;  3U50 C;  3CC4 A;  1SMY C;  5GRO A;  5DNF A;  1EWI A;  2PMZ B;  1SNC A;  4FF4 A;  2K6A A;  4OXP A;  1Y69 U;  1JOQ A;  1K3B C;  3GDE A;  3NEN A;  3HOY H;  1EEI D;  3B6Y A;  2QDB A;  3U9S A;  1F77 A;  3S16 B;  3M7G A;  1R9T B;  5ELC A;  3A8I E;  1QJO A;  5KEE A;  2JA6 H;  4OEM B;  3HOX G;  4GKJ Q;  2CFM A;  4JI8 L;  3EIV A;  3GTG H;  2VB3 X;  1CT1 D;  1TWF B;  2FIN B;  4RWS C;  3KBG A;  1JWS D;  1II3 A;  4IUV A;  2AWO A;  2EJM A;  1CKN B;  1AZP A;  2R93 G;  1EY5 A;  3M3Y B;  4J15 A;  2E2D C;  1J6Q A;  2IJ0 A;  3PO2 B;  4BXX H;  3S9W A;  1QB5 D;  4BS9 A;  5IYC H;  1VMP A;  2IT1 A;  2VNU D;  1STG A;  1HH2 P;  3ICE A;  3L3O C;  1RTO A;  1P8L A;  4RFB A;  2VXW A;  3I90 A;  3OHX C;  4OEL B;  1EY9 A;  3CCM A;  3PF5 A;  1XPR A;  4X6A H;  2JA8 H;  4JI2 L;  5D65 A;  4DUZ L;  3FMC A;  2AUK A;  1GUO A;  3KFU A;  4GOP C;  1SFO B;  2EPB A;  2JA5 H;  5JEA H;  3HG9 A;  1WI5 A;  3R93 A;  1IBK Q;  4C3I B;  2F0Q A;  3HKZ E;  3PIP 3;  1AE3 A;  5IP9 H;  3PF4 A;  4WFN 3;  2JSO A;  4S3S A;  2XRS D;  1C48 A;  3JAM c;  4P2C B;  2F4I A;  3T4A C;  5JVG 3;  1NR2 A;  3HOY G;  4JI6 L;  2QEX A;  1LTL A;  3S1N H;  2F0F A;  2LFN A;  1YIT A;  2MJ8 A;  1BOS A;  1K0S A;  3V05 A;  5ISR A;  5CV8 A;  2JA6 G;  2HQL A;  3RLN A;  2ALY B;  2F0M A;  3KJO A;  3T56 B;  4PMC A;  1TWC B;  5CMD A;  5M3M G;  4J1M A;  1PHJ A;  1LT4 D;  3D6W A;  1FJG Q;  1FNU A;  1DXM A;  3NHH A;  4KKU A;  1Q86 C;  4C3J B;  3D0F A;  3C1F A;  4JI3 L;  4HED A;  1KAA A;  2F0W A;  1NJI C;  1KD1 C;  4H0L C;  4TQU S;  3TP6 A;  3PIP A;  1A0I A;  3F2B A;  4RGN A;  1JJC B;  2WB1 B;  5DM6 3;  2L55 A;  4PNY A;  2NTS A;  4LFA L;  4OGQ C;  1HUM A;  2MQH A;  4IZ8 A;  4DNR B;  2NZO A;  2DUD A;  2RCN A;  2ZTE A;  1YJ9 A;  3S17 H;  4IPD A;  4LFC Q;  3OIQ A;  3E9I A;  2JA5 G;  1TWH H;  3GTM H;  2IX3 A;  2UUC L;  5JEA G;  3HOX B;  4DV6 L;  4A3B B;  1Q8K A;  5EJW A;  1XXG A;  3JC6 6;  4R4O A;  5IP9 G;  2KCN A;  2R93 B;  3C46 A;  1NCV A;  4BBR G;  1SDF A;  4HIK A;  1KAW A;  4KV6 A;  2B39 A;  2N3S A;  1TWA B;  1LTR D;  4KI0 A;  1PRT B;  3NQT A;  3TZD A;  2CH4 W;  4POG A;  4ZK9 B;  5KNC A;  2DJF C;  3QB3 A;  1M1K C;  2ICI A;  4JBW A;  4DUY L;  1TVX A;  1OXV A;  2HCI A;  3BYY B;  1KRT A;  1PH1 A;  1GO3 E;  3OYY A;  1NY4 A;  4XQJ A;  4X64 Q;  3QJY A;  1STH A;  2VZA A;  2A68 C;  4Y7N H;  1TII D;  4OO1 H;  5I4D A;  1BCP D;  1FGB D;  4WJW A;  2HHH Q;  2RHQ B;  1YZ6 A;  2A6H D;  2KA7 A;  1YJN A;  2EZV A;  1CUK A;  4TVA B;  3CCR A;  2E2I H;  1H9J A;  1W6J A;  1LV9 A;  4PZ8 A;  4BA1 I;  1FNV A;  3MFG A;  1B44 D;  3W2D A;  2CVR A;  1K73 C;  1GUS A;  1BBX C;  4UDU C;  3MZ5 A;  2K01 A;  4QY7 A;  5M5X H;  2PW5 A;  2PQA B;  5COR A;  3E0E A;  3QOL A;  3PMF A;  1YHA A;  1MHW C;  3DEP A;  2EVB A;  3J7A V;  2F3V A;  4GN3 B;  1VCI A;  2B2Y A;  1EQQ A;  3G7L A;  4JI5 L;  1CHQ D;  1V9P A;  2F0T A;  1KDA A;  5CV5 A;  4OWT B;  3NWS A;  1S5F D;  3DWQ A;  3CCJ A;  1HZC A;  1DZ1 A;  2K50 A;  3GTG B;  1CM9 A;  4QL5 A;  2HIV A;  1J5E L;  1IBM L;  3KLW A;  3M4Q A;  2OWO A;  4HIO A;  2G5D A;  1F9R A;  2QCP X;  1PH3 A;  3GP7 A;  2ZJR A;  3S2D H;  4G7H C;  5IYD G;  3CXC A;  3I4M B;  3OWF A;  2LY7 A;  5ELB A;  1QCB D;  4HIM A;  4JI7 Q;  2B2T C;  2TSS A;  1IKM A;  3RZD H;  2E5L Q;  1X54 A;  4R1J A;  2IW3 A;  1G2T A;  3I70 A;  5CV6 A;  5BR8 L;  2D9U A;  4HCE A;  2CHB D;  1VQO A;  2JA8 B;  4DK0 A;  3TN2 A;  4DR3 Q;  4LF6 L;  2R92 H;  4PZ6 A;  4WJ3 M;  1V1P A;  3RMH A;  3CHB D;  1X3Q A;  4H13 C;  3PV0 A;  4HCS A;  4OO1 G;  1JB7 A;  4GZY C;  2JA5 B;  1IBL Q;  4ODG A;  2EOT A;  2Y0S B;  4F87 A;  2M2L A;  1KNA A;  1PDQ A;  3PUV A;  4B9X A;  4DR4 L;  4A3J H;  1C4Q A;  4CDD C;  1MSH A;  3LGJ A;  4P72 A;  4GKK Q;  3K58 A;  3DEO A;  3OTO L;  5D14 A;  5JPM C;  2HCC A;  2VQE L;  1QVC A;  4JBJ A;  5KND A;  1B9M A;  4IJH A;  3P1H A;  3VR6 A;  2NUC A;  2F0J A;  3R2T A;  1I3Q H;  2ZTD A;  4FXG C;  3F8T A;  3BVZ A;  5DAU A;  4L5R C;  4RKB A;  3S1N B;  3RZO H;  4L8J A;  4PZ7 A;  5IYB H;  1UWV A;  1TS5 A;  3SK6 A;  3NTI A;  4KKS A;  5C0X J;  3W5O A;  1N36 Q;  2K1B A;  1ENA A;  2B8F A;  4DV4 Q;  1BVS A;  3VR5 A;  1KHI A;  2EXZ A;  2F52 A;  4DR7 Q;  1PZJ D;  3G6E A;  4NB3 A;  4WOR A;  2YTY A;  1JE5 A;  4NMZ A;  5C4X H;  4UAI A;  3UDF A;  2UUB L;  1ZKO A;  5C3E H;  1MJC A;  4ZKB B;  1DCZ A;  1BDO A;  3GQB A;  1TR5 A;  1V1P B;  2KEC A;  1HTP A;  3TRE A;  2FJ2 A;  4R4T A;  3CCS A;  3SE0 A;  1EFI D;  2UXD Q;  4HR7 B;  1FGU A;  1QZG A;  1A3T A;  4LF7 Q;  3A7A B;  1SBB B;  1QVF A;  1VQC A;  4FF3 A;  2E2J H;  5GAE C;  1RIP A;  1UEB A;  4HN7 A;  2R92 G;  3S17 B;  3PUZ A;  4NXM L;  4GLA C;  3CME A;  5IWA L;  4JOI C;  1IW7 C;  3F1Z A;  5IGC A;  5JJZ A;  1ZEQ X;  1Y14 B;  2XVS A;  1TWH B;  2K52 A;  4CKE A;  4IQZ A;  1ROD A;  3OWE B;  1JWU D;  2WP8 J;  4LFB L;  1IYV A;  1SRO A;  1YNN D;  3X3M A;  5E4W C;  4DV0 L;  4A3J G;  1A3U A;  4ZKC B;  4R8I A;  1L0X B;  2NN6 H;  3N52 A;  3PGZ A;  4GS3 A;  4A3F B;  1VQM A;  4BBS G;  4YHH Q;  4MZ9 A;  4B3M Q;  4B3S Q;  3K5N A;  4HJ7 A;  1CTM A;  5GAD C;  1A62 A;  4QMG A;  2OTJ A;  3M9B A;  3NTK A;  1EQT A;  1BF4 A;  4PMB A;  4GOP B;  1O7Y A;  3OW7 A;  1J9O A;  5G3L F;  4JI4 Q;  1V8Q A;  4JG2 A;  5IYB G;  1VS0 A;  1EYA A;  1MKH A;  5IOC A;  1B8A A;  3TME A;  4NW2 A;  2CWP A;  2MPM A;  2J0T D;  4QIW B;  1RDP D;  1LTB D;  2R61 A;  4Y7N B;  1KAB A;  1ESF A;  4O0A A;  1PH5 A;  2A6E C;  2IX1 A;  3STB C;  4RHR A;  1D5M C;  5GAH C;  2L1B A;  2F4V Q;  1JE4 A;  4K5V A;  3ND9 A;  2JEA I;  2ID0 A;  3CQZ H;  5C44 B;  1PTO D;  5M5X B;  1ASZ A;  1TS2 A;  2L12 A;  4YCV A;  3NUC A;  1RD9 D;  3K6O A;  1EFW A;  2VUM B;  4M8A A;  1UUP A;  3Q24 A;  2BE5 D;  4ZLT F;  3NEL A;  3S1Q H;  1X6O A;  1MBY A;  1QZH A;  2ASB A;  1QWY A;  3T1H Q;  5FLX c;  1GJX A;  4K2L A;  3W1G A;  3CC2 A;  3JAM L;  3TBI B;  5IGE A;  3F2D A;  2NWG A;  5IT9 c;  2UU9 L;  4NXN L;  4X62 L;  1VQ8 A;  2N49 A;  5C4Z A;  1SNM A;  4Y52 H;  2ZM6 L;  5FJ8 G;  3A0J A;  3T1Y Q;  4HAE A;  2I46 A;  4DV2 L;  4C56 C;  2J7Z A;  2K14 A;  2KBN A;  2I0Q A;  5I9O A;  1WTQ A;  1E24 A;  2GA4 B;  3I3C A;  1UEA B;  3SGI A;  2PZW A;  3GTJ H;  4OIK A;  2NN6 G;  3CPF A;  4A3E H;  4X3S A;  4UP9 A;  1PYS B;  4IAL A;  3M7N A;  2B2U C;  2AQ3 B;  5J22 A;  1X3P A;  1N34 Q;  2LMC B;  1EU3 A;  2HDM A;  3F2C A;  2D62 A;  5EBD A;  1CSQ A;  3JAM i;  2Z0S A;  2PI2 A;  2K33 A;  2UXC L;  4IPC A;  1KLU D;  2K5H A;  3O13 A;  5BN3 A;  2EIF A;  4ME3 A;  3WDN A;  2ZJP A;  1K9M C;  1TWG H;  3K80 C;  4N8X 1;  1VQA A;  2Q2I A;  4K2K A;  5LMN L;  3C2P A;  3AFP A;  1A15 A;  2F3W A;  1GXD C;  4IUN A;  4DAY B;  1U0L A;  1SEB D;  1WVL A;  5AJ3 L;  1PXU A;  4ZUI A;  3H15 A;  4A3J B;  2CQA A;  4DR2 L;  3IFT A;  1CI3 M;  1A63 A;  2IX0 A;  3H3V I;  1PTO F;  5I6Y A;  1G51 A;  4DV3 L;  3H0G H;  1MD2 D;  3VYR A;  2B2T A;  3R8B A;  3L7Z C;  2OF1 A;  4JI0 L;  3Q22 A;  4JI1 L;  3RZO B;  4PG3 A;  1EY8 A;  4P74 A;  1CK1 A;  1AEX A;  1PH2 A;  4KN4 C;  1WD0 A;  2C5C A;  5C0X H;  3H91 A;  1H9M A;  3PCO B;  1B3A A;  3HOV B;  4JPB W;  3Q6S A;  3IKJ A;  4KHZ A;  1GM5 A;  4KD4 A;  3PO3 B;  4JI2 Q;  5C4X B;  4R4C A;  4LWC A;  4DUZ Q;  3BZD B;  3LX0 A;  3T16 A;  3J7Z C;  4A3E G;  4RH6 A;  1L2F A;  2JK8 A;  5C3E B;  1CQF A;  4XQN A;  3CF5 A;  5GAG C;  3J80 c;  1LTT D;  4JV5 L;  3PQI A;  4XXE A;  2SDF A;  1GOZ A;  4OL7 A;  1BKB A;  1VDZ A;  3EQL C;  1GD7 A;  3T13 A;  4DF7 A;  3J7A F;  1HUN A;  2BDO A;  4FVM A;  1UE7 A;  1B3Q A;  2E2J B;  3KLS X;  1Q82 C;  3VDY A;  2B2V C;  2X69 A;  2EY1 A;  2E75 C;  1YVC A;  1Y1V B;  1G91 A;  2ZXR A;  2QGQ A;  1LT5 D;  3TDQ A;  3HOZ H;  4A93 G;  2R7F A;  4C3H H;  2G9D A;  4XQQ A;  1XNQ L;  1LTI D;  2UUA Q;  3EBE A;  2PPB C;  1DOK A;  1Y1W H;  1SYF A;  1STA A;  3QO2 A;  5KRU A;  4TRD A;  4G7O C;  2EQS A;  3CCU A;  5C5M A;  5COY A;  4IJL A;  1I6H B;  3HRZ C;  1FR3 A;  1ZXT A;  4OON A;  5EPJ A;  3H0G G;  3MTS A;  4BY7 H;  1K8M A;  3TP5 A;  1EYG A;  1SXT A;  1PH9 A;  4JI3 Q;  1QNU A;  1IZ6 A;  3UE0 A;  1KDC A;  3FDT A;  1OXX K;  4AH6 A;  1VQH A;  3H94 A;  5C0X G;  1V1Q A;  5CGK A;  1H9S B;  1HTL D;  2L0C A;  3ZYY X;  4AYB G;  2PNH A;  3G48 A;  4MTN A;  4LFA Q;  4JOI A;  3DHQ A;  3GTP H;  2WKC A;  3KYH C;  3GV3 A;  3OSO A;  1NBW A;  5M3M H;  4AQY L;  1UE6 A;  3KF6 A;  2UUC Q;  2DN8 A;  3UDI A;  3SHL A;  2RF4 A;  5DEH A;  4P71 A;  2JXM B;  4R8N A;  1EOT A;  4LF8 L;  4DR1 L;  2B2W C;  3RNU A;  4KHV A;  1BBW A;  1M8A A;  3S1Q B;  3ITP A;  2EJG C;  4ILW A;  3BDO A;  1W6K A;  1QIL A;  2JYO A;  4R9W A;  1WTP A;  1EOV A;  4FYD A;  3HOZ G;  2ENB A;  1GVP A;  4C3H G;  2B63 H;  1Q3L A;  3FP9 A;  4K14 A;  1F2Z A;  2BH8 A;  1V1O A;  3DWA A;  4RGM A;  1Y1W G;  4OX9 L;  5LMN W;  2V4D A;  1E22 A;  1XMO Q;  3GTJ B;  4XYQ A;  1B4O A;  3RLF A;  1F2Y A;  4HID A;  3H09 A;  3KDF A;  1XX8 A;  2K5D A;  5K36 H;  4BBR H;  3U58 A;  4Q5V A;  2I5M X;  1M90 C;  1LAB A;  2EXD A;  1E0B A;  1GHJ A;  1HNZ L;  4BY7 G;  4LF4 Q;  3S14 H;  3N6R A;  1VQI A;  1WCM H;  5JVH 3;  2CCZ A;  2F0P A;  2XWB B;  2DNE A;  4EVO A;  2HUG A;  4QJF A;  1AN8 A;  3G6J B;  5A2Q E;  1EIG A;  2QF7 A;  3NBI A;  5M3F G;  3KF6 B;  2E76 C;  2WV6 D;  1F2L A;  3AYH B;  3KBX A;  3BVM A;  2DNC A;  1Q12 A;  4LF5 L;  4JI5 Q;  2NVQ H;  1B7Y B;  2A6H C;  2GVA A;  1HNW L;  4LMQ D;  3RUZ A;  2H4O A;  1X3G A;  2KHJ A;  4X65 L;  4IUQ A;  1D8L A;  4A3G H;  4IO9 A;  1J5E Q;  4JBK A;  2B2U A;  4JBM A;  3HKZ G;  2LS0 1;  4Z9C B;  3H0G B;  4OO1 I;  3EN2 A;  5IGD A;  3S24 A;  3FEW X;  1I5F A;  3ONA B;  3I8Z A;  4B3T L;  1F9S A;  1WTV A;  2NVT B;  3UE1 A;  2RQX A;  1HNX L;  4IUR A;  4AYB B;  1KQS A;  3KDF B;  5BR8 Q;  2B63 G;  1EIY B;  2EY2 A;  1P16 A;  4KK7 A;  1I50 H;  1B50 A;  4LF6 Q;  2R7Z H;  3K59 A;  5FO9 B;  4C1N I;  1PVO A;  1RKN A;  4YIJ A;  2JE6 I;  5E1F A;  5IP7 G;  1VQK A;  3MA2 B;  3MHB A;  2I07 B;  5E7N A;  3K57 A;  3KK7 A;  5K36 G;  1EYC A;  2DY7 A;  2M00 A;  5K5P A;  2A69 C;  1QOH A;  5M5Y H;  1EUJ A;  4ME5 A;  4GKJ L;  3BDL A;  1E2Z A;  3ERQ A;  5IYD H;  4LNQ A;  1B70 B;  2G9H D;  4B08 A;  2F0N A;  4RHS A;  1WCM G;  1K83 B;  1NNX A;  1ZYR C;  2VQF Q;  1LTG D;  4A76 A;  1KLG D;  2KJX A;  1S40 A;  1KC8 C;  2AKW B;  3E5S A;  5JJI A;  1K0R A;  2YTX A;  1JT8 A;  1X56 A;  2ZXP A;  5CYU A;  4QF4 A;  3NBH A;  3MC0 B;  2OT2 A;  1BO0 A;  3CW2 C;  1E7Z A;  4EGV A;  1XNR L;  3HOZ B;  4C3H B;  2PQE A;  2F0K A;  3K7A B;  4KY6 A;  1Y1W B;  1YNX A;  4IFD J;  3BS1 A;  3K0Y A;  4JK1 C;  5CBA E;  4QQB X;  1SR3 A;  1NTG A;  5C3X A;  2VW9 A;  4H7B A;  4A3G G;  1EY4 A;  2X6G A;  5HGQ A;  1OXU A;  3I4N H;  4KHP Q;  1PFB A;  1IBK L;  1HZ9 A;  1SYB A;  2K5V A;  2KVM A;  3OW2 A;  1PH4 A;  2UUB Q;  1HZB A;  2NVY H;  4GNX A;  4LUV A;  5C4J H;  1Y8N B;  2KEE A;  1E2V A;  3HOY B;  3ND8 A;  4N8F A;  3S15 H;  2B2V A;  5EKI A;  1HFN A;  3NSW A;  1H9R A;  3IFD A;  4A3C H;  4CJ2 C;  4DU9 A;  3MEH A;  2KEN A;  2JA6 B;  3TSS A;  3Q23 A;  4A3K H;  2PZT A;  2R7Z G;  4NXM Q;  3AU7 A;  5L37 A;  2K05 A;  2RVL A;  1X3E A;  2N8N A;  5IWA Q;  1B2T A;  5D3I B;  5M3M B;  1KRS A;  1W3S A;  1SE3 A;  2MFI A;  3LNN A;  3NBH B;  3KOJ A;  5FO8 B;  4K5X A;  1N32 Q;  2RHS B;  2BDN A;  3HKZ B;  1JQY D;  4IUP A;  2IWH A;  3K8A A;  2GN5 A;  2A73 B;  2HQE A;  4DPG A;  1I4H A;  4A3M H;  4ZAI A;  4JYA L;  3GO5 A;  5DM7 3;  3T51 B;  1LM0 A;  4YWK A;  3V2T A;  3KUP A;  2L11 A;  3SDZ A;  2ZXO A;  5HY6 A;  2XNA C;  4L5S A;  1PLF A;  4B9W A;  2DJG C;  3CPW A;  1G2S A;  3P20 A;  5KGU A;  4CBV A;  2K75 A;  4RGO S;  3SK4 A;  1PH8 A;  4CDE C;  4FXD A;  2RBM A;  1BCP F;  3GTL H;  4CDF C;  1A2U A;  1B9N A;  1SYD A;  1MJE A;  1LUZ A;  1CZW A;  1TY0 A;  1UAP A;  1HCZ A;  4LFC L;  1QG7 A;  2JJQ A;  1STB A;  4BBR B;  3KLS A;  2KCM A;  2O5I C;  1EY6 A;  3I4N G;  5FLX E;  2VB2 X;  3BG3 A;  2ZJQ A;  1K3R A;  4RKL A;  4BBS H;  3S14 B;  2B2W A;  2XTI A;  5IT9 E;  3IAY A;  2A8V A;  1XMQ L;  4NP5 A;  3TZU A;  1D5X C;  3AFQ A;  3EJI A;  2Z1C A;  4DV5 L;  5FKA C;  2YU9 H;  2R6G A;  3FKI G;  1Z9F A;  2NN6 I;  2WAQ E;  1VF5 C;  3Q0A A;  1S72 A;  4A3C G;  2LKV A;  1I4R A;  2E8G A;  1VQG A;  5EBC A;  2NVX H;  4A3K G;  4FP5 D;  1PYB A;  5JPN C;  2NVQ B;  1OTC A;  1OXS C;  1HQM C;  4NXN Q;  4X62 Q;  5EKK A;  3OOC A;  4CDC C;  3CCE A;  4BA2 I;  3HKS A;  3NWT A;  2ZM6 Q;  4BY1 H;  3CP0 A;  2K5Q A;  1PTO C;  4HSV A;  1QVG A;  1XJV A;  1BXT A;  5C5L A;  3GTQ H;  2C35 B;  4K0K L;  1X65 A;  1WFQ A;  4LAA A;  2RKS A;  2BE5 C;  4L5Q A;  3K5L A;  3CC7 A;  4A3M G;  3J7A 5;  3K5M A;  3SEB A;  1ASY A;  1DOL A;  5JJL A;  4DFA A;  1VQF A;  5I6W A;  1TKW B;  4X66 L;  4K8I A;  4LUZ A;  3S1R H;  4F88 A;  2UXC Q;  4G7Z C;  3OMG A;  3GTM B;  3C1E A;  3TQY A;  3W1B A;  4YY3 L;  2R7Z B;  5FJ8 H;  2QKI C;  3J81 E;  5LMN Q;  2WAQ G;  3WOF A;  1GKH A;  4LF9 Q;  2I5H A;  4GLX A;  4DR6 L;  1WTO A;  4A3D H;  2LXJ A;  4V19 0;  3D6C A;  1I94 Q;  3FPP A;  2A74 C;  1CA6 A;  1B1Z A;  4DR2 Q;  2AMC B;  1XYI A;  3I55 A;  1PFN A;  3BZC A;  5FK9 C;  5CR3 A;  2EYM A;  2QDL A;  5KYL A;  3BDC A;  3S1M H;  1A6X A;  1CA5 A;  1DOM A;  4JI7 L;  2F0D A;  4V0B A;  2E5L L;  1I6V C;  3J80 E;  1L1O A;  1VF7 A;  4IFD H;  1QUQ A;  4DR3 L;  1VQ6 A;  2HIX A;  4ID6 A;  5GQO A;  2JQO A;  1WD1 A;  4FF2 A;  2E2I B;  4BY1 G;  1F9P A;  1U5K A;  3F2U A;  3A8J E;  2F1M A;  2ATW A;  1LAC A;  1I4G A;  5HGT A;  3OPO A;  1Q1B A;  3BU2 A;  1HR0 L;  1H95 A;  1R9T H;  3QIA A;  1PA6 A;  3HOW H;  2K5N A;  5ELF A;  4DAM A;  2Q2T A;  1OO9 B;  3NEM A;  3AEV A;  4JV5 Q;  5JAV A;  4GKK L;  2K4K A;  2Q8I B;  3ULL A;  3S15 B;  1RF2 D;  4TKO B;  1TWF H;  4G57 A;  1K8O A;  5IGF A;  4DV1 L;  4DV7 L;  2CWA A;  2B8G A;  2HT1 A;  2TMP A;  2PMZ E;  3M3Y H;  4JW0 A;  4DKA C;  1PTO H;  2EYF A;  1ENC A;  1YNJ C;  4OWX B;  4O1N A;  1SNO A;  3TRZ A;  1VMC A;  1NE3 A;  3A54 A;  5I2Y A;  1IL2 A;  4A3D G;  3E9H A;  2OXP A;  1BR9 A;  3TS0 A;  3S2D B;  1XNQ Q;  1SYC A;  3RN2 A;  1HPC A;  5C0X I;  2QA4 A;  2LSS A;  2N55 A;  1SLJ A;  1NUC A;  4C1N K;  3WWV A;  1W2B A;  5BN4 A;  3MVV A;  3Q8D A;  4CJ1 B;  3RZD B;  3I7F A;  4FXK C;  5LL6 S;  1SFO H;  1QUQ B;  1EL0 A;  3E3X A;  1HJP A;  5HUR A;  2L5T A;  2B3G A;  4YCU A;  4C3I H;  4N9P A;  2R92 B;  3IRB A;  5KYI A;  3CRL C;  1SJE D;  4DAP A;  5E3F A;  3D4R A;  2Z4I A;  3SVM A;  4LF7 L;  4KY7 A;  4A93 H;  3GTL B;  3I73 A;  4IFD G;  3M85 A;  3FPU B;  1KNE A;  1D1I A;  2Z6K A;  1GUW A;  3P75 A;  2EY6 A;  5IE8 A;  4YWM A;  3FVQ A;  4KY5 A;  2O4X A;  1MI2 A;  3L9A X;  2LXK A;  4JI8 Q;  4EQO A;  1PV4 A;  4Q0F A;  4BBS B;  1XTC D;  3PSI A;  3S16 H;  4K8J A;  3J81 c;  2XWJ B;  2M9V A;  4AQY Q;  3HOW G;  4IUT A;  1PFM A;  4E6I A;  4DR5 L;  1I3Q B;  4ALP A;  4QGU A;  2VY3 A;  2YU9 B;  2SOB A;  3MXG A;  4LF8 Q;  3CU7 A;  4DR1 Q;  4PMW A;  1RCV D;  1LTA D;  2F0U A;  1D2B A;  4B3R L;  3R3O A;  3GD7 A;  1M4V A;  1O78 A;  1LO5 D;  3RD4 A;  3QWN A;  1ONL A;  3DXJ C;  2EDG A;  1S5E D;  3A8K E;  3VYT A;  3DWP A;  4IPG A;  4OX9 Q;  3ULJ A;  2MGS A;  3T53 B;  4HJA A;  2FMC A;  2RSN A;  2QW7 A;  3MAQ A;  3DUZ A;  1V43 A;  2F4V L;  1PRT D;  4GNX C;  1LTS D;  1J8I A;  1NSN S;  3PIO 3;  3I4O A;  1JMC A;  1LLR D;  2O5J C;  1KXL A;  5J39 A;  2F0G A;  5IOD A;  4C3I G;  1HNZ Q;  2F0I A;  3V96 A;  3BYT B;  1MGS A;  3KF8 A;  4L6T B;  4LW1 A;  1SNQ A;  2WB1 E;  4NDX A;  5IGB A;  2YYZ A;  3WOE A;  4BWG B;  4JI6 Q;  4KJO A;  4IPH A;  3T1H L;  4PV1 C;  1DM0 B;  4ZCK A;  4DXF A;  2A1A A;  3EVQ A;  1JOO A;  2R3Z A;  3A74 A;  4LF5 Q;  1CKN A;  2DGY A;  3T1Y L;  1NMG A;  5A2Q L;  1VQL A;  1T5X D;  4U67 3;  1HNW Q;  1PFS A;  2PW7 A;  2EYO A;  4X65 Q;  1D7Q A;  3CKI B;  2J4X A;  4X3U A;  2IHF A;  5T1G A;  3W3A A;  1EIF A;  2RSO A;  1FNW A;  4DAV A;  2PNR C;  1HR0 W;  1ESR A;  3BJU A;  3BVG A;  4OWW B;  5M3F H;  1F2M A;  1HQR D;  1RTN A;  2BOS A;  4HSP A;  3UDG A;  4B3T Q;  1LT3 D;  3PIO A;  2RA4 A;  1I4Q A;  4U68 A;  4KD3 A;  1Y8O B;  2A5H A;  2N88 A;  3BZK A;  4QB4 A;  4L63 B;  1HNX Q;  3ULP A;  3OMC A;  1EY7 A;  3D4W A;  1MSG A;  5H1S E;  2WB1 G;  1D5Z C;  1S4Z A;  1UNS A;  3D4D A;  2AHO B;  5J1Z A;  3TP7 A;  3CQZ B;  5JOB A;  1E3P A;  4ZYS A;  1BQQ T;  4DV6 Q;  2DY8 A;  1G29 1;  3EA6 A;  4P75 A;  3VYS A;  3KF8 B;  1JJ2 A;  3LWU A;  1JIC A;  5CV7 A;  1VQ7 A;  3I2Z A;  4PQX A;  2Z6B A;  3RR5 A;  2N78 A;  2Z8L A;  3HOW B;  4WRD A;  4XT3 B;  2MNA A;  1AH9 A;  1PRT F;  1ILQ A;  1S5C D;  5AFW A;  1JOR A;  4A3B G;  3GV6 A;  3QG1 A;  1FVI A;  1TS3 A;  1BBU A;  1XTD A;  4I7A A;  3R2I A;  4KKT A;  4EX5 A;  1JC7 A;  4F7X A;  3QR8 A;  1U9R A;  1PTO B;  4YWL A;  1PMR A;  4XTC S;  1VQ9 A;  1LYL A;  3HGB A;  2NZH A;  3I4M H;  3RLO A;  4DUY Q;  4EQP A;  1SSO A;  3OIP A;  1WTX A;  1XNR Q;  4A3E B;  2EJF C;  5IP7 H;  1GUT A;  4IOC A;  2OCE A;  3TP8 A;  1STE A;  1ET9 A;  5I2X A;  4JVZ A;  1PH7 A;  2CW0 D;  1EIH A;  4R4I A;  4UPA A;  1DGS A;  4ZRZ A;  3GTK H;  1TQO A;  4HMI A;  4I65 A;  1JCK B;  1XWE A;  1DYQ A;  2K7V A;  4ZQ3 A;  1HA6 A;  2JEB I;  3NQI A;  1TWG B;  1KIX A;  2WFW A;  1PZK D;  1HFG A;  1N33 L;  1ENF A;  1XPO A;  3KJP A;  2K28 A;  4A93 B;  3AB9 A;  1BCP C;  4H44 C;  2WKD A;  5F2D A;  2NYZ D;  5D3D A;  1K8G A;  2JN4 A;  1DD2 A;  3MEF A;  1KL9 A;  3HFZ B;  1WTH A;  1SMY D;  4UP7 A;  4F8M A;  3AMU A;  5EPL A;  4O42 A;  1GUN A;  1SMX A;  2AWN A;  1IBM Q;  2UUA L;  2Y0S E;  2UXB L;  3M4O H;  5LMU L;  1SE4 A;  5ELD A;  4UP8 A;  2OQ0 A;  5EGT A;  3A56 A;  3A5U A;  2KHS A;  1WOC A;  2H5X A;  4LUO A;  2ICE C;  1AP0 A;  3GTO H;  2HDL A;  1SAP A;  1B53 A;  2OEO A;  4JYA Q;  1ILP A;  5FLM H;  3I4M G;  3NXW A;  3VR4 A;  1A2T A;  4BXX G;  1O7L A;  5EQ0 A;  1L1O C;  5IYC G;  3MXU A;  3PUY A;  5FO7 B;  1VQD A;  4ULL A;  2FFK B;  2E2H H;  2JA8 G;  1ET6 A;  1SJH D;  4UHV A;  3UDX A;  3RN5 A;  1RL2 A;  3MWY W;  2EYH A;  1LT6 D;  2Z9H A;  3M4P A;  1IXR A;  1EEF D;  1VQ4 A;  1PZI D;  4DR4 Q;  3HP3 A;  2PQA A;  1HHV A;  1SYE A;  3UI2 A;  5EKL A;  3VA5 A;  3OTO Q;  2C9O A;  4EQN A;  2VQE Q;  2L15 A;  4MIU A;  3NP8 A;  1U4M A;  4H02 A;  1STY A;  4DNI A;  2Y0S G;  2B29 A;  1KTK A;  2IPK D;  1EQR A;  5C3W A;  2OTL A;  2AQ1 B;  1GHK A;  2ZTC A;  1TU2 B;  1XMQ Q;  4HJ5 A;  4A75 A;  4DV5 Q;  1S5B D;  1DJR D;  1L0Y B;  1Q81 C;  4DK6 C;  1JOK A;  4A3F H;  1JB3 A;  1STN A;  2NZ1 D;  4RCN A;  2AUJ D;  5FLX L;  1FD7 D;  4HJ9 A;  1R4P B;  1X3F A;  5IT9 L;  3CCQ A;  4RA8 A;  3IL8 A;  1Q8I A;  5M9O A;  1FL0 A;  3VA7 A;  3DM3 A;  3A5Z B;  4R4Q A;  4RAU C;  5J3B A;  1SE8 A;  3CAM A;  1Z6H A;  3MXP A;  4BY7 B;  1XMO L;  5IY0 A;  1L0W A;  2XIW A;  3D8G A;  4A3L H;  2K5W A;  3D3R A;  3DLL A;  3FRP B;  3KLR A;  4FDB A;  4X3T A;  2ES2 A;  3I72 A;  4K0K Q;  1EWC A;  1EQV A;  3CD6 A;  3FKI H;  3E6Z X;  5M3F B;  4DK3 C;  2BA1 A;  4LF4 L;  5KIX A;  4J6H A;  3GTP B;  5FLM G;  1SE2 A;  4QCL A;  4KTA A;  2CQO A;  5C44 H;  4HJ8 A;  1UE1 A;  2CH4 A;  4X66 Q;  2JP1 A;  1VQE A;  2Q2H A;  4AIM A;  2WAC A;  2E74 C;  1HA5 A;  2EE1 A;  2Z6K C;  2VUM H;  1C9O A;  1XPU A;  1BUV T;  4QIW E;  2HD3 A;  1D6E C;  3QOJ A;  4YY3 Q;  1Q90 A;  1SN8 A;  2Q8T A;  3CCL A;  4LFB Q;  4CKC A;  3ER0 A;  2QIL A;  4XT1 B;  4DV0 Q;  1C8C A;  4DR6 Q;  1X55 A;  3SR1 A;  3M4Y A;  3P7J A;  1FJG L;  4NPS A;  1C7Y A;  1GUG A;  1OXT A;  2D0O A;  1X32 A;  3J81 L;  4JCV E;  2IY5 B;  1TY2 A;  4MNO A;  3VYU A;  4UY8 C;  2B63 B;  4DXG A;  4A3F G;  2A69 D;  4K6D A;  1K28 A;  4RG1 A;  3L0O A;  1UE5 A;  1YNN C;  2SEB D;  1ZYR D;  1IYJ B;  4CKB A;  4GNX B;  4MHE A;  4XYO A;  1YHB A;  1E1T A;  2NBF A;  4K6L A;  2PCF B;  3S2H H;  1Q1E A;  3H6M A;  3J81 i;  3GTK B;  1WCM B;  1WJJ A;  1QNK A;  5CV9 A;  1CHP D;  4M1U B;  3J80 L;  5CV4 A;  4A3L G;  1BNZ A;  2A68 D;  2EYL A;  4GN5 A;  4A3I H;  1NAP A;  1DON A;  1CKO A;  1AFP A;  2EYJ A;  1HR0 Q;  1AW7 A;  4GN4 B;  2VQF L;  1SRU A;  4DK1 A;  3J81 j;  3U9O A;  1H9K A;  2Q8R E;  5C44 G;  3DMU A;  3SK5 A;  2AQ2 B;  2XSC A;  1AE2 A;  4RCO A;  3U4V A;  4DV1 Q;  4DV7 Q;  2VUM G;  4X3K A;  3HOU H;  2UU9 Q;  4LJZ C;  5EPK A;  2KOL A;  2MUY A;  1WTW A;  2X6L A;  1JJG A;  2RDH A;  5G3L D;  2RDG A;  1C0A A;  2PYK A;  4N9T A;  4A3G B;  4X64 L;  4DV2 Q;  3J80 i;  1N8R C;  5FOB B;  3M4O B;  4DNT B;  2HHH L;  4EQ5 A;  1CZG A;  3I56 A;  5C6A A;  1JWM D;  3K0X A;  1PH6 A;  3HOV H;  4IFD I;  2D0P A;  3HZX A;  4GOP A;  3PO3 H;  4KHP L;  1QE6 A;  3MXN A;  1WTR A;  3GTO B;  1IL8 A;  3LWE A;  2MP1 A;  3I91 A;  3J7Y W;  4C2M H;  3NE5 B;  4LK1 C;  1I50 B;  4KLK A;  3CMA A;  2JA7 H;  1EZ6 A;  1IKL A;  2FMM A;  2QEJ C;  3AQQ A;  1VQN A;  1A3V A;  2XN9 C;  2R7D A;  2E2H B;  1E1O A;  3HEJ A;  5M5Y B;  2K03 A;  2EY5 A;  5AJ3 Q;  3I4L A;  4GLV B;  3ZJY C;  3CRK C;  2PI2 E;  5M5W H;  1IYU A;  1Y1V H;  4HMJ A;  2XGT A;  4CHT B;  1YI2 A;  1MIU A;  4A3I G;  2F0O A;  1HRJ A;  3G4S A;  1YHQ A;  5CC4 A;  1HXY D;  3NTH A;  4A4I A;  1N32 L;  4DR5 Q;  2K32 A;  2RCF A;  4DV3 Q;  3A7L A;  4MTK A;  3NK9 A;  4DA2 A;  2WIN B;  2I5L X;  4JI0 Q;  1VQB A;  1VQJ A;  4JI1 Q;  2D2C C;  5IGG A;  1I6H H;  1FYC A;  3HOU G;  1ML0 D;  4B3R Q;  1YEZ A;  1CSP A;  2P5Z X;  4POF A;  2CKZ B;  3D31 A;  5ELO A;  4L5T A;  3I4N B;  3MXN B;  5ELN A;  2FXQ A;  2A19 A;  1IBL L;  1CKM A;  5TSS A;  4QUF A;  4TSS A;  5NUC A;  1TT2 A;  2MO0 A;  3HOV G; 
#chains in the Genus database with same CATH homology
 2NVY B;  5LHY 1;  5C4J B;  2F0H A;  1BCP B;  3A55 A;  5A35 A;  2KQ3 A;  3FKI B;  2KCC A;  3VR2 A;  4FNF A;  5IIF A;  5I9P A;  2K04 A;  2IL8 A;  4FF1 A;  3PUX A;  4OHJ A;  1SYG A;  1G8Z D;  2BCO A;  4DAY A;  2F0V A;  2O2L D;  4A3K B;  1Z47 A;  5ELE A;  1I4P A;  3HS0 C;  4IN3 A;  3NPP A;  3X3N A;  3VR3 A;  1AZQ A;  1PRT C;  1IW7 D;  4A3M B;  2WII B;  4XDX A;  5JEA J;  3EFX D;  2SNM A;  5C4H A;  1EY0 A;  3SXH A;  2F0L A;  4KMU C;  2PZU A;  4CJ0 B;  3H3V C;  2D5D A;  1PYW D;  4K5W A;  2F0S A;  1E2W A;  1U4L A;  2WAQ B;  2L4N A;  2H1E A;  4XIG S;  3S2H B;  5BN5 A;  4CGY B;  2KUM A;  4KN7 C;  4A3I B;  1I4X A;  2NTT A;  4HTH A;  4KJN A;  1IHZ A;  2A6E D;  4ABN A;  2ZT9 C;  1CFM A;  2NB0 A;  1EYD A;  4J8Q A;  1G6Z A;  1SND A;  2KED A;  2NVX B;  4MN3 A;  5CBE E;  2EYP A;  2MHV A;  3HOU B;  2XRQ D;  1R4Q B;  1D1K A;  2PO4 A;  2FHT A;  4BY1 B;  1O80 A;  3PUW A;  1CQV A;  2RDF A;  1U4R A;  3ERO A;  3DM1 A;  3GTQ B;  3URY A;  1TS4 A;  3E0J A;  4RGT A;  3C3L A;  3MFY A;  1Y8P B;  4NKL A;  2L9H A;  1YNJ D;  1T5E A;  2F0E A;  1EU4 A;  4FO2 A;  3JAM E;  5LL6 X;  3S1R B;  1H9S A;  1RHP A;  4C2M B;  1JR0 D;  1F9Q A;  1EZ8 A;  3SK8 A;  2JA7 B;  1RJT A;  5KNB A;  4G4K A;  2F03 A;  4A3D B;  2BA0 A;  4IUU A;  1ICW A;  2B2Y C;  2CW0 C;  5M5W B;  4OIJ A;  4QUC A;  1Z7T A;  4ZUJ A;  1SNP A;  2Z4H A;  3S1M B;  5E4X A;  1EWH A;  4I7Z C;  1O7Z A;  1NR4 A;  1S5D D;  4C3J G;  2SNS A;  5T1I A;  1U4P A;  4DN4 M;  3K5O A;  4DGZ A;  1KDB A;  1SMY C;  5DNF A;  2PMZ B;  1SNC A;  4FF4 A;  2K6A A;  1Y69 U;  1JOQ A;  1EEI D;  2QDB A;  3U9S A;  1F77 A;  3S16 B;  3M7G A;  1R9T B;  5ELC A;  3A8I E;  1QJO A;  5KEE A;  2VB3 X;  1CT1 D;  1TWF B;  2FIN B;  4RWS C;  3KBG A;  1JWS D;  1II3 A;  4IUV A;  2AWO A;  2EJM A;  1AZP A;  1EY5 A;  3M3Y B;  2E2D C;  2IJ0 A;  3PO2 B;  3S9W A;  1QB5 D;  4BS9 A;  1VMP A;  2IT1 A;  2VNU D;  1STG A;  3L3O C;  1RTO A;  4RFB A;  2VXW A;  3I90 A;  3OHX C;  1EY9 A;  5D65 A;  3FMC A;  2AUK A;  1GUO A;  1SFO B;  2EPB A;  5JEA H;  3HG9 A;  3R93 A;  4C3I B;  2F0Q A;  3PIP 3;  4WFN 3;  2JSO A;  4S3S A;  2XRS D;  1C48 A;  4P2C B;  2F4I A;  3T4A C;  5JVG 3;  1NR2 A;  2F0F A;  2LFN A;  2MJ8 A;  1BOS A;  3V05 A;  5ISR A;  5CV8 A;  2F0M A;  3T56 B;  4PMC A;  1TWC B;  5CMD A;  4J1M A;  1LT4 D;  3D6W A;  1FNU A;  1DXM A;  3NHH A;  4KKU A;  4C3J B;  3C1F A;  4HED A;  1KAA A;  2F0W A;  4H0L C;  4TQU S;  3TP6 A;  4RGN A;  2WB1 B;  5DM6 3;  2L55 A;  4PNY A;  2NTS A;  4OGQ C;  1HUM A;  4IZ8 A;  4DNR B;  3OIQ A;  2IX3 A;  5JEA G;  3HOX B;  4A3B B;  5EJW A;  1XXG A;  2KCN A;  2R93 B;  3C46 A;  1NCV A;  1SDF A;  4KV6 A;  2B39 A;  1TWA B;  1LTR D;  4KI0 A;  1PRT B;  3NQT A;  3TZD A;  4ZK9 B;  5KNC A;  3QB3 A;  2ICI A;  4JBW A;  1TVX A;  1OXV A;  2HCI A;  3BYY B;  4XQJ A;  3QJY A;  1STH A;  2A68 C;  4OO1 H;  1TII D;  5I4D A;  1BCP D;  1FGB D;  4WJW A;  2A6H D;  2KA7 A;  2EZV A;  1H9J A;  1W6J A;  1LV9 A;  4BA1 I;  1FNV A;  3MFG A;  1B44 D;  3W2D A;  2CVR A;  1GUS A;  1BBX C;  4UDU C;  3MZ5 A;  2K01 A;  2PW5 A;  5COR A;  3PMF A;  3QOL A;  3DEP A;  3J7A V;  2EVB A;  2F3V A;  1VCI A;  2B2Y A;  3G7L A;  1CHQ D;  2F0T A;  1KDA A;  5CV5 A;  3NWS A;  1S5F D;  3DWQ A;  1DZ1 A;  3GTG B;  1CM9 A;  1F9R A;  2QCP X;  3GP7 A;  4G7H C;  3I4M B;  3OWF A;  2LY7 A;  5ELB A;  1QCB D;  2B2T C;  2TSS A;  1IKM A;  2IW3 A;  1G2T A;  3I70 A;  5CV6 A;  2D9U A;  4HCE A;  2CHB D;  2JA8 B;  4DK0 A;  3TN2 A;  1V1P A;  3RMH A;  3CHB D;  1X3Q A;  4H13 C;  3PV0 A;  4HCS A;  4OO1 G;  4GZY C;  2JA5 B;  4ODG A;  2EOT A;  2Y0S B;  4F87 A;  2M2L A;  1KNA A;  1PDQ A;  3PUV A;  4B9X A;  1C4Q A;  1MSH A;  3K58 A;  3DEO A;  5D14 A;  5JPM C;  2HCC A;  5KND A;  1B9M A;  3P1H A;  3VR6 A;  2NUC A;  2F0J A;  3R2T A;  4FXG C;  3BVZ A;  5DAU A;  4RKB A;  3S1N B;  4L8J A;  1TS5 A;  3SK6 A;  3NTI A;  4KKS A;  5C0X J;  2K1B A;  1ENA A;  2B8F A;  3VR5 A;  2EXZ A;  1PZJ D;  4WOR A;  4NMZ A;  4UAI A;  1ZKO A;  4ZKB B;  1DCZ A;  1BDO A;  3GQB A;  1TR5 A;  1V1P B;  2KEC A;  1HTP A;  2FJ2 A;  3SE0 A;  1EFI D;  4HR7 B;  1A3T A;  3A7A B;  1SBB B;  4FF3 A;  4HN7 A;  3S17 B;  3PUZ A;  1IW7 C;  5IGC A;  5JJZ A;  1ZEQ X;  2XVS A;  1TWH B;  4CKE A;  4IQZ A;  1ROD A;  3OWE B;  1JWU D;  2WP8 J;  1IYV A;  1YNN D;  3X3M A;  5E4W C;  1A3U A;  4ZKC B;  4R8I A;  1L0X B;  2NN6 H;  3N52 A;  4A3F B;  3K5N A;  1CTM A;  4QMG A;  3NTK A;  1EQT A;  1BF4 A;  4PMB A;  1O7Y A;  3OW7 A;  1J9O A;  5G3L F;  1V8Q A;  1EYA A;  5IOC A;  3TME A;  4NW2 A;  2MPM A;  2J0T D;  4QIW B;  1RDP D;  1LTB D;  2R61 A;  4Y7N B;  1KAB A;  1ESF A;  2A6E C;  2IX1 A;  4RHR A;  1D5M C;  2L1B A;  1JE4 A;  4K5V A;  3ND9 A;  2JEA I;  2ID0 A;  5C44 B;  1PTO D;  5M5X B;  1TS2 A;  2L12 A;  3NUC A;  1RD9 D;  3K6O A;  2VUM B;  4M8A A;  1UUP A;  3Q24 A;  2BE5 D;  4ZLT F;  1MBY A;  1QWY A;  1GJX A;  4K2L A;  3JAM L;  3TBI B;  5IGE A;  2NWG A;  5C4Z A;  1SNM A;  4HAE A;  2I46 A;  4C56 C;  2J7Z A;  5I9O A;  1WTQ A;  2GA4 B;  3I3C A;  1UEA B;  2PZW A;  4OIK A;  2NN6 G;  4X3S A;  4IAL A;  3M7N A;  2B2U C;  2AQ3 B;  5J22 A;  1X3P A;  2LMC B;  1EU3 A;  2HDM A;  2D62 A;  5EBD A;  2K33 A;  1KLU D;  3O13 A;  5BN3 A;  3WDN A;  4K2K A;  3C2P A;  1A15 A;  2F3W A;  1GXD C;  4IUN A;  1SEB D;  1WVL A;  1PXU A;  4ZUI A;  4A3J B;  2CQA A;  3IFT A;  1CI3 M;  2IX0 A;  1PTO F;  5I6Y A;  1MD2 D;  3VYR A;  2B2T A;  3R8B A;  3L7Z C;  2OF1 A;  3Q22 A;  3RZO B;  1EY8 A;  1CK1 A;  1AEX A;  4KN4 C;  1WD0 A;  2C5C A;  5C0X H;  3H91 A;  1H9M A;  1B3A A;  3HOV B;  3Q6S A;  3IKJ A;  4KHZ A;  4KD4 A;  3PO3 B;  5C4X B;  3BZD B;  3LX0 A;  3T16 A;  4RH6 A;  5C3E B;  1CQF A;  4XQN A;  1LTT D;  4XXE A;  2SDF A;  1GOZ A;  4OL7 A;  1VDZ A;  3EQL C;  3T13 A;  4DF7 A;  3J7A F;  1HUN A;  2BDO A;  4FVM A;  2E2J B;  3KLS X;  2B2V C;  2X69 A;  2EY1 A;  2E75 C;  1Y1V B;  1G91 A;  2ZXR A;  1LT5 D;  3TDQ A;  2G9D A;  4XQQ A;  1LTI D;  2PPB C;  1DOK A;  1SYF A;  1STA A;  3QO2 A;  5KRU A;  4TRD A;  4G7O C;  5C5M A;  5COY A;  1I6H B;  3HRZ C;  1FR3 A;  1ZXT A;  5EPJ A;  3MTS A;  1K8M A;  3TP5 A;  1SXT A;  1QNU A;  1KDC A;  3FDT A;  1OXX K;  3H94 A;  5C0X G;  5CGK A;  1H9S B;  1HTL D;  2L0C A;  3ZYY X;  3DHQ A;  2WKC A;  3GV3 A;  3OSO A;  2DN8 A;  3SHL A;  5DEH A;  2JXM B;  4R8N A;  1EOT A;  2B2W C;  4KHV A;  1M8A A;  3S1Q B;  3ITP A;  2EJG C;  4ILW A;  3BDO A;  1W6K A;  1QIL A;  2JYO A;  4R9W A;  1WTP A;  4FYD A;  2ENB A;  4C3H G;  1Q3L A;  4K14 A;  1F2Z A;  1V1O A;  3DWA A;  4RGM A;  2V4D A;  3GTJ B;  4XYQ A;  1B4O A;  3RLF A;  1F2Y A;  3H09 A;  1XX8 A;  2K5D A;  5K36 H;  4Q5V A;  1LAB A;  1E0B A;  1GHJ A;  3N6R A;  5JVH 3;  2F0P A;  2XWB B;  2DNE A;  4EVO A;  2HUG A;  1AN8 A;  3G6J B;  5A2Q E;  1EIG A;  2QF7 A;  3NBI A;  2E76 C;  2WV6 D;  1F2L A;  3KBX A;  3BVM A;  2DNC A;  1Q12 A;  2A6H C;  3RUZ A;  4LMQ D;  2H4O A;  4IUQ A;  2B2U A;  2LS0 1;  4Z9C B;  3H0G B;  4OO1 I;  5IGD A;  3FEW X;  3ONA B;  3I8Z A;  1F9S A;  1WTV A;  2NVT B;  2RQX A;  4IUR A;  4AYB B;  2EY2 A;  4KK7 A;  1B50 A;  3K59 A;  5FO9 B;  4C1N I;  1RKN A;  4YIJ A;  2JE6 I;  5E1F A;  3MA2 B;  3MHB A;  2I07 B;  3K57 A;  3KK7 A;  5K36 G;  1EYC A;  2DY7 A;  2M00 A;  5K5P A;  2A69 C;  1QOH A;  4ME5 A;  3BDL A;  1E2Z A;  3ERQ A;  2G9H D;  4B08 A;  2F0N A;  4RHS A;  1K83 B;  1ZYR C;  1LTG D;  1KLG D;  2KJX A;  3E5S A;  2ZXP A;  5CYU A;  4QF4 A;  3NBH A;  3MC0 B;  2OT2 A;  1BO0 A;  4EGV A;  3HOZ B;  4C3H B;  2PQE A;  2F0K A;  3K7A B;  4KY6 A;  1Y1W B;  4IFD J;  3BS1 A;  3K0Y A;  4JK1 C;  5CBA E;  5C3X A;  4H7B A;  1EY4 A;  2X6G A;  1OXU A;  1PFB A;  1SYB A;  2KVM A;  1Y8N B;  2KEE A;  1E2V A;  3HOY B;  3ND8 A;  2B2V A;  5EKI A;  1HFN A;  3NSW A;  1H9R A;  3IFD A;  4CJ2 C;  4DU9 A;  3MEH A;  2JA6 B;  3TSS A;  3Q23 A;  2PZT A;  3AU7 A;  2K05 A;  2RVL A;  1B2T A;  5D3I B;  5M3M B;  1SE3 A;  3LNN A;  5FO8 B;  4K5X A;  2BDN A;  3HKZ B;  1JQY D;  4IUP A;  2IWH A;  2A73 B;  2HQE A;  1I4H A;  4ZAI A;  3GO5 A;  5DM7 3;  3T51 B;  3V2T A;  3KUP A;  2L11 A;  3SDZ A;  2ZXO A;  2XNA C;  1PLF A;  4B9W A;  1G2S A;  3P20 A;  5KGU A;  4CBV A;  4RGO S;  3SK4 A;  4FXD A;  2RBM A;  1BCP F;  1A2U A;  1B9N A;  1SYD A;  1CZW A;  1TY0 A;  1UAP A;  1HCZ A;  1QG7 A;  1STB A;  4BBR B;  3KLS A;  2O5I C;  1EY6 A;  5FLX E;  2VB2 X;  3BG3 A;  4RKL A;  3S14 B;  2B2W A;  5IT9 E;  3IAY A;  4NP5 A;  3TZU A;  1D5X C;  3EJI A;  2Z1C A;  5FKA C;  2R6G A;  2NN6 I;  1VF5 C;  3Q0A A;  2LKV A;  1I4R A;  5EBC A;  4FP5 D;  5JPN C;  2NVQ B;  1OXS C;  1HQM C;  5EKK A;  3OOC A;  4BA2 I;  3NWT A;  2K5Q A;  1PTO C;  4HSV A;  1BXT A;  5C5L A;  4LAA A;  2RKS A;  2BE5 C;  3K5L A;  3K5M A;  3SEB A;  1DOL A;  4DFA A;  5I6W A;  1TKW B;  4K8I A;  4F88 A;  4G7Z C;  3OMG A;  3GTM B;  3C1E A;  2R7Z B;  2QKI C;  3J81 E;  3WOF A;  1WTO A;  4V19 0;  3D6C A;  3FPP A;  2A74 C;  1CA6 A;  1B1Z A;  1XYI A;  1PFN A;  5FK9 C;  5CR3 A;  2EYM A;  5KYL A;  3BDC A;  1A6X A;  1CA5 A;  1DOM A;  2F0D A;  4V0B A;  1I6V C;  3J80 E;  1VF7 A;  4IFD H;  4ID6 A;  4FF2 A;  1WD1 A;  2E2I B;  1F9P A;  3F2U A;  3A8J E;  2F1M A;  1LAC A;  1I4G A;  5HGT A;  3OPO A;  1Q1B A;  3QIA A;  5ELF A;  1OO9 B;  5JAV A;  2Q8I B;  3S15 B;  1RF2 D;  4TKO B;  4G57 A;  1K8O A;  5IGF A;  2B8G A;  2TMP A;  1PTO H;  2EYF A;  1ENC A;  1YNJ C;  4O1N A;  1SNO A;  1VMC A;  3A54 A;  5I2Y A;  2OXP A;  1BR9 A;  3S2D B;  1SYC A;  1HPC A;  5C0X I;  2N55 A;  1NUC A;  4C1N K;  5BN4 A;  3MVV A;  4CJ1 B;  3RZD B;  4FXK C;  5LL6 S;  1EL0 A;  5HUR A;  2L5T A;  4N9P A;  2R92 B;  5KYI A;  3CRL C;  1SJE D;  4DAP A;  5E3F A;  3D4R A;  2Z4I A;  3SVM A;  4KY7 A;  3GTL B;  3I73 A;  4IFD G;  3M85 A;  3FPU B;  1KNE A;  1D1I A;  1GUW A;  3P75 A;  2EY6 A;  3FVQ A;  4KY5 A;  2O4X A;  1MI2 A;  3L9A X;  4EQO A;  4Q0F A;  4BBS B;  1XTC D;  4K8J A;  2XWJ B;  2M9V A;  4IUT A;  1PFM A;  4E6I A;  1I3Q B;  2YU9 B;  2SOB A;  3MXG A;  3CU7 A;  4PMW A;  1RCV D;  1LTA D;  2F0U A;  1D2B A;  3R3O A;  3GD7 A;  1M4V A;  1O78 A;  1LO5 D;  3RD4 A;  1ONL A;  3QWN A;  3DXJ C;  2EDG A;  1S5E D;  3A8K E;  3VYT A;  3DWP A;  2MGS A;  3T53 B;  2FMC A;  2RSN A;  3MAQ A;  3DUZ A;  1V43 A;  1PRT D;  1J8I A;  1LTS D;  1NSN S;  3PIO 3;  1LLR D;  2O5J C;  5J39 A;  2F0G A;  5IOD A;  4C3I G;  2F0I A;  3V96 A;  3BYT B;  1MGS A;  3KF8 A;  4L6T B;  1SNQ A;  4NDX A;  5IGB A;  2YYZ A;  3WOE A;  4BWG B;  4KJO A;  4PV1 C;  1DM0 B;  4DXF A;  3EVQ A;  1JOO A;  2R3Z A;  5A2Q L;  1T5X D;  4U67 3;  2PW7 A;  2EYO A;  3CKI B;  2J4X A;  4X3U A;  5T1G A;  3W3A A;  2RSO A;  1FNW A;  4DAV A;  2PNR C;  1ESR A;  3BVG A;  1F2M A;  1HQR D;  1RTN A;  2BOS A;  4HSP A;  1LT3 D;  2RA4 A;  1I4Q A;  4U68 A;  4KD3 A;  1Y8O B;  2A5H A;  2N88 A;  4QB4 A;  4L63 B;  3OMC A;  1EY7 A;  3D4W A;  1MSG A;  1D5Z C;  1S4Z A;  1UNS A;  3D4D A;  5J1Z A;  3TP7 A;  3CQZ B;  5JOB A;  4ZYS A;  1BQQ T;  2DY8 A;  1G29 1;  3EA6 A;  3VYS A;  3LWU A;  1JIC A;  5CV7 A;  4PQX A;  2Z8L A;  3HOW B;  4WRD A;  4XT3 B;  1PRT F;  1ILQ A;  1S5C D;  5AFW A;  1JOR A;  3GV6 A;  3QG1 A;  1TS3 A;  3R2I A;  4KKT A;  1JC7 A;  4F7X A;  1U9R A;  1PTO B;  1PMR A;  4XTC S;  3HGB A;  4EQP A;  1SSO A;  3OIP A;  1WTX A;  4A3E B;  2EJF C;  1GUT A;  3TP8 A;  1STE A;  1ET9 A;  5I2X A;  2CW0 D;  1EIH A;  4ZRZ A;  1TQO A;  4HMI A;  4I65 A;  1JCK B;  1XWE A;  1DYQ A;  2K7V A;  4ZQ3 A;  1HA6 A;  2JEB I;  3NQI A;  1TWG B;  1PZK D;  1HFG A;  1ENF A;  2K28 A;  4A93 B;  3AB9 A;  1BCP C;  4H44 C;  2WKD A;  5F2D A;  2NYZ D;  5D3D A;  1DD2 A;  1SMY D;  4F8M A;  3AMU A;  5EPL A;  4O42 A;  1GUN A;  2AWN A;  1SE4 A;  5ELD A;  5EGT A;  3A56 A;  2KHS A;  2ICE C;  1AP0 A;  2HDL A;  1SAP A;  1B53 A;  2OEO A;  1ILP A;  3NXW A;  3VR4 A;  1A2T A;  1O7L A;  5EQ0 A;  3MXU A;  3PUY A;  5FO7 B;  4ULL A;  2FFK B;  1ET6 A;  1SJH D;  3MWY W;  2EYH A;  1LT6 D;  1EEF D;  1PZI D;  1HHV A;  3HP3 A;  1SYE A;  3UI2 A;  5EKL A;  3VA5 A;  2C9O A;  4EQN A;  4MIU A;  3NP8 A;  1U4M A;  1STY A;  1KTK A;  2IPK D;  5C3W A;  2AQ1 B;  1GHK A;  1TU2 B;  1S5B D;  1DJR D;  1L0Y B;  1JOK A;  1JB3 A;  1STN A;  2NZ1 D;  4RCN A;  2AUJ D;  5FLX L;  1FD7 D;  1R4P B;  5IT9 L;  4RA8 A;  3IL8 A;  1Q8I A;  5M9O A;  3VA7 A;  4RAU C;  1Z6H A;  3MXP A;  4BY7 B;  2XIW A;  3D8G A;  2K5W A;  3D3R A;  3FRP B;  3KLR A;  4X3T A;  3I72 A;  1EWC A;  1EQV A;  3E6Z X;  5M3F B;  2BA1 A;  5KIX A;  4J6H A;  3GTP B;  1SE2 A;  4QCL A;  4KTA A;  2JP1 A;  2WAC A;  2E74 C;  1HA5 A;  2EE1 A;  1BUV T;  1D6E C;  3QOJ A;  1Q90 A;  2Q8T A;  4CKC A;  4XT1 B;  2QIL A;  1C8C A;  3SR1 A;  3M4Y A;  3P7J A;  1GUG A;  1OXT A;  1X32 A;  3J81 L;  1TY2 A;  3VYU A;  2B63 B;  4DXG A;  2A69 D;  4K6D A;  1YNN C;  2SEB D;  1ZYR D;  4CKB A;  4MHE A;  4XYO A;  2NBF A;  4K6L A;  2PCF B;  1Q1E A;  3H6M A;  3GTK B;  1WCM B;  1QNK A;  5CV9 A;  1CHP D;  4M1U B;  3J80 L;  5CV4 A;  1BNZ A;  2A68 D;  2EYL A;  1NAP A;  1DON A;  1AFP A;  2EYJ A;  1AW7 A;  4DK1 A;  3U9O A;  1H9K A;  2Q8R E;  3DMU A;  3SK5 A;  2AQ2 B;  2XSC A;  4RCO A;  4X3K A;  4LJZ C;  5EPK A;  2KOL A;  2MUY A;  1WTW A;  2X6L A;  2RDH A;  5G3L D;  2RDG A;  2PYK A;  4N9T A;  4A3G B;  5FOB B;  3M4O B;  4DNT B;  1CZG A;  5C6A A;  1JWM D;  4IFD I;  3HZX A;  1QE6 A;  3MXN A;  1WTR A;  3GTO B;  1IL8 A;  3LWE A;  2MP1 A;  3I91 A;  3J7Y W;  3NE5 B;  4LK1 C;  1I50 B;  1EZ6 A;  1IKL A;  2FMM A;  2QEJ C;  1A3V A;  2XN9 C;  2E2H B;  3HEJ A;  5M5Y B;  2K03 A;  2EY5 A;  3I4L A;  3CRK C;  1IYU A;  4HMJ A;  4CHT B;  2F0O A;  1HRJ A;  5CC4 A;  1HXY D;  3NTH A;  2K32 A;  3A7L A;  3NK9 A;  4DA2 A;  2WIN B;  2D2C C;  5IGG A;  1FYC A;  1ML0 D;  3D31 A;  3I4N B;  5TSS A;  4QUF A;  4TSS A;  5NUC A;  1TT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...