2Q00A

Crystal structure of the p95883_sulso protein from sulfolobus solfataricus. nesg target ssr10.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
120
Chain Sequence
SISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf c02003 protein
publication title Crystal structure of the P95883_SULSO protein from Sulfolobus solfataricus.
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Structural genomics, unknown function
total genus 46
structure length 120
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2q00A00
3MFNA 3U3FA 4R32A 3AJMA 5F28E 1OW7A 3C8GB 1PV3A 3L8IA 3GM3A 2Q00A 3RQEA 3BRJA 3K7DA 3O10A 2LK4A 1OW6A 1JOGA 4EBKA 4XEKA 1ZZPA 3RQFA 4XEVA 2L6GA 2JPUA 3C8GA 2HSBA 2JX0A 4EBJA 4NQFA 1K04A 3L8JA 3S9OA 1K40A 3GM1A 2L6FA 3JYYA 3JZ0A 3U0CA 3C18A 1KTMA 1O3UA 1WTYA 1QVXA 2PBEA 3RQGA 3TULA 1WWPA 4XEFA 3B71A 2YWAA 2KK1A 1K05A 1OW8A 1KNYA 1UFBA 1WOLA 1V4AA 2L6HA 3GM2A 3C8GD
chains in the Genus database with same CATH superfamily
2CCYA 1CPQA 3ZTMA 5CI9A 3NDBB 1AUEA 1LI5A 1VK5A 1WATA 4WABA 2Q00A 1NSGB 2XRHA 2IXOA 4JTDB 3NMKA 2J46A 5COMA 3EG9A 5A6JA 2EIJC 2ZXOA 1WASA 2HSBA 3SZRA 4BJ6A 1Z63A 1I5NA 1BR1A 3IQTA 3C7JA 2XXAB 2VC9A 3AOUA 3VAYA 4H4KC 2NG1A 1CGME 2V3CC 2YLIA 2YQYA 5K0IA 1WWPA 2NPUA 1EA8A 1NFOA 4XTKA 3NKEA 5DLJA 1TQGA 2GAQA 3DZAA 5L0FA 3FVYA 1E85A 2Y69C 3MX3A 2HSQA 1PD0A 3NYMA 1EQ1A 3Q6NA 4MTFA 4AK9A 2J45A 3TQOA 1RCPA 3W8HA 5A6KA 1PV3A 3HNLA 1VLTA 2HJMA 4X0RA 3JTLO 4EHPA 1ZW3A 2R7QA 2AWYA 2J7PD 3EFOA 1TR2A 2XLVA 2F22A 1EI7A 3H65A 2UUHA 4IRUA 2R7SA 1A7EA 4JCZA 2X51A 3C8GA 3ZWIA 4MVSA 1MNDA 3KYJA 3RH3A 3ASOC 4U9DA 1E2XA 2TMVP 2IXMA 3V7OA 1K40A 4ULVA 3VF0A 4QDLA 3IQ6A 2KQ9A 1BZ4A 2EPOA 3AG2C 2VH3A 4JE9A 4MVOA 2W4MA 3C62A 3CSKA 3DMDA 2QUPA 4IGGA 3RVYA 4JTAB 4I1OB 4DOZA 1R4TA 2DYRC 4PJNA 5F5HA 4DRIB 4XLNF 4IAQA 4XQ1A 3NG1A 2YL0A 3PMRA 5KYWB 4U5HA 5KYUA 1XZQA 3LLKA 4M63A 2CDQA 1G4US 3I5QA 3RQEA 5JRAA 2EPNA 2Q9AA 3TK0A 1OCRC 3A9CA 2KC3A 1OKKA 1TWAA 2CYDA 4IJJA 3TD7A 3VM6A 5A6BD 4K7BA 4BJTA 4MVRA 3C63A 3EZHA 4P6IC 1HY5A 2WL8A 3WG7C 2NUPB 4E0HA 1QSPA 4MS2A 1QPUA 1FFTC 3N0TA 3MYFA 1G4WR 1YAUO 2YKZA 2Q7RA 4NTFA 1OCCC 3NMJA 5KYYB 2J0WA 4B6IA 1WN0A 2FFHA 4WGZA 4NTAA 1QVXA 1LIHA 2KGOA 5FZTA 1EKYA 3OA1A 2P6VA 1M6TA 3O39A 4IB4A 1O87A 1GM5A 1RXQA 3ASNC 3ITFA 4W8KA 3I4UA 2YL3A 5D92A 5B1BC 1GS9A 4AL1A 4C3EA 1JR8A 4YL0A 3W8IA 4FAPB 3GEEA 2L7AA 3WAQA 2OJED 3UMIA 1JPNA 1VYIA 3JRTA 3M4BA 4ULWA 2XS1A 4RD9A 1OW6A 1YA9A 3DE8A 3RW0A 1XWJA 3U9JA 4MNDA 1I4ZA 1H6GA 2OG2A 2Y3DA 3A11A 4WGYA 5HV9A 4K1OA 4ONSA 4CDAA 3RF3A 1A7VA 3CAXA 1YYJA 1T6IA 2OEVA 2ZXRA 3EGDA 4CS8A 5AC5A 1ZHTA 2YL1A 3JT1A 2ZPAA 4YK5A 3RIPA 3X1OA 2PBEA 2LFDA 2HS5A 3B0VC 1N1CA 3LJBA 3LEVA 4OIOF 4LDKA 4NCQA 3M79A 4G7OF 1SYQA 3CZ6A 1K05A 1OW8A 1OR3A 2IXNA 3BEHA 2XLWA 1S7ZA 1YDIA 2PX3A 1PCXA 3C8GD 3IHUA 4R32A 3AQCA 1OR2A 2LCHA 4HEAJ 4JEBA 4XPYA 1OW7A 4E0IA 2P61A 1S05A 4U5CE 3IPMO 4J32B 1NU9C 3BRJA 3KPHA 4A2NB 2EIKC 3RKOF 3G50A 2CW0F 3NRHA 1RJ9B 1YA7O 3DD7A 4PACA 4U5EE 1VTMP 3FXHA 4XEVA 2M64A 4CIHA 3SXMA 1SMYF 2YHSA 1HE9A 2J8WA 2CGEA 3L0IA 3EHNA 1IW7F 1JAFA 4CDYA 3UMHA 4OIQF 4PK4A 2NUTA 4DXWA 4QI2A 4J7YA 4OD5A 3B0UX 1LVKA 2WB7A 4O6MA 3U2MA 1OKKD 4U9EA 1W2WA 2A6HF 4EBBA 4JW1A 4GEHA 2R9RB 4I1MA 4DBQA 4YWQA 1HW2A 1UFBA 2L6HA 3ZVRA 4C7OB 2G3VA 2AP3A 4YL1A 3PDMP 3B29A 3QW1A 5KYXA 2XM4A 3R2PA 4D4XA 1YARO 2HMQA 3RYLA 2R7TA 1M2OA 4ZLCA 1NG1A 3HLZA 4XWJA 3W2WA 2HJ3A 2A1DD 3RFYA 3TOLA 1ZW2A 2OQMA 1T5OA 1GGQA 1BDJB 5DQTA 1HE1A 2LSEA 2JPUA 3ZC4A 1OCZC 2W45A 3EZIA 2JX0A 1J8YF 1ORYA 2ASRA 2RSEB 3EQLF 4FWVA 4HFKB 4JJFA 4NQFA 3ABLC 4G7HF 1HMOA 4CS7A 3FDQA 2P7VA 4RBNA 1WGWA 1CGOA 1MMNA 2Y3GA 4JCHA 1TWHA 3HNIA 4JC7A 2XLOA 3GORA 3JSZA 3NKDA 2XL4A 5BQGA 2OCCC 1NU7D 1MMGA 5T3WA 3B71A 3EFOB 2Q9CA 3GEHA 5COFA 2R02A 2G3KA 4IWBA 2R7RA 2YLDA 3OEOA 4JIOA 4KNWA 3W4YA 1LS4A 1A7DA 1D1AA 1D0XA 3T9OA 3AJMA 1V54C 4EKWA 1QLEC 2WZLA 3L8IA 5A69A 3GM3A 3N2ZB 4WJ0A 2FGYA 4MTOA 1G5ZA 2IOQA 1LE4A 3UMKA 1HW1A 3C8ZA 1ZZPA 2A6EF 3FOOA 2YZSA 3JYHA 2LP4A 3T6BA 4CBEA 1DOWA 5CI8A 1CGNA 2LQGA 2O9XA 4Q4ZF 1YVIA 3GWNA 4PR9A 3ZG1A 2VB6A 1TFOB 3ECSA 1ZHYA 4MVUA 1FR0A 4NC3A 4RDAA 1YLMA 2QNLA 5B3SC 2KNHA 2PNOA 3Q7GA 3Q7LA 1FMWA 4OD4A 3T6GB 1TFKB 1C02A 2QE9A 1FFHA 4U5BE 3V5ZA 4E18A 2XXAA 3MFNA 3S29A 4EIYA 5JS5A 1Z3IX 3K1IC 3G4ZA 2J9BA 4DRJB 1FNTc 4GQHA 2YLGA 3E70C 5L3QA 2H7VC 2YRFA 3KMIA 3T4RA 1XZPA 3U8VA 3U5SA 4A4AA 5EHHA 1RKEB 2MYSA 3J06A 2DI3A 4OIPF 2DGJA 3K1HA 3AQBA 1FAPB 4U5DE 3POVA 4MVMA 3QZCA 2R7WA 1I4YA 4YT8A 2AWCA 2RD9A 2H8AA 2PP4A 4BPMA 2IXPA 4AL0A 3KH2A 2EPLX 2EINC 1A0BA 4CS9C 3E9VA 3O55A 5BUOA 3DJNB 3US6A 4XPWA 2KK1A 1E83A 3ATPA 1V4AA 2Q3TA 2XLMA 3IQCA 2L9JA 3U3FA 3PCVA 5L0GA 3TJ6A 4F4BA 1KU2A 1E86A 1BBHA 2LK4A 4OINF 2NSGA 2W9YA 2A0UA 2B0HA 3DAFA 2H7OA 4XEKA 2R7UA 4JTCB 4PJMA 3RQFA 3IEEA 4PJJA 1LKXA 1Q0KA 4LACB 3U9MA 3JCUQ 2LFFA 5KYWA 1PD1A 1RKCA 2KJGA 5CIVA 3SXYA 2GWWA 4YN0B 3SP1A 3EJNA 1ZHXA 1O5HA 2A68F 3N24A 3LAYA 5D91A 2CNWA 3JYYA 4LDQA 4JURI 3C18A 3SYNA 5F5FA 1KTMA 1WTYA 2Y39A 3UR3C 3UGPA 4CIPA 5E33A 4AE4A 4J30B 1TKNA 4N06A 2GFHA 2LIGA 1RMVA 2BL2A 3LEOA 3VYWA 1WOLA 1DOVA 3UGOA 2A0BA 5KYYA 3X2QC 4KC9A 1QKRA 3MBGA 1Z6AA 5EK0A 5F28E 1YJGA 2M4EA 5AGFA 2VCCA 3NYJA 4DVZA 2YL7A 4JKVA 2KYHA 3K7DA 2P1AA 3SXKA 3S84A 2D5RB 2NUTB 2VCBA 2EILC 3S0XA 1LE2A 5IY5C 4MW3A 3EGXA 3ZQYA 4C3BA 3LNRA 2WZGA 3Q6MA 4LLCA 4EWCA 3SEOA 4BG0A 3I5PA 3FMSA 3GWLA 1T9KA 2R25A 3MLGA 1D1BA 1V74B 1M2VB 2IM8A 3K1IA 4N4WA 1NLXA 2DYSC 2UUIA 3GANA 3RVZA 2D4UA 4BJ1A 2V26A 4I3MA 3V5YA 3AG3C 2VCAA 5GPGB 3AGTA 1ORSC 2HV7A 1D0ZA 1UG7A 2XM0A 4I44A 1VB5A 4XPXA 5A6AA 1T6UA 5EGYA 5L0HA 3EPVA 3EG9B 1LI7A 4G78A 3DM9B 4DRHB 3EH2A 4G7ZF 3JRMO 4JVSA 3CQZA 5DS5A 2QY9A 4CS9A 3GODA 2QTVA 1OQCA 4MTGA 4BEJA 3DKAA 2J9VA 1T01A 2HUJA 1AVOB 1C03A 3KYIA 2ZD9A 1D0YA 1H9TA 3M1CB 4MW8A 3LLIA 2BC5A 3QVZA 2MHRA 1RJ9A 3GM1A 2YVKA 1Q0GA 4IARA 3JZ0A 4NY3A 3SXZA 1Y6DA 4U5GA 5T3TA 2DB4A 2EPKX 4JEAA 2R03A 2XLHA 4JZAA 4Z9HA 4CJGA 4P9TA 1OXKA 4XEFA 3LNMB 1MMAA 2HZ8A 5BQIA 2EIMC 4IAOA 4Z9IA 4Q5SF 1VYKA 3U3BA 1NFNA 3MYIA 1ZU4A 5E3CA 2Y3HA 2YEVA 2Q9BA 3C8GB 4U5FE 5DVWA 1MQVA 3DWWA 4OIRF 2CNWD 4YT4A 3U8PA 1IZMA 1ORJA 3EHMA 3LESA 3M15A 3K6BA 1SF8A 1SR2A 3QTHA 4P9FA 4DVYP 4C7OA 2A69F 5JT4A 4PFOA 1LM3B 2Z15A 2XS8A 5L0JA 2P0NA 5JSLA 3ZSUA 3L34A 5B3IA 4YL3A 3S28A 3S9OA 3WHNA 4MVQA 2OEXA 3ABMC 1ZYRF 2H7BA 4O7GA 5KYUB 3WODF 1ZHWA 5JUAA 4NTBA 2J9WA 5L0DA 3TULA 1FTSA 2FAPB 5COGA 1NBBA 3B0PA 1NZEA 1F1MA 3GM2A 1YZCA 4E17A 2ZXWC 3LS1A 4CSAC 2XL6A 4CS8C 2B0JA 3M4CA 2OOCA 1M56C 3ZQVA 4BJ5C 1APCA 4K0DA 1CPRA 3NMIA 4AX2A 3ABKC 2QLAA 4QI0A 1JRAA 2AVKA 3T6JA 5BQHA 3S90A 3U2LA 3QW0A 4L6RA 2GDCA 3ZDLA 1FMVA 4MQ9F 2KW3C 4FESA 3LS0A 3LUTB 2NSFA 2G62A 2HMZA 3R7CA 3DI5A 1ST6A 3EH1A 1QQ3A 2I15A 1VLSA 2WZFA 4LDRA 1Q0MA 4FX5A 5KYNA 3FAJA 1Q0DA 2YWAA 2J0XA 4ER9A 4E7ZA 2E87A 1H7IA 2WVQA 3AG1C 2ETSA 4YT5A 4H54A 4O6YA 4KI2A 2XSEA 2R05A 2HKVA 4C3DA 2IYLD 1BR2A 2C04A 2R7XA 2EPMX 4LERA 2ICWG 4O79A 1JOGA 3EGDB 3B9QA 3UNGC 1TWGA 1BR4A 1OXBA 2BE5F 1C17M 2GA0A 3DE9A 1A41A 2HFIA 4AE4B 3VRCA 1T6QA 1VMAA 5T1DB 1L7CA 2W4BA 3HNJA 1LS1A 3AGUA 2X0CA 1R5ID 1V55C 4JJGA 5DS6A 1M57C 1O3UA 2JD3A 4PFPA 2R7VA 2AU5A 1RKEA 3FHDA 4LLEA 2Q4FA 3IQ5A 1LPEA 1YYXA 2ZXPA 2NUPA 3CEXA 3HNKA 2IBFA 3GEIA 1MMDA 3QVYA 5L0IA 4CDVA 2WVOA 1Z5ZA 1KNYA 3EGXB 2L6FA 2PX0A 3DM5A 1GQAA 4Z9JA 2I8BA 1H9GA 4BJ6C 2J9UA 3O6XA 4DBRA 1Z7Qc 2C03A 1AEPA 3FAPB 5HSWA 2PF4E 2XL8A 4KNVA 2KSFA 2LD6A 4YJWA 4EBKA 1VOMA 2OJQA 1E84A 1OCOC 4D4NA 3S27A 4BEMJ 2L6GA 1B68A 2OU6A 3FOPA 3OWTA 1ZHZA 2Y3BA 4HE8D 3F47A 5AC4A 2PFDA 3HJCA 4CSAA 3QMKA 4E7SA 256BA 3H2UA 5FCLA 3HKKA 4W8PA 3KL4A 4BJ5A 4MVZA 3F46A 2HV6A 1Z23A 2J7PA 5DS4A 5KYXB 4Q7CA 3RQGA 2VASA 3TJ5A 4GYTA 4KBLA 3DXJF 1L3PA 2MWQA 1HMDA 3ZIBA 1ZVZA 3U0CA 2R7OA 4PJLA 4ZLDA 5E2QA 2XLEA 1U0BB 3HTKC 3DAGA 3NYLA 3TOMA 4JRZA 3O10A 5TJ5E 3G4XA 5B1AC 1D1CA 4CX9A 4ANJA 2XLDA 1JPJA 3PHF2 1J8MF 5DQZA 3ZTZA 5JLIA 3AG4C 4UDVA 4CJOA 5L3VA 1ZU5A 5JVEA 5JP7A 4DJ9A 3K66A 1JMWA 1TWCA 4EBJA 3DJUB 3V5XA 4EUKB 1K04A 1SZIA 1U6HA 3L8JA 3JSEO 4N6CA 5E3AA 1G8XA 4O6NA 5L0CA 4G0HA 3SNHA 1QZXA 4N6HA 5A6BA 3H2VA 4XLPF 1Q0FA 1Y4CA 2OKUA 3L1MA 1MNEA 2L81A 1YZAA 3K33A 4J7TA 3KKBA 3W2VA 4YT2A 4HFFB 2WVNA 1U89A 1M2VA
chains in the Genus database with same CATH topology
3MFNA 3U3FA 4R32A 3AJMA 5F28E 1OW7A 3C8GB 1PV3A 3L8IA 3GM3A 2Q00A 3RQEA 3BRJA 3K7DA 3O10A 2LK4A 1OW6A 1JOGA 4EBKA 4XEKA 1ZZPA 3RQFA 4XEVA 2L6GA 2JPUA 3C8GA 2HSBA 2JX0A 4EBJA 4NQFA 1K04A 3L8JA 3S9OA 1K40A 3GM1A 2L6FA 3JYYA 3JZ0A 3U0CA 3C18A 1KTMA 1O3UA 1WTYA 1QVXA 2PBEA 3RQGA 3TULA 1WWPA 4XEFA 3B71A 2YWAA 2KK1A 1K05A 1OW8A 1KNYA 1UFBA 1WOLA 1V4AA 2L6HA 3GM2A 3C8GD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFN A;  3U3F A;  4R32 A;  3AJM A;  5F28 E;  1OW7 A;  3C8G B;  1PV3 A;  3L8I A;  3GM3 A;  2Q00 A;  3RQE A;  3BRJ A;  3K7D A;  3O10 A;  2LK4 A;  1OW6 A;  1JOG A;  4EBK A;  4XEK A;  1ZZP A;  3RQF A;  4XEV A;  2L6G A;  2JPU A;  3C8G A;  2HSB A;  2JX0 A;  4EBJ A;  4NQF A;  1K04 A;  3L8J A;  3S9O A;  1K40 A;  3GM1 A;  2L6F A;  3JYY A;  3JZ0 A;  3U0C A;  3C18 A;  1KTM A;  1O3U A;  1WTY A;  1QVX A;  2PBE A;  3RQG A;  3TUL A;  1WWP A;  4XEF A;  3B71 A;  2YWA A;  2KK1 A;  1K05 A;  1OW8 A;  1KNY A;  1UFB A;  1WOL A;  1V4A A;  2L6H A;  3GM2 A;  3C8G D; 
#chains in the Genus database with same CATH topology
 2CCY A;  1CPQ A;  3ZTM A;  5CI9 A;  3NDB B;  1AUE A;  1LI5 A;  1VK5 A;  1WAT A;  4WAB A;  2Q00 A;  1NSG B;  2XRH A;  2IXO A;  4JTD B;  3NMK A;  2J46 A;  5COM A;  3EG9 A;  5A6J A;  2EIJ C;  2ZXO A;  1WAS A;  2HSB A;  3SZR A;  4BJ6 A;  1Z63 A;  1I5N A;  1BR1 A;  3IQT A;  3C7J A;  2XXA B;  2VC9 A;  3AOU A;  3VAY A;  4H4K C;  2NG1 A;  1CGM E;  2V3C C;  2YLI A;  2YQY A;  5K0I A;  1WWP A;  2NPU A;  1EA8 A;  1NFO A;  4XTK A;  3NKE A;  5DLJ A;  1TQG A;  2GAQ A;  3DZA A;  5L0F A;  3FVY A;  1E85 A;  2Y69 C;  3MX3 A;  2HSQ A;  1PD0 A;  3NYM A;  1EQ1 A;  3Q6N A;  4MTF A;  4AK9 A;  2J45 A;  3TQO A;  1RCP A;  3W8H A;  5A6K A;  1PV3 A;  3HNL A;  1VLT A;  2HJM A;  4X0R A;  3JTL O;  4EHP A;  1ZW3 A;  2R7Q A;  2AWY A;  2J7P D;  3EFO A;  1TR2 A;  2XLV A;  2F22 A;  1EI7 A;  3H65 A;  2UUH A;  4IRU A;  2R7S A;  1A7E A;  4JCZ A;  2X51 A;  3C8G A;  3ZWI A;  4MVS A;  1MND A;  3KYJ A;  3RH3 A;  3ASO C;  4U9D A;  1E2X A;  2TMV P;  2IXM A;  3V7O A;  1K40 A;  4ULV A;  3VF0 A;  4QDL A;  3IQ6 A;  2KQ9 A;  1BZ4 A;  2EPO A;  3AG2 C;  2VH3 A;  4JE9 A;  4MVO A;  2W4M A;  3C62 A;  3CSK A;  3DMD A;  2QUP A;  4IGG A;  3RVY A;  4JTA B;  4I1O B;  4DOZ A;  1R4T A;  2DYR C;  4PJN A;  5F5H A;  4DRI B;  4XLN F;  4IAQ A;  4XQ1 A;  3NG1 A;  2YL0 A;  3PMR A;  5KYW B;  4U5H A;  5KYU A;  1XZQ A;  3LLK A;  4M63 A;  2CDQ A;  1G4U S;  3I5Q A;  3RQE A;  5JRA A;  2EPN A;  2Q9A A;  3TK0 A;  1OCR C;  3A9C A;  2KC3 A;  1OKK A;  1TWA A;  2CYD A;  4IJJ A;  3TD7 A;  3VM6 A;  5A6B D;  4K7B A;  4BJT A;  4MVR A;  3C63 A;  3EZH A;  4P6I C;  1HY5 A;  2WL8 A;  3WG7 C;  2NUP B;  4E0H A;  1QSP A;  4MS2 A;  1QPU A;  1FFT C;  3N0T A;  3MYF A;  1G4W R;  1YAU O;  2YKZ A;  2Q7R A;  4NTF A;  1OCC C;  3NMJ A;  5KYY B;  2J0W A;  4B6I A;  1WN0 A;  2FFH A;  4WGZ A;  4NTA A;  1QVX A;  1LIH A;  2KGO A;  5FZT A;  1EKY A;  3OA1 A;  2P6V A;  1M6T A;  3O39 A;  4IB4 A;  1O87 A;  1GM5 A;  1RXQ A;  3ASN C;  3ITF A;  4W8K A;  3I4U A;  2YL3 A;  5D92 A;  5B1B C;  1GS9 A;  4AL1 A;  4C3E A;  1JR8 A;  4YL0 A;  3W8I A;  4FAP B;  3GEE A;  2L7A A;  3WAQ A;  2OJE D;  3UMI A;  1JPN A;  1VYI A;  3JRT A;  3M4B A;  4ULW A;  2XS1 A;  4RD9 A;  1OW6 A;  1YA9 A;  3DE8 A;  3RW0 A;  1XWJ A;  3U9J A;  4MND A;  1I4Z A;  1H6G A;  2OG2 A;  2Y3D A;  3A11 A;  4WGY A;  5HV9 A;  4K1O A;  4ONS A;  4CDA A;  3RF3 A;  1A7V A;  3CAX A;  1YYJ A;  1T6I A;  2OEV A;  2ZXR A;  3EGD A;  4CS8 A;  5AC5 A;  1ZHT A;  2YL1 A;  3JT1 A;  2ZPA A;  4YK5 A;  3RIP A;  3X1O A;  2PBE A;  2LFD A;  2HS5 A;  3B0V C;  1N1C A;  3LJB A;  3LEV A;  4OIO F;  4LDK A;  4NCQ A;  3M79 A;  4G7O F;  1SYQ A;  3CZ6 A;  1K05 A;  1OW8 A;  1OR3 A;  2IXN A;  3BEH A;  2XLW A;  1S7Z A;  1YDI A;  2PX3 A;  1PCX A;  3C8G D;  3IHU A;  4R32 A;  3AQC A;  1OR2 A;  2LCH A;  4HEA J;  4JEB A;  4XPY A;  1OW7 A;  4E0I A;  2P61 A;  1S05 A;  4U5C E;  3IPM O;  4J32 B;  1NU9 C;  3BRJ A;  3KPH A;  4A2N B;  2EIK C;  3RKO F;  3G50 A;  2CW0 F;  3NRH A;  1RJ9 B;  1YA7 O;  3DD7 A;  4PAC A;  4U5E E;  1VTM P;  3FXH A;  4XEV A;  2M64 A;  4CIH A;  3SXM A;  1SMY F;  2YHS A;  1HE9 A;  2J8W A;  2CGE A;  3L0I A;  3EHN A;  1IW7 F;  1JAF A;  4CDY A;  3UMH A;  4OIQ F;  4PK4 A;  2NUT A;  4DXW A;  4QI2 A;  4J7Y A;  4OD5 A;  3B0U X;  1LVK A;  2WB7 A;  4O6M A;  3U2M A;  1OKK D;  4U9E A;  1W2W A;  2A6H F;  4EBB A;  4JW1 A;  4GEH A;  2R9R B;  4I1M A;  4DBQ A;  4YWQ A;  1HW2 A;  1UFB A;  2L6H A;  3ZVR A;  4C7O B;  2G3V A;  2AP3 A;  4YL1 A;  3PDM P;  3B29 A;  3QW1 A;  5KYX A;  2XM4 A;  3R2P A;  4D4X A;  1YAR O;  2HMQ A;  3RYL A;  2R7T A;  1M2O A;  4ZLC A;  1NG1 A;  3HLZ A;  4XWJ A;  3W2W A;  2HJ3 A;  2A1D D;  3RFY A;  3TOL A;  1ZW2 A;  2OQM A;  1T5O A;  1GGQ A;  1BDJ B;  5DQT A;  1HE1 A;  2LSE A;  2JPU A;  3ZC4 A;  1OCZ C;  2W45 A;  3EZI A;  2JX0 A;  1J8Y F;  1ORY A;  2ASR A;  2RSE B;  3EQL F;  4FWV A;  4HFK B;  4JJF A;  4NQF A;  3ABL C;  4G7H F;  1HMO A;  4CS7 A;  3FDQ A;  2P7V A;  4RBN A;  1WGW A;  1CGO A;  1MMN A;  2Y3G A;  4JCH A;  1TWH A;  3HNI A;  4JC7 A;  2XLO A;  3GOR A;  3JSZ A;  3NKD A;  2XL4 A;  5BQG A;  2OCC C;  1NU7 D;  1MMG A;  5T3W A;  3B71 A;  3EFO B;  2Q9C A;  3GEH A;  5COF A;  2R02 A;  2G3K A;  4IWB A;  2R7R A;  2YLD A;  3OEO A;  4JIO A;  4KNW A;  3W4Y A;  1LS4 A;  1A7D A;  1D1A A;  1D0X A;  3T9O A;  3AJM A;  1V54 C;  4EKW A;  1QLE C;  2WZL A;  3L8I A;  5A69 A;  3GM3 A;  3N2Z B;  4WJ0 A;  2FGY A;  4MTO A;  1G5Z A;  2IOQ A;  1LE4 A;  3UMK A;  1HW1 A;  3C8Z A;  1ZZP A;  2A6E F;  3FOO A;  2YZS A;  3JYH A;  2LP4 A;  3T6B A;  4CBE A;  1DOW A;  5CI8 A;  1CGN A;  2LQG A;  2O9X A;  4Q4Z F;  1YVI A;  3GWN A;  4PR9 A;  3ZG1 A;  2VB6 A;  1TFO B;  3ECS A;  1ZHY A;  4MVU A;  1FR0 A;  4NC3 A;  4RDA A;  1YLM A;  2QNL A;  5B3S C;  2KNH A;  2PNO A;  3Q7G A;  3Q7L A;  1FMW A;  4OD4 A;  3T6G B;  1TFK B;  1C02 A;  2QE9 A;  1FFH A;  4U5B E;  3V5Z A;  4E18 A;  2XXA A;  3MFN A;  3S29 A;  4EIY A;  5JS5 A;  1Z3I X;  3K1I C;  3G4Z A;  2J9B A;  4DRJ B;  1FNT c;  4GQH A;  2YLG A;  3E70 C;  5L3Q A;  2H7V C;  2YRF A;  3KMI A;  3T4R A;  1XZP A;  3U8V A;  3U5S A;  4A4A A;  5EHH A;  1RKE B;  2MYS A;  3J06 A;  2DI3 A;  4OIP F;  2DGJ A;  3K1H A;  3AQB A;  1FAP B;  4U5D E;  3POV A;  4MVM A;  3QZC A;  2R7W A;  1I4Y A;  4YT8 A;  2AWC A;  2RD9 A;  2H8A A;  2PP4 A;  4BPM A;  2IXP A;  4AL0 A;  3KH2 A;  2EPL X;  2EIN C;  1A0B A;  4CS9 C;  3E9V A;  3O55 A;  5BUO A;  3DJN B;  3US6 A;  4XPW A;  2KK1 A;  1E83 A;  3ATP A;  1V4A A;  2Q3T A;  2XLM A;  3IQC A;  2L9J A;  3U3F A;  3PCV A;  5L0G A;  3TJ6 A;  4F4B A;  1KU2 A;  1E86 A;  1BBH A;  2LK4 A;  4OIN F;  2NSG A;  2W9Y A;  2A0U A;  2B0H A;  3DAF A;  2H7O A;  4XEK A;  2R7U A;  4JTC B;  4PJM A;  3RQF A;  3IEE A;  4PJJ A;  1LKX A;  1Q0K A;  4LAC B;  3U9M A;  3JCU Q;  2LFF A;  5KYW A;  1PD1 A;  1RKC A;  2KJG A;  5CIV A;  3SXY A;  2GWW A;  4YN0 B;  3SP1 A;  3EJN A;  1ZHX A;  1O5H A;  2A68 F;  3N24 A;  3LAY A;  5D91 A;  2CNW A;  3JYY A;  4LDQ A;  4JUR I;  3C18 A;  3SYN A;  5F5F A;  1KTM A;  1WTY A;  2Y39 A;  3UR3 C;  3UGP A;  4CIP A;  5E33 A;  4AE4 A;  4J30 B;  1TKN A;  4N06 A;  2GFH A;  2LIG A;  1RMV A;  2BL2 A;  3LEO A;  3VYW A;  1WOL A;  1DOV A;  3UGO A;  2A0B A;  5KYY A;  3X2Q C;  4KC9 A;  1QKR A;  3MBG A;  1Z6A A;  5EK0 A;  5F28 E;  1YJG A;  2M4E A;  5AGF A;  2VCC A;  3NYJ A;  4DVZ A;  2YL7 A;  4JKV A;  2KYH A;  3K7D A;  2P1A A;  3SXK A;  3S84 A;  2D5R B;  2NUT B;  2VCB A;  2EIL C;  3S0X A;  1LE2 A;  5IY5 C;  4MW3 A;  3EGX A;  3ZQY A;  4C3B A;  3LNR A;  2WZG A;  3Q6M A;  4LLC A;  4EWC A;  3SEO A;  4BG0 A;  3I5P A;  3FMS A;  3GWL A;  1T9K A;  2R25 A;  3MLG A;  1D1B A;  1V74 B;  1M2V B;  2IM8 A;  3K1I A;  4N4W A;  1NLX A;  2DYS C;  2UUI A;  3GAN A;  3RVZ A;  2D4U A;  4BJ1 A;  2V26 A;  4I3M A;  3V5Y A;  3AG3 C;  2VCA A;  5GPG B;  3AGT A;  1ORS C;  2HV7 A;  1D0Z A;  1UG7 A;  2XM0 A;  4I44 A;  1VB5 A;  4XPX A;  5A6A A;  1T6U A;  5EGY A;  5L0H A;  3EPV A;  3EG9 B;  1LI7 A;  4G78 A;  3DM9 B;  4DRH B;  3EH2 A;  4G7Z F;  3JRM O;  4JVS A;  3CQZ A;  5DS5 A;  2QY9 A;  4CS9 A;  3GOD A;  2QTV A;  1OQC A;  4MTG A;  4BEJ A;  3DKA A;  2J9V A;  1T01 A;  2HUJ A;  1AVO B;  1C03 A;  3KYI A;  2ZD9 A;  1D0Y A;  1H9T A;  3M1C B;  4MW8 A;  3LLI A;  2BC5 A;  3QVZ A;  2MHR A;  1RJ9 A;  3GM1 A;  2YVK A;  1Q0G A;  4IAR A;  3JZ0 A;  4NY3 A;  3SXZ A;  1Y6D A;  4U5G A;  5T3T A;  2DB4 A;  2EPK X;  4JEA A;  2R03 A;  2XLH A;  4JZA A;  4Z9H A;  4CJG A;  4P9T A;  1OXK A;  4XEF A;  3LNM B;  1MMA A;  2HZ8 A;  5BQI A;  2EIM C;  4IAO A;  4Z9I A;  4Q5S F;  1VYK A;  3U3B A;  1NFN A;  3MYI A;  1ZU4 A;  5E3C A;  2Y3H A;  2YEV A;  2Q9B A;  3C8G B;  4U5F E;  5DVW A;  1MQV A;  3DWW A;  4OIR F;  2CNW D;  4YT4 A;  3U8P A;  1IZM A;  1ORJ A;  3EHM A;  3LES A;  3M15 A;  3K6B A;  1SF8 A;  1SR2 A;  3QTH A;  4P9F A;  4DVY P;  4C7O A;  2A69 F;  5JT4 A;  4PFO A;  1LM3 B;  2Z15 A;  2XS8 A;  5L0J A;  2P0N A;  5JSL A;  3ZSU A;  3L34 A;  5B3I A;  4YL3 A;  3S28 A;  3S9O A;  3WHN A;  4MVQ A;  2OEX A;  3ABM C;  1ZYR F;  2H7B A;  4O7G A;  5KYU B;  3WOD F;  1ZHW A;  5JUA A;  4NTB A;  2J9W A;  5L0D A;  3TUL A;  1FTS A;  2FAP B;  5COG A;  1NBB A;  3B0P A;  1NZE A;  1F1M A;  3GM2 A;  1YZC A;  4E17 A;  2ZXW C;  3LS1 A;  4CSA C;  2XL6 A;  4CS8 C;  2B0J A;  3M4C A;  2OOC A;  1M56 C;  3ZQV A;  4BJ5 C;  1APC A;  4K0D A;  1CPR A;  3NMI A;  4AX2 A;  3ABK C;  2QLA A;  4QI0 A;  1JRA A;  2AVK A;  3T6J A;  5BQH A;  3S90 A;  3U2L A;  3QW0 A;  4L6R A;  2GDC A;  3ZDL A;  1FMV A;  4MQ9 F;  2KW3 C;  4FES A;  3LS0 A;  3LUT B;  2NSF A;  2G62 A;  2HMZ A;  3R7C A;  3DI5 A;  1ST6 A;  3EH1 A;  1QQ3 A;  2I15 A;  1VLS A;  2WZF A;  4LDR A;  1Q0M A;  4FX5 A;  5KYN A;  3FAJ A;  1Q0D A;  2YWA A;  2J0X A;  4ER9 A;  4E7Z A;  2E87 A;  1H7I A;  2WVQ A;  3AG1 C;  2ETS A;  4YT5 A;  4H54 A;  4O6Y A;  4KI2 A;  2XSE A;  2R05 A;  2HKV A;  4C3D A;  2IYL D;  1BR2 A;  2C04 A;  2R7X A;  2EPM X;  4LER A;  2ICW G;  4O79 A;  1JOG A;  3EGD B;  3B9Q A;  3UNG C;  1TWG A;  1BR4 A;  1OXB A;  2BE5 F;  1C17 M;  2GA0 A;  3DE9 A;  1A41 A;  2HFI A;  4AE4 B;  3VRC A;  1T6Q A;  1VMA A;  5T1D B;  1L7C A;  2W4B A;  3HNJ A;  1LS1 A;  3AGU A;  2X0C A;  1R5I D;  1V55 C;  4JJG A;  5DS6 A;  1M57 C;  1O3U A;  2JD3 A;  4PFP A;  2R7V A;  2AU5 A;  1RKE A;  3FHD A;  4LLE A;  2Q4F A;  3IQ5 A;  1LPE A;  1YYX A;  2ZXP A;  2NUP A;  3CEX A;  3HNK A;  2IBF A;  3GEI A;  1MMD A;  3QVY A;  5L0I A;  4CDV A;  2WVO A;  1Z5Z A;  1KNY A;  3EGX B;  2L6F A;  2PX0 A;  3DM5 A;  1GQA A;  4Z9J A;  2I8B A;  1H9G A;  4BJ6 C;  2J9U A;  3O6X A;  4DBR A;  1Z7Q c;  2C03 A;  1AEP A;  3FAP B;  5HSW A;  2PF4 E;  2XL8 A;  4KNV A;  2KSF A;  2LD6 A;  4YJW A;  4EBK A;  1VOM A;  2OJQ A;  1E84 A;  1OCO C;  4D4N A;  3S27 A;  4BEM J;  2L6G A;  1B68 A;  2OU6 A;  3FOP A;  3OWT A;  1ZHZ A;  2Y3B A;  4HE8 D;  3F47 A;  5AC4 A;  2PFD A;  3HJC A;  4CSA A;  3QMK A;  4E7S A;  256B A;  3H2U A;  5FCL A;  3HKK A;  4W8P A;  3KL4 A;  4BJ5 A;  4MVZ A;  3F46 A;  2HV6 A;  1Z23 A;  2J7P A;  5DS4 A;  5KYX B;  4Q7C A;  3RQG A;  2VAS A;  3TJ5 A;  4GYT A;  4KBL A;  3DXJ F;  1L3P A;  2MWQ A;  1HMD A;  3ZIB A;  1ZVZ A;  3U0C A;  2R7O A;  4PJL A;  4ZLD A;  5E2Q A;  2XLE A;  1U0B B;  3HTK C;  3DAG A;  3NYL A;  3TOM A;  4JRZ A;  3O10 A;  5TJ5 E;  3G4X A;  5B1A C;  1D1C A;  4CX9 A;  4ANJ A;  2XLD A;  1JPJ A;  3PHF 2;  1J8M F;  5DQZ A;  3ZTZ A;  5JLI A;  3AG4 C;  4UDV A;  4CJO A;  5L3V A;  1ZU5 A;  5JVE A;  5JP7 A;  4DJ9 A;  3K66 A;  1JMW A;  1TWC A;  4EBJ A;  3DJU B;  3V5X A;  4EUK B;  1K04 A;  1SZI A;  1U6H A;  3L8J A;  3JSE O;  4N6C A;  5E3A A;  1G8X A;  4O6N A;  5L0C A;  4G0H A;  3SNH A;  1QZX A;  4N6H A;  5A6B A;  3H2V A;  4XLP F;  1Q0F A;  1Y4C A;  2OKU A;  3L1M A;  1MNE A;  2L81 A;  1YZA A;  3K33 A;  4J7T A;  3KKB A;  3W2V A;  4YT2 A;  4HFF B;  2WVN A;  1U89 A;  1M2V A; 
#chains in the Genus database with same CATH homology
 3MFN A;  3U3F A;  4R32 A;  3AJM A;  5F28 E;  1OW7 A;  3C8G B;  1PV3 A;  3L8I A;  3GM3 A;  2Q00 A;  3RQE A;  3BRJ A;  3K7D A;  3O10 A;  2LK4 A;  1OW6 A;  1JOG A;  4EBK A;  4XEK A;  1ZZP A;  3RQF A;  4XEV A;  2L6G A;  2JPU A;  3C8G A;  2HSB A;  2JX0 A;  4EBJ A;  4NQF A;  1K04 A;  3L8J A;  3S9O A;  1K40 A;  3GM1 A;  2L6F A;  3JYY A;  3JZ0 A;  3U0C A;  3C18 A;  1KTM A;  1O3U A;  1WTY A;  1QVX A;  2PBE A;  3RQG A;  3TUL A;  1WWP A;  4XEF A;  3B71 A;  2YWA A;  2KK1 A;  1K05 A;  1OW8 A;  1KNY A;  1UFB A;  1WOL A;  1V4A A;  2L6H A;  3GM2 A;  3C8G D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...