2Q00A

Crystal structure of the p95883_sulso protein from sulfolobus solfataricus. nesg target ssr10.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
120
Chain Sequence
SISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf c02003 protein
publication title Crystal structure of the P95883_SULSO protein from Sulfolobus solfataricus.
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Structural genomics, unknown function
total genus 46
structure length 120
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2q00A00
3C18A 1K40A 1O3UA 3C8GA 3RQEA 4EBKA 1V4AA 3GM3A 3U0CA 2HSBA 5F28E 2L6FA 2LK4A 3JZ0A 3RQGA 4R32A 1K04A 3L8JA 1WWPA 3GM2A 3U3FA 2L6HA 1OW8A 3AJMA 3RQFA 1ZZPA 2JPUA 4XEKA 1PV3A 2L6GA 1WTYA 4NQFA 1OW7A 4XEFA 4XEVA 1K05A 1KNYA 4EBJA 3C8GB 2JX0A 2YWAA 3C8GD 3MFNA 3TULA 3GM1A 1OW6A 3K7DA 1JOGA 2PBEA 3O10A 1QVXA 2KK1A 1UFBA 1KTMA 3L8IA 3S9OA 2Q00A 3B71A 3BRJA 3JYYA 1WOLA
chains in the Genus database with same CATH superfamily
3VYWA 1O3UA 3RQEA 2FFHA 2HSBA 4MVZA 3GANA 2G3VA 3H65A 3B0UX 4W8KA 4G7OF 2IXPA 2HS5A 3KMIA 3R7CA 1FR0A 3S90A 3EH2A 1ZYRF 2ZXRA 4JEAA 2Y69C 2WZFA 2J9WA 1ZHTA 4QDLA 2NSFA 1RCPA 2MHRA 2QUPA 2VCCA 3QTHA 5BUOA 3IQ6A 3DD7A 4DVZA 2DYRC 3S84A 4U5BE 1T6QA 4BPMA 4CS8C 5KYXB 3K7DA 1YYXA 4YN0B 1SF8A 3RVYA 4A2NB 4BJ6C 1QSPA 3JSZA 4MTOA 5A69A 3BRJA 3DXJF 1E84A 1OCCC 2R7WA 2ZXWC 4PJMA 3ZTMA 1V4AA 2CCYA 2W4MA 2L81A 1FMWA 2R7SA 2LFDA 1H9TA 3DAFA 4EUKB 2YL0A 3DM9B 3LEOA 1G5ZA 4Q7CA 5COMA 4KNVA 1BR4A 2C03A 5CIVA 1OCRC 2YZSA 3M1CB 2YEVA 2P7VA 4RD9A 3SYNA 4PJLA 3UMIA 3ZTZA 1WTYA 4MTGA 4DRIB 1HY5A 5B3SC 1EA8A 1T9KA 3ZC4A 4J7TA 2R7UA 2EPLX 2ZPAA 2ZD9A 3IQ5A 4PJNA 3RFYA 2XXAA 1ORSC 2R7VA 3GM1A 4JKVA 1OKKD 3DWWA 2J0WA 4G7HF 4Z9IA 1ZHXA 3PMRA 4BEJA 2UUHA 4H54A 3G50A 3LUTB 5E3CA 4H4KC 1NBBA 3B9QA 2EPOA 4YL1A 1MMGA 3JT1A 2XL8A 1SZIA 3X1OA 2Q7RA 3CAXA 1D0XA 4O6YA 3DE9A 5B1AC 3NDBB 3U5SA 2BE5F 4OD5A 5T3TA 3L8JA 3NMIA 4D4NA 4GQHA 1WN0A 5JLIA 1HE9A 1ORJA 3K1IC 4MVRA 2OEVA 1F1MA 1YJGA 5F5HA 2IOQA 2QE9A 3C8ZA 3NRHA 2OG2A 1D1BA 2WB7A 2XLOA 3MX3A 3W4YA 2EIKC 3SZRA 2L9JA 1Z3IX 2E87A 2DGJA 3SXZA 1VLSA 4AE4A 2KQ9A 4OIPF 3SEOA 3K1HA 3FXHA 3AQBA 3NKDA 1M6TA 1OW6A 1O5HA 3CZ6A 2EILC 2Z15A 1JRAA 2Q00A 3NMKA 2J45A 4PACA 1JMWA 2YHSA 1A7EA 4IRUA 4QI0A 1V74B 2H7OA 5CI8A 1H7IA 2Q9CA 1Q0DA 5F28E 2FAPB 3WODF 2R7OA 3EGXA 4JTDB 2GA0A 3ATPA 1A41A 3LLIA 4XPWA 3EG9B 3G4ZA 4N06A 2NUTA 3RH3A 3UMKA 3JSEO 5JUAA 3KYIA 4JJGA 4WGZA 3AJMA 2NPUA 5JS5A 3RQFA 2GFHA 1U0BB 2LFFA 2V26A 1OR3A 2ICWG 4I3MA 3IPMO 1MMAA 5EK0A 1D0ZA 2CYDA 2XM4A 2XS8A 3GWLA 4YT4A 5EHHA 4UDVA 2JX0A 1BBHA 2AP3A 2EPMX 2YWAA 3EPVA 1RJ9A 2YRFA 4HFFB 4JIOA 2J9VA 1GQAA 3EGDA 1TWHA 2D4UA 3UNGC 3WHNA 3PDMP 3ZSUA 2AWYA 3T6JA 2XLDA 4I44A 4JC7A 2R9RB 2YVKA 2H7BA 3JYYA 4L6RA 4IJJA 4N6CA 2LQGA 4CS9A 2NUPB 3C18A 5KYWA 1D1AA 3LNMB 4E7ZA 4I1OB 4N6HA 4YT2A 3FVYA 3GEHA 2YL7A 4LDQA 2WZLA 3VRCA 1VTMP 3EZHA 5L0GA 1IZMA 4Z9HA 4OIOF 5L0IA 2KNHA 1TR2A 1YDIA 4HFKB 5D91A 5GPGB 1M2VA 1HMDA 4JTCB 5TJ5E 2HJ3A 1VMAA 3KL4A 4DBRA 1FAPB 3ABKC 3T4RA 4C3DA 1AEPA 3N24A 3LJBA 1L7CA 3G4XA 3GEEA 1XWJA 3ABMC 2J7PD 5AC5A 2ZXOA 4CSAA 1LI7A 2GWWA 3MBGA 2KSFA 3CEXA 3AG1C 4A4AA 1NFNA 3B0PA 3TD7A 4JE9A 3EJNA 3C8GA 5A6JA 1CGME 3C63A 3Q7GA 4BEMJ 3M15A 3KPHA 1NSGB 2X51A 4C7OB 5KYUB 4E0IA 1PD0A 3LS1A 3IQCA 2EINC 2NSGA 4FWVA 3TK0A 1YA9A 4DXWA 1M2OA 4P6IC 1YA7O 2Y39A 5JVEA 2Q9AA 4XQ1A 1YZAA 5IY5C 1T5OA 1G8XA 3IEEA 2HV6A 3PHF2 1MNEA 4YT8A 1APCA 4OD4A 5FZTA 3DJUB 4HE8D 5L0HA 2L7AA 3GORA 2C04A 1FNTc 1R4TA 2WVNA 1RMVA 4N4WA 2B0HA 3HNLA 3JRMO 2HFIA 5COGA 1ZW2A 2KK1A 4F4BA 1A7DA 3L8IA 2HUJA 5A6BA 4J30B 4XPYA 1C17M 3B29A 3BEHA 1QQ3A 3HLZA 1LIHA 3SNHA 1MQVA 4U5EE 1OCZC 2XL6A 2CW0F 1Q0MA 4K1OA 5KYXA 1ORYA 1VOMA 2QNLA 4U9DA 1Z23A 3AG3C 3NKEA 3S27A 4B6IA 3Q6NA 2DB4A 1QKRA 5BQGA 2A1DD 2J46A 4XLNF 5BQHA 3AGTA 3EQLF 4LLCA 1T6IA 1V55C 2JPUA 4O6NA 4PFOA 2Q4FA 2J0XA 2UUIA 1OW7A 3CSKA 4QI2A 4XEVA 1E86A 1RKCA 3HKKA 3NYMA 4KI2A 1M56C 3HJCA 2I8BA 3V5ZA 3UMHA 2A0BA 4J7YA 1VYKA 4BJ5A 1KTMA 1D1CA 3QW0A 3RW0A 4MVMA 2VCBA 1WOLA 3EHMA 2PP4A 3LLKA 3R2PA 1BR1A 2XRHA 3ZQVA 4DBQA 1OCOC 1EI7A 1K40A 2A68F 3K66A 2VCAA 4CDYA 3U0CA 1GS9A 4YJWA 4NCQA 2L6FA 1NU9C 1WASA 2J9BA 3M4CA 4XWJA 5JP7A 3QZCA 3O55A 5A6AA 3A11A 4U5FE 2J7PA 5KYYB 1LPEA 2YKZA 3V7OA 2VB6A 1ZHWA 3AGUA 1TKNA 3GM2A 1IW7F 1D0YA 4JTAB 1LI5A 5DS6A 1WGWA 3ASNC 2BC5A 4G78A 3WAQA 4KBLA 4M63A 2D5RB 4CS9C 2IYLD 4D4XA 2OJQA 3KKBA 4LDKA 2XLMA 4O6MA 3NYJA 3UGOA 3UGPA 3TJ5A 1GGQA 1J8YF 1YAUO 4EHPA 3C8GD 2OQMA 3MFNA 3FAJA 1MMNA 4YL3A 1C02A 3T6GB 1N1CA 2X0CA 1NG1A 2AWCA 4U5GA 1OXKA 2XLWA 1R5ID 3N2ZB 1Z7Qc 1VB5A 1A0BA 1QVXA 4ANJA 1Z6AA 1NZEA 3B71A 3QMKA 5L0FA 4DJ9A 2YQYA 1H6GA 1T6UA 1HMOA 3KYJA 4CJOA 2OU6A 1ZU5A 4LDRA 4P9TA 4OINF 5L3VA 3POVA 1JPNA 2W45A 5L0DA 2LCHA 3I5QA 1RKEB 1E85A 2CDQA 4ZLDA 1Z5ZA 3L34A 2R05A 1TFKB 3X2QC 4IB4A 1XZQA 4CSAC 2Y3GA 4ULWA 2KGOA 1E2XA 1FFHA 2P61A 1W2WA 1YLMA 1QPUA 1ZZPA 3E9VA 1NFOA 4DRHB 2XSEA 2WL8A 4C3EA 5HSWA 5A6BD 3MYIA 4C3BA 1K05A 4MVSA 2VASA 3E70C 3NG1A 3EG9A 1WATA 3QVZA 3N0TA 3Q7LA 4LACB 3W8HA 1S7ZA 1SYQA 2G62A 1CPQA 2H7VC 3HNIA 2XS1A 3OA1A 3OEOA 3ZVRA 2RD9A 4OIRF 1UG7A 2NG1A 2Y3BA 3F47A 3TOMA 4WJ0A 3UR3C 4JRZA 3QW1A 2PNOA 3EFOB 4FESA 4GEHA 2HJMA 2XLEA 3ECSA 1EQ1A 2IXMA 3JYHA 4CDAA 3DJNB 2CGEA 1YVIA 1OW8A 4G0HA 5EGYA 4RBNA 2FGYA 3RIPA 1I4ZA 1VK5A 4JZAA 4KNWA 2QLAA 2I15A 2NUPA 5JT4A 3EHNA 4MNDA 3PCVA 2PX0A 2A6HF 3U2LA 3VAYA 3ASOC 5DQZA 3ABLC 3U2MA 4WGYA 2AVKA 5E3AA 4CDVA 3H2UA 1EKYA 1JOGA 2KC3A 1AUEA 3SXKA 1ZU4A 1ZW3A 2HMQA 2ASRA 2P1AA 3L1MA 3Q6MA 1LKXA 5K0IA 1L3PA 1HE1A 2KJGA 3W8IA 2PX3A 1SMYF 4U9EA 3GM3A 2Y3HA 3DKAA 3RVZA 4G7ZF 256BA 3EZIA 1GM5A 5FCLA 3W2VA 1DOWA 4BJ5C 1M57C 3WG7C 4AX2A 2J9UA 2WVOA 5BQIA 2AU5A 2A6EF 2TMVP 2OKUA 2IM8A 4E18A 3FHDA 4NQFA 2HMZA 5B1BC 3SXMA 3ZDLA 2LD6A 2Q3TA 5DS4A 2EPNA 1O87A 1KNYA 4XTKA 3LAYA 1SR2A 4C7OA 4K7BA 3TJ6A 4IWBA 1BZ4A 4CJGA 1CGNA 1FMVA 1QZXA 3I4UA 3NYLA 3O10A 4I1MA 4JW1A 1LS1A 4NTFA 3JRTA 4AL1A 2G3KA 3OWTA 4FX5A 4JCHA 5KYNA 4NTAA 2QTVA 3U3BA 4R32A 2H8AA 2VH3A 3ZG1A 1CGOA 1JR8A 4EWCA 2MWQA 4CBEA 2YL3A 1VYIA 3LNRA 3O6XA 3M79A 2R7XA 5DLJA 1OR2A 3HNJA 1PCXA 3GEIA 2R7QA 3O39A 4LLEA 3FAPB 1T01A 1TQGA 4XEFA 3JCUQ 1E83A 3DI5A 4DVYP 3IHUA 2W4BA 3A9CA 1G4WR 2YLIA 1Q0GA 3AQCA 2IBFA 3K33A 3NMJA 1FTSA 4RDAA 4ULVA 2ETSA 3MYFA 2RSEB 4MS2A 4EBBA 2M4EA 3T9OA 1LS4A 2PF4E 3JTLO 4YWQA 2R7TA 1U89A 3AG2C 3EH1A 2HV7A 4MVUA 2BL2A 5T1DB 4IARA 3RKOF 2XXAB 4MVOA 5DS5A 5T3WA 2OOCA 4W8PA 4LERA 3ZIBA 1S05A 4BG0A 2QY9A 1G4US 4X0RA 5L3QA 4E7SA 3QVYA 4XPXA 2A69F 3K6BA 1PV3A 2L6GA 3LESA 1LE4A 2HZ8A 2LIGA 4FAPB 4GYTA 1LVKA 1Q0KA 2CNWA 2LSEA 3DE8A 1ST6A 4JCZA 3U9MA 3TOLA 5KYYA 3TULA 3FDQA 4OIQF 1XZPA 1CPRA 1TWGA 1BDJB 4PK4A 4E0HA 3DM5A 2Y3DA 4JEBA 4KC9A 3S28A 3U8VA 4ZLCA 2XL4A 4P9FA 4PFPA 4DOZA 5DVWA 2Q9BA 2XM0A 4E17A 4NTBA 4YK5A 4Z9JA 4EBKA 1PD1A 3LS0A 2DI3A 4JJFA 1ZHYA 5COFA 4AE4B 5AC4A 1B68A 1H9GA 1TWAA 1C03A 1K04A 2B0JA 2WVQA 2EIMC 5E33A 1LE2A 3LEVA 1BR2A 3M4BA 3MLGA 2EIJC 4CS8A 4ER9A 4CIPA 3W2WA 2R7RA 2OJED 3FOOA 4BJ6A 1ZVZA 1Q0FA 4XEKA 4BJTA 4MW3A 3AG4C 1LM3B 2YLGA 3IQTA 5JSLA 3SP1A 1YYJA 1RKEA 2V3CC 2R03A 1MMDA 2IXOA 2P6VA 1HW1A 2GDCA 3EGXB 1FFTC 5E2QA 3RF3A 5JRAA 2OCCC 4MTFA 3C62A 3RYLA 2HKVA 2NUTB 4IAQA 3S9OA 1JAFA 3ZQYA 3DZAA 2YLDA 4BJ1A 3J06A 5F5FA 4PJJA 3V5YA 4AL0A 4XLPF 3KH2A 1Y4CA 3C7JA 4U5DE 5D92A 2R02A 2LK4A 1RXQA 3RQGA 1V54C 4CX9A 4YT5A 5A6KA 1ZHZA 1RJ9B 1TWCA 1TFOB 2OEXA 2VC9A 3EGDB 1U6HA 3U3FA 2L6HA 2M64A 3S0XA 4DRJB 1KU2A 4CS7A 2KW3C 3ZWIA 2MYSA 5L0JA 2GAQA 2ZXPA 4WABA 1Z63A 1MNDA 3EFOA 4PR9A 1I5NA 2KYHA 1AVOB 4CIHA 3I5PA 5KYWB 3V5XA 3B0VC 5CI9A 2A0UA 4EKWA 1OQCA 2EPKX 4U5HA 2LP4A 3SXYA 4IAOA 4Q5SF 2XLVA 3H2VA 3CQZA 3F46A 4J32B 4JURI 1Y6DA 3K1IA 4HEAJ 3S29A 3U8PA 5B3IA 1J8MF 4Q4ZF 1NLXA 3FMSA 1YZCA 3DMDA 2P0NA 3HTKC 4MQ9F 1M2VB 2R25A 1OKKA 2O9XA 2JD3A 3L0IA 3JZ0A 4ONSA 4YL0A 5HV9A 3VM6A 4MW8A 4NC3A 4EIYA 3ITFA 3VF0A 2CNWD 4AK9A 1WWPA 3AOUA 3DAGA 1QLEC 2XLHA 2W9YA 1I4YA 2J8WA 4O7GA 3HNKA 3U9JA 4IGGA 4EBJA 3C8GB 2WZGA 1JPJA 5L0CA 2DYSC 1DOVA 1YARO 3GODA 4JVSA 1OXBA 4NY3A 1NU7D 5KYUA 3TQOA 5DQTA 2PBEA 1HW2A 2PFDA 1A7VA 4K0DA 1UFBA 2HSQA 1VLTA 3FOPA 2F22A 2IXNA 4O79A 4U5CE 3GWNA 4MVQA 5AGFA 3T6BA 3US6A 2YL1A
chains in the Genus database with same CATH topology
3C18A 1K40A 1O3UA 3C8GA 3RQEA 4EBKA 1V4AA 3GM3A 3U0CA 2HSBA 5F28E 2L6FA 2LK4A 3JZ0A 3RQGA 4R32A 1K04A 3L8JA 1WWPA 3GM2A 3U3FA 2L6HA 1OW8A 3AJMA 3RQFA 1ZZPA 2JPUA 4XEKA 1PV3A 2L6GA 1WTYA 4NQFA 1OW7A 4XEFA 4XEVA 1K05A 1KNYA 4EBJA 3C8GB 2JX0A 2YWAA 3C8GD 3MFNA 3TULA 3GM1A 1OW6A 3K7DA 1JOGA 2PBEA 3O10A 1QVXA 2KK1A 1UFBA 1KTMA 3L8IA 3S9OA 2Q00A 3B71A 3BRJA 3JYYA 1WOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  1K40 A;  1O3U A;  3C8G A;  3RQE A;  4EBK A;  1V4A A;  3GM3 A;  3U0C A;  2HSB A;  5F28 E;  2L6F A;  2LK4 A;  3JZ0 A;  3RQG A;  4R32 A;  1K04 A;  3L8J A;  1WWP A;  3GM2 A;  3U3F A;  2L6H A;  1OW8 A;  3AJM A;  3RQF A;  1ZZP A;  2JPU A;  4XEK A;  1PV3 A;  2L6G A;  1WTY A;  4NQF A;  1OW7 A;  4XEF A;  4XEV A;  1K05 A;  1KNY A;  4EBJ A;  3C8G B;  2JX0 A;  2YWA A;  3C8G D;  3MFN A;  3TUL A;  3GM1 A;  1OW6 A;  3K7D A;  1JOG A;  2PBE A;  3O10 A;  1QVX A;  2KK1 A;  1UFB A;  1KTM A;  3L8I A;  3S9O A;  2Q00 A;  3B71 A;  3BRJ A;  3JYY A;  1WOL A; 
#chains in the Genus database with same CATH topology
 3VYW A;  1O3U A;  3RQE A;  2FFH A;  2HSB A;  4MVZ A;  3GAN A;  2G3V A;  3H65 A;  3B0U X;  4W8K A;  4G7O F;  2IXP A;  2HS5 A;  3KMI A;  3R7C A;  1FR0 A;  3S90 A;  3EH2 A;  1ZYR F;  2ZXR A;  4JEA A;  2Y69 C;  2WZF A;  2J9W A;  1ZHT A;  4QDL A;  2NSF A;  1RCP A;  2MHR A;  2QUP A;  2VCC A;  3QTH A;  5BUO A;  3IQ6 A;  3DD7 A;  4DVZ A;  2DYR C;  3S84 A;  4U5B E;  1T6Q A;  4BPM A;  4CS8 C;  5KYX B;  3K7D A;  1YYX A;  4YN0 B;  1SF8 A;  3RVY A;  4A2N B;  4BJ6 C;  1QSP A;  3JSZ A;  4MTO A;  5A69 A;  3BRJ A;  3DXJ F;  1E84 A;  1OCC C;  2R7W A;  2ZXW C;  4PJM A;  3ZTM A;  1V4A A;  2CCY A;  2W4M A;  2L81 A;  1FMW A;  2R7S A;  2LFD A;  1H9T A;  3DAF A;  4EUK B;  2YL0 A;  3DM9 B;  3LEO A;  1G5Z A;  4Q7C A;  5COM A;  4KNV A;  1BR4 A;  2C03 A;  5CIV A;  1OCR C;  2YZS A;  3M1C B;  2YEV A;  2P7V A;  4RD9 A;  3SYN A;  4PJL A;  3UMI A;  3ZTZ A;  1WTY A;  4MTG A;  4DRI B;  1HY5 A;  5B3S C;  1EA8 A;  1T9K A;  3ZC4 A;  4J7T A;  2R7U A;  2EPL X;  2ZPA A;  2ZD9 A;  3IQ5 A;  4PJN A;  3RFY A;  2XXA A;  1ORS C;  2R7V A;  3GM1 A;  4JKV A;  1OKK D;  3DWW A;  2J0W A;  4G7H F;  4Z9I A;  1ZHX A;  3PMR A;  4BEJ A;  2UUH A;  4H54 A;  3G50 A;  3LUT B;  5E3C A;  4H4K C;  1NBB A;  3B9Q A;  2EPO A;  4YL1 A;  1MMG A;  3JT1 A;  2XL8 A;  1SZI A;  3X1O A;  2Q7R A;  3CAX A;  1D0X A;  4O6Y A;  3DE9 A;  5B1A C;  3NDB B;  3U5S A;  2BE5 F;  4OD5 A;  5T3T A;  3L8J A;  3NMI A;  4D4N A;  4GQH A;  1WN0 A;  5JLI A;  1HE9 A;  1ORJ A;  3K1I C;  4MVR A;  2OEV A;  1F1M A;  1YJG A;  5F5H A;  2IOQ A;  2QE9 A;  3C8Z A;  3NRH A;  2OG2 A;  1D1B A;  2WB7 A;  2XLO A;  3MX3 A;  3W4Y A;  2EIK C;  3SZR A;  2L9J A;  1Z3I X;  2E87 A;  2DGJ A;  3SXZ A;  1VLS A;  4AE4 A;  2KQ9 A;  4OIP F;  3SEO A;  3K1H A;  3FXH A;  3AQB A;  3NKD A;  1M6T A;  1OW6 A;  1O5H A;  3CZ6 A;  2EIL C;  2Z15 A;  1JRA A;  2Q00 A;  3NMK A;  2J45 A;  4PAC A;  1JMW A;  2YHS A;  1A7E A;  4IRU A;  4QI0 A;  1V74 B;  2H7O A;  5CI8 A;  1H7I A;  2Q9C A;  1Q0D A;  5F28 E;  2FAP B;  3WOD F;  2R7O A;  3EGX A;  4JTD B;  2GA0 A;  3ATP A;  1A41 A;  3LLI A;  4XPW A;  3EG9 B;  3G4Z A;  4N06 A;  2NUT A;  3RH3 A;  3UMK A;  3JSE O;  5JUA A;  3KYI A;  4JJG A;  4WGZ A;  3AJM A;  2NPU A;  5JS5 A;  3RQF A;  2GFH A;  1U0B B;  2LFF A;  2V26 A;  1OR3 A;  2ICW G;  4I3M A;  3IPM O;  1MMA A;  5EK0 A;  1D0Z A;  2CYD A;  2XM4 A;  2XS8 A;  3GWL A;  4YT4 A;  5EHH A;  4UDV A;  2JX0 A;  1BBH A;  2AP3 A;  2EPM X;  2YWA A;  3EPV A;  1RJ9 A;  2YRF A;  4HFF B;  4JIO A;  2J9V A;  1GQA A;  3EGD A;  1TWH A;  2D4U A;  3UNG C;  3WHN A;  3PDM P;  3ZSU A;  2AWY A;  3T6J A;  2XLD A;  4I44 A;  4JC7 A;  2R9R B;  2YVK A;  2H7B A;  3JYY A;  4L6R A;  4IJJ A;  4N6C A;  2LQG A;  4CS9 A;  2NUP B;  3C18 A;  5KYW A;  1D1A A;  3LNM B;  4E7Z A;  4I1O B;  4N6H A;  4YT2 A;  3FVY A;  3GEH A;  2YL7 A;  4LDQ A;  2WZL A;  3VRC A;  1VTM P;  3EZH A;  5L0G A;  1IZM A;  4Z9H A;  4OIO F;  5L0I A;  2KNH A;  1TR2 A;  1YDI A;  4HFK B;  5D91 A;  5GPG B;  1M2V A;  1HMD A;  4JTC B;  5TJ5 E;  2HJ3 A;  1VMA A;  3KL4 A;  4DBR A;  1FAP B;  3ABK C;  3T4R A;  4C3D A;  1AEP A;  3N24 A;  3LJB A;  1L7C A;  3G4X A;  3GEE A;  1XWJ A;  3ABM C;  2J7P D;  5AC5 A;  2ZXO A;  4CSA A;  1LI7 A;  2GWW A;  3MBG A;  2KSF A;  3CEX A;  3AG1 C;  4A4A A;  1NFN A;  3B0P A;  3TD7 A;  4JE9 A;  3EJN A;  3C8G A;  5A6J A;  1CGM E;  3C63 A;  3Q7G A;  4BEM J;  3M15 A;  3KPH A;  1NSG B;  2X51 A;  4C7O B;  5KYU B;  4E0I A;  1PD0 A;  3LS1 A;  3IQC A;  2EIN C;  2NSG A;  4FWV A;  3TK0 A;  1YA9 A;  4DXW A;  1M2O A;  4P6I C;  1YA7 O;  2Y39 A;  5JVE A;  2Q9A A;  4XQ1 A;  1YZA A;  5IY5 C;  1T5O A;  1G8X A;  3IEE A;  2HV6 A;  3PHF 2;  1MNE A;  4YT8 A;  1APC A;  4OD4 A;  5FZT A;  3DJU B;  4HE8 D;  5L0H A;  2L7A A;  3GOR A;  2C04 A;  1FNT c;  1R4T A;  2WVN A;  1RMV A;  4N4W A;  2B0H A;  3HNL A;  3JRM O;  2HFI A;  5COG A;  1ZW2 A;  2KK1 A;  4F4B A;  1A7D A;  3L8I A;  2HUJ A;  5A6B A;  4J30 B;  4XPY A;  1C17 M;  3B29 A;  3BEH A;  1QQ3 A;  3HLZ A;  1LIH A;  3SNH A;  1MQV A;  4U5E E;  1OCZ C;  2XL6 A;  2CW0 F;  1Q0M A;  4K1O A;  5KYX A;  1ORY A;  1VOM A;  2QNL A;  4U9D A;  1Z23 A;  3AG3 C;  3NKE A;  3S27 A;  4B6I A;  3Q6N A;  2DB4 A;  1QKR A;  5BQG A;  2A1D D;  2J46 A;  4XLN F;  5BQH A;  3AGT A;  3EQL F;  4LLC A;  1T6I A;  1V55 C;  2JPU A;  4O6N A;  4PFO A;  2Q4F A;  2J0X A;  2UUI A;  1OW7 A;  3CSK A;  4QI2 A;  4XEV A;  1E86 A;  1RKC A;  3HKK A;  3NYM A;  4KI2 A;  1M56 C;  3HJC A;  2I8B A;  3V5Z A;  3UMH A;  2A0B A;  4J7Y A;  1VYK A;  4BJ5 A;  1KTM A;  1D1C A;  3QW0 A;  3RW0 A;  4MVM A;  2VCB A;  1WOL A;  3EHM A;  2PP4 A;  3LLK A;  3R2P A;  1BR1 A;  2XRH A;  3ZQV A;  4DBQ A;  1OCO C;  1EI7 A;  1K40 A;  2A68 F;  3K66 A;  2VCA A;  4CDY A;  3U0C A;  1GS9 A;  4YJW A;  4NCQ A;  2L6F A;  1NU9 C;  1WAS A;  2J9B A;  3M4C A;  4XWJ A;  5JP7 A;  3QZC A;  3O55 A;  5A6A A;  3A11 A;  4U5F E;  2J7P A;  5KYY B;  1LPE A;  2YKZ A;  3V7O A;  2VB6 A;  1ZHW A;  3AGU A;  1TKN A;  3GM2 A;  1IW7 F;  1D0Y A;  4JTA B;  1LI5 A;  5DS6 A;  1WGW A;  3ASN C;  2BC5 A;  4G78 A;  3WAQ A;  4KBL A;  4M63 A;  2D5R B;  4CS9 C;  2IYL D;  4D4X A;  2OJQ A;  3KKB A;  4LDK A;  2XLM A;  4O6M A;  3NYJ A;  3UGO A;  3UGP A;  3TJ5 A;  1GGQ A;  1J8Y F;  1YAU O;  4EHP A;  3C8G D;  2OQM A;  3MFN A;  3FAJ A;  1MMN A;  4YL3 A;  1C02 A;  3T6G B;  1N1C A;  2X0C A;  1NG1 A;  2AWC A;  4U5G A;  1OXK A;  2XLW A;  1R5I D;  3N2Z B;  1Z7Q c;  1VB5 A;  1A0B A;  1QVX A;  4ANJ A;  1Z6A A;  1NZE A;  3B71 A;  3QMK A;  5L0F A;  4DJ9 A;  2YQY A;  1H6G A;  1T6U A;  1HMO A;  3KYJ A;  4CJO A;  2OU6 A;  1ZU5 A;  4LDR A;  4P9T A;  4OIN F;  5L3V A;  3POV A;  1JPN A;  2W45 A;  5L0D A;  2LCH A;  3I5Q A;  1RKE B;  1E85 A;  2CDQ A;  4ZLD A;  1Z5Z A;  3L34 A;  2R05 A;  1TFK B;  3X2Q C;  4IB4 A;  1XZQ A;  4CSA C;  2Y3G A;  4ULW A;  2KGO A;  1E2X A;  1FFH A;  2P61 A;  1W2W A;  1YLM A;  1QPU A;  1ZZP A;  3E9V A;  1NFO A;  4DRH B;  2XSE A;  2WL8 A;  4C3E A;  5HSW A;  5A6B D;  3MYI A;  4C3B A;  1K05 A;  4MVS A;  2VAS A;  3E70 C;  3NG1 A;  3EG9 A;  1WAT A;  3QVZ A;  3N0T A;  3Q7L A;  4LAC B;  3W8H A;  1S7Z A;  1SYQ A;  2G62 A;  1CPQ A;  2H7V C;  3HNI A;  2XS1 A;  3OA1 A;  3OEO A;  3ZVR A;  2RD9 A;  4OIR F;  1UG7 A;  2NG1 A;  2Y3B A;  3F47 A;  3TOM A;  4WJ0 A;  3UR3 C;  4JRZ A;  3QW1 A;  2PNO A;  3EFO B;  4FES A;  4GEH A;  2HJM A;  2XLE A;  3ECS A;  1EQ1 A;  2IXM A;  3JYH A;  4CDA A;  3DJN B;  2CGE A;  1YVI A;  1OW8 A;  4G0H A;  5EGY A;  4RBN A;  2FGY A;  3RIP A;  1I4Z A;  1VK5 A;  4JZA A;  4KNW A;  2QLA A;  2I15 A;  2NUP A;  5JT4 A;  3EHN A;  4MND A;  3PCV A;  2PX0 A;  2A6H F;  3U2L A;  3VAY A;  3ASO C;  5DQZ A;  3ABL C;  3U2M A;  4WGY A;  2AVK A;  5E3A A;  4CDV A;  3H2U A;  1EKY A;  1JOG A;  2KC3 A;  1AUE A;  3SXK A;  1ZU4 A;  1ZW3 A;  2HMQ A;  2ASR A;  2P1A A;  3L1M A;  3Q6M A;  1LKX A;  5K0I A;  1L3P A;  1HE1 A;  2KJG A;  3W8I A;  2PX3 A;  1SMY F;  4U9E A;  3GM3 A;  2Y3H A;  3DKA A;  3RVZ A;  4G7Z F;  256B A;  3EZI A;  1GM5 A;  5FCL A;  3W2V A;  1DOW A;  4BJ5 C;  1M57 C;  3WG7 C;  4AX2 A;  2J9U A;  2WVO A;  5BQI A;  2AU5 A;  2A6E F;  2TMV P;  2OKU A;  2IM8 A;  4E18 A;  3FHD A;  4NQF A;  2HMZ A;  5B1B C;  3SXM A;  3ZDL A;  2LD6 A;  2Q3T A;  5DS4 A;  2EPN A;  1O87 A;  1KNY A;  4XTK A;  3LAY A;  1SR2 A;  4C7O A;  4K7B A;  3TJ6 A;  4IWB A;  1BZ4 A;  4CJG A;  1CGN A;  1FMV A;  1QZX A;  3I4U A;  3NYL A;  3O10 A;  4I1M A;  4JW1 A;  1LS1 A;  4NTF A;  3JRT A;  4AL1 A;  2G3K A;  3OWT A;  4FX5 A;  4JCH A;  5KYN A;  4NTA A;  2QTV A;  3U3B A;  4R32 A;  2H8A A;  2VH3 A;  3ZG1 A;  1CGO A;  1JR8 A;  4EWC A;  2MWQ A;  4CBE A;  2YL3 A;  1VYI A;  3LNR A;  3O6X A;  3M79 A;  2R7X A;  5DLJ A;  1OR2 A;  3HNJ A;  1PCX A;  3GEI A;  2R7Q A;  3O39 A;  4LLE A;  3FAP B;  1T01 A;  1TQG A;  4XEF A;  3JCU Q;  1E83 A;  3DI5 A;  4DVY P;  3IHU A;  2W4B A;  3A9C A;  1G4W R;  2YLI A;  1Q0G A;  3AQC A;  2IBF A;  3K33 A;  3NMJ A;  1FTS A;  4RDA A;  4ULV A;  2ETS A;  3MYF A;  2RSE B;  4MS2 A;  4EBB A;  2M4E A;  3T9O A;  1LS4 A;  2PF4 E;  3JTL O;  4YWQ A;  2R7T A;  1U89 A;  3AG2 C;  3EH1 A;  2HV7 A;  4MVU A;  2BL2 A;  5T1D B;  4IAR A;  3RKO F;  2XXA B;  4MVO A;  5DS5 A;  5T3W A;  2OOC A;  4W8P A;  4LER A;  3ZIB A;  1S05 A;  4BG0 A;  2QY9 A;  1G4U S;  4X0R A;  5L3Q A;  4E7S A;  3QVY A;  4XPX A;  2A69 F;  3K6B A;  1PV3 A;  2L6G A;  3LES A;  1LE4 A;  2HZ8 A;  2LIG A;  4FAP B;  4GYT A;  1LVK A;  1Q0K A;  2CNW A;  2LSE A;  3DE8 A;  1ST6 A;  4JCZ A;  3U9M A;  3TOL A;  5KYY A;  3TUL A;  3FDQ A;  4OIQ F;  1XZP A;  1CPR A;  1TWG A;  1BDJ B;  4PK4 A;  4E0H A;  3DM5 A;  2Y3D A;  4JEB A;  4KC9 A;  3S28 A;  3U8V A;  4ZLC A;  2XL4 A;  4P9F A;  4PFP A;  4DOZ A;  5DVW A;  2Q9B A;  2XM0 A;  4E17 A;  4NTB A;  4YK5 A;  4Z9J A;  4EBK A;  1PD1 A;  3LS0 A;  2DI3 A;  4JJF A;  1ZHY A;  5COF A;  4AE4 B;  5AC4 A;  1B68 A;  1H9G A;  1TWA A;  1C03 A;  1K04 A;  2B0J A;  2WVQ A;  2EIM C;  5E33 A;  1LE2 A;  3LEV A;  1BR2 A;  3M4B A;  3MLG A;  2EIJ C;  4CS8 A;  4ER9 A;  4CIP A;  3W2W A;  2R7R A;  2OJE D;  3FOO A;  4BJ6 A;  1ZVZ A;  1Q0F A;  4XEK A;  4BJT A;  4MW3 A;  3AG4 C;  1LM3 B;  2YLG A;  3IQT A;  5JSL A;  3SP1 A;  1YYJ A;  1RKE A;  2V3C C;  2R03 A;  1MMD A;  2IXO A;  2P6V A;  1HW1 A;  2GDC A;  3EGX B;  1FFT C;  5E2Q A;  3RF3 A;  5JRA A;  2OCC C;  4MTF A;  3C62 A;  3RYL A;  2HKV A;  2NUT B;  4IAQ A;  3S9O A;  1JAF A;  3ZQY A;  3DZA A;  2YLD A;  4BJ1 A;  3J06 A;  5F5F A;  4PJJ A;  3V5Y A;  4AL0 A;  4XLP F;  3KH2 A;  1Y4C A;  3C7J A;  4U5D E;  5D92 A;  2R02 A;  2LK4 A;  1RXQ A;  3RQG A;  1V54 C;  4CX9 A;  4YT5 A;  5A6K A;  1ZHZ A;  1RJ9 B;  1TWC A;  1TFO B;  2OEX A;  2VC9 A;  3EGD B;  1U6H A;  3U3F A;  2L6H A;  2M64 A;  3S0X A;  4DRJ B;  1KU2 A;  4CS7 A;  2KW3 C;  3ZWI A;  2MYS A;  5L0J A;  2GAQ A;  2ZXP A;  4WAB A;  1Z63 A;  1MND A;  3EFO A;  4PR9 A;  1I5N A;  2KYH A;  1AVO B;  4CIH A;  3I5P A;  5KYW B;  3V5X A;  3B0V C;  5CI9 A;  2A0U A;  4EKW A;  1OQC A;  2EPK X;  4U5H A;  2LP4 A;  3SXY A;  4IAO A;  4Q5S F;  2XLV A;  3H2V A;  3CQZ A;  3F46 A;  4J32 B;  4JUR I;  1Y6D A;  3K1I A;  4HEA J;  3S29 A;  3U8P A;  5B3I A;  1J8M F;  4Q4Z F;  1NLX A;  3FMS A;  1YZC A;  3DMD A;  2P0N A;  3HTK C;  4MQ9 F;  1M2V B;  2R25 A;  1OKK A;  2O9X A;  2JD3 A;  3L0I A;  3JZ0 A;  4ONS A;  4YL0 A;  5HV9 A;  3VM6 A;  4MW8 A;  4NC3 A;  4EIY A;  3ITF A;  3VF0 A;  2CNW D;  4AK9 A;  1WWP A;  3AOU A;  3DAG A;  1QLE C;  2XLH A;  2W9Y A;  1I4Y A;  2J8W A;  4O7G A;  3HNK A;  3U9J A;  4IGG A;  4EBJ A;  3C8G B;  2WZG A;  1JPJ A;  5L0C A;  2DYS C;  1DOV A;  1YAR O;  3GOD A;  4JVS A;  1OXB A;  4NY3 A;  1NU7 D;  5KYU A;  3TQO A;  5DQT A;  2PBE A;  1HW2 A;  2PFD A;  1A7V A;  4K0D A;  1UFB A;  2HSQ A;  1VLT A;  3FOP A;  2F22 A;  2IXN A;  4O79 A;  4U5C E;  3GWN A;  4MVQ A;  5AGF A;  3T6B A;  3US6 A;  2YL1 A; 
#chains in the Genus database with same CATH homology
 3C18 A;  1K40 A;  1O3U A;  3C8G A;  3RQE A;  4EBK A;  1V4A A;  3GM3 A;  3U0C A;  2HSB A;  5F28 E;  2L6F A;  2LK4 A;  3JZ0 A;  3RQG A;  4R32 A;  1K04 A;  3L8J A;  1WWP A;  3GM2 A;  3U3F A;  2L6H A;  1OW8 A;  3AJM A;  3RQF A;  1ZZP A;  2JPU A;  4XEK A;  1PV3 A;  2L6G A;  1WTY A;  4NQF A;  1OW7 A;  4XEF A;  4XEV A;  1K05 A;  1KNY A;  4EBJ A;  3C8G B;  2JX0 A;  2YWA A;  3C8G D;  3MFN A;  3TUL A;  3GM1 A;  1OW6 A;  3K7D A;  1JOG A;  2PBE A;  3O10 A;  1QVX A;  2KK1 A;  1UFB A;  1KTM A;  3L8I A;  3S9O A;  2Q00 A;  3B71 A;  3BRJ A;  3JYY A;  1WOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...