2PZUA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
130
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzuA00
2OF1A 4K5VA 2F0GA 2EYOA 4NKLA 1STAA 3T13A 4IALA 5C5MA 1EYAA 2M00A 5C4ZA 3MVVA 4KY5A 3VA5A 2F0JA 3OSOA 4RKBA 5CV9A 3RUZA 3QOJA 1EY9A 3QOLA 2WACA 5KEEA 3SR1A 3OMCA 2EY5A 5IGGA 4HTHA 2F0EA 5C5LA 2EYHA 1NSNS 1TQOA 5DEHA 1EZ6A 4K8IA 3TMEA 3BDCA 2EYJA 5J22A 2OXPA 5I6WA 5EGTA 4DFAA 2EYFA 4EQNA 4KY7A 4HMIA 3D6CA 3SK5A 1U9RA 5K5PA 3S9WA 3EVQA 5C6AA 1A2UA 1AEXA 1KDCA 2EYLA 2NUCA 2F3WA 1SNQA 1RKNA 2HQEA 4KHVA 3T16A 5CV4A 1JORA 5F2DA 4B9XA 2F0NA 1EYDA 5KIXA 3BDLA 4WORA 3SK4A 4DU9A 1SYCA 4QB4A 1SYEA 4NDXA 4EQOA 4F8MA 2RBMA 3D8GA 3OWFA 2F0IA 4KJNA 5CV5A 4ZUJA 1EYCA 3P1HA 5HGTA 4PMBA 4KY6A 3R3OA 3SHLA 1SNDA 3SK8A 4K14A 5IGFA 2OEOA 3SXHA 4MIUA 1STNA 1SNCA 3V2TA 4RKLA 1STHA 4ZUIA 4J1MA 5CR3A 4ODGA 5M9OA 1EY8A 2SNSA 3D4WA 4S3SA 1A3VA 1F2MA 2EXZA 4IUNA 4K2LA 3NP8A 4NMZA 1EQVA 3C1FA 4TRDA 2F3VA 1EY5A 4HMJA 5CC4A 2EY6A 5C3XA 5J39A 2ENBA 5IGBA 3ITPA 1EZ8A 4NP5A 1KDAA 1JOOA 4K2KA 4N9PA 1EY6A 2O4XA 2RKSA 3P75A 4PMCA 3MHBA 5KGUA 3PMFA 5EKLA 1A2TA 4LAAA 5DAUA 3NK9A 1TR5A 1ENAA 2EYMA 4G57A 3C1EA 5EKKA 3OMGA 1F2ZA 2QDBA 3SK6A 2F0MA 2KHSA 2F0SA 2KQ3A 1SNOA 3EROA 3HEJA 4WRDA 3TP8A 5KRUA 4ID6A 5C3WA 2PZTA 4OL7A 2EY1A 2PW5A 2EYPA 3DMUA 2F0TA 3DHQA 2PZUA 3NQTA 2F0DA 5CV8A 3NHHA 5CV6A 4K8JA 2SNMA 4K5XA 1SYGA 1SYFA 1STBA 2PYKA 3LX0A 1IHZA 3D4DA 4H7BA 1JOKA 4DF7A 2F0QA 3MXPA 5E3FA 3MEHA 1ENCA 5HURA 1STYA 2PW7A 3NUCA 4K5WA 1A3UA 5JOBA 3TP5A 2F0LA 5IIFA 5CGKA 5NUCA 4ME5A 1KABA 4ZQ3A 2F0PA 3QB3A 3TP7A 5KYIA 1EY0A 3H6MA 1TT2A 1EY7A 5J1ZA 4B9WA 2F0UA 2EY2A 2F0KA 1II3A 2F0VA 4KV6A 5I9PA 4E6IA 5C4HA 5ISRA 1JOQA 4I65A 3ERQA 2SOBA 5JAVA 4EVOA 1F2YA 1SYDA 3EJIA 4YIJA 3HZXA 4KTAA 5CV7A 3U9OA 1EY4A 5IGDA 3MZ5A 4KD3A 4KJOA 2LKVA 3E5SA 4R8NA 5E1FA 1SNMA 5IOCA 5KYLA 1STGA 4QF4A 5I9OA 4PNYA 5I6YA 1A3TA 4KD4A 4EQPA 3NXWA 1KDBA 2F0WA 4DGZA 5IODA 1SNPA 2F0OA 2F0HA 1KAAA 2PQEA 4IZ8A 4K6DA 4N9TA 4F7XA 5IGCA 4QMGA 4J6HA 5IGEA 2F0FA 1NUCA 3TP6A 1SYBA 2RDFA 2PZWA
chains in the Genus database with same CATH superfamily
5ELEA 3JC66 3GTKH 3T13A 3F2DA 1C0AA 3BG3A 2X69A 4RCOA 4K6LA 2IY5B 4JYAL 5DM73 1YNXA 4DK0A 3PUXA 3TSSA 4J8QA 5KEEA 2F0EA 1QNKA 5E4XA 3HOYG 2OXPA 1YHBA 1QE6A 5IP7H 2E2JH 1ONLA 1BR9A 4TVAB 1TWHB 5DM63 5F2DA 1BCPC 3GTJH 1H9JA 2UUAL 5M5WH 1X3FA 4LF5Q 4C3HG 5IYBG 4YCUA 4AQYQ 2CH4A 4JI6L 4GKKL 1JJ2A 1B9NA 4BXXG 4JC0A 1STHA 1PTOB 5IT9c 4V0BA 2NVTB 3BZCA 1TWGH 1EY5A 4XT3B 5C3XA 3KLSX 2K28A 4FF2A 4PQXA 1PRTD 1FL0A 2RSOA 3S15H 4JOIC 4A3CG 4HSVA 1G91A 3VR6A 3PUZA 4N8X1 3SK6A 4A3LH 3ULJA 1LTLA 1PXUA 4OHJA 2EY1A 4DAPA 2EYPA 5M5XH 5C0XH 1K0RA 4K8JA 1PH7A 4DNIA 1M8AA 4RHRA 2SDFA 5HURA 1ASZA 4BS9A 1GUWA 4KI0A 1WJJA 1LT4D 5NUCA 1SFOB 4ZQ3A 1JC7A 2E5LL 4FNFA 4DV2Q 2BDNA 1K8GA 1PFNA 4G4KA 1IYUA 3KBXA 4DR6L 1K28A 2HQLA 4ULLA 4HJAA 1I4XA 2LFNA 5CBAE 1JICA 3GTOH 2DJFC 1CQVA 2NN6I 4A3CH 2K33A 1LTBD 4X64L 4YWKA 3GTLB 4IO9A 2ID0A 5I6YA 2PQAB 1IL2A 5KNCA 4DAVA 4LFBQ 1K83B 1J5EL 2JA9A 1KXLA 1JB7A 1VMPA 1STEA 4B3TL 3GO5A 4K6DA 2F4VQ 1BDOA 2F4IA 1RF2D 5EPJA 1HRJA 4NPSA 4DV1L 1QVGA 3MXNB 2AQ3B 3PO3G 3UI2A 3SR1A 4CKBA 2Z6KC 1VQ9A 2VB3X 4DFAA 4LF6Q 2VL6A 2EZVA 1RJTA 1A63A 1JT8A 2Q8IB 2KVMA 1KDCA 4A3KH 2IHFA 4B3RQ 2RCFA 2B2VA 5AJ3Q 5KIXA 3CXCA 1TWCB 4HR7B 2MFIA 5G3LF 5LHY1 2KOLA 1EWHA 3MWYW 4AIMA 4ALPA 1SNDA 2CWAA 1EEFD 3RMHA 1KD1C 1STNA 4K0KQ 1GVPA 2N78A 1B1ZA 4E6IA 3NTIA 1I6HB 3J81i 3HOWG 2ENBA 5D14A 5I2YA 1KDAA 1WVLA 3PCOB 1Q7YC 2R7DA 1EY6A 4DV4L 2A69D 4X3KA 1CUKA 2GVAA 3MXUA 1I50B 1FNVA 1SR3A 3CCRA 1C48A 5CBEE 1W2BA 3Q23A 4YHHL 2H1EA 4APVA 4LF7L 2A6HC 3G7LA 1PLFA 1PTOH 5C3WA 3TRZA 1MI2A 1N34L 1VQDA 2C5CA 5M3FG 3AB9A 1HNZL 2DJGC 4CHTB 3GTQB 1CFMA 2VQEL 1OXSC 2DNEA 4EX5A 2F0QA 1WCMH 4DV3Q 2IPKD 1KC8C 3GV6A 3I3CA 3TP5A 2Z0SA 5KYIA 4RAUC 1PA6A 3GDEA 1JOQA 1BBUA 3K7UC 1F9RA 4MTNA 4EVOA 1GUOA 4QL5A 3W3AA 4KTAA 1A6XA 2CW0C 4DR1L 1UE6A 4C3IH 5IP9G 3HOVH 1BUVT 3H0GB 2A6ED 3RNUA 4N9TA 3ND8A 1SMXA 1JR0D 1A8VA 2WB1E 4K5VA 1XYIA 1PH8A 2E2IB 3TZDA 2O2LD 1GUTA 1TKWB 5DLQE 1C8CA 1FYCA 5IT9L 3EBEA 4KKUA 3M3YB 5FLXc 4DAYA 1BBWA 3CQZB 1WTVA 1QZGA 3BDCA 1KL9A 4C3JB 5EGTA 2HDMA 1AP0A 2EYFA 1K83H 4A3DB 1RTNA 1SNQA 2YTVA 4KHVA 1VQBA 4B9XA 1VQCA 1QG7A 1RHPA 3MC0B 1Y69U 1DM0B 4NXNQ 2R7ZH 3OWFA 1X3GA 2D9UA 2N3SA 3MXGA 4XT1B 1ET9A 3SK8A 3A5UA 4OWTB 1HCZA 3H3VC 2KCCA 3D4WA 4S3SA 5IGDA 1F2MA 5TSSA 1EQVA 3CW2C 4TQUS 3M4PA 4HMJA 1HR0L 1EZ8A 1KNEA 2WINB 4PMCA 2PNRC 1OXXK 2YYZA 4QJFA 4LFAL 4YWLA 3PUYA 1GD7A 1PH9A 2H4OA 4I7ZC 2F0SA 1NE3A 5GAGC 3S2HB 1OXUA 4LF5L 2F0TA 3AU7A 2PMZB 3CAMA 4YCVA 3BU2A 4JI1Q 5LMUL 4AQYL 1KLGD 4QUCA 3LX0A 1S4ZA 2ZJPA 4JBKA 2AQ2B 1LM0A 3I56A 3E9IA 4A93H 1I50H 4IUVA 3KJOA 1AFPA 4BY7B 1CA6A 4O42A 3QB3A 3TEHB 4WJ3M 1B8AA 1GXDC 3WDNA 1YI2A 2BDOA 5C4HA 2SEBD 4B08A 3K7AB 4TSSA 2HCCA 1E2VA 1VMCA 1R9TB 2K5HA 1Q1BA 3GTGB 1EOTA 3K0YA 2NVYB 4DK6C 1DYQA 1VQAA 5I2XA 4C3JG 4GOPC 2A1AA 5FJ8H 1OTCA 4A3DG 4X66L 3CCJA 2K6AA 1XNQL 3IKJA 4LF9Q 1XJVA 1H9SB 3JAMc 4IOAA 3I90A 2ZTEA 2B2VC 4RGNA 4HIDA 2K5QA 4A3JH 1N8RC 1EZ6A 1YITA 1Y8NB 5C44B 3J7YW 3H0GH 1ICWA 1VQLA 1J6QA 3CCLA 3EVQA 5LL6X 2EYLA 4FO2A 5FLMG 5M3MB 1RKNA 2HQEA 3J80E 4DXFA 1Z7TA 3GTMB 1K8MA 4CDCC 2BA0A 1I4GA 4JI6Q 4GKKQ 2E2IH 2CQOA 2K1BA 4HCEA 1H9RA 3I4MG 3K8AA 1G291 3KFUA 4K14A 2ASBA 1XPRA 1O7IA 3CQZH 4DV0Q 4KKTA 3V05A 4C3JH 1CM9A 2B3GA 3LNNA 4TRDA 2UXBQ 3QG1A 2ZTDA 1PRTB 4WJWA 1HFNA 1RL2A 3OOCA 4NP5A 3DEOA 1HA5A 5KGUA 1AN8A 1WD0A 4JBJA 2J0TD 4FP5D 3VYUA 2YV5A 1U4RA 2FMMA 3LWUA 5FKAC 4JI3Q 1E0BA 1B53A 5AJ3L 2RA4A 4BY7G 4OO1G 2PZTA 2Z8LA 4L63B 3WWVA 2E76C 5IYDH 3Q6SA 5CV8A 3K6OA 4QQBX 3S1NB 3KF8A 3G71A 2QA4A 3I7FA 5EKIA 1JWUD 2V4DA 2AHOB 4N8FA 1Q1EA 3BVGA 2ES2A 4XIGS 1IKMA 3I73A 3TP7A 3A8IE 4A4IA 1TS3A 1MSHA 1TS2A 3S2HH 3X3NA 3L9AX 3E6ZX 2MNAA 1I4RA 5FLXL 3Q8DA 3F8TA 1BCPF 1SE3A 2OTJA 4LUZA 1X6OA 2JA5H 4B3TQ 1SNMA 1KIXA 2JA6H 4KHPL 1KDBA 1IXRA 1N33Q 2A5HA 4KKSA 1ILPA 3QR8A 4BY7H 1KTKA 5C44G 1GUNA 1LTTD 1NUCA 2JEBI 4I7AA 3H91A 1XPUA 4UHVA 4DV3L 5C4XG 4O2DA 3VA5A 1YHQA 1DXMA 2ZTCA 1W3SA 2I5MX 5GQOA 3K7AH 3T1YQ 1EY9A 3FP9A 4ZAIA 1YZ6A 2WACA 3HOUH 2EY5A 1Z6HA 2NVYH 2B63B 4DA2A 3P7JA 4A3EB 4A3MB 2KBNA 1XX8A 1CTMA 3RLFA 3BDLA 3CPWA 2NVXB 2J4XA 4QB4A 2E75C 3I8ZA 2ZXPA 4KJNA 2VUMB 3TS0A 3G4SA 4UP7A 4DV6Q 2D5DA 1SROA 1KLUD 1HR0W 2I5HA 2SNSA 4YY3L 4K2LA 3C2PA 4CJ1B 1D5ZC 1L2FA 5J39A 3HOXB 5M3MH 1GUGA 3ERSX 2OWOA 4B3SL 3GTMH 2AUJD 3J7AF 4N9PA 3PIOA 2O4XA 5BN5A 5ELOA 4LF7Q 1HQMC 3K81C 1EFWA 1B7YB 3CHBD 4IFDJ 5IY0A 1QVCA 4G57A 1A15A 3C1EA 1D6EC 3M85A 3F2BA 1RIPA 1YBYA 4PZ7A 3HOZB 4OEMB 3PIO3 4IOCA 4IUUA 1Y1VB 3T53B 4NXNL 1HQRD 3J7AV 1SJED 4L8JA 1PYBA 3JAME 4FYDA 1AH9A 4PZ8A 1UWVA 4XXEA 1BBXC 4DF7A 3MFYA 1CZGA 4HJ7A 1ENCA 1IYVA 4C3HB 3I70A 3GP7A 2L9HA 3S17B 1EL0A 1VDZA 3F2CA 4H44C 1C4QA 1G6ZA 2MPMA 1SXTA 2HIVA 5J1ZA 3TBIB 3K5LA 1JQYD 5ISRA 4DR1Q 1UE7A 4P72A 1HH2P 3ERQA 4I65A 1L1OA 3EJIA 3AMUA 3S1NH 4OIKA 3D3RA 1UEAB 4DPGA 4DGZA 2UUBL 1E2WA 2HD3A 2JA8B 4X6AH 2XVSA 1FR3A 2F0HA 5IYCG 4BBSB 1CT1D 3U50C 2Z6BA 4JI1L 2RHQB 5DNFA 2F0FA 3KLWA 1I3QH 2P5ZX 2PI2A 2B63G 2CFMA 3BZDB 4IUTA 2EJMA 4A3EG 1EYAA 2A19A 2EQSA 2L0CA 2ATWA 4Z9CB 2B2YA 5I4DA 4PG3A 3PV0A 1PMRA 1OXVA 1DONA 4HN7A 4C1NK 3TMEA 2VUMG 4LF4L 1E24A 5K5PA 3D6CA 3A8KE 1LACA 1MHWC 3A5ZB 4IUQA 4OXPA 3SK4A 1AZQA 1CZWA 1SYEA 4DAMA 2XWBB 4F8MA 1PH1A 2K04A 5CV5A 2Q2IA 2NWGA 4GNXB 4GS3A 1D5XC 4C1NI 1HR0Q 4IFDH 2ICEC 3GD7A 2A6HD 4A3BG 1A3VA 4IUNA 1TU2B 3HOZG 1U5KA 4LF9L 3UDXA 4WFN3 4ZKBB 2BOSA 2PCFB 4A3MH 4LFAQ 3Q0AA 1Y1VG 3DWAA 2NVXH 1IBMQ 3NEMA 4DAYB 1WTRA 3UDIA 3CD6A 3PO3B 1AE2A 4RFBA 1SLJA 1PRTF 4IPGA 5LMUQ 1T9HA 1U4MA 1VQNA 1PFBA 1PZJD 1V1QA 1VQGA 2F03A 4DXGA 5KNDA 3HOXH 2JYOA 4Y7NH 3K0XA 3IFTA 2CW0D 4DV0L 2QW7A 3OYYA 2UXBL 5IIFA 5CGKA 1LTSD 2F0PA 1S5DD 2JA8G 1EY0A 3HOZH 3HOYH 2WV6D 4BBSG 2CKZB 1F77A 4PV1C 3S1QB 3HOWB 2O5JC 1SYDA 3EFXD 1DGSA 4Y52H 5CV7A 1ZXTA 4H02A 4JI3L 4CKCA 5I9OA 1Q82C 1X3QA 4KD4A 1VF7A 2UXCQ 4C3HH 5IYBH 4X66Q 3UE1A 1WTXA 1XNQQ 1IYJB 5BR8L 4BXXH 4PZ6A 5EJWA 3HG9A 4JI4L 3M7NA 1B50A 2YU9B 4A3FB 5M3FB 3K59A 1UNSA 2LS01 3HS0C 3S2DB 1K3RA 4FXKC 1VQJA 2JEAI 2R92B 4HTHA 2FJ2A 2B2WA 3Q22A 3N6RA 1EUJA 2EYJA 2CHBD 1O7YA 5A2QE 1V1OA 2LMCB 1AEXA 1LTID 4QY7A 1EYGA 1QCBD 2XRSD 3ZYYX 1EQQA 1NCVA 1NJIC 4UY8C 3I4NG 4GN4B 3RZOB 1N33L 1CKNA 4EQOA 5EBDA 2NBFA 3R8BA 3K57A 1Q8IA 1VQ5A 1VQKA 1N36Q 2K01A 2I5LX 1W6JA 5M9OA 1EY8A 4GOPA 3C1FA 3TDQA 3T1YL 3CPFA 2PMZE 2MHVA 1EIFA 2RKSA 3G6JB 4UP9A 3HKSA 1NY4A 4BBRB 4A76A 1MD2D 3FDTA 1S5FD 2D0PA 1EIHA 4UPAA 4LFCQ 1CHQD 4ID6A 3NPPA 4L6TB 4AH6A 1LTAD 3PF5A 1FNWA 2IX1A 3J7ZC 2Q8RE 4FXGC 4CJ0B 4DV6L 2IHEA 3D4DA 4H7BA 4OELB 2KHIA 3KJPA 2YTYA 1TWHH 3I55A 1G2TA 3PO3H 1L1OC 4L5SA 1EFID 1S40A 2HDLA 3H6MA 3CMEA 1PH5A 2EY2A 3E0JA 1X54A 1Y1WG 3RLOA 3Q24A 4JI0Q 4KHPQ 2NVTH 4A3FG 2EJFC 2TSSA 4H13C 5EBCA 1SN8A 3J7A5 4IPHA 3MTSA 3J80c 2R92G 1R4PB 3KBGA 5K36G 1M1KC 1KQSA 2B2YC 2KJXA 1BCPB 2UU9Q 1G6PA 1YJWA 3KF8B 1STAA 4DR5Q 3URYA 2KHJA 2KEDA 3S1QH 1XMQQ 5CV9A 3HOWH 3X3MA 3SDZA 5DEHA 1TQOA 4R9WA 3G6EA 3U58A 3ULPA 3W1BA 2D62A 2L15A 2MQHA 2HUGA 3T16A 1IBKL 1HUMA 4R4TA 1SFOH 1EEID 1EU3A 1LO5D 5L37A 5M3FH 3S2DH 1T5EA 2EDGA 2N88A 2WAQG 4YY3Q 1EYCA 3KLSA 4MTKA 2ZJRA 2EPBA 4BBRG 4M1UB 1SNCA 4DR2L 1YNJD 4B3SQ 3GTLH 1K8AC 3QJYA 1R4QB 2G9HD 1F2LA 2A8VA 4DV7L 4X65Q 2CWPA 3T56B 4JV5L 1Z9FA 3NTHA 1XTDA 4OWXB 3KDFB 4IPCA 3BJUA 4IQZA 1I94L 4FF3A 2M9VA 2VW9A 5IP9H 2AWOA 3EROA 3S14B 4OL7A 4R1JA 2Z4HA 2ZXRA 4U68A 2PZUA 4A3GG 3F2UA 4A3IB 3AFQA 4HSPA 1WTOA 2K7VA 3CMAA 5A35A 1BKBA 4CKEA 1PFMA 2HIXA 1S72A 1SJHD 3I4MB 1TWCH 2JSOA 1TT2A 2G5DA 1B70B 4OX9Q 1TVXA 3LGJA 1II3A 5M5YB 1IBML 1JMCA 1RODA 3OWEB 4BY1B 2UUBQ 4ZRZA 3MZ5A 2UUCL 1I6HH 1RTOA 3UE0A 1DJRD 2F0WA 1RCVD 3ONAB 4IURA 4AYBB 3L7ZC 4F88A 1PH6A 3QIAA 4XTCS 5JEAJ 2B2WC 4GN3B 2JQOA 1E22A 5C3EB 3J81E 1ESFA 3LWEA 1LABA 1JJGA 3O13A 2WKDA 2B29A 4HEDA 4LF4Q 4DNRB 4HJ8A 3GTQH 2IX3A 1PTOD 3MEFA 5HY6A 1HNWQ 1QILA 4C56C 3IFDA 1Y8PB 3PSIA 3NTKA 4RA8A 1CHPD 4MZ9A 3R2TA 1PYSB 2Q8TA 1SMYC 3TZUA 4LMQD 1L1OB 1UEBA 1WOCA 4JW0A 1JORA 4MNOA 5E7NA 4GZYC 5LL6S 4RGMA 4WORA 4HIMA 1ESRA 3R93A 5CYUA 3I72A 4DU9A 1GOZA 3D8GA 2XNAC 4DR7Q 1NAPA 1KRSA 4PMBA 1LT6D 3D0FA 4JPBW 3CC4A 3OTOQ 1VQEA 4J1MA 3TQYA 4BA1I 3NP8A 4NMZA 1XPOA 4RHSA 5AFWA 2ZM6Q 4X62Q 5IWAL 3CU7A 3MXNA 1MBYA 3PO2B 5JEAG 4K2KA 5C4XB 5GROA 4A3IG 3MHBA 3PMFA 1A2TA 4LAAA 3NK9A 1ENAA 5T1IA 2PO4A 1M90C 3OMGA 3IAYA 1I4HA 3KUPA 1QZHA 3M3YH 4FXDA 1BOSA 1F9PA 1FVIA 1FJGQ 1DOKA 1JWSD 3FEWX 3EA6A 3BDOA 3DHQA 3OIPA 3T51B 3S16B 1V9PA 2F0DA 4DK1A 4G7HC 3CC2A 3SEBA 2K32A 1NTGA 3J80L 4DR4Q 2EE1A 2JA7B 4A3DH 1D7QA 2X6GA 1Y14B 4BY1G 3STBD 1N36L 1RD9D 1EWCA 4LUVA 1Q90A 3AEVA 5JOBA 1AW7A 4IN3A 3SE0A 4ILWA 4L5RC 3JAMi 4AYBG 4X3UA 3S14H 5JJIA 3A0JA 5IE8A 4KV6A 3PF4A 3U4VA 1YNJC 3NBHA 2NZ1D 5FLMH 5C3EG 3VA7A 4A3IH 4YIJA 1HXYD 1K3BC 4LK1C 1YJ9A 4KK7A 4LFCL 5BR8Q 5JJLA 3NXWA 4JI4Q 3I4MH 3RZDB 3FKIG 1W6KA 2F0OA 1EOVA 1BNZA 2PQEA 1WTWA 1ILQA 5M5YH 1HZAA 4KLKA 3CCVA 1FNUA 4BY1H 4RKBA 5ELDA 3H3VI 3NE5B 2D2CC 3K5OA 3MA2B 2EYHA 4JI0L 1JB3A 3MFGA 3WOEA 2MJ8A 3EIVA 2LXJA 2ALYB 5CV4A 4OO1H 5C3EH 1NMFA 2R93G 4RMFA 4QIWB 1SAPA 1SYCA 2JXMB 2R7FA 3I91A 4H0LC 4UAIA 1VQ6A 3PO2G 1HHVA 1IW7C 4P2CB 4EGVA 4ZUJA 1MSGA 1VQ7A 4KY6A 1JWMD 2UU9L 4IFDI 4R4QA 2LXKA 5FO8B 3GQBA 4DR5L 1R9TH 1XMQL 2F3VA 1QB5D 3GTGH 5CC4A 2VXWA 1MKHA 2LY7A 1WTQA 4O1NA 4G7OC 1XXGA 3P75A 5LMNW 2JA7G 5GAHC 4FDBA 2JN4A 4MHEA 1G8ZD 1S5ED 1Q12A 1PVOA 3E3XA 4YCWA 4XYQA 4WRDA 2AUKA 2RVLA 1O7LA 1PTOC 3DLLA 2CH4W 2WIIB 5C44H 3NHHA 4JBWA 1SYGA 1SYFA 1CKNB 3UDFA 5C4XH 2NB0A 3NENA 1V43A 1K9MC 4XQQA 1A3UA 2MO1A 2F0LA 4GOPB 4X65L 1HNXL 2N8NA 4A3BB 1EQRA 1EIYB 4B9WA 3IRBA 1XNRQ 4DK3C 4R4OA 2GVBA 1ICFB 4IJLA 1V1PA 3S16H 3DM1A 5JAVA 1WTPA 1U4PA 2JA7H 1L0XB 2B2UC 4CBVA 1QUQA 2LKVA 3CC7A 3E5SA 3CCUA 1J8IA 3FHWA 1AE3A 2B39A 2I07B 4KN4C 4DR3L 4F7XA 3K5MA 2QKIC 3S15B 2VS1A 2F0GA 1E2ZA 1UAPA 1GUSA 3QOJA 3M4YA 3JAML 5JJKA 2VY3A 2A68C 2HT1A 1OXTA 5C5LA 4L5TA 5M5XB 4OX9L 2C9OA 5J22A 3STBC 1IBKQ 4JI5Q 2E2DC 3RZDH 2KA7A 4HMIA 2K52A 1M4VA 4OONA 2HHHQ 3A56A 1IBLQ 3I2ZA 1X55A 4LNQA 2UXDQ 1CI3M 3CRLC 4JI2Q 4DR2Q 5ELFA 5EQ0A 2MGSA 2Y0SB 4Q5VA 3RN5A 3HP3A 1WI5A 3D4RA 5IGFA 1B2TA 4DV7Q 5JJZA 3H3VH 2LSSA 3BZKA 4ZUIA 1TY2A 4ODGA 1SRUA 2C35B 3HFZB 1LT3D 3GTOB 4JV5Q 4LJZC 1V8QA 2FINB 1D8LA 1K73C 1ENFA 3CRKC 3NWSA 3A55A 5LMNQ 1I94Q 2WP8J 2ICIA 3VR4A 4ZK9B 1X32A 1HNWL 1VQHA 5EKLA 2FFKB 2N55A 4GLAC 2GN5A 1EQTA 1EU4A 3P20A 5C0XJ 1QJOA 5IP7G 3CCEA 2F52A 2KQ3A 3HEJA 1SNOA 3T4AC 3CCSA 1N32L 5ELBA 3PUVA 3DUZA 3ND9A 1EIGA 5IYCH 1X3PA 2XWJB 1NBWA 4JBMA 5CV6A 2SNMA 3QO2A 1PHJA 4DR7L 2K14A 5D65A 2B63H 3DEPA 1K0SA 3OTOL 4A3EH 4UDUC 3I4NB 3MEHA 3M9BA 1QOHA 1SE4A 1NR4A 4NXMQ 1BQQT 4A3KB 2ZM6L 2B2TA 4X62L 3FPPA 1WD1A 3CCMA 2A73B 4RWSC 2VUMH 2UUCQ 2F0VA 3HKZB 2K75A 1G51A 1B4OA 2EJGC 1F2YA 5COYA 1AZPA 3PUWA 3KYHC 5GAEC 4U673 3EN2A 4KD3A 1HZCA 1VS0A 4KJOA 4UP8A 1LTGD 5E1FA 2O5IC 5KYLA 4LF8Q 4EQPA 4A3LG 3OIQA 1FJGL 1BVSA 1SNPA 4DV5Q 3VR2A 3BVZA 5C0XG 4DNTB 4DR4L 3L3OC 4A3BH 4ZLTF 5BN3A 4NKLA 1B3AA 2OQKA 2M00A 1YHAA 5C4ZA 2JK8A 3M4QA 2D0OA 1N9WA 1HZ9A 3RR5A 3IL8A 5H1SE 1Y1VH 4Q0FA 3OW7A 3I4LA 5IGGA 2OTLA 2M2LA 3BVMA 1L0WA 2Y0SG 1VQFA 2BA1A 3ULLA 3R2IA 1H9MA 1HTPA 2IL8A 1KRTA 1O7ZA 5BN4A 1Q3LA 2F3WA 1WCMB 2K5DA 1ZYRC 3S17H 1EYDA 1C9OA 1JJCB 1Y1WB 1S5BD 2QF7A 3KF6A 2Q2UA 5HGTA 1E1OA 3SXHA 5IWAQ 4RKLA 4ZCKA 4O0AA 5FO9B 1CK1A 3TS2A 1I6VC 2Z1CA 1X9NA 2JA8H 3BYYB 4C3IB 5IGBA 3HOVB 4BBSH 3DWPA 5JVH3 2CCZA 4GLXA 4DN4M 1ET6A 5DAUA 2L1BA 3AQQA 4HIKA 2WFWA 1IKLA 4GLVB 3CF5A 4OWWB 4A3KG 3A7LA 4RGOS 2QCPX 5T1GA 1DOMA 5A2QL 2KECA 3HKZG 3S1MB 4CDEC 2PYKA 1I5FA 1IHZA 4ABNA 4TKOB 2WAQB 1STYA 3NUCA 3J81c 4AYBE 2JJQA 3RD4A 4ZKCB 4PMWA 3CCQA 2R7ZB 1PZID 2H5XA 3F1ZA 4HJ9A 4JI8Q 3H09A 1F9SA 3ICEA 2VNUD 1X65A 1OO9B 3DWQA 1U4LA 3HZXA 2BH2A 4R8NA 5IOCA 3I4NH 2R3ZA 1DCZA 2K5VA 2YTXA 4B3MQ 1H95A 3FRPB 1YVCA 1SMYD 1I4QA 4RGTA 1Z47A 3S1RB 2PZWA 2EYOA 1VCIA 1WCMG 4DUZQ 4KY5A 4A3GB 2F0JA 1SE2A 2MUYA 2WKCA 4MN3A 5ELNA 4JI7Q 1I4PA 3KK7A 3VYTA 1S5CD 1PH4A 2CVRA 5FK9C 1Q86C 1XNRL 1HZBA 3T1HQ 4KY7A 2PI2E 4IPDA 5C6AA 3FVQA 2K5NA 5G3LD 1SDFA 3KOJA 3NBHB 4A93B 2OCEA 4POGA 3PQIA 4C3IG 1GKHA 5EPLA 3HOVG 1SSOA 3GV3A 3H15A 5ELCA 1P8LA 1HUNA 2VZAA 3V2TA 3VYSA 1EWIA 5CR3A 4ME3A 2E74C 3D6WA 1HA6A 3SGIA 1PH3A 1Q8KA 4NW2A 4R4CA 1JOOA 2GA4B 2EXDA 3U9SA 2L5TA 1Y1WH 2RDHA 4JI5L 5CMDA 2NN6G 1J9OA 2YU9H 4A3FH 1K8OA 1L0YB 2L55A 4X3TA 1QNUA 2HHHL 1TS5A 1UE1A 1PYWD 2KHSA 1IBLL 3A74A 2R92H 2B8GA 2VB2X 3PIPA 3C3LA 4OGQC 2UXDL 5K36H 2K4KA 1A0IA 1LTRD 3J80i 1DOLA 4JI2L 4HJ5A 1KNAA 2B2TC 4A3JB 2R7ZG 3W5OA 3K58A 5IT9E 1STBA 1PRTC 4GNXA 2KCNA 5FO7B 1HNXQ 3J81j 3PIP3 2EOTA 1B9MA 2BCOA 3RZOH 2VQFQ 5LMNL 3ZJYC 2Q2HA 4JG2A 1JE5A 2SOBA 2EIFA 4KHZA 3OHXC 3S1MH 2DY7A 3S24A 1EY4A 2NN6H 4C2MB 4DR3Q 1JE4A 1HTLD 1MJEA 2AMCB 3TP6A 1CKMA 2RQXA 5IODA 2NVQB 4XDXA 2I0QA 4HAEA 4BBRH 3FMCA 5IGCA 2E2HB 4CJ2C 4J6HA 2OEOA 3A8JE 4DUYL 1CA5A 4RG1A 4IALA 5C5MA 1D2BA 4NXML 4QIWE 2B8FA 4A93G 2AKWB 3H94A 1PFSA 2UXCL 1IW7D 5JPNC 1LYLA 3QOLA 3G48A 4GKJQ 1NSNS 2E8GA 2XN9C 1ZEQX 4LUOA 2L4NA 1YEZA 2NTTA 4YWMA 3OW2A 1QWYA 1A2UA 2NUCA 1V1PB 3S1RH 1PTOF 1C7YA 4OO1I 2F3IA 3VDYA 4LF8L 1QUQB 2B2UA 3UDGA 5EAYA 4CDFC 4A3GH 4NDXA 4DV5L 1GHJA 1CSQA 1D1IA 2ZJQA 4IJHA 3NWTA 5FJ8G 4FVMA 1VQ8A 2EXZA 3FKIB 1P16A 1RDPD 1LUZA 2EY6A 1LLRD 2JA6B 2JA5B 3J81L 1E7ZA 4A3JG 2IWHA 2F1MA 3ER0A 1VF5C 1N32Q 2RDGA 3H0GG 1XMOQ 1LV9A 2K03A 5EKKA 1KHIA 5HGQA 1VQPA 2PQAA 4LW1A 3TP8A 2R61A 3WOFA 5KRUA 4G7ZC 3RN2A 1PH2A 1Q81C 4A75A 3DMUA 3HOUB 3GTPB 2BE5D 1TWAB 3NQTA 3N52A 2RSNA 3NELA 2R93B 1JOKA 2A69C 1UE5A 4QGUA 5E3FA 2PNHA 2XGTA 1FGUA 2PW7A 3V96A 5JPMC 4JYAQ 2NYZD 4P71A 1DZ1A 4ME5A 1KABA 4NB3A 4JVZA 1XTCD 3FPUB 2RHSB 1TY0A 1BF4A 2KEEA 4XQNA 4DV2L 1D1KA 5E4WC 4P73A 2A68D 2MO0A 2QGQA 1T5XD 2Q2TA 2UUAQ 5D3DA 1U0LA 5IYDG 4HIOA 1IL8A 3W2DA 4QMGA 1YNND 3A54A 2KCMA 4LFBL 1PV4A 2QEJC 3MVVA 1O80A 1WFQA 2F4VL 4KN7C 3RUZA 1TS4A 1VQ4A 2HCIA 1TIID 2K05A 5JEAH 4C2MH 2IX0A 2Y0SE 1VQMA 2CQAA 5I6WA 2A6EC 4JI8L 2NVQH 3CKIB 4EQNA 1U9RA 3S9WA 2G9DA 3MAQA 1GO3E 2E2HH 3HRZC 4GN5A 2WB1B 2L12A 4M8AA 4FF1A 1X3EA 4LF6L 2F0NA 2JA5G 2OQ0A 2JA6G 4B3ML 2FHTA 4P74A 4XYOA 4B3RL 1SBBB 1B3QA 1MIUA 3P1HA 2KENA 5GADC 5CORA 2DY8A 3M7GA 4MIUA 2MP1A 4X3SA 1ASYA 4P75A 1O78A 4DKAC 3PGZA 4DUZL 3HGBA 4POFA 5FLXE 1HFGA 4K0KL 2N49A 1UUPA 2E5LQ 2QILA 2NTSA 4JI7L 3HOUG 2EVBA 4DR6Q 5C4JB 1VQOA 3CP0A 2KUMA 3T1HL 4BWGB 1I3QB 5EPKA 1F2ZA 1CSPA 2OT2A 2V1CC 5D3IB 4X64Q 4GNXC 2F0MA 3KLRA 3B6YA 4WJ4A 2K5WA 1QVFA 1H9KA 5KNBA 3M4OB 4BA2I 1LT5D 3FKIH 2JE6I 2PW5A 3HKZE 1J5EQ 4JOIA 1TWFB 4K5XA 3L2PA 1VQIA 3KF6B 3MXPA 1Y8OB 3K80C 3BS1A 2DUDA 4DV1Q 2XIWA 4HCSA 1BO0A 1BCPD 1EY7A 5M3MG 4QUFA 4CDDC 2F0KA 3GTKB 1GHKA 5I9PA 1B44D 1BXTA 3GTPH 1TWAH 2IJ0A 2DGYA 3KDFA 4CGYB 1GM5A 4EQ5A 4R8IA 2ZXOA 1NR2A 2R93H 4XQJA 4QF4A 1KAWA 3W1GA 1A3TA 2XTIA 2NZHA 3DM3A 3PO2H 4V190 2IW3A 4L5QA 2PPBC 1KAAA 2E2JB 1ML0D 4QCLA 4PNYA 1E3PA 1ZYRD 2RDFA 3VYRA 3GTJB 1CQFA 2OF1A 3C46A 2JP1A 4JK1C 1HJPA 1HPCA 2X6LA 5M5WB 2WB1G 4RCNA 3OSOA 2J7ZA 2TMPA 2BE5C 4R4IA 3OMCA 3NQIA 2FXQA 1ZKOA 2QEXA 2VQFL 1MGSA 1WYDA 4DV4Q 4K8IA 3NBIA 1A62A 1IZ6A 3OPOA 3SK5A 1TWGB 4Y7NB 3K5NA 2I46A 2KCTA 4YHHQ 2Z6KA 1N34Q 1SEBD 4F87A 2NZOA 3D31A 2RBMA 1JCKB 1HNZQ 2F0IA 3TN2A 3HOYB 1PDQA 3SVMA 2VQEQ 3L0OA 3R3OA 2R6GA 2XSCA 3SHLA 2AQ1B 2K50A 1SE8A 4RH6A 5C0XI 3A7AB 4IUPA 3AYHB 1YIJA 4KMUC 1MJCA 1WTHA 3ITPA 2Z9HA 4GKJL 1NMGA 1Q46A 3E0EA 3DXJC 2DNCA 3NSWA 3TREA 1YNNC 1G2SA 1TR5A 2WAQE 2EYMA 3I4OA 2QDBA 4OIJA 1CKOA 4ZYSA 2L11A 1TXYA 3BYTB 1E1TA 3EQLC 1FD7D 2FMCA 3E9HA 2DN8A 1FGBD 1DD2A 1GJXA 3RLNA 4IFDG 5C4JH 2A74C 4J15A 1H9SA 4LWCA 1YJNA 1NNXA 4K5WA 3VR3A 3U4ZA 4A3MG 2QDLA 4FF4A 2Z4IA 1XWEA 1F9QA 2BH8A 3AFPA 2F0UA 3M4OH 1X56A 2ZT9C 1S3OA 1XMOL 1TWFH 2AWNA 3U9OA 2RF4A 5J3BA 1PZKD 1STGA 2XRQD 3VR5A 4JCVE 4DUYQ 5FOBB 2IT1A 2RCNA 5IGEA 5JVG3 3HOXG 1D5MC 1SYBA 3QWNA 4IZ8A
chains in the Genus database with same CATH topology
5ELEA 3T13A 3BG3A 2X69A 4RCOA 4K6LA 5DM73 4DK0A 3PUXA 3TSSA 4J8QA 5KEEA 2F0EA 1QNKA 5E4XA 2OXPA 1QE6A 1ONLA 1BR9A 1TWHB 5DM63 5F2DA 1BCPC 1H9JA 4C3HG 1B9NA 1STHA 1PTOB 4V0BA 2NVTB 1EY5A 4XT3B 5C3XA 3KLSX 2K28A 4FF2A 4PQXA 1PRTD 2RSOA 4HSVA 1G91A 3VR6A 3PUZA 3SK6A 1PXUA 4OHJA 2EY1A 4DAPA 2EYPA 5C0XH 4K8JA 1M8AA 4RHRA 2SDFA 5HURA 4BS9A 1GUWA 4KI0A 1LT4D 5NUCA 1SFOB 4ZQ3A 1JC7A 4FNFA 2BDNA 1PFNA 4G4KA 1IYUA 3KBXA 4ULLA 1I4XA 2LFNA 5CBAE 1JICA 1CQVA 2NN6I 2K33A 1LTBD 3GTLB 2ID0A 5I6YA 5KNCA 4DAVA 1K83B 1VMPA 1STEA 3GO5A 4K6DA 1BDOA 2F4IA 1RF2D 5EPJA 1HRJA 2AQ3B 3UI2A 3SR1A 4CKBA 2VB3X 4DFAA 2EZVA 1RJTA 2Q8IB 2KVMA 1KDCA 2B2VA 5KIXA 1TWCB 4HR7B 5G3LF 5LHY1 2KOLA 1EWHA 3MWYW 1SNDA 1EEFD 3RMHA 1STNA 1B1ZA 4E6IA 3NTIA 1I6HB 2ENBA 5D14A 5I2YA 1KDAA 1WVLA 1EY6A 2A69D 4X3KA 3MXUA 1I50B 1FNVA 1C48A 5CBEE 3Q23A 2H1EA 2A6HC 3G7LA 1PLFA 1PTOH 5C3WA 1MI2A 2C5CA 3AB9A 4CHTB 3GTQB 1CFMA 1OXSC 2DNEA 2F0QA 2IPKD 3GV6A 3I3CA 3TP5A 5KYIA 4RAUC 1JOQA 1F9RA 4EVOA 1GUOA 3W3AA 4KTAA 1A6XA 2CW0C 1BUVT 3H0GB 2A6ED 4N9TA 3ND8A 1JR0D 1XYIA 4K5VA 2E2IB 3TZDA 2O2LD 1GUTA 1TKWB 1C8CA 1FYCA 5IT9L 4KKUA 3M3YB 4DAYA 3CQZB 1WTVA 3BDCA 4C3JB 5EGTA 2HDMA 1AP0A 2EYFA 4A3DB 1RTNA 1SNQA 4KHVA 4B9XA 1QG7A 1RHPA 3MC0B 1Y69U 1DM0B 3OWFA 2D9UA 3MXGA 4XT1B 1ET9A 3SK8A 1HCZA 3H3VC 2KCCA 3D4WA 4S3SA 5IGDA 1F2MA 5TSSA 1EQVA 4TQUS 4HMJA 1EZ8A 1KNEA 2WINB 4PMCA 2PNRC 1OXXK 2YYZA 3PUYA 2H4OA 4I7ZC 2F0SA 3S2HB 1OXUA 2F0TA 3AU7A 2PMZB 1KLGD 4QUCA 3LX0A 1S4ZA 2AQ2B 4IUVA 1AFPA 4BY7B 1CA6A 4O42A 3QB3A 1GXDC 3WDNA 2BDOA 5C4HA 2SEBD 4B08A 3K7AB 4TSSA 2HCCA 1E2VA 1VMCA 1R9TB 1Q1BA 3GTGB 1EOTA 3K0YA 2NVYB 1DYQA 5I2XA 4C3JG 2K6AA 3IKJA 1H9SB 3I90A 2B2VC 4RGNA 2K5QA 1EZ6A 1Y8NB 5C44B 3J7YW 1ICWA 3EVQA 5LL6X 2EYLA 4FO2A 5M3MB 1RKNA 2HQEA 3J80E 4DXFA 1Z7TA 3GTMB 1K8MA 2BA0A 1I4GA 2K1BA 4HCEA 1H9RA 1G291 4K14A 4KKTA 3V05A 1CM9A 3LNNA 4TRDA 3QG1A 1PRTB 4WJWA 1HFNA 3OOCA 4NP5A 3DEOA 1HA5A 5KGUA 1AN8A 1WD0A 2J0TD 4FP5D 3VYUA 1U4RA 2FMMA 3LWUA 5FKAC 1E0BA 1B53A 2RA4A 4OO1G 2PZTA 2Z8LA 4L63B 2E76C 3Q6SA 5CV8A 3K6OA 3S1NB 3KF8A 5EKIA 1JWUD 2V4DA 1Q1EA 3BVGA 4XIGS 1IKMA 3I73A 3TP7A 3A8IE 1TS3A 1MSHA 1TS2A 3X3NA 3L9AX 3E6ZX 1I4RA 5FLXL 1BCPF 1SE3A 1SNMA 1KDBA 2A5HA 4KKSA 1ILPA 1KTKA 1GUNA 1LTTD 1NUCA 2JEBI 3H91A 3VA5A 1DXMA 1EY9A 4ZAIA 2WACA 2EY5A 1Z6HA 2B63B 4DA2A 3P7JA 4A3EB 4A3MB 1XX8A 1CTMA 3RLFA 3BDLA 2NVXB 2J4XA 4QB4A 2E75C 3I8ZA 2ZXPA 4KJNA 2VUMB 2D5DA 1KLUD 2SNSA 4K2LA 3C2PA 4CJ1B 1D5ZC 5J39A 3HOXB 1GUGA 2AUJD 3J7AF 4N9PA 2O4XA 5BN5A 1HQMC 3CHBD 4IFDJ 4G57A 1A15A 3C1EA 1D6EC 3M85A 3HOZB 3PIO3 4IUUA 1Y1VB 3T53B 1HQRD 3J7AV 1SJED 4L8JA 3JAME 4FYDA 4XXEA 1BBXC 4DF7A 3MFYA 1CZGA 1ENCA 1IYVA 4C3HB 3I70A 3GP7A 2L9HA 3S17B 1EL0A 1VDZA 4H44C 1C4QA 1G6ZA 2MPMA 1SXTA 5J1ZA 3TBIB 3K5LA 1JQYD 5ISRA 4I65A 3ERQA 3EJIA 3AMUA 4OIKA 3D3RA 1UEAB 4DGZA 2JA8B 1E2WA 2XVSA 1FR3A 2F0HA 4BBSB 1CT1D 5DNFA 2F0FA 3BZDB 4IUTA 2EJMA 1EYAA 2L0CA 4Z9CB 2B2YA 5I4DA 3PV0A 1PMRA 1OXVA 1DONA 4HN7A 4C1NK 3TMEA 5K5PA 3D6CA 3A8KE 1LACA 4IUQA 3SK4A 1AZQA 1CZWA 1SYEA 2XWBB 4F8MA 2K04A 5CV5A 2NWGA 1D5XC 4C1NI 4IFDH 2ICEC 3GD7A 2A6HD 1A3VA 4IUNA 1TU2B 4WFN3 4ZKBB 2BOSA 2PCFB 3Q0AA 3DWAA 1WTRA 3PO3B 4RFBA 1PRTF 1U4MA 1PFBA 1PZJD 2F03A 4DXGA 5KNDA 2JYOA 3IFTA 2CW0D 5IIFA 5CGKA 1LTSD 2F0PA 1S5DD 1EY0A 2WV6D 1F77A 4PV1C 3S1QB 3HOWB 2O5JC 1SYDA 3EFXD 5CV7A 1ZXTA 4CKCA 5I9OA 1X3QA 4KD4A 1VF7A 1WTXA 5EJWA 3HG9A 3M7NA 1B50A 2YU9B 4A3FB 5M3FB 3K59A 1UNSA 2LS01 3HS0C 3S2DB 4FXKC 2JEAI 2R92B 4HTHA 2FJ2A 2B2WA 3Q22A 3N6RA 2EYJA 2CHBD 1O7YA 5A2QE 1V1OA 2LMCB 1AEXA 1LTID 1QCBD 2XRSD 3ZYYX 1NCVA 3RZOB 4EQOA 5EBDA 2NBFA 3R8BA 3K57A 1Q8IA 2K01A 1W6JA 5M9OA 1EY8A 3C1FA 3TDQA 2MHVA 2RKSA 3G6JB 4BBRB 1MD2D 3FDTA 1S5FD 1EIHA 1CHQD 4ID6A 3NPPA 4L6TB 1LTAD 1FNWA 2IX1A 2Q8RE 4FXGC 4CJ0B 4H7BA 3D4DA 1G2TA 1EFID 2HDLA 3H6MA 2EY2A 3E0JA 3Q24A 2EJFC 2TSSA 4H13C 5EBCA 3MTSA 1R4PB 3KBGA 5K36G 2B2YC 2KJXA 1BCPB 1STAA 3URYA 2KEDA 5CV9A 3X3MA 3SDZA 5DEHA 1TQOA 4R9WA 2D62A 2HUGA 3T16A 1HUMA 1EEID 1EU3A 1LO5D 1T5EA 2EDGA 2N88A 1EYCA 3KLSA 2EPBA 4M1UB 1SNCA 1YNJD 3QJYA 1R4QB 2G9HD 1F2LA 3T56B 3NTHA 4IQZA 4FF3A 2M9VA 2AWOA 3EROA 3S14B 4OL7A 2Z4HA 2ZXRA 4U68A 2PZUA 3F2UA 4A3IB 4HSPA 1WTOA 2K7VA 5A35A 4CKEA 1PFMA 1SJHD 3I4MB 2JSOA 1TT2A 1TVXA 1II3A 5M5YB 1RODA 3OWEB 4BY1B 4ZRZA 3MZ5A 1RTOA 1DJRD 2F0WA 1RCVD 3ONAB 4IURA 4AYBB 3L7ZC 4F88A 3QIAA 4XTCS 5JEAJ 2B2WC 5C3EB 3J81E 1ESFA 3LWEA 1LABA 3O13A 2WKDA 4HEDA 4DNRB 2IX3A 1PTOD 1QILA 4C56C 3IFDA 1Y8PB 3NTKA 4RA8A 1CHPD 3R2TA 2Q8TA 1SMYC 3TZUA 4LMQD 1JORA 4GZYC 5LL6S 4RGMA 4WORA 1ESRA 3R93A 5CYUA 3I72A 4DU9A 1GOZA 3D8GA 2XNAC 1NAPA 4PMBA 1LT6D 4J1MA 4BA1I 3NP8A 4NMZA 4RHSA 5AFWA 3CU7A 3MXNA 1MBYA 3PO2B 5JEAG 4K2KA 5C4XB 3MHBA 3PMFA 1A2TA 4LAAA 3NK9A 1ENAA 5T1IA 2PO4A 3OMGA 3IAYA 1I4HA 3KUPA 4FXDA 1BOSA 1F9PA 1DOKA 1JWSD 3FEWX 3EA6A 3BDOA 3DHQA 3OIPA 3T51B 3S16B 2F0DA 4DK1A 4G7HC 3SEBA 2K32A 3J80L 2JA7B 2EE1A 2X6GA 1RD9D 1EWCA 1Q90A 5JOBA 1AW7A 4IN3A 3SE0A 4ILWA 4X3UA 4KV6A 1YNJC 3NBHA 2NZ1D 3VA7A 4YIJA 1HXYD 4LK1C 4KK7A 3NXWA 3RZDB 1W6KA 2F0OA 1BNZA 2PQEA 1WTWA 1ILQA 1FNUA 4RKBA 5ELDA 3NE5B 2D2CC 3K5OA 3MA2B 2EYHA 1JB3A 3MFGA 3WOEA 2MJ8A 5CV4A 4OO1H 4QIWB 1SAPA 1SYCA 2JXMB 3I91A 4H0LC 4UAIA 1HHVA 1IW7C 4P2CB 4EGVA 4ZUJA 1MSGA 4KY6A 1JWMD 4IFDI 5FO8B 3GQBA 2F3VA 1QB5D 5CC4A 2VXWA 2LY7A 1WTQA 4O1NA 4G7OC 1XXGA 3P75A 4MHEA 1G8ZD 1S5ED 1Q12A 4XYQA 4WRDA 2AUKA 2RVLA 1O7LA 1PTOC 2WIIB 3NHHA 4JBWA 1SYGA 1SYFA 2NB0A 1V43A 4XQQA 1A3UA 2F0LA 4A3BB 4B9WA 1V1PA 3DM1A 5JAVA 1WTPA 1U4PA 1L0XB 2B2UC 4CBVA 2LKVA 3E5SA 1J8IA 2B39A 2I07B 4KN4C 4F7XA 3K5MA 2QKIC 3S15B 2F0GA 1E2ZA 1UAPA 1GUSA 3QOJA 3M4YA 3JAML 2A68C 1OXTA 5C5LA 5M5XB 2C9OA 5J22A 2E2DC 2KA7A 4HMIA 1M4VA 3A56A 1CI3M 3CRLC 5ELFA 5EQ0A 2MGSA 2Y0SB 4Q5VA 3HP3A 3D4RA 5IGFA 1B2TA 5JJZA 4ZUIA 1TY2A 4ODGA 1LT3D 3GTOB 4LJZC 1V8QA 2FINB 1ENFA 3CRKC 3NWSA 3A55A 2WP8J 2ICIA 3VR4A 4ZK9B 1X32A 5EKLA 2FFKB 2N55A 1EQTA 1EU4A 3P20A 5C0XJ 1QJOA 2KQ3A 3HEJA 1SNOA 3T4AC 5ELBA 3PUVA 3DUZA 3ND9A 1EIGA 1X3PA 2XWJB 5CV6A 2SNMA 3QO2A 5D65A 3DEPA 3I4NB 4UDUC 3MEHA 1QOHA 1SE4A 1NR4A 1BQQT 4A3KB 2B2TA 3FPPA 1WD1A 2A73B 4RWSC 2F0VA 3HKZB 1B4OA 2EJGC 1F2YA 5COYA 1AZPA 3PUWA 4U673 4KD3A 4KJOA 2O5IC 1LTGD 5E1FA 5KYLA 4EQPA 3OIQA 1SNPA 3VR2A 3BVZA 5C0XG 4DNTB 3L3OC 4ZLTF 5BN3A 4NKLA 1B3AA 2M00A 5C4ZA 3IL8A 4Q0FA 3OW7A 3I4LA 5IGGA 2M2LA 3BVMA 2BA1A 3R2IA 1H9MA 1HTPA 2IL8A 1O7ZA 5BN4A 1Q3LA 2F3WA 1WCMB 2K5DA 1ZYRC 1EYDA 1Y1WB 1S5BD 2QF7A 5HGTA 3SXHA 4RKLA 5FO9B 1CK1A 1I6VC 2Z1CA 3BYYB 4C3IB 5IGBA 3HOVB 3DWPA 5JVH3 4DN4M 1ET6A 5DAUA 2L1BA 1IKLA 3A7LA 4RGOS 2QCPX 5T1GA 1DOMA 5A2QL 2KECA 3S1MB 2PYKA 1IHZA 4ABNA 4TKOB 2WAQB 1STYA 3NUCA 3RD4A 4ZKCB 4PMWA 2R7ZB 1PZID 3H09A 1F9SA 2VNUD 1OO9B 3DWQA 1U4LA 3HZXA 4R8NA 5IOCA 2R3ZA 1DCZA 3FRPB 1SMYD 4RGTA 1I4QA 1Z47A 3S1RB 2PZWA 2EYOA 1VCIA 4KY5A 4A3GB 2F0JA 1SE2A 2MUYA 2WKCA 4MN3A 1I4PA 3KK7A 3VYTA 1S5CD 2CVRA 5FK9C 4KY7A 5C6AA 3FVQA 5G3LD 1SDFA 4A93B 4C3IG 5EPLA 1SSOA 3GV3A 5ELCA 1HUNA 3V2TA 3VYSA 5CR3A 2E74C 3D6WA 1HA6A 4NW2A 1JOOA 2GA4B 3U9SA 2L5TA 2RDHA 5CMDA 2NN6G 1J9OA 1K8OA 1L0YB 2L55A 4X3TA 1QNUA 1TS5A 1PYWD 2KHSA 2B8GA 2VB2X 3C3LA 4OGQC 5K36H 1LTRD 1DOLA 1KNAA 2B2TC 4A3JB 3K58A 5IT9E 1STBA 1PRTC 2KCNA 5FO7B 3PIP3 2EOTA 1B9MA 2BCOA 2SOBA 4KHZA 3OHXC 2DY7A 1EY4A 2NN6H 4C2MB 1JE4A 1HTLD 2RQXA 5IODA 2NVQB 4XDXA 4HAEA 5IGCA 3FMCA 2E2HB 4CJ2C 4J6HA 2OEOA 3A8JE 1CA5A 4IALA 5C5MA 1D2BA 2B8FA 3H94A 1IW7D 5JPNC 3QOLA 1NSNS 2XN9C 1ZEQX 2L4NA 2NTTA 1QWYA 1A2UA 2NUCA 1V1PB 1PTOF 4OO1I 2B2UA 4NDXA 1GHJA 1D1IA 3NWTA 4FVMA 2EXZA 3FKIB 1RDPD 2JA5B 2EY6A 1LLRD 2JA6B 3J81L 2IWHA 2F1MA 1VF5C 2RDGA 1LV9A 2K03A 5EKKA 3TP8A 2R61A 3WOFA 5KRUA 4G7ZC 3DMUA 3HOUB 3GTPB 2BE5D 1TWAB 3NQTA 3N52A 2RSNA 2R93B 1JOKA 2A69C 5E3FA 2PW7A 3V96A 5JPMC 2NYZD 1DZ1A 4ME5A 1KABA 1XTCD 3FPUB 1TY0A 1BF4A 2KEEA 4XQNA 1D1KA 5E4WC 2A68D 1T5XD 5D3DA 1IL8A 3W2DA 4QMGA 1YNND 3A54A 2QEJC 3MVVA 1O80A 4KN7C 3RUZA 1TS4A 2HCIA 1TIID 2K05A 5JEAH 2IX0A 2CQAA 5I6WA 2A6EC 3CKIB 4EQNA 1U9RA 3S9WA 2G9DA 3MAQA 3HRZC 2WB1B 2L12A 4M8AA 4FF1A 2F0NA 2FHTA 4XYOA 1SBBB 3P1HA 5CORA 2DY8A 3M7GA 4MIUA 2MP1A 4X3SA 1O78A 3HGBA 5FLXE 1HFGA 1UUPA 2QILA 2NTSA 2EVBA 5C4JB 2KUMA 4BWGB 1I3QB 5EPKA 1F2ZA 2OT2A 5D3IB 2F0MA 3KLRA 2K5WA 1H9KA 5KNBA 3M4OB 4BA2I 1LT5D 2JE6I 2PW5A 1TWFB 4K5XA 3MXPA 1Y8OB 3BS1A 2XIWA 4HCSA 1BO0A 1BCPD 1EY7A 4QUFA 2F0KA 3GTKB 1GHKA 5I9PA 1B44D 1BXTA 2IJ0A 4CGYB 4R8IA 2ZXOA 1NR2A 4XQJA 4QF4A 1A3TA 4V190 2IW3A 2PPBC 1KAAA 2E2JB 1ML0D 4QCLA 4PNYA 1ZYRD 2RDFA 3VYRA 3GTJB 1CQFA 2OF1A 3C46A 2JP1A 4JK1C 1HPCA 2X6LA 5M5WB 4RCNA 3OSOA 2J7ZA 2TMPA 2BE5C 3OMCA 3NQIA 1ZKOA 1MGSA 4K8IA 3NBIA 3OPOA 3SK5A 4Y7NB 1TWGB 3K5NA 2I46A 1SEBD 4F87A 3D31A 2RBMA 1JCKB 2F0IA 3TN2A 3HOYB 1PDQA 3SVMA 3R3OA 2R6GA 2XSCA 3SHLA 2AQ1B 4RH6A 5C0XI 3A7AB 4IUPA 4KMUC 3ITPA 3DXJC 2DNCA 3NSWA 1YNNC 1G2SA 1TR5A 2EYMA 2QDBA 4OIJA 4ZYSA 2L11A 3BYTB 3EQLC 1FD7D 2FMCA 2DN8A 1FGBD 1DD2A 1GJXA 4IFDG 2A74C 1H9SA 4K5WA 3VR3A 4FF4A 2Z4IA 1XWEA 1F9QA 2F0UA 2ZT9C 2AWNA 3U9OA 1PZKD 1STGA 2XRQD 3VR5A 1D5MC 5FOBB 2IT1A 5IGEA 5JVG3 3TP6A 1SYBA 3QWNA 4IZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF1 A;  4K5V A;  2F0G A;  2EYO A;  4NKL A;  1STA A;  3T13 A;  4IAL A;  5C5M A;  1EYA A;  2M00 A;  5C4Z A;  3MVV A;  4KY5 A;  3VA5 A;  2F0J A;  3OSO A;  4RKB A;  5CV9 A;  3RUZ A;  3QOJ A;  1EY9 A;  3QOL A;  2WAC A;  5KEE A;  3SR1 A;  3OMC A;  2EY5 A;  5IGG A;  4HTH A;  2F0E A;  5C5L A;  2EYH A;  1NSN S;  1TQO A;  5DEH A;  1EZ6 A;  4K8I A;  3TME A;  3BDC A;  2EYJ A;  5J22 A;  2OXP A;  5I6W A;  5EGT A;  4DFA A;  2EYF A;  4EQN A;  4KY7 A;  4HMI A;  3D6C A;  3SK5 A;  1U9R A;  5K5P A;  3S9W A;  3EVQ A;  5C6A A;  1A2U A;  1AEX A;  1KDC A;  2EYL A;  2NUC A;  2F3W A;  1SNQ A;  1RKN A;  2HQE A;  4KHV A;  3T16 A;  5CV4 A;  1JOR A;  5F2D A;  4B9X A;  2F0N A;  1EYD A;  5KIX A;  3BDL A;  4WOR A;  3SK4 A;  4DU9 A;  1SYC A;  4QB4 A;  1SYE A;  4NDX A;  4EQO A;  4F8M A;  2RBM A;  3D8G A;  3OWF A;  2F0I A;  4KJN A;  5CV5 A;  4ZUJ A;  1EYC A;  3P1H A;  5HGT A;  4PMB A;  4KY6 A;  3R3O A;  3SHL A;  1SND A;  3SK8 A;  4K14 A;  5IGF A;  2OEO A;  3SXH A;  4MIU A;  1STN A;  1SNC A;  3V2T A;  4RKL A;  1STH A;  4ZUI A;  4J1M A;  5CR3 A;  4ODG A;  5M9O A;  1EY8 A;  2SNS A;  3D4W A;  4S3S A;  1A3V A;  1F2M A;  2EXZ A;  4IUN A;  4K2L A;  3NP8 A;  4NMZ A;  1EQV A;  3C1F A;  4TRD A;  2F3V A;  1EY5 A;  4HMJ A;  5CC4 A;  2EY6 A;  5C3X A;  5J39 A;  2ENB A;  5IGB A;  3ITP A;  1EZ8 A;  4NP5 A;  1KDA A;  1JOO A;  4K2K A;  4N9P A;  1EY6 A;  2O4X A;  2RKS A;  3P75 A;  4PMC A;  3MHB A;  5KGU A;  3PMF A;  5EKL A;  1A2T A;  4LAA A;  5DAU A;  3NK9 A;  1TR5 A;  1ENA A;  2EYM A;  4G57 A;  3C1E A;  5EKK A;  3OMG A;  1F2Z A;  2QDB A;  3SK6 A;  2F0M A;  2KHS A;  2F0S A;  2KQ3 A;  1SNO A;  3ERO A;  3HEJ A;  4WRD A;  3TP8 A;  5KRU A;  4ID6 A;  5C3W A;  2PZT A;  4OL7 A;  2EY1 A;  2PW5 A;  2EYP A;  3DMU A;  2F0T A;  3DHQ A;  2PZU A;  3NQT A;  2F0D A;  5CV8 A;  3NHH A;  5CV6 A;  4K8J A;  2SNM A;  4K5X A;  1SYG A;  1SYF A;  1STB A;  2PYK A;  3LX0 A;  1IHZ A;  3D4D A;  4H7B A;  1JOK A;  4DF7 A;  2F0Q A;  3MXP A;  5E3F A;  3MEH A;  1ENC A;  5HUR A;  1STY A;  2PW7 A;  3NUC A;  4K5W A;  1A3U A;  5JOB A;  3TP5 A;  2F0L A;  5IIF A;  5CGK A;  5NUC A;  4ME5 A;  1KAB A;  4ZQ3 A;  2F0P A;  3QB3 A;  3TP7 A;  5KYI A;  1EY0 A;  3H6M A;  1TT2 A;  1EY7 A;  5J1Z A;  4B9W A;  2F0U A;  2EY2 A;  2F0K A;  1II3 A;  2F0V A;  4KV6 A;  5I9P A;  4E6I A;  5C4H A;  5ISR A;  1JOQ A;  4I65 A;  3ERQ A;  2SOB A;  5JAV A;  4EVO A;  1F2Y A;  1SYD A;  3EJI A;  4YIJ A;  3HZX A;  4KTA A;  5CV7 A;  3U9O A;  1EY4 A;  5IGD A;  3MZ5 A;  4KD3 A;  4KJO A;  2LKV A;  3E5S A;  4R8N A;  5E1F A;  1SNM A;  5IOC A;  5KYL A;  1STG A;  4QF4 A;  5I9O A;  4PNY A;  5I6Y A;  1A3T A;  4KD4 A;  4EQP A;  3NXW A;  1KDB A;  2F0W A;  4DGZ A;  5IOD A;  1SNP A;  2F0O A;  2F0H A;  1KAA A;  2PQE A;  4IZ8 A;  4K6D A;  4N9T A;  4F7X A;  5IGC A;  4QMG A;  4J6H A;  5IGE A;  2F0F A;  1NUC A;  3TP6 A;  1SYB A;  2RDF A;  2PZW A; 
#chains in the Genus database with same CATH topology
 5ELE A;  3JC6 6;  3GTK H;  3T13 A;  3F2D A;  1C0A A;  3BG3 A;  2X69 A;  4RCO A;  4K6L A;  2IY5 B;  4JYA L;  5DM7 3;  1YNX A;  4DK0 A;  3PUX A;  3TSS A;  4J8Q A;  5KEE A;  2F0E A;  1QNK A;  5E4X A;  3HOY G;  2OXP A;  1YHB A;  1QE6 A;  5IP7 H;  2E2J H;  1ONL A;  1BR9 A;  4TVA B;  1TWH B;  5DM6 3;  5F2D A;  1BCP C;  3GTJ H;  1H9J A;  2UUA L;  5M5W H;  1X3F A;  4LF5 Q;  4C3H G;  5IYB G;  4YCU A;  4AQY Q;  2CH4 A;  4JI6 L;  4GKK L;  1JJ2 A;  1B9N A;  4BXX G;  4JC0 A;  1STH A;  1PTO B;  5IT9 c;  4V0B A;  2NVT B;  3BZC A;  1TWG H;  1EY5 A;  4XT3 B;  5C3X A;  3KLS X;  2K28 A;  4FF2 A;  4PQX A;  1PRT D;  1FL0 A;  2RSO A;  3S15 H;  4JOI C;  4A3C G;  4HSV A;  1G91 A;  3VR6 A;  3PUZ A;  4N8X 1;  3SK6 A;  4A3L H;  3ULJ A;  1LTL A;  1PXU A;  4OHJ A;  2EY1 A;  4DAP A;  2EYP A;  5M5X H;  5C0X H;  1K0R A;  4K8J A;  1PH7 A;  4DNI A;  1M8A A;  4RHR A;  2SDF A;  5HUR A;  1ASZ A;  4BS9 A;  1GUW A;  4KI0 A;  1WJJ A;  1LT4 D;  5NUC A;  1SFO B;  4ZQ3 A;  1JC7 A;  2E5L L;  4FNF A;  4DV2 Q;  2BDN A;  1K8G A;  1PFN A;  4G4K A;  1IYU A;  3KBX A;  4DR6 L;  1K28 A;  2HQL A;  4ULL A;  4HJA A;  1I4X A;  2LFN A;  5CBA E;  1JIC A;  3GTO H;  2DJF C;  1CQV A;  2NN6 I;  4A3C H;  2K33 A;  1LTB D;  4X64 L;  4YWK A;  3GTL B;  4IO9 A;  2ID0 A;  5I6Y A;  2PQA B;  1IL2 A;  5KNC A;  4DAV A;  4LFB Q;  1K83 B;  1J5E L;  2JA9 A;  1KXL A;  1JB7 A;  1VMP A;  1STE A;  4B3T L;  3GO5 A;  4K6D A;  2F4V Q;  1BDO A;  2F4I A;  1RF2 D;  5EPJ A;  1HRJ A;  4NPS A;  4DV1 L;  1QVG A;  3MXN B;  2AQ3 B;  3PO3 G;  3UI2 A;  3SR1 A;  4CKB A;  2Z6K C;  1VQ9 A;  2VB3 X;  4DFA A;  4LF6 Q;  2VL6 A;  2EZV A;  1RJT A;  1A63 A;  1JT8 A;  2Q8I B;  2KVM A;  1KDC A;  4A3K H;  2IHF A;  4B3R Q;  2RCF A;  2B2V A;  5AJ3 Q;  5KIX A;  3CXC A;  1TWC B;  4HR7 B;  2MFI A;  5G3L F;  5LHY 1;  2KOL A;  1EWH A;  3MWY W;  4AIM A;  4ALP A;  1SND A;  2CWA A;  1EEF D;  3RMH A;  1KD1 C;  1STN A;  4K0K Q;  1GVP A;  2N78 A;  1B1Z A;  4E6I A;  3NTI A;  1I6H B;  3J81 i;  3HOW G;  2ENB A;  5D14 A;  5I2Y A;  1KDA A;  1WVL A;  3PCO B;  1Q7Y C;  2R7D A;  1EY6 A;  4DV4 L;  2A69 D;  4X3K A;  1CUK A;  2GVA A;  3MXU A;  1I50 B;  1FNV A;  1SR3 A;  3CCR A;  1C48 A;  5CBE E;  1W2B A;  3Q23 A;  4YHH L;  2H1E A;  4APV A;  4LF7 L;  2A6H C;  3G7L A;  1PLF A;  1PTO H;  5C3W A;  3TRZ A;  1MI2 A;  1N34 L;  1VQD A;  2C5C A;  5M3F G;  3AB9 A;  1HNZ L;  2DJG C;  4CHT B;  3GTQ B;  1CFM A;  2VQE L;  1OXS C;  2DNE A;  4EX5 A;  2F0Q A;  1WCM H;  4DV3 Q;  2IPK D;  1KC8 C;  3GV6 A;  3I3C A;  3TP5 A;  2Z0S A;  5KYI A;  4RAU C;  1PA6 A;  3GDE A;  1JOQ A;  1BBU A;  3K7U C;  1F9R A;  4MTN A;  4EVO A;  1GUO A;  4QL5 A;  3W3A A;  4KTA A;  1A6X A;  2CW0 C;  4DR1 L;  1UE6 A;  4C3I H;  5IP9 G;  3HOV H;  1BUV T;  3H0G B;  2A6E D;  3RNU A;  4N9T A;  3ND8 A;  1SMX A;  1JR0 D;  1A8V A;  2WB1 E;  4K5V A;  1XYI A;  1PH8 A;  2E2I B;  3TZD A;  2O2L D;  1GUT A;  1TKW B;  5DLQ E;  1C8C A;  1FYC A;  5IT9 L;  3EBE A;  4KKU A;  3M3Y B;  5FLX c;  4DAY A;  1BBW A;  3CQZ B;  1WTV A;  1QZG A;  3BDC A;  1KL9 A;  4C3J B;  5EGT A;  2HDM A;  1AP0 A;  2EYF A;  1K83 H;  4A3D B;  1RTN A;  1SNQ A;  2YTV A;  4KHV A;  1VQB A;  4B9X A;  1VQC A;  1QG7 A;  1RHP A;  3MC0 B;  1Y69 U;  1DM0 B;  4NXN Q;  2R7Z H;  3OWF A;  1X3G A;  2D9U A;  2N3S A;  3MXG A;  4XT1 B;  1ET9 A;  3SK8 A;  3A5U A;  4OWT B;  1HCZ A;  3H3V C;  2KCC A;  3D4W A;  4S3S A;  5IGD A;  1F2M A;  5TSS A;  1EQV A;  3CW2 C;  4TQU S;  3M4P A;  4HMJ A;  1HR0 L;  1EZ8 A;  1KNE A;  2WIN B;  4PMC A;  2PNR C;  1OXX K;  2YYZ A;  4QJF A;  4LFA L;  4YWL A;  3PUY A;  1GD7 A;  1PH9 A;  2H4O A;  4I7Z C;  2F0S A;  1NE3 A;  5GAG C;  3S2H B;  1OXU A;  4LF5 L;  2F0T A;  3AU7 A;  2PMZ B;  3CAM A;  4YCV A;  3BU2 A;  4JI1 Q;  5LMU L;  4AQY L;  1KLG D;  4QUC A;  3LX0 A;  1S4Z A;  2ZJP A;  4JBK A;  2AQ2 B;  1LM0 A;  3I56 A;  3E9I A;  4A93 H;  1I50 H;  4IUV A;  3KJO A;  1AFP A;  4BY7 B;  1CA6 A;  4O42 A;  3QB3 A;  3TEH B;  4WJ3 M;  1B8A A;  1GXD C;  3WDN A;  1YI2 A;  2BDO A;  5C4H A;  2SEB D;  4B08 A;  3K7A B;  4TSS A;  2HCC A;  1E2V A;  1VMC A;  1R9T B;  2K5H A;  1Q1B A;  3GTG B;  1EOT A;  3K0Y A;  2NVY B;  4DK6 C;  1DYQ A;  1VQA A;  5I2X A;  4C3J G;  4GOP C;  2A1A A;  5FJ8 H;  1OTC A;  4A3D G;  4X66 L;  3CCJ A;  2K6A A;  1XNQ L;  3IKJ A;  4LF9 Q;  1XJV A;  1H9S B;  3JAM c;  4IOA A;  3I90 A;  2ZTE A;  2B2V C;  4RGN A;  4HID A;  2K5Q A;  4A3J H;  1N8R C;  1EZ6 A;  1YIT A;  1Y8N B;  5C44 B;  3J7Y W;  3H0G H;  1ICW A;  1VQL A;  1J6Q A;  3CCL A;  3EVQ A;  5LL6 X;  2EYL A;  4FO2 A;  5FLM G;  5M3M B;  1RKN A;  2HQE A;  3J80 E;  4DXF A;  1Z7T A;  3GTM B;  1K8M A;  4CDC C;  2BA0 A;  1I4G A;  4JI6 Q;  4GKK Q;  2E2I H;  2CQO A;  2K1B A;  4HCE A;  1H9R A;  3I4M G;  3K8A A;  1G29 1;  3KFU A;  4K14 A;  2ASB A;  1XPR A;  1O7I A;  3CQZ H;  4DV0 Q;  4KKT A;  3V05 A;  4C3J H;  1CM9 A;  2B3G A;  3LNN A;  4TRD A;  2UXB Q;  3QG1 A;  2ZTD A;  1PRT B;  4WJW A;  1HFN A;  1RL2 A;  3OOC A;  4NP5 A;  3DEO A;  1HA5 A;  5KGU A;  1AN8 A;  1WD0 A;  4JBJ A;  2J0T D;  4FP5 D;  3VYU A;  2YV5 A;  1U4R A;  2FMM A;  3LWU A;  5FKA C;  4JI3 Q;  1E0B A;  1B53 A;  5AJ3 L;  2RA4 A;  4BY7 G;  4OO1 G;  2PZT A;  2Z8L A;  4L63 B;  3WWV A;  2E76 C;  5IYD H;  3Q6S A;  5CV8 A;  3K6O A;  4QQB X;  3S1N B;  3KF8 A;  3G71 A;  2QA4 A;  3I7F A;  5EKI A;  1JWU D;  2V4D A;  2AHO B;  4N8F A;  1Q1E A;  3BVG A;  2ES2 A;  4XIG S;  1IKM A;  3I73 A;  3TP7 A;  3A8I E;  4A4I A;  1TS3 A;  1MSH A;  1TS2 A;  3S2H H;  3X3N A;  3L9A X;  3E6Z X;  2MNA A;  1I4R A;  5FLX L;  3Q8D A;  3F8T A;  1BCP F;  1SE3 A;  2OTJ A;  4LUZ A;  1X6O A;  2JA5 H;  4B3T Q;  1SNM A;  1KIX A;  2JA6 H;  4KHP L;  1KDB A;  1IXR A;  1N33 Q;  2A5H A;  4KKS A;  1ILP A;  3QR8 A;  4BY7 H;  1KTK A;  5C44 G;  1GUN A;  1LTT D;  1NUC A;  2JEB I;  4I7A A;  3H91 A;  1XPU A;  4UHV A;  4DV3 L;  5C4X G;  4O2D A;  3VA5 A;  1YHQ A;  1DXM A;  2ZTC A;  1W3S A;  2I5M X;  5GQO A;  3K7A H;  3T1Y Q;  1EY9 A;  3FP9 A;  4ZAI A;  1YZ6 A;  2WAC A;  3HOU H;  2EY5 A;  1Z6H A;  2NVY H;  2B63 B;  4DA2 A;  3P7J A;  4A3E B;  4A3M B;  2KBN A;  1XX8 A;  1CTM A;  3RLF A;  3BDL A;  3CPW A;  2NVX B;  2J4X A;  4QB4 A;  2E75 C;  3I8Z A;  2ZXP A;  4KJN A;  2VUM B;  3TS0 A;  3G4S A;  4UP7 A;  4DV6 Q;  2D5D A;  1SRO A;  1KLU D;  1HR0 W;  2I5H A;  2SNS A;  4YY3 L;  4K2L A;  3C2P A;  4CJ1 B;  1D5Z C;  1L2F A;  5J39 A;  3HOX B;  5M3M H;  1GUG A;  3ERS X;  2OWO A;  4B3S L;  3GTM H;  2AUJ D;  3J7A F;  4N9P A;  3PIO A;  2O4X A;  5BN5 A;  5ELO A;  4LF7 Q;  1HQM C;  3K81 C;  1EFW A;  1B7Y B;  3CHB D;  4IFD J;  5IY0 A;  1QVC A;  4G57 A;  1A15 A;  3C1E A;  1D6E C;  3M85 A;  3F2B A;  1RIP A;  1YBY A;  4PZ7 A;  3HOZ B;  4OEM B;  3PIO 3;  4IOC A;  4IUU A;  1Y1V B;  3T53 B;  4NXN L;  1HQR D;  3J7A V;  1SJE D;  4L8J A;  1PYB A;  3JAM E;  4FYD A;  1AH9 A;  4PZ8 A;  1UWV A;  4XXE A;  1BBX C;  4DF7 A;  3MFY A;  1CZG A;  4HJ7 A;  1ENC A;  1IYV A;  4C3H B;  3I70 A;  3GP7 A;  2L9H A;  3S17 B;  1EL0 A;  1VDZ A;  3F2C A;  4H44 C;  1C4Q A;  1G6Z A;  2MPM A;  1SXT A;  2HIV A;  5J1Z A;  3TBI B;  3K5L A;  1JQY D;  5ISR A;  4DR1 Q;  1UE7 A;  4P72 A;  1HH2 P;  3ERQ A;  4I65 A;  1L1O A;  3EJI A;  3AMU A;  3S1N H;  4OIK A;  3D3R A;  1UEA B;  4DPG A;  4DGZ A;  2UUB L;  1E2W A;  2HD3 A;  2JA8 B;  4X6A H;  2XVS A;  1FR3 A;  2F0H A;  5IYC G;  4BBS B;  1CT1 D;  3U50 C;  2Z6B A;  4JI1 L;  2RHQ B;  5DNF A;  2F0F A;  3KLW A;  1I3Q H;  2P5Z X;  2PI2 A;  2B63 G;  2CFM A;  3BZD B;  4IUT A;  2EJM A;  4A3E G;  1EYA A;  2A19 A;  2EQS A;  2L0C A;  2ATW A;  4Z9C B;  2B2Y A;  5I4D A;  4PG3 A;  3PV0 A;  1PMR A;  1OXV A;  1DON A;  4HN7 A;  4C1N K;  3TME A;  2VUM G;  4LF4 L;  1E24 A;  5K5P A;  3D6C A;  3A8K E;  1LAC A;  1MHW C;  3A5Z B;  4IUQ A;  4OXP A;  3SK4 A;  1AZQ A;  1CZW A;  1SYE A;  4DAM A;  2XWB B;  4F8M A;  1PH1 A;  2K04 A;  5CV5 A;  2Q2I A;  2NWG A;  4GNX B;  4GS3 A;  1D5X C;  4C1N I;  1HR0 Q;  4IFD H;  2ICE C;  3GD7 A;  2A6H D;  4A3B G;  1A3V A;  4IUN A;  1TU2 B;  3HOZ G;  1U5K A;  4LF9 L;  3UDX A;  4WFN 3;  4ZKB B;  2BOS A;  2PCF B;  4A3M H;  4LFA Q;  3Q0A A;  1Y1V G;  3DWA A;  2NVX H;  1IBM Q;  3NEM A;  4DAY B;  1WTR A;  3UDI A;  3CD6 A;  3PO3 B;  1AE2 A;  4RFB A;  1SLJ A;  1PRT F;  4IPG A;  5LMU Q;  1T9H A;  1U4M A;  1VQN A;  1PFB A;  1PZJ D;  1V1Q A;  1VQG A;  2F03 A;  4DXG A;  5KND A;  3HOX H;  2JYO A;  4Y7N H;  3K0X A;  3IFT A;  2CW0 D;  4DV0 L;  2QW7 A;  3OYY A;  2UXB L;  5IIF A;  5CGK A;  1LTS D;  2F0P A;  1S5D D;  2JA8 G;  1EY0 A;  3HOZ H;  3HOY H;  2WV6 D;  4BBS G;  2CKZ B;  1F77 A;  4PV1 C;  3S1Q B;  3HOW B;  2O5J C;  1SYD A;  3EFX D;  1DGS A;  4Y52 H;  5CV7 A;  1ZXT A;  4H02 A;  4JI3 L;  4CKC A;  5I9O A;  1Q82 C;  1X3Q A;  4KD4 A;  1VF7 A;  2UXC Q;  4C3H H;  5IYB H;  4X66 Q;  3UE1 A;  1WTX A;  1XNQ Q;  1IYJ B;  5BR8 L;  4BXX H;  4PZ6 A;  5EJW A;  3HG9 A;  4JI4 L;  3M7N A;  1B50 A;  2YU9 B;  4A3F B;  5M3F B;  3K59 A;  1UNS A;  2LS0 1;  3HS0 C;  3S2D B;  1K3R A;  4FXK C;  1VQJ A;  2JEA I;  2R92 B;  4HTH A;  2FJ2 A;  2B2W A;  3Q22 A;  3N6R A;  1EUJ A;  2EYJ A;  2CHB D;  1O7Y A;  5A2Q E;  1V1O A;  2LMC B;  1AEX A;  1LTI D;  4QY7 A;  1EYG A;  1QCB D;  2XRS D;  3ZYY X;  1EQQ A;  1NCV A;  1NJI C;  4UY8 C;  3I4N G;  4GN4 B;  3RZO B;  1N33 L;  1CKN A;  4EQO A;  5EBD A;  2NBF A;  3R8B A;  3K57 A;  1Q8I A;  1VQ5 A;  1VQK A;  1N36 Q;  2K01 A;  2I5L X;  1W6J A;  5M9O A;  1EY8 A;  4GOP A;  3C1F A;  3TDQ A;  3T1Y L;  3CPF A;  2PMZ E;  2MHV A;  1EIF A;  2RKS A;  3G6J B;  4UP9 A;  3HKS A;  1NY4 A;  4BBR B;  4A76 A;  1MD2 D;  3FDT A;  1S5F D;  2D0P A;  1EIH A;  4UPA A;  4LFC Q;  1CHQ D;  4ID6 A;  3NPP A;  4L6T B;  4AH6 A;  1LTA D;  3PF5 A;  1FNW A;  2IX1 A;  3J7Z C;  2Q8R E;  4FXG C;  4CJ0 B;  4DV6 L;  2IHE A;  3D4D A;  4H7B A;  4OEL B;  2KHI A;  3KJP A;  2YTY A;  1TWH H;  3I55 A;  1G2T A;  3PO3 H;  1L1O C;  4L5S A;  1EFI D;  1S40 A;  2HDL A;  3H6M A;  3CME A;  1PH5 A;  2EY2 A;  3E0J A;  1X54 A;  1Y1W G;  3RLO A;  3Q24 A;  4JI0 Q;  4KHP Q;  2NVT H;  4A3F G;  2EJF C;  2TSS A;  4H13 C;  5EBC A;  1SN8 A;  3J7A 5;  4IPH A;  3MTS A;  3J80 c;  2R92 G;  1R4P B;  3KBG A;  5K36 G;  1M1K C;  1KQS A;  2B2Y C;  2KJX A;  1BCP B;  2UU9 Q;  1G6P A;  1YJW A;  3KF8 B;  1STA A;  4DR5 Q;  3URY A;  2KHJ A;  2KED A;  3S1Q H;  1XMQ Q;  5CV9 A;  3HOW H;  3X3M A;  3SDZ A;  5DEH A;  1TQO A;  4R9W A;  3G6E A;  3U58 A;  3ULP A;  3W1B A;  2D62 A;  2L15 A;  2MQH A;  2HUG A;  3T16 A;  1IBK L;  1HUM A;  4R4T A;  1SFO H;  1EEI D;  1EU3 A;  1LO5 D;  5L37 A;  5M3F H;  3S2D H;  1T5E A;  2EDG A;  2N88 A;  2WAQ G;  4YY3 Q;  1EYC A;  3KLS A;  4MTK A;  2ZJR A;  2EPB A;  4BBR G;  4M1U B;  1SNC A;  4DR2 L;  1YNJ D;  4B3S Q;  3GTL H;  1K8A C;  3QJY A;  1R4Q B;  2G9H D;  1F2L A;  2A8V A;  4DV7 L;  4X65 Q;  2CWP A;  3T56 B;  4JV5 L;  1Z9F A;  3NTH A;  1XTD A;  4OWX B;  3KDF B;  4IPC A;  3BJU A;  4IQZ A;  1I94 L;  4FF3 A;  2M9V A;  2VW9 A;  5IP9 H;  2AWO A;  3ERO A;  3S14 B;  4OL7 A;  4R1J A;  2Z4H A;  2ZXR A;  4U68 A;  2PZU A;  4A3G G;  3F2U A;  4A3I B;  3AFQ A;  4HSP A;  1WTO A;  2K7V A;  3CMA A;  5A35 A;  1BKB A;  4CKE A;  1PFM A;  2HIX A;  1S72 A;  1SJH D;  3I4M B;  1TWC H;  2JSO A;  1TT2 A;  2G5D A;  1B70 B;  4OX9 Q;  1TVX A;  3LGJ A;  1II3 A;  5M5Y B;  1IBM L;  1JMC A;  1ROD A;  3OWE B;  4BY1 B;  2UUB Q;  4ZRZ A;  3MZ5 A;  2UUC L;  1I6H H;  1RTO A;  3UE0 A;  1DJR D;  2F0W A;  1RCV D;  3ONA B;  4IUR A;  4AYB B;  3L7Z C;  4F88 A;  1PH6 A;  3QIA A;  4XTC S;  5JEA J;  2B2W C;  4GN3 B;  2JQO A;  1E22 A;  5C3E B;  3J81 E;  1ESF A;  3LWE A;  1LAB A;  1JJG A;  3O13 A;  2WKD A;  2B29 A;  4HED A;  4LF4 Q;  4DNR B;  4HJ8 A;  3GTQ H;  2IX3 A;  1PTO D;  3MEF A;  5HY6 A;  1HNW Q;  1QIL A;  4C56 C;  3IFD A;  1Y8P B;  3PSI A;  3NTK A;  4RA8 A;  1CHP D;  4MZ9 A;  3R2T A;  1PYS B;  2Q8T A;  1SMY C;  3TZU A;  4LMQ D;  1L1O B;  1UEB A;  1WOC A;  4JW0 A;  1JOR A;  4MNO A;  5E7N A;  4GZY C;  5LL6 S;  4RGM A;  4WOR A;  4HIM A;  1ESR A;  3R93 A;  5CYU A;  3I72 A;  4DU9 A;  1GOZ A;  3D8G A;  2XNA C;  4DR7 Q;  1NAP A;  1KRS A;  4PMB A;  1LT6 D;  3D0F A;  4JPB W;  3CC4 A;  3OTO Q;  1VQE A;  4J1M A;  3TQY A;  4BA1 I;  3NP8 A;  4NMZ A;  1XPO A;  4RHS A;  5AFW A;  2ZM6 Q;  4X62 Q;  5IWA L;  3CU7 A;  3MXN A;  1MBY A;  3PO2 B;  5JEA G;  4K2K A;  5C4X B;  5GRO A;  4A3I G;  3MHB A;  3PMF A;  1A2T A;  4LAA A;  3NK9 A;  1ENA A;  5T1I A;  2PO4 A;  1M90 C;  3OMG A;  3IAY A;  1I4H A;  3KUP A;  1QZH A;  3M3Y H;  4FXD A;  1BOS A;  1F9P A;  1FVI A;  1FJG Q;  1DOK A;  1JWS D;  3FEW X;  3EA6 A;  3BDO A;  3DHQ A;  3OIP A;  3T51 B;  3S16 B;  1V9P A;  2F0D A;  4DK1 A;  4G7H C;  3CC2 A;  3SEB A;  2K32 A;  1NTG A;  3J80 L;  4DR4 Q;  2EE1 A;  2JA7 B;  4A3D H;  1D7Q A;  2X6G A;  1Y14 B;  4BY1 G;  3STB D;  1N36 L;  1RD9 D;  1EWC A;  4LUV A;  1Q90 A;  3AEV A;  5JOB A;  1AW7 A;  4IN3 A;  3SE0 A;  4ILW A;  4L5R C;  3JAM i;  4AYB G;  4X3U A;  3S14 H;  5JJI A;  3A0J A;  5IE8 A;  4KV6 A;  3PF4 A;  3U4V A;  1YNJ C;  3NBH A;  2NZ1 D;  5FLM H;  5C3E G;  3VA7 A;  4A3I H;  4YIJ A;  1HXY D;  1K3B C;  4LK1 C;  1YJ9 A;  4KK7 A;  4LFC L;  5BR8 Q;  5JJL A;  3NXW A;  4JI4 Q;  3I4M H;  3RZD B;  3FKI G;  1W6K A;  2F0O A;  1EOV A;  1BNZ A;  2PQE A;  1WTW A;  1ILQ A;  5M5Y H;  1HZA A;  4KLK A;  3CCV A;  1FNU A;  4BY1 H;  4RKB A;  5ELD A;  3H3V I;  3NE5 B;  2D2C C;  3K5O A;  3MA2 B;  2EYH A;  4JI0 L;  1JB3 A;  3MFG A;  3WOE A;  2MJ8 A;  3EIV A;  2LXJ A;  2ALY B;  5CV4 A;  4OO1 H;  5C3E H;  1NMF A;  2R93 G;  4RMF A;  4QIW B;  1SAP A;  1SYC A;  2JXM B;  2R7F A;  3I91 A;  4H0L C;  4UAI A;  1VQ6 A;  3PO2 G;  1HHV A;  1IW7 C;  4P2C B;  4EGV A;  4ZUJ A;  1MSG A;  1VQ7 A;  4KY6 A;  1JWM D;  2UU9 L;  4IFD I;  4R4Q A;  2LXK A;  5FO8 B;  3GQB A;  4DR5 L;  1R9T H;  1XMQ L;  2F3V A;  1QB5 D;  3GTG H;  5CC4 A;  2VXW A;  1MKH A;  2LY7 A;  1WTQ A;  4O1N A;  4G7O C;  1XXG A;  3P75 A;  5LMN W;  2JA7 G;  5GAH C;  4FDB A;  2JN4 A;  4MHE A;  1G8Z D;  1S5E D;  1Q12 A;  1PVO A;  3E3X A;  4YCW A;  4XYQ A;  4WRD A;  2AUK A;  2RVL A;  1O7L A;  1PTO C;  3DLL A;  2CH4 W;  2WII B;  5C44 H;  3NHH A;  4JBW A;  1SYG A;  1SYF A;  1CKN B;  3UDF A;  5C4X H;  2NB0 A;  3NEN A;  1V43 A;  1K9M C;  4XQQ A;  1A3U A;  2MO1 A;  2F0L A;  4GOP B;  4X65 L;  1HNX L;  2N8N A;  4A3B B;  1EQR A;  1EIY B;  4B9W A;  3IRB A;  1XNR Q;  4DK3 C;  4R4O A;  2GVB A;  1ICF B;  4IJL A;  1V1P A;  3S16 H;  3DM1 A;  5JAV A;  1WTP A;  1U4P A;  2JA7 H;  1L0X B;  2B2U C;  4CBV A;  1QUQ A;  2LKV A;  3CC7 A;  3E5S A;  3CCU A;  1J8I A;  3FHW A;  1AE3 A;  2B39 A;  2I07 B;  4KN4 C;  4DR3 L;  4F7X A;  3K5M A;  2QKI C;  3S15 B;  2VS1 A;  2F0G A;  1E2Z A;  1UAP A;  1GUS A;  3QOJ A;  3M4Y A;  3JAM L;  5JJK A;  2VY3 A;  2A68 C;  2HT1 A;  1OXT A;  5C5L A;  4L5T A;  5M5X B;  4OX9 L;  2C9O A;  5J22 A;  3STB C;  1IBK Q;  4JI5 Q;  2E2D C;  3RZD H;  2KA7 A;  4HMI A;  2K52 A;  1M4V A;  4OON A;  2HHH Q;  3A56 A;  1IBL Q;  3I2Z A;  1X55 A;  4LNQ A;  2UXD Q;  1CI3 M;  3CRL C;  4JI2 Q;  4DR2 Q;  5ELF A;  5EQ0 A;  2MGS A;  2Y0S B;  4Q5V A;  3RN5 A;  3HP3 A;  1WI5 A;  3D4R A;  5IGF A;  1B2T A;  4DV7 Q;  5JJZ A;  3H3V H;  2LSS A;  3BZK A;  4ZUI A;  1TY2 A;  4ODG A;  1SRU A;  2C35 B;  3HFZ B;  1LT3 D;  3GTO B;  4JV5 Q;  4LJZ C;  1V8Q A;  2FIN B;  1D8L A;  1K73 C;  1ENF A;  3CRK C;  3NWS A;  3A55 A;  5LMN Q;  1I94 Q;  2WP8 J;  2ICI A;  3VR4 A;  4ZK9 B;  1X32 A;  1HNW L;  1VQH A;  5EKL A;  2FFK B;  2N55 A;  4GLA C;  2GN5 A;  1EQT A;  1EU4 A;  3P20 A;  5C0X J;  1QJO A;  5IP7 G;  3CCE A;  2F52 A;  2KQ3 A;  3HEJ A;  1SNO A;  3T4A C;  3CCS A;  1N32 L;  5ELB A;  3PUV A;  3DUZ A;  3ND9 A;  1EIG A;  5IYC H;  1X3P A;  2XWJ B;  1NBW A;  4JBM A;  5CV6 A;  2SNM A;  3QO2 A;  1PHJ A;  4DR7 L;  2K14 A;  5D65 A;  2B63 H;  3DEP A;  1K0S A;  3OTO L;  4A3E H;  4UDU C;  3I4N B;  3MEH A;  3M9B A;  1QOH A;  1SE4 A;  1NR4 A;  4NXM Q;  1BQQ T;  4A3K B;  2ZM6 L;  2B2T A;  4X62 L;  3FPP A;  1WD1 A;  3CCM A;  2A73 B;  4RWS C;  2VUM H;  2UUC Q;  2F0V A;  3HKZ B;  2K75 A;  1G51 A;  1B4O A;  2EJG C;  1F2Y A;  5COY A;  1AZP A;  3PUW A;  3KYH C;  5GAE C;  4U67 3;  3EN2 A;  4KD3 A;  1HZC A;  1VS0 A;  4KJO A;  4UP8 A;  1LTG D;  5E1F A;  2O5I C;  5KYL A;  4LF8 Q;  4EQP A;  4A3L G;  3OIQ A;  1FJG L;  1BVS A;  1SNP A;  4DV5 Q;  3VR2 A;  3BVZ A;  5C0X G;  4DNT B;  4DR4 L;  3L3O C;  4A3B H;  4ZLT F;  5BN3 A;  4NKL A;  1B3A A;  2OQK A;  2M00 A;  1YHA A;  5C4Z A;  2JK8 A;  3M4Q A;  2D0O A;  1N9W A;  1HZ9 A;  3RR5 A;  3IL8 A;  5H1S E;  1Y1V H;  4Q0F A;  3OW7 A;  3I4L A;  5IGG A;  2OTL A;  2M2L A;  3BVM A;  1L0W A;  2Y0S G;  1VQF A;  2BA1 A;  3ULL A;  3R2I A;  1H9M A;  1HTP A;  2IL8 A;  1KRT A;  1O7Z A;  5BN4 A;  1Q3L A;  2F3W A;  1WCM B;  2K5D A;  1ZYR C;  3S17 H;  1EYD A;  1C9O A;  1JJC B;  1Y1W B;  1S5B D;  2QF7 A;  3KF6 A;  2Q2U A;  5HGT A;  1E1O A;  3SXH A;  5IWA Q;  4RKL A;  4ZCK A;  4O0A A;  5FO9 B;  1CK1 A;  3TS2 A;  1I6V C;  2Z1C A;  1X9N A;  2JA8 H;  3BYY B;  4C3I B;  5IGB A;  3HOV B;  4BBS H;  3DWP A;  5JVH 3;  2CCZ A;  4GLX A;  4DN4 M;  1ET6 A;  5DAU A;  2L1B A;  3AQQ A;  4HIK A;  2WFW A;  1IKL A;  4GLV B;  3CF5 A;  4OWW B;  4A3K G;  3A7L A;  4RGO S;  2QCP X;  5T1G A;  1DOM A;  5A2Q L;  2KEC A;  3HKZ G;  3S1M B;  4CDE C;  2PYK A;  1I5F A;  1IHZ A;  4ABN A;  4TKO B;  2WAQ B;  1STY A;  3NUC A;  3J81 c;  4AYB E;  2JJQ A;  3RD4 A;  4ZKC B;  4PMW A;  3CCQ A;  2R7Z B;  1PZI D;  2H5X A;  3F1Z A;  4HJ9 A;  4JI8 Q;  3H09 A;  1F9S A;  3ICE A;  2VNU D;  1X65 A;  1OO9 B;  3DWQ A;  1U4L A;  3HZX A;  2BH2 A;  4R8N A;  5IOC A;  3I4N H;  2R3Z A;  1DCZ A;  2K5V A;  2YTX A;  4B3M Q;  1H95 A;  3FRP B;  1YVC A;  1SMY D;  1I4Q A;  4RGT A;  1Z47 A;  3S1R B;  2PZW A;  2EYO A;  1VCI A;  1WCM G;  4DUZ Q;  4KY5 A;  4A3G B;  2F0J A;  1SE2 A;  2MUY A;  2WKC A;  4MN3 A;  5ELN A;  4JI7 Q;  1I4P A;  3KK7 A;  3VYT A;  1S5C D;  1PH4 A;  2CVR A;  5FK9 C;  1Q86 C;  1XNR L;  1HZB A;  3T1H Q;  4KY7 A;  2PI2 E;  4IPD A;  5C6A A;  3FVQ A;  2K5N A;  5G3L D;  1SDF A;  3KOJ A;  3NBH B;  4A93 B;  2OCE A;  4POG A;  3PQI A;  4C3I G;  1GKH A;  5EPL A;  3HOV G;  1SSO A;  3GV3 A;  3H15 A;  5ELC A;  1P8L A;  1HUN A;  2VZA A;  3V2T A;  3VYS A;  1EWI A;  5CR3 A;  4ME3 A;  2E74 C;  3D6W A;  1HA6 A;  3SGI A;  1PH3 A;  1Q8K A;  4NW2 A;  4R4C A;  1JOO A;  2GA4 B;  2EXD A;  3U9S A;  2L5T A;  1Y1W H;  2RDH A;  4JI5 L;  5CMD A;  2NN6 G;  1J9O A;  2YU9 H;  4A3F H;  1K8O A;  1L0Y B;  2L55 A;  4X3T A;  1QNU A;  2HHH L;  1TS5 A;  1UE1 A;  1PYW D;  2KHS A;  1IBL L;  3A74 A;  2R92 H;  2B8G A;  2VB2 X;  3PIP A;  3C3L A;  4OGQ C;  2UXD L;  5K36 H;  2K4K A;  1A0I A;  1LTR D;  3J80 i;  1DOL A;  4JI2 L;  4HJ5 A;  1KNA A;  2B2T C;  4A3J B;  2R7Z G;  3W5O A;  3K58 A;  5IT9 E;  1STB A;  1PRT C;  4GNX A;  2KCN A;  5FO7 B;  1HNX Q;  3J81 j;  3PIP 3;  2EOT A;  1B9M A;  2BCO A;  3RZO H;  2VQF Q;  5LMN L;  3ZJY C;  2Q2H A;  4JG2 A;  1JE5 A;  2SOB A;  2EIF A;  4KHZ A;  3OHX C;  3S1M H;  2DY7 A;  3S24 A;  1EY4 A;  2NN6 H;  4C2M B;  4DR3 Q;  1JE4 A;  1HTL D;  1MJE A;  2AMC B;  3TP6 A;  1CKM A;  2RQX A;  5IOD A;  2NVQ B;  4XDX A;  2I0Q A;  4HAE A;  4BBR H;  3FMC A;  5IGC A;  2E2H B;  4CJ2 C;  4J6H A;  2OEO A;  3A8J E;  4DUY L;  1CA5 A;  4RG1 A;  4IAL A;  5C5M A;  1D2B A;  4NXM L;  4QIW E;  2B8F A;  4A93 G;  2AKW B;  3H94 A;  1PFS A;  2UXC L;  1IW7 D;  5JPN C;  1LYL A;  3QOL A;  3G48 A;  4GKJ Q;  1NSN S;  2E8G A;  2XN9 C;  1ZEQ X;  4LUO A;  2L4N A;  1YEZ A;  2NTT A;  4YWM A;  3OW2 A;  1QWY A;  1A2U A;  2NUC A;  1V1P B;  3S1R H;  1PTO F;  1C7Y A;  4OO1 I;  2F3I A;  3VDY A;  4LF8 L;  1QUQ B;  2B2U A;  3UDG A;  5EAY A;  4CDF C;  4A3G H;  4NDX A;  4DV5 L;  1GHJ A;  1CSQ A;  1D1I A;  2ZJQ A;  4IJH A;  3NWT A;  5FJ8 G;  4FVM A;  1VQ8 A;  2EXZ A;  3FKI B;  1P16 A;  1RDP D;  1LUZ A;  2EY6 A;  1LLR D;  2JA6 B;  2JA5 B;  3J81 L;  1E7Z A;  4A3J G;  2IWH A;  2F1M A;  3ER0 A;  1VF5 C;  1N32 Q;  2RDG A;  3H0G G;  1XMO Q;  1LV9 A;  2K03 A;  5EKK A;  1KHI A;  5HGQ A;  1VQP A;  2PQA A;  4LW1 A;  3TP8 A;  2R61 A;  3WOF A;  5KRU A;  4G7Z C;  3RN2 A;  1PH2 A;  1Q81 C;  4A75 A;  3DMU A;  3HOU B;  3GTP B;  2BE5 D;  1TWA B;  3NQT A;  3N52 A;  2RSN A;  3NEL A;  2R93 B;  1JOK A;  2A69 C;  1UE5 A;  4QGU A;  5E3F A;  2PNH A;  2XGT A;  1FGU A;  2PW7 A;  3V96 A;  5JPM C;  4JYA Q;  2NYZ D;  4P71 A;  1DZ1 A;  4ME5 A;  1KAB A;  4NB3 A;  4JVZ A;  1XTC D;  3FPU B;  2RHS B;  1TY0 A;  1BF4 A;  2KEE A;  4XQN A;  4DV2 L;  1D1K A;  5E4W C;  4P73 A;  2A68 D;  2MO0 A;  2QGQ A;  1T5X D;  2Q2T A;  2UUA Q;  5D3D A;  1U0L A;  5IYD G;  4HIO A;  1IL8 A;  3W2D A;  4QMG A;  1YNN D;  3A54 A;  2KCM A;  4LFB L;  1PV4 A;  2QEJ C;  3MVV A;  1O80 A;  1WFQ A;  2F4V L;  4KN7 C;  3RUZ A;  1TS4 A;  1VQ4 A;  2HCI A;  1TII D;  2K05 A;  5JEA H;  4C2M H;  2IX0 A;  2Y0S E;  1VQM A;  2CQA A;  5I6W A;  2A6E C;  4JI8 L;  2NVQ H;  3CKI B;  4EQN A;  1U9R A;  3S9W A;  2G9D A;  3MAQ A;  1GO3 E;  2E2H H;  3HRZ C;  4GN5 A;  2WB1 B;  2L12 A;  4M8A A;  4FF1 A;  1X3E A;  4LF6 L;  2F0N A;  2JA5 G;  2OQ0 A;  2JA6 G;  4B3M L;  2FHT A;  4P74 A;  4XYO A;  4B3R L;  1SBB B;  1B3Q A;  1MIU A;  3P1H A;  2KEN A;  5GAD C;  5COR A;  2DY8 A;  3M7G A;  4MIU A;  2MP1 A;  4X3S A;  1ASY A;  4P75 A;  1O78 A;  4DKA C;  3PGZ A;  4DUZ L;  3HGB A;  4POF A;  5FLX E;  1HFG A;  4K0K L;  2N49 A;  1UUP A;  2E5L Q;  2QIL A;  2NTS A;  4JI7 L;  3HOU G;  2EVB A;  4DR6 Q;  5C4J B;  1VQO A;  3CP0 A;  2KUM A;  3T1H L;  4BWG B;  1I3Q B;  5EPK A;  1F2Z A;  1CSP A;  2OT2 A;  2V1C C;  5D3I B;  4X64 Q;  4GNX C;  2F0M A;  3KLR A;  3B6Y A;  4WJ4 A;  2K5W A;  1QVF A;  1H9K A;  5KNB A;  3M4O B;  4BA2 I;  1LT5 D;  3FKI H;  2JE6 I;  2PW5 A;  3HKZ E;  1J5E Q;  4JOI A;  1TWF B;  4K5X A;  3L2P A;  1VQI A;  3KF6 B;  3MXP A;  1Y8O B;  3K80 C;  3BS1 A;  2DUD A;  4DV1 Q;  2XIW A;  4HCS A;  1BO0 A;  1BCP D;  1EY7 A;  5M3M G;  4QUF A;  4CDD C;  2F0K A;  3GTK B;  1GHK A;  5I9P A;  1B44 D;  1BXT A;  3GTP H;  1TWA H;  2IJ0 A;  2DGY A;  3KDF A;  4CGY B;  1GM5 A;  4EQ5 A;  4R8I A;  2ZXO A;  1NR2 A;  2R93 H;  4XQJ A;  4QF4 A;  1KAW A;  3W1G A;  1A3T A;  2XTI A;  2NZH A;  3DM3 A;  3PO2 H;  4V19 0;  2IW3 A;  4L5Q A;  2PPB C;  1KAA A;  2E2J B;  1ML0 D;  4QCL A;  4PNY A;  1E3P A;  1ZYR D;  2RDF A;  3VYR A;  3GTJ B;  1CQF A;  2OF1 A;  3C46 A;  2JP1 A;  4JK1 C;  1HJP A;  1HPC A;  2X6L A;  5M5W B;  2WB1 G;  4RCN A;  3OSO A;  2J7Z A;  2TMP A;  2BE5 C;  4R4I A;  3OMC A;  3NQI A;  2FXQ A;  1ZKO A;  2QEX A;  2VQF L;  1MGS A;  1WYD A;  4DV4 Q;  4K8I A;  3NBI A;  1A62 A;  1IZ6 A;  3OPO A;  3SK5 A;  1TWG B;  4Y7N B;  3K5N A;  2I46 A;  2KCT A;  4YHH Q;  2Z6K A;  1N34 Q;  1SEB D;  4F87 A;  2NZO A;  3D31 A;  2RBM A;  1JCK B;  1HNZ Q;  2F0I A;  3TN2 A;  3HOY B;  1PDQ A;  3SVM A;  2VQE Q;  3L0O A;  3R3O A;  2R6G A;  2XSC A;  3SHL A;  2AQ1 B;  2K50 A;  1SE8 A;  4RH6 A;  5C0X I;  3A7A B;  4IUP A;  3AYH B;  1YIJ A;  4KMU C;  1MJC A;  1WTH A;  3ITP A;  2Z9H A;  4GKJ L;  1NMG A;  1Q46 A;  3E0E A;  3DXJ C;  2DNC A;  3NSW A;  3TRE A;  1YNN C;  1G2S A;  1TR5 A;  2WAQ E;  2EYM A;  3I4O A;  2QDB A;  4OIJ A;  1CKO A;  4ZYS A;  2L11 A;  1TXY A;  3BYT B;  1E1T A;  3EQL C;  1FD7 D;  2FMC A;  3E9H A;  2DN8 A;  1FGB D;  1DD2 A;  1GJX A;  3RLN A;  4IFD G;  5C4J H;  2A74 C;  4J15 A;  1H9S A;  4LWC A;  1YJN A;  1NNX A;  4K5W A;  3VR3 A;  3U4Z A;  4A3M G;  2QDL A;  4FF4 A;  2Z4I A;  1XWE A;  1F9Q A;  2BH8 A;  3AFP A;  2F0U A;  3M4O H;  1X56 A;  2ZT9 C;  1S3O A;  1XMO L;  1TWF H;  2AWN A;  3U9O A;  2RF4 A;  5J3B A;  1PZK D;  1STG A;  2XRQ D;  3VR5 A;  4JCV E;  4DUY Q;  5FOB B;  2IT1 A;  2RCN A;  5IGE A;  5JVG 3;  3HOX G;  1D5M C;  1SYB A;  3QWN A;  4IZ8 A; 
#chains in the Genus database with same CATH homology
 5ELE A;  3T13 A;  3BG3 A;  2X69 A;  4RCO A;  4K6L A;  5DM7 3;  4DK0 A;  3PUX A;  3TSS A;  4J8Q A;  5KEE A;  2F0E A;  1QNK A;  5E4X A;  2OXP A;  1QE6 A;  1ONL A;  1BR9 A;  1TWH B;  5DM6 3;  5F2D A;  1BCP C;  1H9J A;  4C3H G;  1B9N A;  1STH A;  1PTO B;  4V0B A;  2NVT B;  1EY5 A;  4XT3 B;  5C3X A;  3KLS X;  2K28 A;  4FF2 A;  4PQX A;  1PRT D;  2RSO A;  4HSV A;  1G91 A;  3VR6 A;  3PUZ A;  3SK6 A;  1PXU A;  4OHJ A;  2EY1 A;  4DAP A;  2EYP A;  5C0X H;  4K8J A;  1M8A A;  4RHR A;  2SDF A;  5HUR A;  4BS9 A;  1GUW A;  4KI0 A;  1LT4 D;  5NUC A;  1SFO B;  4ZQ3 A;  1JC7 A;  4FNF A;  2BDN A;  1PFN A;  4G4K A;  1IYU A;  3KBX A;  4ULL A;  1I4X A;  2LFN A;  5CBA E;  1JIC A;  1CQV A;  2NN6 I;  2K33 A;  1LTB D;  3GTL B;  2ID0 A;  5I6Y A;  5KNC A;  4DAV A;  1K83 B;  1VMP A;  1STE A;  3GO5 A;  4K6D A;  1BDO A;  2F4I A;  1RF2 D;  5EPJ A;  1HRJ A;  2AQ3 B;  3UI2 A;  3SR1 A;  4CKB A;  2VB3 X;  4DFA A;  2EZV A;  1RJT A;  2Q8I B;  2KVM A;  1KDC A;  2B2V A;  5KIX A;  1TWC B;  4HR7 B;  5G3L F;  5LHY 1;  2KOL A;  1EWH A;  3MWY W;  1SND A;  1EEF D;  3RMH A;  1STN A;  1B1Z A;  4E6I A;  3NTI A;  1I6H B;  2ENB A;  5D14 A;  5I2Y A;  1KDA A;  1WVL A;  1EY6 A;  2A69 D;  4X3K A;  3MXU A;  1I50 B;  1FNV A;  1C48 A;  5CBE E;  3Q23 A;  2H1E A;  2A6H C;  3G7L A;  1PLF A;  1PTO H;  5C3W A;  1MI2 A;  2C5C A;  3AB9 A;  4CHT B;  3GTQ B;  1CFM A;  1OXS C;  2DNE A;  2F0Q A;  2IPK D;  3GV6 A;  3I3C A;  3TP5 A;  5KYI A;  4RAU C;  1JOQ A;  1F9R A;  4EVO A;  1GUO A;  3W3A A;  4KTA A;  1A6X A;  2CW0 C;  1BUV T;  3H0G B;  2A6E D;  4N9T A;  3ND8 A;  1JR0 D;  1XYI A;  4K5V A;  2E2I B;  3TZD A;  2O2L D;  1GUT A;  1TKW B;  1C8C A;  1FYC A;  5IT9 L;  4KKU A;  3M3Y B;  4DAY A;  3CQZ B;  1WTV A;  3BDC A;  4C3J B;  5EGT A;  2HDM A;  1AP0 A;  2EYF A;  4A3D B;  1RTN A;  1SNQ A;  4KHV A;  4B9X A;  1QG7 A;  1RHP A;  3MC0 B;  1Y69 U;  1DM0 B;  3OWF A;  2D9U A;  3MXG A;  4XT1 B;  1ET9 A;  3SK8 A;  1HCZ A;  3H3V C;  2KCC A;  3D4W A;  4S3S A;  5IGD A;  1F2M A;  5TSS A;  1EQV A;  4TQU S;  4HMJ A;  1EZ8 A;  1KNE A;  2WIN B;  4PMC A;  2PNR C;  1OXX K;  2YYZ A;  3PUY A;  2H4O A;  4I7Z C;  2F0S A;  3S2H B;  1OXU A;  2F0T A;  3AU7 A;  2PMZ B;  1KLG D;  4QUC A;  3LX0 A;  1S4Z A;  2AQ2 B;  4IUV A;  1AFP A;  4BY7 B;  1CA6 A;  4O42 A;  3QB3 A;  1GXD C;  3WDN A;  2BDO A;  5C4H A;  2SEB D;  4B08 A;  3K7A B;  4TSS A;  2HCC A;  1E2V A;  1VMC A;  1R9T B;  1Q1B A;  3GTG B;  1EOT A;  3K0Y A;  2NVY B;  1DYQ A;  5I2X A;  4C3J G;  2K6A A;  3IKJ A;  1H9S B;  3I90 A;  2B2V C;  4RGN A;  2K5Q A;  1EZ6 A;  1Y8N B;  5C44 B;  3J7Y W;  1ICW A;  3EVQ A;  5LL6 X;  2EYL A;  4FO2 A;  5M3M B;  1RKN A;  2HQE A;  3J80 E;  4DXF A;  1Z7T A;  3GTM B;  1K8M A;  2BA0 A;  1I4G A;  2K1B A;  4HCE A;  1H9R A;  1G29 1;  4K14 A;  4KKT A;  3V05 A;  1CM9 A;  3LNN A;  4TRD A;  3QG1 A;  1PRT B;  4WJW A;  1HFN A;  3OOC A;  4NP5 A;  3DEO A;  1HA5 A;  5KGU A;  1AN8 A;  1WD0 A;  2J0T D;  4FP5 D;  3VYU A;  1U4R A;  2FMM A;  3LWU A;  5FKA C;  1E0B A;  1B53 A;  2RA4 A;  4OO1 G;  2PZT A;  2Z8L A;  4L63 B;  2E76 C;  3Q6S A;  5CV8 A;  3K6O A;  3S1N B;  3KF8 A;  5EKI A;  1JWU D;  2V4D A;  1Q1E A;  3BVG A;  4XIG S;  1IKM A;  3I73 A;  3TP7 A;  3A8I E;  1TS3 A;  1MSH A;  1TS2 A;  3X3N A;  3L9A X;  3E6Z X;  1I4R A;  5FLX L;  1BCP F;  1SE3 A;  1SNM A;  1KDB A;  2A5H A;  4KKS A;  1ILP A;  1KTK A;  1GUN A;  1LTT D;  1NUC A;  2JEB I;  3H91 A;  3VA5 A;  1DXM A;  1EY9 A;  4ZAI A;  2WAC A;  2EY5 A;  1Z6H A;  2B63 B;  4DA2 A;  3P7J A;  4A3E B;  4A3M B;  1XX8 A;  1CTM A;  3RLF A;  3BDL A;  2NVX B;  2J4X A;  4QB4 A;  2E75 C;  3I8Z A;  2ZXP A;  4KJN A;  2VUM B;  2D5D A;  1KLU D;  2SNS A;  4K2L A;  3C2P A;  4CJ1 B;  1D5Z C;  5J39 A;  3HOX B;  1GUG A;  2AUJ D;  3J7A F;  4N9P A;  2O4X A;  5BN5 A;  1HQM C;  3CHB D;  4IFD J;  4G57 A;  1A15 A;  3C1E A;  1D6E C;  3M85 A;  3HOZ B;  3PIO 3;  4IUU A;  1Y1V B;  3T53 B;  1HQR D;  3J7A V;  1SJE D;  4L8J A;  3JAM E;  4FYD A;  4XXE A;  1BBX C;  4DF7 A;  3MFY A;  1CZG A;  1ENC A;  1IYV A;  4C3H B;  3I70 A;  3GP7 A;  2L9H A;  3S17 B;  1EL0 A;  1VDZ A;  4H44 C;  1C4Q A;  1G6Z A;  2MPM A;  1SXT A;  5J1Z A;  3TBI B;  3K5L A;  1JQY D;  5ISR A;  4I65 A;  3ERQ A;  3EJI A;  3AMU A;  4OIK A;  3D3R A;  1UEA B;  4DGZ A;  2JA8 B;  1E2W A;  2XVS A;  1FR3 A;  2F0H A;  4BBS B;  1CT1 D;  5DNF A;  2F0F A;  3BZD B;  4IUT A;  2EJM A;  1EYA A;  2L0C A;  4Z9C B;  2B2Y A;  5I4D A;  3PV0 A;  1PMR A;  1OXV A;  1DON A;  4HN7 A;  4C1N K;  3TME A;  5K5P A;  3D6C A;  3A8K E;  1LAC A;  4IUQ A;  3SK4 A;  1AZQ A;  1CZW A;  1SYE A;  2XWB B;  4F8M A;  2K04 A;  5CV5 A;  2NWG A;  1D5X C;  4C1N I;  4IFD H;  2ICE C;  3GD7 A;  2A6H D;  1A3V A;  4IUN A;  1TU2 B;  4WFN 3;  4ZKB B;  2BOS A;  2PCF B;  3Q0A A;  3DWA A;  1WTR A;  3PO3 B;  4RFB A;  1PRT F;  1U4M A;  1PFB A;  1PZJ D;  2F03 A;  4DXG A;  5KND A;  2JYO A;  3IFT A;  2CW0 D;  5IIF A;  5CGK A;  1LTS D;  2F0P A;  1S5D D;  1EY0 A;  2WV6 D;  1F77 A;  4PV1 C;  3S1Q B;  3HOW B;  2O5J C;  1SYD A;  3EFX D;  5CV7 A;  1ZXT A;  4CKC A;  5I9O A;  1X3Q A;  4KD4 A;  1VF7 A;  1WTX A;  5EJW A;  3HG9 A;  3M7N A;  1B50 A;  2YU9 B;  4A3F B;  5M3F B;  3K59 A;  1UNS A;  2LS0 1;  3HS0 C;  3S2D B;  4FXK C;  2JEA I;  2R92 B;  4HTH A;  2FJ2 A;  2B2W A;  3Q22 A;  3N6R A;  2EYJ A;  2CHB D;  1O7Y A;  5A2Q E;  1V1O A;  2LMC B;  1AEX A;  1LTI D;  1QCB D;  2XRS D;  3ZYY X;  1NCV A;  3RZO B;  4EQO A;  5EBD A;  2NBF A;  3R8B A;  3K57 A;  1Q8I A;  2K01 A;  1W6J A;  5M9O A;  1EY8 A;  3C1F A;  3TDQ A;  2MHV A;  2RKS A;  3G6J B;  4BBR B;  1MD2 D;  3FDT A;  1S5F D;  1EIH A;  1CHQ D;  4ID6 A;  3NPP A;  4L6T B;  1LTA D;  1FNW A;  2IX1 A;  2Q8R E;  4FXG C;  4CJ0 B;  4H7B A;  3D4D A;  1G2T A;  1EFI D;  2HDL A;  3H6M A;  2EY2 A;  3E0J A;  3Q24 A;  2EJF C;  2TSS A;  4H13 C;  5EBC A;  3MTS A;  1R4P B;  3KBG A;  5K36 G;  2B2Y C;  2KJX A;  1BCP B;  1STA A;  3URY A;  2KED A;  5CV9 A;  3X3M A;  3SDZ A;  5DEH A;  1TQO A;  4R9W A;  2D62 A;  2HUG A;  3T16 A;  1HUM A;  1EEI D;  1EU3 A;  1LO5 D;  1T5E A;  2EDG A;  2N88 A;  1EYC A;  3KLS A;  2EPB A;  4M1U B;  1SNC A;  1YNJ D;  3QJY A;  1R4Q B;  2G9H D;  1F2L A;  3T56 B;  3NTH A;  4IQZ A;  4FF3 A;  2M9V A;  2AWO A;  3ERO A;  3S14 B;  4OL7 A;  2Z4H A;  2ZXR A;  4U68 A;  2PZU A;  3F2U A;  4A3I B;  4HSP A;  1WTO A;  2K7V A;  5A35 A;  4CKE A;  1PFM A;  1SJH D;  3I4M B;  2JSO A;  1TT2 A;  1TVX A;  1II3 A;  5M5Y B;  1ROD A;  3OWE B;  4BY1 B;  4ZRZ A;  3MZ5 A;  1RTO A;  1DJR D;  2F0W A;  1RCV D;  3ONA B;  4IUR A;  4AYB B;  3L7Z C;  4F88 A;  3QIA A;  4XTC S;  5JEA J;  2B2W C;  5C3E B;  3J81 E;  1ESF A;  3LWE A;  1LAB A;  3O13 A;  2WKD A;  4HED A;  4DNR B;  2IX3 A;  1PTO D;  1QIL A;  4C56 C;  3IFD A;  1Y8P B;  3NTK A;  4RA8 A;  1CHP D;  3R2T A;  2Q8T A;  1SMY C;  3TZU A;  4LMQ D;  1JOR A;  4GZY C;  5LL6 S;  4RGM A;  4WOR A;  1ESR A;  3R93 A;  5CYU A;  3I72 A;  4DU9 A;  1GOZ A;  3D8G A;  2XNA C;  1NAP A;  4PMB A;  1LT6 D;  4J1M A;  4BA1 I;  3NP8 A;  4NMZ A;  4RHS A;  5AFW A;  3CU7 A;  3MXN A;  1MBY A;  3PO2 B;  5JEA G;  4K2K A;  5C4X B;  3MHB A;  3PMF A;  1A2T A;  4LAA A;  3NK9 A;  1ENA A;  5T1I A;  2PO4 A;  3OMG A;  3IAY A;  1I4H A;  3KUP A;  4FXD A;  1BOS A;  1F9P A;  1DOK A;  1JWS D;  3FEW X;  3EA6 A;  3BDO A;  3DHQ A;  3OIP A;  3T51 B;  3S16 B;  2F0D A;  4DK1 A;  4G7H C;  3SEB A;  2K32 A;  3J80 L;  2JA7 B;  2EE1 A;  2X6G A;  1RD9 D;  1EWC A;  1Q90 A;  5JOB A;  1AW7 A;  4IN3 A;  3SE0 A;  4ILW A;  4X3U A;  4KV6 A;  1YNJ C;  3NBH A;  2NZ1 D;  3VA7 A;  4YIJ A;  1HXY D;  4LK1 C;  4KK7 A;  3NXW A;  3RZD B;  1W6K A;  2F0O A;  1BNZ A;  2PQE A;  1WTW A;  1ILQ A;  1FNU A;  4RKB A;  5ELD A;  3NE5 B;  2D2C C;  3K5O A;  3MA2 B;  2EYH A;  1JB3 A;  3MFG A;  3WOE A;  2MJ8 A;  5CV4 A;  4OO1 H;  4QIW B;  1SAP A;  1SYC A;  2JXM B;  3I91 A;  4H0L C;  4UAI A;  1HHV A;  1IW7 C;  4P2C B;  4EGV A;  4ZUJ A;  1MSG A;  4KY6 A;  1JWM D;  4IFD I;  5FO8 B;  3GQB A;  2F3V A;  1QB5 D;  5CC4 A;  2VXW A;  2LY7 A;  1WTQ A;  4O1N A;  4G7O C;  1XXG A;  3P75 A;  4MHE A;  1G8Z D;  1S5E D;  1Q12 A;  4XYQ A;  4WRD A;  2AUK A;  2RVL A;  1O7L A;  1PTO C;  2WII B;  3NHH A;  4JBW A;  1SYG A;  1SYF A;  2NB0 A;  1V43 A;  4XQQ A;  1A3U A;  2F0L A;  4A3B B;  4B9W A;  1V1P A;  3DM1 A;  5JAV A;  1WTP A;  1U4P A;  1L0X B;  2B2U C;  4CBV A;  2LKV A;  3E5S A;  1J8I A;  2B39 A;  2I07 B;  4KN4 C;  4F7X A;  3K5M A;  2QKI C;  3S15 B;  2F0G A;  1E2Z A;  1UAP A;  1GUS A;  3QOJ A;  3M4Y A;  3JAM L;  2A68 C;  1OXT A;  5C5L A;  5M5X B;  2C9O A;  5J22 A;  2E2D C;  2KA7 A;  4HMI A;  1M4V A;  3A56 A;  1CI3 M;  3CRL C;  5ELF A;  5EQ0 A;  2MGS A;  2Y0S B;  4Q5V A;  3HP3 A;  3D4R A;  5IGF A;  1B2T A;  5JJZ A;  4ZUI A;  1TY2 A;  4ODG A;  1LT3 D;  3GTO B;  4LJZ C;  1V8Q A;  2FIN B;  1ENF A;  3CRK C;  3NWS A;  3A55 A;  2WP8 J;  2ICI A;  3VR4 A;  4ZK9 B;  1X32 A;  5EKL A;  2FFK B;  2N55 A;  1EQT A;  1EU4 A;  3P20 A;  5C0X J;  1QJO A;  2KQ3 A;  3HEJ A;  1SNO A;  3T4A C;  5ELB A;  3PUV A;  3DUZ A;  3ND9 A;  1EIG A;  1X3P A;  2XWJ B;  5CV6 A;  2SNM A;  3QO2 A;  5D65 A;  3DEP A;  3I4N B;  4UDU C;  3MEH A;  1QOH A;  1SE4 A;  1NR4 A;  1BQQ T;  4A3K B;  2B2T A;  3FPP A;  1WD1 A;  2A73 B;  4RWS C;  2F0V A;  3HKZ B;  1B4O A;  2EJG C;  1F2Y A;  5COY A;  1AZP A;  3PUW A;  4U67 3;  4KD3 A;  4KJO A;  2O5I C;  1LTG D;  5E1F A;  5KYL A;  4EQP A;  3OIQ A;  1SNP A;  3VR2 A;  3BVZ A;  5C0X G;  4DNT B;  3L3O C;  4ZLT F;  5BN3 A;  4NKL A;  1B3A A;  2M00 A;  5C4Z A;  3IL8 A;  4Q0F A;  3OW7 A;  3I4L A;  5IGG A;  2M2L A;  3BVM A;  2BA1 A;  3R2I A;  1H9M A;  1HTP A;  2IL8 A;  1O7Z A;  5BN4 A;  1Q3L A;  2F3W A;  1WCM B;  2K5D A;  1ZYR C;  1EYD A;  1Y1W B;  1S5B D;  2QF7 A;  5HGT A;  3SXH A;  4RKL A;  5FO9 B;  1CK1 A;  1I6V C;  2Z1C A;  3BYY B;  4C3I B;  5IGB A;  3HOV B;  3DWP A;  5JVH 3;  4DN4 M;  1ET6 A;  5DAU A;  2L1B A;  1IKL A;  3A7L A;  4RGO S;  2QCP X;  5T1G A;  1DOM A;  5A2Q L;  2KEC A;  3S1M B;  2PYK A;  1IHZ A;  4ABN A;  4TKO B;  2WAQ B;  1STY A;  3NUC A;  3RD4 A;  4ZKC B;  4PMW A;  2R7Z B;  1PZI D;  3H09 A;  1F9S A;  2VNU D;  1OO9 B;  3DWQ A;  1U4L A;  3HZX A;  4R8N A;  5IOC A;  2R3Z A;  1DCZ A;  3FRP B;  1SMY D;  4RGT A;  1I4Q A;  1Z47 A;  3S1R B;  2PZW A;  2EYO A;  1VCI A;  4KY5 A;  4A3G B;  2F0J A;  1SE2 A;  2MUY A;  2WKC A;  4MN3 A;  1I4P A;  3KK7 A;  3VYT A;  1S5C D;  2CVR A;  5FK9 C;  4KY7 A;  5C6A A;  3FVQ A;  5G3L D;  1SDF A;  4A93 B;  4C3I G;  5EPL A;  1SSO A;  3GV3 A;  5ELC A;  1HUN A;  3V2T A;  3VYS A;  5CR3 A;  2E74 C;  3D6W A;  1HA6 A;  4NW2 A;  1JOO A;  2GA4 B;  3U9S A;  2L5T A;  2RDH A;  5CMD A;  2NN6 G;  1J9O A;  1K8O A;  1L0Y B;  2L55 A;  4X3T A;  1QNU A;  1TS5 A;  1PYW D;  2KHS A;  2B8G A;  2VB2 X;  3C3L A;  4OGQ C;  5K36 H;  1LTR D;  1DOL A;  1KNA A;  2B2T C;  4A3J B;  3K58 A;  5IT9 E;  1STB A;  1PRT C;  2KCN A;  5FO7 B;  3PIP 3;  2EOT A;  1B9M A;  2BCO A;  2SOB A;  4KHZ A;  3OHX C;  2DY7 A;  1EY4 A;  2NN6 H;  4C2M B;  1JE4 A;  1HTL D;  2RQX A;  5IOD A;  2NVQ B;  4XDX A;  4HAE A;  5IGC A;  3FMC A;  2E2H B;  4CJ2 C;  4J6H A;  2OEO A;  3A8J E;  1CA5 A;  4IAL A;  5C5M A;  1D2B A;  2B8F A;  3H94 A;  1IW7 D;  5JPN C;  3QOL A;  1NSN S;  2XN9 C;  1ZEQ X;  2L4N A;  2NTT A;  1QWY A;  1A2U A;  2NUC A;  1V1P B;  1PTO F;  4OO1 I;  2B2U A;  4NDX A;  1GHJ A;  1D1I A;  3NWT A;  4FVM A;  2EXZ A;  3FKI B;  1RDP D;  2JA5 B;  2EY6 A;  1LLR D;  2JA6 B;  3J81 L;  2IWH A;  2F1M A;  1VF5 C;  2RDG A;  1LV9 A;  2K03 A;  5EKK A;  3TP8 A;  2R61 A;  3WOF A;  5KRU A;  4G7Z C;  3DMU A;  3HOU B;  3GTP B;  2BE5 D;  1TWA B;  3NQT A;  3N52 A;  2RSN A;  2R93 B;  1JOK A;  2A69 C;  5E3F A;  2PW7 A;  3V96 A;  5JPM C;  2NYZ D;  1DZ1 A;  4ME5 A;  1KAB A;  1XTC D;  3FPU B;  1TY0 A;  1BF4 A;  2KEE A;  4XQN A;  1D1K A;  5E4W C;  2A68 D;  1T5X D;  5D3D A;  1IL8 A;  3W2D A;  4QMG A;  1YNN D;  3A54 A;  2QEJ C;  3MVV A;  1O80 A;  4KN7 C;  3RUZ A;  1TS4 A;  2HCI A;  1TII D;  2K05 A;  5JEA H;  2IX0 A;  2CQA A;  5I6W A;  2A6E C;  3CKI B;  4EQN A;  1U9R A;  3S9W A;  2G9D A;  3MAQ A;  3HRZ C;  2WB1 B;  2L12 A;  4M8A A;  4FF1 A;  2F0N A;  2FHT A;  4XYO A;  1SBB B;  3P1H A;  5COR A;  2DY8 A;  3M7G A;  4MIU A;  2MP1 A;  4X3S A;  1O78 A;  3HGB A;  5FLX E;  1HFG A;  1UUP A;  2QIL A;  2NTS A;  2EVB A;  5C4J B;  2KUM A;  4BWG B;  1I3Q B;  5EPK A;  1F2Z A;  2OT2 A;  5D3I B;  2F0M A;  3KLR A;  2K5W A;  1H9K A;  5KNB A;  3M4O B;  4BA2 I;  1LT5 D;  2JE6 I;  2PW5 A;  1TWF B;  4K5X A;  3MXP A;  1Y8O B;  3BS1 A;  2XIW A;  4HCS A;  1BO0 A;  1BCP D;  1EY7 A;  4QUF A;  2F0K A;  3GTK B;  1GHK A;  5I9P A;  1B44 D;  1BXT A;  2IJ0 A;  4CGY B;  4R8I A;  2ZXO A;  1NR2 A;  4XQJ A;  4QF4 A;  1A3T A;  4V19 0;  2IW3 A;  2PPB C;  1KAA A;  2E2J B;  1ML0 D;  4QCL A;  4PNY A;  1ZYR D;  2RDF A;  3VYR A;  3GTJ B;  1CQF A;  2OF1 A;  3C46 A;  2JP1 A;  4JK1 C;  1HPC A;  2X6L A;  5M5W B;  4RCN A;  3OSO A;  2J7Z A;  2TMP A;  2BE5 C;  3OMC A;  3NQI A;  1ZKO A;  1MGS A;  4K8I A;  3NBI A;  3OPO A;  3SK5 A;  4Y7N B;  1TWG B;  3K5N A;  2I46 A;  1SEB D;  4F87 A;  3D31 A;  2RBM A;  1JCK B;  2F0I A;  3TN2 A;  3HOY B;  1PDQ A;  3SVM A;  3R3O A;  2R6G A;  2XSC A;  3SHL A;  2AQ1 B;  4RH6 A;  5C0X I;  3A7A B;  4IUP A;  4KMU C;  3ITP A;  3DXJ C;  2DNC A;  3NSW A;  1YNN C;  1G2S A;  1TR5 A;  2EYM A;  2QDB A;  4OIJ A;  4ZYS A;  2L11 A;  3BYT B;  3EQL C;  1FD7 D;  2FMC A;  2DN8 A;  1FGB D;  1DD2 A;  1GJX A;  4IFD G;  2A74 C;  1H9S A;  4K5W A;  3VR3 A;  4FF4 A;  2Z4I A;  1XWE A;  1F9Q A;  2F0U A;  2ZT9 C;  2AWN A;  3U9O A;  1PZK D;  1STG A;  2XRQ D;  3VR5 A;  1D5M C;  5FOB B;  2IT1 A;  5IGE A;  5JVG 3;  3TP6 A;  1SYB A;  3QWN A;  4IZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...