2Q00A

Crystal structure of the p95883_sulso protein from sulfolobus solfataricus. nesg target ssr10.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
120
Chain Sequence
SISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the P95883_SULSO protein from Sulfolobus solfataricus.
rcsb
source organism Sulfolobus solfataricus p2
molecule tags Structural genomics, unknown function
molecule keywords Orf c02003 protein
total genus 46
structure length 120
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2q00A00
3AJMA 1V4AA 3RQEA 1OW7A 1K05A 3K7DA 3L8IA 3GM3A 3C8GA 2LK4A 2YWAA 2L6FA 1O3UA 1WTYA 3C18A 3U3FA 4EBKA 1OW8A 3GM2A 3B71A 3S9OA 1WWPA 3TULA 3RQGA 2JPUA 2Q00A 4XEKA 1K04A 1OW6A 4NQFA 4XEVA 1K40A 2JX0A 2L6GA 2PBEA 3C8GB 4XEFA 1PV3A 2L6HA 1UFBA 3RQFA 1WOLA 3JZ0A 1QVXA 3O10A 3U0CA 5F28E 3GM1A 1JOGA 3BRJA 3MFNA 2KK1A 3L8JA 1ZZPA 3C8GD 4R32A 1KNYA 4EBJA 1KTMA 3JYYA 2HSBA
chains in the Genus database with same CATH superfamily
1YA7O 5GPGB 3TJ6A 2R7OA 3MYFA 1G8XA 3TOMA 3DE8A 1Z6AA 2PFDA 4W8PA 3IQCA 3MBGA 4BJ5C 3UGOA 2MYSA 1O5HA 1YZCA 2NPUA 3DWWA 4CDVA 4YJWA 2R03A 4EBKA 2FGYA 3EG9B 3S27A 3V5XA 2NSFA 3UMKA 3RF3A 4XPYA 3A9CA 2VB6A 4C7OA 2VH3A 1JRAA 1M2VA 3NMIA 3G4XA 3JSZA 4FX5A 2BL2A 1K40A 1GS9A 3C8GB 2KSFA 3SXZA 3E70C 3JCUQ 4XPWA 4U5GA 2OQMA 5KYWB 1M57C 2VASA 3DM5A 1ORSC 2H7BA 4EBBA 3IEEA 3EZHA 2LQGA 3CSKA 4PACA 2AWYA 2Y39A 1MQVA 1AUEA 4BJ6A 1MMNA 2YL3A 4PFPA 1SZIA 3NYJA 3EGXA 2VCBA 3CEXA 1ZW2A 4F4BA 3GANA 1RJ9A 4BG0A 1D0YA 2CDQA 2HSQA 1A7VA 4G78A 1OCCC 3DXJF 3AGTA 5BQGA 3C18A 1ZU4A 2P0NA 2J45A 2YLGA 3Q7GA 2EIJC 4YT5A 4GYTA 1K04A 4IB4A 3RYLA 4AE4A 5COFA 4CJGA 3KYJA 4O7GA 4MNDA 3EJNA 5KYUB 2L6GA 1VB5A 4CX9A 3ZC4A 3M15A 3EH2A 4HEAJ 1BBHA 1YJGA 3O39A 4RDAA 5BQIA 4AK9A 5L3QA 1Z23A 2KJGA 3UMHA 1HY5A 3RKOF 2IXPA 5CIVA 5JSLA 2XXAA 2NG1A 4A2NB 2X0CA 3NKEA 4MVZA 2YL1A 1YDIA 2YLDA 5L0IA 3LUTB 4N4WA 2ZXOA 3C8GA 2ASRA 5A69A 4O6YA 2WVQA 1EQ1A 1NU9C 3NG1A 1OR2A 1XWJA 4NTAA 3ZQYA 3L34A 1TFOB 2QLAA 1A41A 4U5FE 1C17M 1V74B 1HW1A 1O87A 1M56C 2IM8A 2HV7A 3M4CA 3QVYA 3AG1C 4J32B 4U5CE 1LI5A 2XL8A 1U0BB 1IZMA 1ORYA 2GWWA 1EA8A 2YKZA 3EGXB 1OXKA 2Q3TA 2Y3DA 5KYNA 2LFFA 2GA0A 3LAYA 1SF8A 4G7ZF 4BPMA 4X0RA 5DS6A 5F28E 2C04A 1YLMA 3S90A 1AEPA 1JOGA 2BE5F 3LS0A 4JZAA 4OIOF 2ZPAA 4PR9A 4L6RA 3Q7LA 3WAQA 1Q0DA 2Y3HA 1NFOA 2O9XA 1NU7D 4P9TA 1FFHA 3JYYA 2XLDA 3QTHA 3T6BA 3U8VA 3LEVA 3V7OA 1Q0FA 1T9KA 1RKCA 3AGUA 4EUKB 2LK4A 2A68F 3HLZA 1T5OA 1T6QA 3U3FA 2EPMX 4QDLA 1GM5A 256BA 3L0IA 5JUAA 2I8BA 4UDVA 2Q00A 4XEKA 3OEOA 3UNGC 2W4MA 3FVYA 1BZ4A 3JRTA 2XLHA 4IGGA 3WODF 3ZG1A 2R7SA 3W4YA 3JTLO 2OKUA 1Y4CA 3WG7C 3VM6A 1QZXA 4IWBA 4JE9A 2VCAA 3L8JA 2WVNA 5EHHA 5L0HA 3DKAA 4XLPF 2WZFA 1YVIA 2D4UA 4XQ1A 5L0GA 2QNLA 2A0BA 3AG4C 3AJMA 3B29A 3K7DA 4WABA 1MMDA 1EKYA 3U3BA 2YHSA 2XS1A 2YZSA 1Z7Qc 3A11A 5DVWA 3DZAA 3NRHA 2XLMA 4JJGA 3N2ZB 1QPUA 4ANJA 2G3VA 4FESA 5HV9A 1ZHZA 2HS5A 5DQTA 1CGNA 2XLOA 3KL4A 4MW8A 3UR3C 4B6IA 1LE2A 2YLIA 2R7QA 3ZTMA 2LD6A 4OIRF 1AVOB 4LDRA 2G3KA 4HFFB 2PX3A 2XRHA 4PJMA 3C62A 1PD1A 2Y3BA 2VCCA 1I4ZA 2WL8A 4NC3A 1TWHA 4O79A 2L6HA 2OU6A 1UFBA 3FXHA 4PJJA 2EIMC 3RH3A 3SZRA 2P61A 3I5PA 5EK0A 4EIYA 4JJFA 3W8HA 1VK5A 4D4NA 4RBNA 3B0PA 2TMVP 2ICWG 1D0ZA 5KYXB 4C7OB 4BEMJ 4DVZA 2EPLX 5JS5A 1ZVZA 5D92A 4PK4A 1NZEA 2NUPA 4YL3A 2IOQA 2AU5A 3DJUB 2L9JA 1VYIA 3DD7A 2GAQA 2LP4A 4LLEA 3SXYA 4C3BA 4OD4A 4YT4A 1WTYA 1WASA 3FAPB 2AP3A 5KYWA 2DI3A 2L81A 4JEAA 3VAYA 4CSAA 3RQGA 1OQCA 2G62A 1XZPA 3G4ZA 4WGYA 3R7CA 3B0VC 1OW6A 4JTDB 1JPJA 2EPNA 1H9GA 1LE4A 2PBEA 2Z15A 3X1OA 4CJOA 3U0CA 3T4RA 5DQZA 4E17A 1JAFA 4GEHA 5E3CA 1SR2A 3QMKA 3BRJA 2DB4A 2AVKA 1ZZPA 1Q0MA 3C8GD 3MX3A 4HE8D 1LPEA 2P6VA 4MQ9F 1KTMA 5F5FA 1TFKB 3GWNA 4YWQA 2IYLD 2KQ9A 3M79A 3RVYA 1LVKA 4OIQF 4MVMA 2XM0A 4BJ6C 1TWCA 3MYIA 2XL6A 2OOCA 1A0BA 2Q7RA 1VTMP 5DLJA 3E9VA 4N6CA 4DRIB 3JYHA 4J30B 4DJ9A 4DRJB 1RKEA 3K1IA 1PCXA 3N24A 4CS8A 1VOMA 1T6UA 3IQ6A 1DOWA 1QSPA 1JR8A 2OJQA 3SNHA 4U5DE 4Q4ZF 3AQBA 2OEVA 1TQGA 3GEIA 4ULVA 4G7HF 2WZGA 2PNOA 2B0HA 4MVQA 1QVXA 3NYMA 3RIPA 4E0IA 1LS1A 4AX2A 4JCZA 5FCLA 4IAOA 1FR0A 3RW0A 2LSEA 4JW1A 4EBJA 2HSBA 5T3WA 2W45A 1D0XA 3KH2A 2RD9A 3L1MA 4DRHB 2D5RB 2J9UA 1MMAA 2J7PA 3ITFA 5CI9A 4EKWA 3Q6NA 5CI8A 4MW3A 1M2OA 1Q0GA 1Y6DA 2ETSA 3K33A 1MMGA 4FWVA 4K0DA 1L3PA 3KMIA 4N06A 4I3MA 4LLCA 2P7VA 3N0TA 3ZIBA 2CCYA 2HFIA 2J9VA 3EPVA 1I5NA 2ZXPA 4ONSA 5L0CA 3U2MA 1YYJA 1TWAA 3H2UA 1C03A 5AC4A 3S29A 3W8IA 5KYYB 1FFTC 4D4XA 3NYLA 3O6XA 1WOLA 3B0UX 3ASNC 4LDKA 3EG9A 3MFNA 2J0WA 4JIOA 3CZ6A 1S05A 4DVYP 2L7AA 4NCQA 3X2QC 1EI7A 1ZHTA 2XLEA 2H7VC 2H7OA 1T01A 1HE9A 1V4AA 1YZAA 2EPKX 3JZ0A 2MHRA 5B3SC 1MNDA 3ZQVA 4CS9C 2L6FA 3KYIA 5F5HA 5L0FA 1NLXA 3OWTA 4ER9A 1YAUO 3U9JA 3WHNA 2QE9A 2IXMA 3LLIA 2KW3C 2EINC 2JPUA 2OG2A 5EGYA 2R05A 3EFOA 3IQ5A 4CBEA 3DI5A 2YL0A 3JT1A 3RVZA 5JT4A 4CS7A 3M4BA 2HKVA 4JKVA 4FAPB 4XEFA 1FAPB 2XS8A 3QZCA 4M63A 2R9RB 2Q9BA 2XM4A 2GDCA 3O10A 4MVSA 3VYWA 4JTCB 3U2LA 5JVEA 3ZWIA 2HJMA 3PMRA 4BJ5A 3HNKA 2FFHA 1WGWA 5FZTA 3M1CB 2XLVA 1DOVA 1ZHXA 2XSEA 4CS9A 4Q7CA 4WGZA 4AL1A 4MVRA 3T6JA 2GFHA 1FNTc 1CGME 2WB7A 4U5HA 4U5EE 1OCOC 2R25A 2YWAA 2W4BA 3VRCA 3T6GB 2MWQA 2V3CC 1BR4A 1TKNA 3B71A 4JCHA 4KNVA 4LDQA 5TJ5E 3LLKA 4NY3A 5KYXA 1V55C 2JD3A 1XZQA 3NMJA 1D1BA 2YEVA 1BR1A 4IARA 1C02A 3SYNA 3ZVRA 1E85A 1Z63A 4XPXA 3NDBB 2VC9A 4G7OF 2JX0A 3HJCA 1G5ZA 1RJ9B 5AGFA 3AQCA 5B1BC 3TOLA 2P1AA 1CPQA 3K1HA 1M6TA 3SP1A 2HV6A 4G0HA 4JURI 3PHF2 2BC5A 2KK1A 1S7ZA 3IPMO 4OD5A 1LS4A 3NKDA 4MTOA 3ZDLA 2E87A 3AOUA 1ZW3A 1OKKA 3MLGA 1W2WA 4O6MA 2R7TA 3JRMO 4YT8A 5A6KA 4LACB 3L8IA 4PJLA 1A7DA 2RSEB 5BQHA 2YVKA 4DXWA 4E18A 3S0XA 1GGQA 3DJNB 2QY9A 4JRZA 3LESA 4YK5A 5JRAA 3U9MA 3EGDB 2XL4A 5K0IA 1OKKD 4JTAB 4XLNF 3H65A 1FMWA 3OA1A 4EWCA 2NUTB 3S28A 4LERA 3FDQA 2R7XA 2V26A 3SXMA 1SYQA 1PD0A 2LIGA 3FHDA 3GEEA 2YL7A 2R7WA 1QQ3A 2CGEA 2WZLA 2A0UA 2XLWA 1LI7A 1GQAA 3CAXA 1VLTA 3ECSA 3CQZA 5COGA 1J8MF 3ZTZA 5DS4A 2KYHA 2Q4FA 3HNJA 2DYRC 3DAGA 3LNMB 4R32A 3U5SA 3FOPA 3KKBA 4MTGA 3QW0A 5DS5A 3I5QA 1CGOA 4C3EA 2W9YA 4MVUA 4K7BA 5B1AC 1E86A 1L7CA 3TQOA 2UUIA 3HKKA 3C8ZA 3TD7A 4BJTA 4J7TA 2A6EF 4GQHA 2ZD9A 3BEHA 4MVOA 3ASOC 1I4YA 3AG2C 5JP7A 1NG1A 3V5YA 4ZLDA 1BR2A 2Y69C 4A4AA 4O6NA 3K1IC 1WN0A 4J7YA 3T9OA 1IW7F 4W8KA 3ABLC 3U8PA 3POVA 5A6BD 4NTFA 2A6HF 4ULWA 2PP4A 3NMKA 4CS8C 4C3DA 2CYDA 3HNIA 3EGDA 5A6BA 4Z9IA 4YL1A 3K6BA 4IAQA 4DBQA 4MS2A 3UGPA 3LS1A 4U9EA 2YRFA 4U5BE 1ZYRF 4P9FA 2NUTA 2NSGA 1OW7A 1YYXA 2DGJA 5A6JA 3ZSUA 3C7JA 2HMQA 1Z3IX 4KI2A 5B3IA 4K1OA 3IHUA 3QW1A 3DAFA 1JMWA 1FMVA 4P6IC 4EHPA 1H7IA 3F46A 3PCVA 4YN0B 3US6A 3TULA 4H4KC 1HW2A 4KBLA 2C03A 4MTFA 2CNWD 2Q9CA 1BDJB 1D1CA 1U6HA 5A6AA 2M4EA 2J0XA 1ZHWA 4CSAC 4PJNA 4KNWA 1R5ID 2CW0F 3DM9B 3F47A 5KYYA 1RCPA 4OIPF 1SMYF 1CPRA 4H54A 4JEBA 1MNEA 5T1DB 1Z5ZA 4JVSA 2OJED 5COMA 4AE4B 1RMVA 1ST6A 1ZU5A 2KNHA 2KGOA 3GM3A 4OINF 2R02A 5KYUA 2J9WA 4Q5SF 1B68A 2PX0A 2KC3A 2OCCC 3HNLA 2LCHA 2A1DD 2J7PD 3QVZA 2HUJA 3EHMA 4IRUA 4YL0A 5D91A 4Z9JA 5L3VA 3GM2A 3J06A 1APCA 1QLEC 3ATPA 3EQLF 3H2VA 4CIHA 1E83A 3EH1A 2XXAB 3FMSA 1R4TA 3LEOA 2ZXRA 1A7EA 3EHNA 3R2PA 4WJ0A 1VMAA 4CDAA 4E7SA 3LJBA 1OCRC 5T3TA 1H6GA 1F1MA 1OCZC 2DYSC 2A69F 3G50A 2EPOA 3RQFA 5IY5C 3B9QA 1NFNA 1RXQA 1LIHA 3LNRA 4E7ZA 1H9TA 1RKEB 2CNWA 5L0DA 1KNYA 1HE1A 1E2XA 2HJ3A 4NTBA 1D1AA 3C63A 3EFOB 4N6HA 3W2VA 2Y3GA 4CDYA 2EIKC 2Q9AA 4U9DA 1E84A 3IQTA 1TR2A 1LM3B 4Z9HA 2ZXWC 2LFDA 3SXKA 1G4WR 4HFKB 4IJJA 3Q6MA 1NBBA 4RD9A 2OEXA 3V5ZA 1TWGA 1OW8A 5BUOA 1FTSA 2HZ8A 3S9OA 1VYKA 2J9BA 1YARO 4E0HA 3ABKC 2EILC 3K66A 4I44A 4QI0A 3TK0A 2R7RA 1NSGB 3HTKC 3FOOA 5AC5A 4XEVA 2IBFA 1YA9A 1J8YF 1UG7A 4XTKA 4YT2A 1PV3A 1HMDA 3GM1A 5JLIA 3W2WA 2R7VA 2H8AA 3ABMC 1N1CA 1KU2A 3KPHA 4JC7A 4KC9A 3S84A 1OR3A 2F22A 2UUHA 2X51A 1G4US 2AWCA 4CIPA 1M2VB 3EZIA 1JPNA 3JSEO 3RQEA 3VF0A 3I4UA 4BJ1A 5HSWA 1K05A 5E3AA 3AG3C 2R7UA 4BEJA 3GORA 4I1OB 5E33A 3SEOA 4XWJA 4AL0A 5L0JA 2IXNA 1U89A 1O3UA 1LKXA 2QUPA 2J46A 4DOZA 4QI2A 4ZLCA 4I1MA 3UMIA 1WWPA 1ORJA 2I15A 3TJ5A 2QTVA 4NQFA 2YQYA 1V54C 4DBRA 2NUPB 2J8WA 5E2QA 3GWLA 1ZHYA 2HMZA 1OXBA 1VLSA 1T6IA 1WATA 1Q0KA 1HMOA 2FAPB 3FAJA 2B0JA 3GEHA 3DE9A 3O55A 2PF4E 3GODA 3RFYA 1QKRA 2M64A 3DMDA 2IXOA 4PFOA 2WVOA 3PDMP
chains in the Genus database with same CATH topology
3AJMA 1V4AA 3RQEA 1OW7A 1K05A 3K7DA 3L8IA 3GM3A 3C8GA 2LK4A 2YWAA 2L6FA 1O3UA 1WTYA 3C18A 3U3FA 4EBKA 1OW8A 3GM2A 3B71A 3S9OA 1WWPA 3TULA 3RQGA 2JPUA 2Q00A 4XEKA 1K04A 1OW6A 4NQFA 4XEVA 1K40A 2JX0A 2L6GA 2PBEA 3C8GB 4XEFA 1PV3A 2L6HA 1UFBA 3RQFA 1WOLA 3JZ0A 1QVXA 3O10A 3U0CA 5F28E 3GM1A 1JOGA 3BRJA 3MFNA 2KK1A 3L8JA 1ZZPA 3C8GD 4R32A 1KNYA 4EBJA 1KTMA 3JYYA 2HSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  1V4A A;  3RQE A;  1OW7 A;  1K05 A;  3K7D A;  3L8I A;  3GM3 A;  3C8G A;  2LK4 A;  2YWA A;  2L6F A;  1O3U A;  1WTY A;  3C18 A;  3U3F A;  4EBK A;  1OW8 A;  3GM2 A;  3B71 A;  3S9O A;  1WWP A;  3TUL A;  3RQG A;  2JPU A;  2Q00 A;  4XEK A;  1K04 A;  1OW6 A;  4NQF A;  4XEV A;  1K40 A;  2JX0 A;  2L6G A;  2PBE A;  3C8G B;  4XEF A;  1PV3 A;  2L6H A;  1UFB A;  3RQF A;  1WOL A;  3JZ0 A;  1QVX A;  3O10 A;  3U0C A;  5F28 E;  3GM1 A;  1JOG A;  3BRJ A;  3MFN A;  2KK1 A;  3L8J A;  1ZZP A;  3C8G D;  4R32 A;  1KNY A;  4EBJ A;  1KTM A;  3JYY A;  2HSB A; 
#chains in the Genus database with same CATH topology
 1YA7 O;  5GPG B;  3TJ6 A;  2R7O A;  3MYF A;  1G8X A;  3TOM A;  3DE8 A;  1Z6A A;  2PFD A;  4W8P A;  3IQC A;  3MBG A;  4BJ5 C;  3UGO A;  2MYS A;  1O5H A;  1YZC A;  2NPU A;  3DWW A;  4CDV A;  4YJW A;  2R03 A;  4EBK A;  2FGY A;  3EG9 B;  3S27 A;  3V5X A;  2NSF A;  3UMK A;  3RF3 A;  4XPY A;  3A9C A;  2VB6 A;  4C7O A;  2VH3 A;  1JRA A;  1M2V A;  3NMI A;  3G4X A;  3JSZ A;  4FX5 A;  2BL2 A;  1K40 A;  1GS9 A;  3C8G B;  2KSF A;  3SXZ A;  3E70 C;  3JCU Q;  4XPW A;  4U5G A;  2OQM A;  5KYW B;  1M57 C;  2VAS A;  3DM5 A;  1ORS C;  2H7B A;  4EBB A;  3IEE A;  3EZH A;  2LQG A;  3CSK A;  4PAC A;  2AWY A;  2Y39 A;  1MQV A;  1AUE A;  4BJ6 A;  1MMN A;  2YL3 A;  4PFP A;  1SZI A;  3NYJ A;  3EGX A;  2VCB A;  3CEX A;  1ZW2 A;  4F4B A;  3GAN A;  1RJ9 A;  4BG0 A;  1D0Y A;  2CDQ A;  2HSQ A;  1A7V A;  4G78 A;  1OCC C;  3DXJ F;  3AGT A;  5BQG A;  3C18 A;  1ZU4 A;  2P0N A;  2J45 A;  2YLG A;  3Q7G A;  2EIJ C;  4YT5 A;  4GYT A;  1K04 A;  4IB4 A;  3RYL A;  4AE4 A;  5COF A;  4CJG A;  3KYJ A;  4O7G A;  4MND A;  3EJN A;  5KYU B;  2L6G A;  1VB5 A;  4CX9 A;  3ZC4 A;  3M15 A;  3EH2 A;  4HEA J;  1BBH A;  1YJG A;  3O39 A;  4RDA A;  5BQI A;  4AK9 A;  5L3Q A;  1Z23 A;  2KJG A;  3UMH A;  1HY5 A;  3RKO F;  2IXP A;  5CIV A;  5JSL A;  2XXA A;  2NG1 A;  4A2N B;  2X0C A;  3NKE A;  4MVZ A;  2YL1 A;  1YDI A;  2YLD A;  5L0I A;  3LUT B;  4N4W A;  2ZXO A;  3C8G A;  2ASR A;  5A69 A;  4O6Y A;  2WVQ A;  1EQ1 A;  1NU9 C;  3NG1 A;  1OR2 A;  1XWJ A;  4NTA A;  3ZQY A;  3L34 A;  1TFO B;  2QLA A;  1A41 A;  4U5F E;  1C17 M;  1V74 B;  1HW1 A;  1O87 A;  1M56 C;  2IM8 A;  2HV7 A;  3M4C A;  3QVY A;  3AG1 C;  4J32 B;  4U5C E;  1LI5 A;  2XL8 A;  1U0B B;  1IZM A;  1ORY A;  2GWW A;  1EA8 A;  2YKZ A;  3EGX B;  1OXK A;  2Q3T A;  2Y3D A;  5KYN A;  2LFF A;  2GA0 A;  3LAY A;  1SF8 A;  4G7Z F;  4BPM A;  4X0R A;  5DS6 A;  5F28 E;  2C04 A;  1YLM A;  3S90 A;  1AEP A;  1JOG A;  2BE5 F;  3LS0 A;  4JZA A;  4OIO F;  2ZPA A;  4PR9 A;  4L6R A;  3Q7L A;  3WAQ A;  1Q0D A;  2Y3H A;  1NFO A;  2O9X A;  1NU7 D;  4P9T A;  1FFH A;  3JYY A;  2XLD A;  3QTH A;  3T6B A;  3U8V A;  3LEV A;  3V7O A;  1Q0F A;  1T9K A;  1RKC A;  3AGU A;  4EUK B;  2LK4 A;  2A68 F;  3HLZ A;  1T5O A;  1T6Q A;  3U3F A;  2EPM X;  4QDL A;  1GM5 A;  256B A;  3L0I A;  5JUA A;  2I8B A;  4UDV A;  2Q00 A;  4XEK A;  3OEO A;  3UNG C;  2W4M A;  3FVY A;  1BZ4 A;  3JRT A;  2XLH A;  4IGG A;  3WOD F;  3ZG1 A;  2R7S A;  3W4Y A;  3JTL O;  2OKU A;  1Y4C A;  3WG7 C;  3VM6 A;  1QZX A;  4IWB A;  4JE9 A;  2VCA A;  3L8J A;  2WVN A;  5EHH A;  5L0H A;  3DKA A;  4XLP F;  2WZF A;  1YVI A;  2D4U A;  4XQ1 A;  5L0G A;  2QNL A;  2A0B A;  3AG4 C;  3AJM A;  3B29 A;  3K7D A;  4WAB A;  1MMD A;  1EKY A;  3U3B A;  2YHS A;  2XS1 A;  2YZS A;  1Z7Q c;  3A11 A;  5DVW A;  3DZA A;  3NRH A;  2XLM A;  4JJG A;  3N2Z B;  1QPU A;  4ANJ A;  2G3V A;  4FES A;  5HV9 A;  1ZHZ A;  2HS5 A;  5DQT A;  1CGN A;  2XLO A;  3KL4 A;  4MW8 A;  3UR3 C;  4B6I A;  1LE2 A;  2YLI A;  2R7Q A;  3ZTM A;  2LD6 A;  4OIR F;  1AVO B;  4LDR A;  2G3K A;  4HFF B;  2PX3 A;  2XRH A;  4PJM A;  3C62 A;  1PD1 A;  2Y3B A;  2VCC A;  1I4Z A;  2WL8 A;  4NC3 A;  1TWH A;  4O79 A;  2L6H A;  2OU6 A;  1UFB A;  3FXH A;  4PJJ A;  2EIM C;  3RH3 A;  3SZR A;  2P61 A;  3I5P A;  5EK0 A;  4EIY A;  4JJF A;  3W8H A;  1VK5 A;  4D4N A;  4RBN A;  3B0P A;  2TMV P;  2ICW G;  1D0Z A;  5KYX B;  4C7O B;  4BEM J;  4DVZ A;  2EPL X;  5JS5 A;  1ZVZ A;  5D92 A;  4PK4 A;  1NZE A;  2NUP A;  4YL3 A;  2IOQ A;  2AU5 A;  3DJU B;  2L9J A;  1VYI A;  3DD7 A;  2GAQ A;  2LP4 A;  4LLE A;  3SXY A;  4C3B A;  4OD4 A;  4YT4 A;  1WTY A;  1WAS A;  3FAP B;  2AP3 A;  5KYW A;  2DI3 A;  2L81 A;  4JEA A;  3VAY A;  4CSA A;  3RQG A;  1OQC A;  2G62 A;  1XZP A;  3G4Z A;  4WGY A;  3R7C A;  3B0V C;  1OW6 A;  4JTD B;  1JPJ A;  2EPN A;  1H9G A;  1LE4 A;  2PBE A;  2Z15 A;  3X1O A;  4CJO A;  3U0C A;  3T4R A;  5DQZ A;  4E17 A;  1JAF A;  4GEH A;  5E3C A;  1SR2 A;  3QMK A;  3BRJ A;  2DB4 A;  2AVK A;  1ZZP A;  1Q0M A;  3C8G D;  3MX3 A;  4HE8 D;  1LPE A;  2P6V A;  4MQ9 F;  1KTM A;  5F5F A;  1TFK B;  3GWN A;  4YWQ A;  2IYL D;  2KQ9 A;  3M79 A;  3RVY A;  1LVK A;  4OIQ F;  4MVM A;  2XM0 A;  4BJ6 C;  1TWC A;  3MYI A;  2XL6 A;  2OOC A;  1A0B A;  2Q7R A;  1VTM P;  5DLJ A;  3E9V A;  4N6C A;  4DRI B;  3JYH A;  4J30 B;  4DJ9 A;  4DRJ B;  1RKE A;  3K1I A;  1PCX A;  3N24 A;  4CS8 A;  1VOM A;  1T6U A;  3IQ6 A;  1DOW A;  1QSP A;  1JR8 A;  2OJQ A;  3SNH A;  4U5D E;  4Q4Z F;  3AQB A;  2OEV A;  1TQG A;  3GEI A;  4ULV A;  4G7H F;  2WZG A;  2PNO A;  2B0H A;  4MVQ A;  1QVX A;  3NYM A;  3RIP A;  4E0I A;  1LS1 A;  4AX2 A;  4JCZ A;  5FCL A;  4IAO A;  1FR0 A;  3RW0 A;  2LSE A;  4JW1 A;  4EBJ A;  2HSB A;  5T3W A;  2W45 A;  1D0X A;  3KH2 A;  2RD9 A;  3L1M A;  4DRH B;  2D5R B;  2J9U A;  1MMA A;  2J7P A;  3ITF A;  5CI9 A;  4EKW A;  3Q6N A;  5CI8 A;  4MW3 A;  1M2O A;  1Q0G A;  1Y6D A;  2ETS A;  3K33 A;  1MMG A;  4FWV A;  4K0D A;  1L3P A;  3KMI A;  4N06 A;  4I3M A;  4LLC A;  2P7V A;  3N0T A;  3ZIB A;  2CCY A;  2HFI A;  2J9V A;  3EPV A;  1I5N A;  2ZXP A;  4ONS A;  5L0C A;  3U2M A;  1YYJ A;  1TWA A;  3H2U A;  1C03 A;  5AC4 A;  3S29 A;  3W8I A;  5KYY B;  1FFT C;  4D4X A;  3NYL A;  3O6X A;  1WOL A;  3B0U X;  3ASN C;  4LDK A;  3EG9 A;  3MFN A;  2J0W A;  4JIO A;  3CZ6 A;  1S05 A;  4DVY P;  2L7A A;  4NCQ A;  3X2Q C;  1EI7 A;  1ZHT A;  2XLE A;  2H7V C;  2H7O A;  1T01 A;  1HE9 A;  1V4A A;  1YZA A;  2EPK X;  3JZ0 A;  2MHR A;  5B3S C;  1MND A;  3ZQV A;  4CS9 C;  2L6F A;  3KYI A;  5F5H A;  5L0F A;  1NLX A;  3OWT A;  4ER9 A;  1YAU O;  3U9J A;  3WHN A;  2QE9 A;  2IXM A;  3LLI A;  2KW3 C;  2EIN C;  2JPU A;  2OG2 A;  5EGY A;  2R05 A;  3EFO A;  3IQ5 A;  4CBE A;  3DI5 A;  2YL0 A;  3JT1 A;  3RVZ A;  5JT4 A;  4CS7 A;  3M4B A;  2HKV A;  4JKV A;  4FAP B;  4XEF A;  1FAP B;  2XS8 A;  3QZC A;  4M63 A;  2R9R B;  2Q9B A;  2XM4 A;  2GDC A;  3O10 A;  4MVS A;  3VYW A;  4JTC B;  3U2L A;  5JVE A;  3ZWI A;  2HJM A;  3PMR A;  4BJ5 A;  3HNK A;  2FFH A;  1WGW A;  5FZT A;  3M1C B;  2XLV A;  1DOV A;  1ZHX A;  2XSE A;  4CS9 A;  4Q7C A;  4WGZ A;  4AL1 A;  4MVR A;  3T6J A;  2GFH A;  1FNT c;  1CGM E;  2WB7 A;  4U5H A;  4U5E E;  1OCO C;  2R25 A;  2YWA A;  2W4B A;  3VRC A;  3T6G B;  2MWQ A;  2V3C C;  1BR4 A;  1TKN A;  3B71 A;  4JCH A;  4KNV A;  4LDQ A;  5TJ5 E;  3LLK A;  4NY3 A;  5KYX A;  1V55 C;  2JD3 A;  1XZQ A;  3NMJ A;  1D1B A;  2YEV A;  1BR1 A;  4IAR A;  1C02 A;  3SYN A;  3ZVR A;  1E85 A;  1Z63 A;  4XPX A;  3NDB B;  2VC9 A;  4G7O F;  2JX0 A;  3HJC A;  1G5Z A;  1RJ9 B;  5AGF A;  3AQC A;  5B1B C;  3TOL A;  2P1A A;  1CPQ A;  3K1H A;  1M6T A;  3SP1 A;  2HV6 A;  4G0H A;  4JUR I;  3PHF 2;  2BC5 A;  2KK1 A;  1S7Z A;  3IPM O;  4OD5 A;  1LS4 A;  3NKD A;  4MTO A;  3ZDL A;  2E87 A;  3AOU A;  1ZW3 A;  1OKK A;  3MLG A;  1W2W A;  4O6M A;  2R7T A;  3JRM O;  4YT8 A;  5A6K A;  4LAC B;  3L8I A;  4PJL A;  1A7D A;  2RSE B;  5BQH A;  2YVK A;  4DXW A;  4E18 A;  3S0X A;  1GGQ A;  3DJN B;  2QY9 A;  4JRZ A;  3LES A;  4YK5 A;  5JRA A;  3U9M A;  3EGD B;  2XL4 A;  5K0I A;  1OKK D;  4JTA B;  4XLN F;  3H65 A;  1FMW A;  3OA1 A;  4EWC A;  2NUT B;  3S28 A;  4LER A;  3FDQ A;  2R7X A;  2V26 A;  3SXM A;  1SYQ A;  1PD0 A;  2LIG A;  3FHD A;  3GEE A;  2YL7 A;  2R7W A;  1QQ3 A;  2CGE A;  2WZL A;  2A0U A;  2XLW A;  1LI7 A;  1GQA A;  3CAX A;  1VLT A;  3ECS A;  3CQZ A;  5COG A;  1J8M F;  3ZTZ A;  5DS4 A;  2KYH A;  2Q4F A;  3HNJ A;  2DYR C;  3DAG A;  3LNM B;  4R32 A;  3U5S A;  3FOP A;  3KKB A;  4MTG A;  3QW0 A;  5DS5 A;  3I5Q A;  1CGO A;  4C3E A;  2W9Y A;  4MVU A;  4K7B A;  5B1A C;  1E86 A;  1L7C A;  3TQO A;  2UUI A;  3HKK A;  3C8Z A;  3TD7 A;  4BJT A;  4J7T A;  2A6E F;  4GQH A;  2ZD9 A;  3BEH A;  4MVO A;  3ASO C;  1I4Y A;  3AG2 C;  5JP7 A;  1NG1 A;  3V5Y A;  4ZLD A;  1BR2 A;  2Y69 C;  4A4A A;  4O6N A;  3K1I C;  1WN0 A;  4J7Y A;  3T9O A;  1IW7 F;  4W8K A;  3ABL C;  3U8P A;  3POV A;  5A6B D;  4NTF A;  2A6H F;  4ULW A;  2PP4 A;  3NMK A;  4CS8 C;  4C3D A;  2CYD A;  3HNI A;  3EGD A;  5A6B A;  4Z9I A;  4YL1 A;  3K6B A;  4IAQ A;  4DBQ A;  4MS2 A;  3UGP A;  3LS1 A;  4U9E A;  2YRF A;  4U5B E;  1ZYR F;  4P9F A;  2NUT A;  2NSG A;  1OW7 A;  1YYX A;  2DGJ A;  5A6J A;  3ZSU A;  3C7J A;  2HMQ A;  1Z3I X;  4KI2 A;  5B3I A;  4K1O A;  3IHU A;  3QW1 A;  3DAF A;  1JMW A;  1FMV A;  4P6I C;  4EHP A;  1H7I A;  3F46 A;  3PCV A;  4YN0 B;  3US6 A;  3TUL A;  4H4K C;  1HW2 A;  4KBL A;  2C03 A;  4MTF A;  2CNW D;  2Q9C A;  1BDJ B;  1D1C A;  1U6H A;  5A6A A;  2M4E A;  2J0X A;  1ZHW A;  4CSA C;  4PJN A;  4KNW A;  1R5I D;  2CW0 F;  3DM9 B;  3F47 A;  5KYY A;  1RCP A;  4OIP F;  1SMY F;  1CPR A;  4H54 A;  4JEB A;  1MNE A;  5T1D B;  1Z5Z A;  4JVS A;  2OJE D;  5COM A;  4AE4 B;  1RMV A;  1ST6 A;  1ZU5 A;  2KNH A;  2KGO A;  3GM3 A;  4OIN F;  2R02 A;  5KYU A;  2J9W A;  4Q5S F;  1B68 A;  2PX0 A;  2KC3 A;  2OCC C;  3HNL A;  2LCH A;  2A1D D;  2J7P D;  3QVZ A;  2HUJ A;  3EHM A;  4IRU A;  4YL0 A;  5D91 A;  4Z9J A;  5L3V A;  3GM2 A;  3J06 A;  1APC A;  1QLE C;  3ATP A;  3EQL F;  3H2V A;  4CIH A;  1E83 A;  3EH1 A;  2XXA B;  3FMS A;  1R4T A;  3LEO A;  2ZXR A;  1A7E A;  3EHN A;  3R2P A;  4WJ0 A;  1VMA A;  4CDA A;  4E7S A;  3LJB A;  1OCR C;  5T3T A;  1H6G A;  1F1M A;  1OCZ C;  2DYS C;  2A69 F;  3G50 A;  2EPO A;  3RQF A;  5IY5 C;  3B9Q A;  1NFN A;  1RXQ A;  1LIH A;  3LNR A;  4E7Z A;  1H9T A;  1RKE B;  2CNW A;  5L0D A;  1KNY A;  1HE1 A;  1E2X A;  2HJ3 A;  4NTB A;  1D1A A;  3C63 A;  3EFO B;  4N6H A;  3W2V A;  2Y3G A;  4CDY A;  2EIK C;  2Q9A A;  4U9D A;  1E84 A;  3IQT A;  1TR2 A;  1LM3 B;  4Z9H A;  2ZXW C;  2LFD A;  3SXK A;  1G4W R;  4HFK B;  4IJJ A;  3Q6M A;  1NBB A;  4RD9 A;  2OEX A;  3V5Z A;  1TWG A;  1OW8 A;  5BUO A;  1FTS A;  2HZ8 A;  3S9O A;  1VYK A;  2J9B A;  1YAR O;  4E0H A;  3ABK C;  2EIL C;  3K66 A;  4I44 A;  4QI0 A;  3TK0 A;  2R7R A;  1NSG B;  3HTK C;  3FOO A;  5AC5 A;  4XEV A;  2IBF A;  1YA9 A;  1J8Y F;  1UG7 A;  4XTK A;  4YT2 A;  1PV3 A;  1HMD A;  3GM1 A;  5JLI A;  3W2W A;  2R7V A;  2H8A A;  3ABM C;  1N1C A;  1KU2 A;  3KPH A;  4JC7 A;  4KC9 A;  3S84 A;  1OR3 A;  2F22 A;  2UUH A;  2X51 A;  1G4U S;  2AWC A;  4CIP A;  1M2V B;  3EZI A;  1JPN A;  3JSE O;  3RQE A;  3VF0 A;  3I4U A;  4BJ1 A;  5HSW A;  1K05 A;  5E3A A;  3AG3 C;  2R7U A;  4BEJ A;  3GOR A;  4I1O B;  5E33 A;  3SEO A;  4XWJ A;  4AL0 A;  5L0J A;  2IXN A;  1U89 A;  1O3U A;  1LKX A;  2QUP A;  2J46 A;  4DOZ A;  4QI2 A;  4ZLC A;  4I1M A;  3UMI A;  1WWP A;  1ORJ A;  2I15 A;  3TJ5 A;  2QTV A;  4NQF A;  2YQY A;  1V54 C;  4DBR A;  2NUP B;  2J8W A;  5E2Q A;  3GWL A;  1ZHY A;  2HMZ A;  1OXB A;  1VLS A;  1T6I A;  1WAT A;  1Q0K A;  1HMO A;  2FAP B;  3FAJ A;  2B0J A;  3GEH A;  3DE9 A;  3O55 A;  2PF4 E;  3GOD A;  3RFY A;  1QKR A;  2M64 A;  3DMD A;  2IXO A;  4PFO A;  2WVO A;  3PDM P; 
#chains in the Genus database with same CATH homology
 3AJM A;  1V4A A;  3RQE A;  1OW7 A;  1K05 A;  3K7D A;  3L8I A;  3GM3 A;  3C8G A;  2LK4 A;  2YWA A;  2L6F A;  1O3U A;  1WTY A;  3C18 A;  3U3F A;  4EBK A;  1OW8 A;  3GM2 A;  3B71 A;  3S9O A;  1WWP A;  3TUL A;  3RQG A;  2JPU A;  2Q00 A;  4XEK A;  1K04 A;  1OW6 A;  4NQF A;  4XEV A;  1K40 A;  2JX0 A;  2L6G A;  2PBE A;  3C8G B;  4XEF A;  1PV3 A;  2L6H A;  1UFB A;  3RQF A;  1WOL A;  3JZ0 A;  1QVX A;  3O10 A;  3U0C A;  5F28 E;  3GM1 A;  1JOG A;  3BRJ A;  3MFN A;  2KK1 A;  3L8J A;  1ZZP A;  3C8G D;  4R32 A;  1KNY A;  4EBJ A;  1KTM A;  3JYY A;  2HSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...