2Q00A

Crystal structure of the p95883_sulso protein from sulfolobus solfataricus. nesg target ssr10.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
120
Chain Sequence
b'SISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orf c02003 protein
molecule tags Structural genomics, unknown function
source organism Sulfolobus solfataricus p2
publication title Crystal structure of the P95883_SULSO protein from Sulfolobus solfataricus.
rcsb
total genus 46
structure length 120
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05942 PaREP1 Archaeal PaREP1/PaREP8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 2q00A00
2Q00A 3GM2A 1ZZPA 2JPUA 2L6HA 2JX0A 3K7DA 3BRJA 1PV3A 1V4AA 3C8GD 3U3FA 4NQFA 3C18A 2YWAA 2PBEA 1K40A 5F28E 3L8JA 2HSBA 2LK4A 1OW8A 1WOLA 4R32A 4XEKA 1KNYA 1OW7A 3AJMA 3RQGA 4EBKA 2L6FA 3JYYA 3RQEA 3TULA 1WTYA 1OW6A 1QVXA 1K04A 3C8GA 2KK1A 1O3UA 1K05A 3GM3A 3JZ0A 3O10A 1WWPA 2L6GA 3GM1A 3S9OA 3B71A 3RQFA 1UFBA 3L8IA 3C8GB 4XEVA 3MFNA 3U0CA 1KTMA 4EBJA 4XEFA 1JOGA
chains in the Genus database with same CATH superfamily
3EGXA 4KC9A 4NTFA 4PJJA 5COFA 2WZFA 1B68A 256BA 1BR1A 3IHUA 3C62A 3UGPA 3ZIBA 1XWJA 2BL2A 5JUAA 5L0DA 1QZXA 4DBRA 4DBQA 3FOPA 1MMAA 1FFTC 1TFOB 3SXMA 1N1CA 3V5XA 4J32B 4N06A 1LM3B 2H7OA 4CBEA 1CGNA 1QQ3A 4O6NA 3RIPA 2B0HA 3JT1A 3UNGC 1DOVA 2H7VC 3LESA 1OW6A 1QVXA 2ZXRA 3HNIA 4OIPF 1V55C 5B1BC 3LEOA 2R7UA 2UUIA 1CGOA 1HE1A 2J9UA 3W4YA 4JURI 1SR2A 5L3QA 3H2UA 2HSQA 4WABA 4YN0B 4DVZA 5T3TA 4MTFA 3RF3A 3ZG1A 3NYJA 2YZSA 2JX0A 3H2VA 2LP4A 5A6BA 3F46A 4NQFA 2J45A 3DE9A 3ABLC 4H54A 4WJ0A 3IQ6A 2YWAA 4U9EA 4YT4A 4CJOA 2A0BA 2DB4A 1Z63A 5DLJA 2IXNA 2CYDA 2HSBA 2C04A 2YL7A 1NU7D 4JJGA 4MVZA 3JRTA 4Z9HA 4UDVA 2YRFA 4BEJA 4OIOF 3AGTA 1ZU4A 2OJED 5A6KA 3VF0A 1H9TA 1M2VB 3C8GA 3CEXA 3S27A 3GM3A 3JCUQ 4F4BA 3QZCA 4P6IC 5A6JA 2L6GA 1BR4A 3ASOC 3JSZA 1LVKA 1HE9A 3FMSA 1LI5A 3K6BA 4E0HA 4XEVA 2IXOA 3EGDB 3IQTA 4E17A 3NDBB 3LUTB 3ASNC 3K1IC 2HMZA 1MNDA 5L0JA 4JCHA 1MNEA 1ZVZA 4DRHB 2PF4E 1Q0MA 4IB4A 4OINF 2L6HA 2R03A 1D1BA 1RMVA 4JRZA 4PFPA 2EPNA 1WGWA 1GS9A 2EINC 2XLHA 2OU6A 3TOLA 4NC3A 4ANJA 3EFOB 3EHNA 5DQTA 2J9VA 2PX0A 3FXHA 3LS0A 1A7DA 4BJ6C 1CPRA 2NG1A 3AG4C 5CI9A 2FFHA 3RYLA 4AK9A 3EHMA 2FAPB 2EILC 2GFHA 4XEKA 2CGEA 3RQGA 5K0IA 4KNVA 3JSEO 2J0XA 2LD6A 3KYIA 2KGOA 4G0HA 5AC4A 4O6MA 1VYKA 5COGA 5HV9A 1L7CA 1YA7O 3AQCA 3JZ0A 1RKEA 3O10A 3JYHA 1RCPA 5BQGA 3RFYA 3EH1A 3JRMO 2CNWD 1UFBA 3CAXA 3HLZA 3RVYA 4D4XA 1UG7A 4E7SA 5EGYA 1ZW3A 3CQZA 4LDRA 2PFDA 3RH3A 5BQIA 1HMOA 1M2OA 3X1OA 2P6VA 1TQGA 4DOZA 1OXBA 1U89A 3W8IA 2Y3DA 2R7XA 3BRJA 1E84A 5DS5A 1F1MA 4U5HA 3B29A 3E9VA 3T6GB 2O9XA 5DS6A 4IGGA 2VCAA 1IZMA 2XS8A 4CS7A 3R2PA 1FR0A 3NG1A 1E83A 3B0UX 2FGYA 4QI0A 4G7HF 2MWQA 1AVOB 3DKAA 1RJ9A 4IJJA 3ATPA 1G4WR 2YLIA 3TJ6A 3S90A 4BJTA 2QTVA 1OR2A 2OEXA 1M6TA 1QSPA 3NYLA 3N2ZB 2AWYA 4JVSA 4MVUA 4G7ZF 1XZPA 2D4UA 4Q7CA 2OOCA 4O6YA 1RKEB 1YYXA 4CS8C 1JPNA 2XLVA 3ABMC 3DAGA 4QDLA 4C7OA 4ONSA 4XPWA 3E70C 2ZXOA 4Z9IA 4HFFB 4YJWA 3TJ5A 3C18A 1Q0FA 4Q4ZF 1RJ9B 3W2WA 2PBEA 2ETSA 2XLDA 4RD9A 3GODA 1JAFA 3TOMA 2X51A 2XM4A 3HTKC 5D91A 5KYWA 1SMYF 3V5ZA 1MQVA 4NCQA 3AG1C 4PACA 3U3BA 4DRJB 1TWGA 2EIMC 4FAPB 4XPYA 5KYUA 3ZDLA 4MTGA 3JYYA 4U5BE 4J30B 3ZSUA 4JCZA 3RKOF 3ZQYA 4GQHA 1OKKD 2ICWG 3ECSA 3EZHA 1ORSC 4MVMA 1OCCC 4P9FA 3K1HA 2LIGA 3RQFA 4YT8A 4N6CA 5L0HA 3M4BA 4IAQA 3T4RA 2XL6A 3PMRA 5E3CA 2ASRA 1H9GA 4XPXA 1NBBA 3NMKA 1L3PA 2HKVA 4AX2A 1J8MF 2B0JA 4MVOA 3L1MA 3I5QA 2EIKC 1OCRC 2A6EF 1NSGB 2LQGA 5A6BD 1T6IA 4LLEA 3L34A 5A69A 2VCCA 3VYWA 3GWNA 4ULWA 1OQCA 1Y4CA 2OG2A 3EGXB 4HEAJ 1T6UA 4AL1A 2L81A 1KU2A 1LKXA 4EKWA 1QKRA 1Q0KA 3TK0A 1TWAA 1OW8A 1C02A 1M56C 1MMNA 1WATA 2YKZA 1HY5A 4I1MA 1EQ1A 3EG9A 4QI2A 4JTAB 4U5GA 1D1AA 3ZTZA 4BJ5A 3TULA 5HSWA 2LFDA 1K05A 3H65A 5AC5A 3NMJA 3S9OA 1Z3IX 4OIRF 1FNTc 2YL1A 2M64A 5L0CA 2L9JA 3MFNA 1VK5A 5A6AA 4EBJA 1YZAA 2EPLX 3HNKA 2HV6A 2EPOA 2NPUA 1I4YA 1ZYRF 2H7BA 4DXWA 3B0VC 5EK0A 2E87A 1NFOA 1ORYA 2OJQA 1O5HA 2KYHA 1YJGA 3AQBA 3OEOA 3QVZA 3SXKA 2DYRC 4JJFA 4A2NB 4CDYA 3U3FA 4OIQF 4E0IA 4ZLDA 2DGJA 4CS8A 2DI3A 3LEVA 3G4XA 3HJCA 3LLKA 5T1DB 4BJ6A 3GANA 1WOLA 1LIHA 2J0WA 1KNYA 2QE9A 3OWTA 1NG1A 4U5DE 4U5CE 3LAYA 4MTOA 5KYWB 2VC9A 3EGDA 1TR2A 2XL4A 2YHSA 3C63A 4JKVA 1Z7Qc 1FMVA 1YA9A 1APCA 2PP4A 3DE8A 3TD7A 4C7OB 5CIVA 2RD9A 1BZ4A 1ZW2A 5JT4A 2NUTB 1RXQA 5E3AA 5B3SC 1U6HA 3X2QC 2NSFA 4H4KC 3ITFA 4LLCA 5JP7A 3M79A 3FDQA 2VASA 3UGOA 3NKDA 3EPVA 4W8PA 3K7DA 1SZIA 2WZLA 3DJUB 4BPMA 4I1OB 2AVKA 2Y3BA 2OCCC 4IWBA 3Q6NA 4NY3A 1CGME 2R7VA 5JLIA 2GAQA 3OA1A 2XSEA 1T5OA 2P61A 2QNLA 3NKEA 5E2QA 1LE2A 4XLNF 3SXYA 4PJLA 3K33A 3KYJA 5JRAA 3LNRA 2R05A 3U5SA 4P9TA 1V74B 3AJMA 4Z9JA 1FFHA 2CNWA 2QLAA 3RQEA 3MYIA 4E7ZA 1OCZC 2KK1A 4IRUA 5JVEA 3VRCA 2RSEB 3LNMB 3B71A 3DAFA 4BJ1A 2R7QA 3WHNA 2LFFA 3DM5A 4MNDA 4EWCA 3Q6MA 2Y69C 2GDCA 3GEEA 2MYSA 3UR3C 5L0GA 1VB5A 4EUKB 1SYQA 3PDMP 3ABKC 4EIYA 1ZZPA 2OQMA 2XLOA 2Y3HA 2ZXPA 3B0PA 3ZTMA 1Y6DA 2AU5A 1PV3A 1OKKA 4PJNA 4JZAA 1R4TA 2F22A 2ZXWC 4XTKA 3SP1A 4DVYP 3KL4A 3V7OA 1NFNA 2A69F 2XM0A 4I44A 5KYYA 5KYUB 4XLPF 1ZU5A 3S29A 4PFOA 3LLIA 3US6A 3C7JA 2R7RA 3N24A 4R32A 3DJNB 2YQYA 1FTSA 2CDQA 1BBHA 2C03A 1R5ID 4CDVA 1HW2A 2W9YA 2HV7A 3EH2A 3FAJA 1T9KA 2KSFA 3SXZA 4DJ9A 3C8ZA 2HS5A 1JRAA 4C3EA 3U0CA 1GQAA 3MX3A 1KTMA 4XEFA 3WG7C 1YAUO 4CDAA 1JPJA 4MW3A 4IAOA 1CPQA 1VLTA 2JPUA 2Y3GA 1ZHXA 2J8WA 1H7IA 2Q9BA 2ZPAA 3NRHA 1FAPB 2P1AA 4LACB 2AP3A 2XLMA 2XS1A 3CSKA 2NUTA 5KYXB 2V26A 1GGQA 3S28A 2R7SA 1G8XA 5L0FA 1JMWA 1K40A 3IEEA 5DVWA 3L8JA 1H6GA 1ZHTA 2M4EA 3DMDA 3O55A 4JIOA 4YT5A 3A9CA 2I15A 2Z15A 4DRIB 2L6FA 3Q7GA 4GYTA 4YL1A 4WGYA 4N4WA 3U9JA 3VAYA 1Q0GA 5F5FA 4YWQA 1NU9C 4EBBA 3JTLO 2CW0F 3PCVA 2VCBA 2Q4FA 2P0NA 1E85A 4JEBA 4MQ9F 2HFIA 1VMAA 2YL3A 4K1OA 1BR2A 2BC5A 5FZTA 3TQOA 5KYXA 1TWHA 2OKUA 4M63A 4U5EE 1LPEA 4W8KA 1AEPA 2IXMA 4CSAA 4NTAA 2PNOA 4FX5A 1GM5A 4CS9C 2H8AA 5BQHA 2J46A 2A68F 4RDAA 2A6HF 2QY9A 2Q9AA 1FMWA 1ZHZA 2G3KA 3RW0A 3UMHA 3GEHA 1S7ZA 3QVYA 1YLMA 2KNHA 4ZLCA 1U0BB 4K0DA 4HFKB 3ZWIA 5DQZA 5DS4A 4KNWA 2YL0A 3GM1A 3ZC4A 4CIPA 1A7EA 1YYJA 4GEHA 3WODF 4KI2A 2KJGA 2OEVA 5IY5C 1OCOC 1MMDA 3BEHA 2BE5F 1G5ZA 3NMIA 2Q00A 5COMA 2CCYA 3EZIA 5AGFA 4YK5A 5L3VA 2YLGA 4YL3A 5JSLA 1S05A 1V4AA 3C8GD 3Q7LA 4YL0A 4BG0A 2DYSC 2EIJC 3M1CB 1LE4A 1VYIA 2R02A 3FHDA 3FOOA 4FESA 4C3DA 2YVKA 2JD3A 1V54C 2P7VA 3IQCA 2NUPA 2R25A 5JS5A 3PHF2 3T6JA 4XQ1A 2KW3C 2I8BA 1PD1A 3DD7A 5D92A 1D0ZA 3DXJF 5EHHA 1EA8A 1NLXA 1PCXA 2HUJA 3U8PA 3N0TA 1IW7F 2Y39A 1WTYA 1JR8A 2R7TA 1T01A 3G4ZA 1Z23A 3WAQA 2KQ9A 3I4UA 1J8YF 1D1CA 1OXKA 5CI8A 2W4MA 3C8GB 4ER9A 2J9BA 2QUPA 3MLGA 1JOGA 1VLSA 1O87A 2XL8A 3FAPB 1A7VA 3SYNA 2KC3A 2R7OA 3IQ5A 4BJ5C 1Z5ZA 1BDJB 1ORJA 4A4AA 4EHPA 1YZCA 1TWCA 5E33A 4CIHA 2R9RB 2WL8A 1TKNA 1M2VA 1AUEA 4HE8D 2W45A 2YLDA 2IXPA 1EI7A 5FCLA 2Q7RA 2UUHA 2VB6A 5BUOA 5B1AC 3KPHA 3SZRA 2HMQA 3KH2A 1DOWA 1O3UA 1LS1A 2GWWA 1T6QA 3UMIA 4PJMA 2R7WA 2VH3A 3LJBA 3A11A 5T3WA 4CJGA 1A0BA 2J7PA 4BEMJ 4D4NA 4WGZA 5L0IA 4LDKA 2HJMA 4O7GA 4PR9A 3V5YA 3S0XA 1LS4A 3QW0A 2XRHA 3GM2A 4G7OF 4B6IA 3MBGA 4AE4B 2IBFA 1E86A 3AGUA 3QW1A 4N6HA 1Q0DA 1HW1A 1OR3A 1PD0A 2WVOA 1WN0A 3K1IA 3B9QA 2Q3TA 4MVSA 3SNHA 3KMIA 4JW1A 2L7AA 5F28E 3GWLA 1ST6A 3FVYA 1OW7A 4FWVA 4J7YA 4CS9A 4EBKA 4OD5A 1K04A 3G50A 4MW8A 3W8HA 4L6RA 2XXAB 3DZAA 1WWPA 4U9DA 3R7CA 2IOQA 4G78A 4ULVA 1YDIA 4RBNA 2AWCA 4MVRA 5KYNA 3O6XA 2D5RB 1LI7A 3O39A 3AG3C 3RVZA 4CSAC 3M4CA 4IARA 1TFKB 2G62A 2G3VA 2LSEA 4LDQA 3L0IA 3NYMA 2X0CA 5F5HA 2NSGA 3EJNA 1D0XA 3S84A 3GORA 1A41A 1SF8A 4JE9A 4J7TA 3T9OA 3HNLA 4JTCB 3ZVRA 4AL0A 1MMGA 2EPMX 4KBLA 3AG2C 1G4US 1C17M 5GPGB 4AE4A 3EFOA 2LK4A 4OD4A 2WB7A 2ZD9A 4LERA 3VM6A 4C3BA 4PK4A 2A1DD 3UMKA 3QMKA 4CX9A 1XZQA 4O79A 2HZ8A 3W2VA 2HJ3A 2A0UA 3L8IA 4K7BA 4YT2A 3I5PA 1NZEA 3DI5A 3F47A 2XLWA 1I4ZA 2XLEA 3DM9B 1YVIA 1VOMA 4JEAA 3HNJA 2TMVP 2J9WA 2IM8A 2WZGA 3IPMO 3U2LA 3U2MA 4Q5SF 5B3IA 3SEOA 1E2XA 1D0YA 3HKKA 2WVNA 2YEVA 3MYFA 3ZQVA 1VTMP 4NTBA 3EQLF 4JC7A 3GEIA 4I3MA 1HMDA 4MVQA 5TJ5E 3J06A 1M57C 2GA0A 2Q9CA 1ZHWA 1QLEC 2MHRA 1QPUA 3LS1A 3AOUA 2NUPB 5KYYB 1W2WA 3CZ6A 4E18A 3POVA 2W4BA 4JTDB 4MS2A 2J7PD 4XWJA 2IYLD 3K66A 1ZHYA 2EPKX 3DWWA 2LCHA 3EG9B 4U5FE 3U9MA 3U8VA 1RKCA 1YARO 2PX3A 1Z6AA 3KKBA 4X0RA 3T6BA 1WASA 2XXAA 1EKYA 1I5NA 3M15A 1C03A 2V3CC 2WVQA 3QTHA
chains in the Genus database with same CATH topology
2Q00A 3GM2A 1ZZPA 2JPUA 2L6HA 2JX0A 3K7DA 3BRJA 1PV3A 1V4AA 3C8GD 3U3FA 4NQFA 3C18A 2YWAA 2PBEA 1K40A 5F28E 3L8JA 2HSBA 2LK4A 1OW8A 1WOLA 4R32A 4XEKA 1KNYA 1OW7A 3AJMA 3RQGA 4EBKA 2L6FA 3JYYA 3RQEA 3TULA 1WTYA 1OW6A 1QVXA 1K04A 3C8GA 2KK1A 1O3UA 1K05A 3GM3A 3JZ0A 3O10A 1WWPA 2L6GA 3GM1A 3S9OA 3B71A 3RQFA 1UFBA 3L8IA 3C8GB 4XEVA 3MFNA 3U0CA 1KTMA 4EBJA 4XEFA 1JOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q00 A;  3GM2 A;  1ZZP A;  2JPU A;  2L6H A;  2JX0 A;  3K7D A;  3BRJ A;  1PV3 A;  1V4A A;  3C8G D;  3U3F A;  4NQF A;  3C18 A;  2YWA A;  2PBE A;  1K40 A;  5F28 E;  3L8J A;  2HSB A;  2LK4 A;  1OW8 A;  1WOL A;  4R32 A;  4XEK A;  1KNY A;  1OW7 A;  3AJM A;  3RQG A;  4EBK A;  2L6F A;  3JYY A;  3RQE A;  3TUL A;  1WTY A;  1OW6 A;  1QVX A;  1K04 A;  3C8G A;  2KK1 A;  1O3U A;  1K05 A;  3GM3 A;  3JZ0 A;  3O10 A;  1WWP A;  2L6G A;  3GM1 A;  3S9O A;  3B71 A;  3RQF A;  1UFB A;  3L8I A;  3C8G B;  4XEV A;  3MFN A;  3U0C A;  1KTM A;  4EBJ A;  4XEF A;  1JOG A; 
#chains in the Genus database with same CATH topology
 3EGX A;  4KC9 A;  4NTF A;  4PJJ A;  5COF A;  2WZF A;  1B68 A;  256B A;  1BR1 A;  3IHU A;  3C62 A;  3UGP A;  3ZIB A;  1XWJ A;  2BL2 A;  5JUA A;  5L0D A;  1QZX A;  4DBR A;  4DBQ A;  3FOP A;  1MMA A;  1FFT C;  1TFO B;  3SXM A;  1N1C A;  3V5X A;  4J32 B;  4N06 A;  1LM3 B;  2H7O A;  4CBE A;  1CGN A;  1QQ3 A;  4O6N A;  3RIP A;  2B0H A;  3JT1 A;  3UNG C;  1DOV A;  2H7V C;  3LES A;  1OW6 A;  1QVX A;  2ZXR A;  3HNI A;  4OIP F;  1V55 C;  5B1B C;  3LEO A;  2R7U A;  2UUI A;  1CGO A;  1HE1 A;  2J9U A;  3W4Y A;  4JUR I;  1SR2 A;  5L3Q A;  3H2U A;  2HSQ A;  4WAB A;  4YN0 B;  4DVZ A;  5T3T A;  4MTF A;  3RF3 A;  3ZG1 A;  3NYJ A;  2YZS A;  2JX0 A;  3H2V A;  2LP4 A;  5A6B A;  3F46 A;  4NQF A;  2J45 A;  3DE9 A;  3ABL C;  4H54 A;  4WJ0 A;  3IQ6 A;  2YWA A;  4U9E A;  4YT4 A;  4CJO A;  2A0B A;  2DB4 A;  1Z63 A;  5DLJ A;  2IXN A;  2CYD A;  2HSB A;  2C04 A;  2YL7 A;  1NU7 D;  4JJG A;  4MVZ A;  3JRT A;  4Z9H A;  4UDV A;  2YRF A;  4BEJ A;  4OIO F;  3AGT A;  1ZU4 A;  2OJE D;  5A6K A;  3VF0 A;  1H9T A;  1M2V B;  3C8G A;  3CEX A;  3S27 A;  3GM3 A;  3JCU Q;  4F4B A;  3QZC A;  4P6I C;  5A6J A;  2L6G A;  1BR4 A;  3ASO C;  3JSZ A;  1LVK A;  1HE9 A;  3FMS A;  1LI5 A;  3K6B A;  4E0H A;  4XEV A;  2IXO A;  3EGD B;  3IQT A;  4E17 A;  3NDB B;  3LUT B;  3ASN C;  3K1I C;  2HMZ A;  1MND A;  5L0J A;  4JCH A;  1MNE A;  1ZVZ A;  4DRH B;  2PF4 E;  1Q0M A;  4IB4 A;  4OIN F;  2L6H A;  2R03 A;  1D1B A;  1RMV A;  4JRZ A;  4PFP A;  2EPN A;  1WGW A;  1GS9 A;  2EIN C;  2XLH A;  2OU6 A;  3TOL A;  4NC3 A;  4ANJ A;  3EFO B;  3EHN A;  5DQT A;  2J9V A;  2PX0 A;  3FXH A;  3LS0 A;  1A7D A;  4BJ6 C;  1CPR A;  2NG1 A;  3AG4 C;  5CI9 A;  2FFH A;  3RYL A;  4AK9 A;  3EHM A;  2FAP B;  2EIL C;  2GFH A;  4XEK A;  2CGE A;  3RQG A;  5K0I A;  4KNV A;  3JSE O;  2J0X A;  2LD6 A;  3KYI A;  2KGO A;  4G0H A;  5AC4 A;  4O6M A;  1VYK A;  5COG A;  5HV9 A;  1L7C A;  1YA7 O;  3AQC A;  3JZ0 A;  1RKE A;  3O10 A;  3JYH A;  1RCP A;  5BQG A;  3RFY A;  3EH1 A;  3JRM O;  2CNW D;  1UFB A;  3CAX A;  3HLZ A;  3RVY A;  4D4X A;  1UG7 A;  4E7S A;  5EGY A;  1ZW3 A;  3CQZ A;  4LDR A;  2PFD A;  3RH3 A;  5BQI A;  1HMO A;  1M2O A;  3X1O A;  2P6V A;  1TQG A;  4DOZ A;  1OXB A;  1U89 A;  3W8I A;  2Y3D A;  2R7X A;  3BRJ A;  1E84 A;  5DS5 A;  1F1M A;  4U5H A;  3B29 A;  3E9V A;  3T6G B;  2O9X A;  5DS6 A;  4IGG A;  2VCA A;  1IZM A;  2XS8 A;  4CS7 A;  3R2P A;  1FR0 A;  3NG1 A;  1E83 A;  3B0U X;  2FGY A;  4QI0 A;  4G7H F;  2MWQ A;  1AVO B;  3DKA A;  1RJ9 A;  4IJJ A;  3ATP A;  1G4W R;  2YLI A;  3TJ6 A;  3S90 A;  4BJT A;  2QTV A;  1OR2 A;  2OEX A;  1M6T A;  1QSP A;  3NYL A;  3N2Z B;  2AWY A;  4JVS A;  4MVU A;  4G7Z F;  1XZP A;  2D4U A;  4Q7C A;  2OOC A;  4O6Y A;  1RKE B;  1YYX A;  4CS8 C;  1JPN A;  2XLV A;  3ABM C;  3DAG A;  4QDL A;  4C7O A;  4ONS A;  4XPW A;  3E70 C;  2ZXO A;  4Z9I A;  4HFF B;  4YJW A;  3TJ5 A;  3C18 A;  1Q0F A;  4Q4Z F;  1RJ9 B;  3W2W A;  2PBE A;  2ETS A;  2XLD A;  4RD9 A;  3GOD A;  1JAF A;  3TOM A;  2X51 A;  2XM4 A;  3HTK C;  5D91 A;  5KYW A;  1SMY F;  3V5Z A;  1MQV A;  4NCQ A;  3AG1 C;  4PAC A;  3U3B A;  4DRJ B;  1TWG A;  2EIM C;  4FAP B;  4XPY A;  5KYU A;  3ZDL A;  4MTG A;  3JYY A;  4U5B E;  4J30 B;  3ZSU A;  4JCZ A;  3RKO F;  3ZQY A;  4GQH A;  1OKK D;  2ICW G;  3ECS A;  3EZH A;  1ORS C;  4MVM A;  1OCC C;  4P9F A;  3K1H A;  2LIG A;  3RQF A;  4YT8 A;  4N6C A;  5L0H A;  3M4B A;  4IAQ A;  3T4R A;  2XL6 A;  3PMR A;  5E3C A;  2ASR A;  1H9G A;  4XPX A;  1NBB A;  3NMK A;  1L3P A;  2HKV A;  4AX2 A;  1J8M F;  2B0J A;  4MVO A;  3L1M A;  3I5Q A;  2EIK C;  1OCR C;  2A6E F;  1NSG B;  2LQG A;  5A6B D;  1T6I A;  4LLE A;  3L34 A;  5A69 A;  2VCC A;  3VYW A;  3GWN A;  4ULW A;  1OQC A;  1Y4C A;  2OG2 A;  3EGX B;  4HEA J;  1T6U A;  4AL1 A;  2L81 A;  1KU2 A;  1LKX A;  4EKW A;  1QKR A;  1Q0K A;  3TK0 A;  1TWA A;  1OW8 A;  1C02 A;  1M56 C;  1MMN A;  1WAT A;  2YKZ A;  1HY5 A;  4I1M A;  1EQ1 A;  3EG9 A;  4QI2 A;  4JTA B;  4U5G A;  1D1A A;  3ZTZ A;  4BJ5 A;  3TUL A;  5HSW A;  2LFD A;  1K05 A;  3H65 A;  5AC5 A;  3NMJ A;  3S9O A;  1Z3I X;  4OIR F;  1FNT c;  2YL1 A;  2M64 A;  5L0C A;  2L9J A;  3MFN A;  1VK5 A;  5A6A A;  4EBJ A;  1YZA A;  2EPL X;  3HNK A;  2HV6 A;  2EPO A;  2NPU A;  1I4Y A;  1ZYR F;  2H7B A;  4DXW A;  3B0V C;  5EK0 A;  2E87 A;  1NFO A;  1ORY A;  2OJQ A;  1O5H A;  2KYH A;  1YJG A;  3AQB A;  3OEO A;  3QVZ A;  3SXK A;  2DYR C;  4JJF A;  4A2N B;  4CDY A;  3U3F A;  4OIQ F;  4E0I A;  4ZLD A;  2DGJ A;  4CS8 A;  2DI3 A;  3LEV A;  3G4X A;  3HJC A;  3LLK A;  5T1D B;  4BJ6 A;  3GAN A;  1WOL A;  1LIH A;  2J0W A;  1KNY A;  2QE9 A;  3OWT A;  1NG1 A;  4U5D E;  4U5C E;  3LAY A;  4MTO A;  5KYW B;  2VC9 A;  3EGD A;  1TR2 A;  2XL4 A;  2YHS A;  3C63 A;  4JKV A;  1Z7Q c;  1FMV A;  1YA9 A;  1APC A;  2PP4 A;  3DE8 A;  3TD7 A;  4C7O B;  5CIV A;  2RD9 A;  1BZ4 A;  1ZW2 A;  5JT4 A;  2NUT B;  1RXQ A;  5E3A A;  5B3S C;  1U6H A;  3X2Q C;  2NSF A;  4H4K C;  3ITF A;  4LLC A;  5JP7 A;  3M79 A;  3FDQ A;  2VAS A;  3UGO A;  3NKD A;  3EPV A;  4W8P A;  3K7D A;  1SZI A;  2WZL A;  3DJU B;  4BPM A;  4I1O B;  2AVK A;  2Y3B A;  2OCC C;  4IWB A;  3Q6N A;  4NY3 A;  1CGM E;  2R7V A;  5JLI A;  2GAQ A;  3OA1 A;  2XSE A;  1T5O A;  2P61 A;  2QNL A;  3NKE A;  5E2Q A;  1LE2 A;  4XLN F;  3SXY A;  4PJL A;  3K33 A;  3KYJ A;  5JRA A;  3LNR A;  2R05 A;  3U5S A;  4P9T A;  1V74 B;  3AJM A;  4Z9J A;  1FFH A;  2CNW A;  2QLA A;  3RQE A;  3MYI A;  4E7Z A;  1OCZ C;  2KK1 A;  4IRU A;  5JVE A;  3VRC A;  2RSE B;  3LNM B;  3B71 A;  3DAF A;  4BJ1 A;  2R7Q A;  3WHN A;  2LFF A;  3DM5 A;  4MND A;  4EWC A;  3Q6M A;  2Y69 C;  2GDC A;  3GEE A;  2MYS A;  3UR3 C;  5L0G A;  1VB5 A;  4EUK B;  1SYQ A;  3PDM P;  3ABK C;  4EIY A;  1ZZP A;  2OQM A;  2XLO A;  2Y3H A;  2ZXP A;  3B0P A;  3ZTM A;  1Y6D A;  2AU5 A;  1PV3 A;  1OKK A;  4PJN A;  4JZA A;  1R4T A;  2F22 A;  2ZXW C;  4XTK A;  3SP1 A;  4DVY P;  3KL4 A;  3V7O A;  1NFN A;  2A69 F;  2XM0 A;  4I44 A;  5KYY A;  5KYU B;  4XLP F;  1ZU5 A;  3S29 A;  4PFO A;  3LLI A;  3US6 A;  3C7J A;  2R7R A;  3N24 A;  4R32 A;  3DJN B;  2YQY A;  1FTS A;  2CDQ A;  1BBH A;  2C03 A;  1R5I D;  4CDV A;  1HW2 A;  2W9Y A;  2HV7 A;  3EH2 A;  3FAJ A;  1T9K A;  2KSF A;  3SXZ A;  4DJ9 A;  3C8Z A;  2HS5 A;  1JRA A;  4C3E A;  3U0C A;  1GQA A;  3MX3 A;  1KTM A;  4XEF A;  3WG7 C;  1YAU O;  4CDA A;  1JPJ A;  4MW3 A;  4IAO A;  1CPQ A;  1VLT A;  2JPU A;  2Y3G A;  1ZHX A;  2J8W A;  1H7I A;  2Q9B A;  2ZPA A;  3NRH A;  1FAP B;  2P1A A;  4LAC B;  2AP3 A;  2XLM A;  2XS1 A;  3CSK A;  2NUT A;  5KYX B;  2V26 A;  1GGQ A;  3S28 A;  2R7S A;  1G8X A;  5L0F A;  1JMW A;  1K40 A;  3IEE A;  5DVW A;  3L8J A;  1H6G A;  1ZHT A;  2M4E A;  3DMD A;  3O55 A;  4JIO A;  4YT5 A;  3A9C A;  2I15 A;  2Z15 A;  4DRI B;  2L6F A;  3Q7G A;  4GYT A;  4YL1 A;  4WGY A;  4N4W A;  3U9J A;  3VAY A;  1Q0G A;  5F5F A;  4YWQ A;  1NU9 C;  4EBB A;  3JTL O;  2CW0 F;  3PCV A;  2VCB A;  2Q4F A;  2P0N A;  1E85 A;  4JEB A;  4MQ9 F;  2HFI A;  1VMA A;  2YL3 A;  4K1O A;  1BR2 A;  2BC5 A;  5FZT A;  3TQO A;  5KYX A;  1TWH A;  2OKU A;  4M63 A;  4U5E E;  1LPE A;  4W8K A;  1AEP A;  2IXM A;  4CSA A;  4NTA A;  2PNO A;  4FX5 A;  1GM5 A;  4CS9 C;  2H8A A;  5BQH A;  2J46 A;  2A68 F;  4RDA A;  2A6H F;  2QY9 A;  2Q9A A;  1FMW A;  1ZHZ A;  2G3K A;  3RW0 A;  3UMH A;  3GEH A;  1S7Z A;  3QVY A;  1YLM A;  2KNH A;  4ZLC A;  1U0B B;  4K0D A;  4HFK B;  3ZWI A;  5DQZ A;  5DS4 A;  4KNW A;  2YL0 A;  3GM1 A;  3ZC4 A;  4CIP A;  1A7E A;  1YYJ A;  4GEH A;  3WOD F;  4KI2 A;  2KJG A;  2OEV A;  5IY5 C;  1OCO C;  1MMD A;  3BEH A;  2BE5 F;  1G5Z A;  3NMI A;  2Q00 A;  5COM A;  2CCY A;  3EZI A;  5AGF A;  4YK5 A;  5L3V A;  2YLG A;  4YL3 A;  5JSL A;  1S05 A;  1V4A A;  3C8G D;  3Q7L A;  4YL0 A;  4BG0 A;  2DYS C;  2EIJ C;  3M1C B;  1LE4 A;  1VYI A;  2R02 A;  3FHD A;  3FOO A;  4FES A;  4C3D A;  2YVK A;  2JD3 A;  1V54 C;  2P7V A;  3IQC A;  2NUP A;  2R25 A;  5JS5 A;  3PHF 2;  3T6J A;  4XQ1 A;  2KW3 C;  2I8B A;  1PD1 A;  3DD7 A;  5D92 A;  1D0Z A;  3DXJ F;  5EHH A;  1EA8 A;  1NLX A;  1PCX A;  2HUJ A;  3U8P A;  3N0T A;  1IW7 F;  2Y39 A;  1WTY A;  1JR8 A;  2R7T A;  1T01 A;  3G4Z A;  1Z23 A;  3WAQ A;  2KQ9 A;  3I4U A;  1J8Y F;  1D1C A;  1OXK A;  5CI8 A;  2W4M A;  3C8G B;  4ER9 A;  2J9B A;  2QUP A;  3MLG A;  1JOG A;  1VLS A;  1O87 A;  2XL8 A;  3FAP B;  1A7V A;  3SYN A;  2KC3 A;  2R7O A;  3IQ5 A;  4BJ5 C;  1Z5Z A;  1BDJ B;  1ORJ A;  4A4A A;  4EHP A;  1YZC A;  1TWC A;  5E33 A;  4CIH A;  2R9R B;  2WL8 A;  1TKN A;  1M2V A;  1AUE A;  4HE8 D;  2W45 A;  2YLD A;  2IXP A;  1EI7 A;  5FCL A;  2Q7R A;  2UUH A;  2VB6 A;  5BUO A;  5B1A C;  3KPH A;  3SZR A;  2HMQ A;  3KH2 A;  1DOW A;  1O3U A;  1LS1 A;  2GWW A;  1T6Q A;  3UMI A;  4PJM A;  2R7W A;  2VH3 A;  3LJB A;  3A11 A;  5T3W A;  4CJG A;  1A0B A;  2J7P A;  4BEM J;  4D4N A;  4WGZ A;  5L0I A;  4LDK A;  2HJM A;  4O7G A;  4PR9 A;  3V5Y A;  3S0X A;  1LS4 A;  3QW0 A;  2XRH A;  3GM2 A;  4G7O F;  4B6I A;  3MBG A;  4AE4 B;  2IBF A;  1E86 A;  3AGU A;  3QW1 A;  4N6H A;  1Q0D A;  1HW1 A;  1OR3 A;  1PD0 A;  2WVO A;  1WN0 A;  3K1I A;  3B9Q A;  2Q3T A;  4MVS A;  3SNH A;  3KMI A;  4JW1 A;  2L7A A;  5F28 E;  3GWL A;  1ST6 A;  3FVY A;  1OW7 A;  4FWV A;  4J7Y A;  4CS9 A;  4EBK A;  4OD5 A;  1K04 A;  3G50 A;  4MW8 A;  3W8H A;  4L6R A;  2XXA B;  3DZA A;  1WWP A;  4U9D A;  3R7C A;  2IOQ A;  4G78 A;  4ULV A;  1YDI A;  4RBN A;  2AWC A;  4MVR A;  5KYN A;  3O6X A;  2D5R B;  1LI7 A;  3O39 A;  3AG3 C;  3RVZ A;  4CSA C;  3M4C A;  4IAR A;  1TFK B;  2G62 A;  2G3V A;  2LSE A;  4LDQ A;  3L0I A;  3NYM A;  2X0C A;  5F5H A;  2NSG A;  3EJN A;  1D0X A;  3S84 A;  3GOR A;  1A41 A;  1SF8 A;  4JE9 A;  4J7T A;  3T9O A;  3HNL A;  4JTC B;  3ZVR A;  4AL0 A;  1MMG A;  2EPM X;  4KBL A;  3AG2 C;  1G4U S;  1C17 M;  5GPG B;  4AE4 A;  3EFO A;  2LK4 A;  4OD4 A;  2WB7 A;  2ZD9 A;  4LER A;  3VM6 A;  4C3B A;  4PK4 A;  2A1D D;  3UMK A;  3QMK A;  4CX9 A;  1XZQ A;  4O79 A;  2HZ8 A;  3W2V A;  2HJ3 A;  2A0U A;  3L8I A;  4K7B A;  4YT2 A;  3I5P A;  1NZE A;  3DI5 A;  3F47 A;  2XLW A;  1I4Z A;  2XLE A;  3DM9 B;  1YVI A;  1VOM A;  4JEA A;  3HNJ A;  2TMV P;  2J9W A;  2IM8 A;  2WZG A;  3IPM O;  3U2L A;  3U2M A;  4Q5S F;  5B3I A;  3SEO A;  1E2X A;  1D0Y A;  3HKK A;  2WVN A;  2YEV A;  3MYF A;  3ZQV A;  1VTM P;  4NTB A;  3EQL F;  4JC7 A;  3GEI A;  4I3M A;  1HMD A;  4MVQ A;  5TJ5 E;  3J06 A;  1M57 C;  2GA0 A;  2Q9C A;  1ZHW A;  1QLE C;  2MHR A;  1QPU A;  3LS1 A;  3AOU A;  2NUP B;  5KYY B;  1W2W A;  3CZ6 A;  4E18 A;  3POV A;  2W4B A;  4JTD B;  4MS2 A;  2J7P D;  4XWJ A;  2IYL D;  3K66 A;  1ZHY A;  2EPK X;  3DWW A;  2LCH A;  3EG9 B;  4U5F E;  3U9M A;  3U8V A;  1RKC A;  1YAR O;  2PX3 A;  1Z6A A;  3KKB A;  4X0R A;  3T6B A;  1WAS A;  2XXA A;  1EKY A;  1I5N A;  3M15 A;  1C03 A;  2V3C C;  2WVQ A;  3QTH A; 
#chains in the Genus database with same CATH homology
 2Q00 A;  3GM2 A;  1ZZP A;  2JPU A;  2L6H A;  2JX0 A;  3K7D A;  3BRJ A;  1PV3 A;  1V4A A;  3C8G D;  3U3F A;  4NQF A;  3C18 A;  2YWA A;  2PBE A;  1K40 A;  5F28 E;  3L8J A;  2HSB A;  2LK4 A;  1OW8 A;  1WOL A;  4R32 A;  4XEK A;  1KNY A;  1OW7 A;  3AJM A;  3RQG A;  4EBK A;  2L6F A;  3JYY A;  3RQE A;  3TUL A;  1WTY A;  1OW6 A;  1QVX A;  1K04 A;  3C8G A;  2KK1 A;  1O3U A;  1K05 A;  3GM3 A;  3JZ0 A;  3O10 A;  1WWP A;  2L6G A;  3GM1 A;  3S9O A;  3B71 A;  3RQF A;  1UFB A;  3L8I A;  3C8G B;  4XEV A;  3MFN A;  3U0C A;  1KTM A;  4EBJ A;  4XEF A;  1JOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...