2Q04A

Crystal structure of acetoin utilization protein (zp_00540088.1) from exiguobacterium sibiricum 255-15 at 2.33 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
GMFEKQFNHRTLETSLGPVEIEGPVTSQILATYKLDPGLTAFRQPAEQHEALVEIAALEEGRIIIARQGNDIIGYVTFLYPDPYETWSEGNNPYILELGAIEVAARFRGQQIGKKLLEVSMLDPAMEHYLILTTEYYWHWDLKGSGLSVWDYRKIMEKMMNHGGLVFFPTDDPEIASHPANCLMARIGKHVAPEVVAHFDALRLRRRFMYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetoin utilization protein (ZP_00540088.1) from Exiguobacterium sibiricum 255-15 at 2.33 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
molecule keywords Acetoin utilization protein
total genus 59
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q04A00
3GKRA 3ZJ0A 4AVCA 1Z4RA 3G3SA 3C26A 2AJ6A 3W6SA 1K4JA 2CNMA 5DWMA 4K30A 4F6AA 2Q7BA 3W91A 3T90A 4LUAA 3PGPA 2OZGA 2Q0YA 3EY5A 1B6BA 4NCZA 5F48A 4U5YA 5ISVA 1KUXA 3I3GA 2EUIA 1UFHA 2VZZA 4KVOE 1QSRA 2Z0ZA 1Y7RA 4FD7A 4XPDB 3VWEA 3N7ZA 2FSRA 1B87A 2PRBA 2HUZA 1R57A 2I00A 2I79A 3VWDA 1S60A 1M4GA 4UBRA 3CXPA 2C27A 4QVTA 1IIDA 5H86A 4JWPA 1WWZA 2GANA 4R57A 1XEBA 1XMTA 2FL4A 2QMLA 3DSBA 2J8MA 4QC6A 3TCVA 1PUAA 5IX3A 4FD4A 3BJ8A 2VQYA 1IYKA 2QECA 1ON0A 4AG9A 3EC4A 3LD2A 2B4DB 2WPXA 2BEIA 3FXTA 4CRZB 2FCKA 4ZBGA 2ZW6A 4BMHA 3TO6A 4I49A 5EC4A 3NE7A 2G3TA 2QIRA 2JEVA 2Y0MA 4IF5A 4QB9A 1VKCA 4H89A 5IV0A 4XNHB 2FXFA 2J8RA 4KOYA 3SXNA 4PK3A 2Q04A 4JXQA 4PSWA 4IUSA 4RI1A 1Y9KA 3FYNA 4CS0B 4M3SA 2FIAA 1IICA 1I12A 2D4OA 3G8WA 3F0AA 4XNHC 1NSLA 3R1KA 3GYAA 2BUEA 1M1DA 4KOXA 4B5OA 5F49A 4R3KA 4JLYA 3SHPA 4KUBA 5H84A 3IGRA 3S6KA 2VI7A 3T9YA 1S7KA 4AG7A 4OAEA 1YX0A 3FNCA 3OWCA 5IB0A 1N71A 4MHDA 2P6EA 5GCNA 1Z9UA 2B3UA 1YLEA 2CNSA 2WPWA 3S6HA 4E8OA 2ZW7A 3TFYA 1RO5A 4KOSA 3TOAA 2X7BA 4R87A 3EO4A 5DWNA 2IL4A 4KVME 1NMTA 2EVNA 4YFJA 2P0WA 1P0HA 2OU2A 1KZFA 1S7LA 1U6MA 2VXKA 1MJAA 3H4QA 2ATRA 2H5MA 2PSWA 2B4DA 1IYLA 2B58A 1Q2YA 3I9SA 3BLNA 2OB0A 2OZUA 4U9YA 4MBUA 4J3GA 1MJBA 1YVKA 2FE7A 4HKFA 4NEXA 4HNXB 5F47A 4HNYB 1S3ZA 2VZYA 2OZHA 4NXYA 1L0CA 2Q4YA 3P2HA 4XPKA 3FB3A 4II9A 5HMNA 1LRZA 3S6FA 1BO4A 2FIWA 2CY2A 4M85A 3QAHA 1QSNA 3PP9A 3R95A 3F8KA 4Y49C 2G3AA 4KOWA 1MJ9A 5HH1A 4NF1A 2Z11A 4KUAA 4YGOA 1XE4A 1PU9A 4ORFA 4R9MA 3WR7A 3B8GA 4KVXA 4X5KA 5KTAA 4MI4A 2ZW5A 1SQHA 5JPHA 2HV2A 1S7NA 5J8CA 1YVOA 1YR0A 4Y49B 1FY7A 2ZXVA 1M4IA 1S7FA 4JD6A 3D2PA 2GIVA 3DR6A 2VEZA 3PZJA 1KUVA 2Z10A 3R96A 4GS4A 5J8FA 2BSWA 2OH1A 4H6ZA 4QBJA 2O28A 4MY0A 4OADA 2JLMA 2REFA 1MK4A 4KZTA 2ZW4A 3CXSA 4XPDC 5CNPA 3TO7A 1NE9A 2FS5A 1I21A 3UY5A 2PR8A 4H6UA 2RC4A 5C88A 2P6FA 2R98A 3D8PA 3SXOA 4KLVA 4B5PB 4L8AA 1Y9WA 4XPLA 5F46A 3CXQA 1IB1E 2HQYA 1XIXA 2PQ8A 3TTHA 3GY9A 5JQ4A 1Z4EA 4KORA 4L89A 3R9FA 2R8VA 4FD5A 3RYOA 5C82A 2PDOA 1I1DA 3TOBA 1YK3A 3D2MA 4ONUA 2A4NA 2FT0A 2JDDA 1KUYA 3V8IA 3R9EA 3KKWA 3E0KA 3TE4A 4DNCA 2AE6A 3F5BA 2R7HA 2NMTA 2JDCA 1J4JA 3JUWA 2VBQA 4RS2A 3TT2A 1TIQA 3S6GA 1CJWA 2G0BA 4U9ZA 5I0CA 5KTDA 4OLLA 4R3LA 2ARHA 4UWIA 3QB8A 2K5TA 2B5GB 2CNTA 4UA3A 4EVYA 4PV6A 3FIXA 4AVAA 2PR1A 2B3VA 2REEA 3FBUA 1P4NA 5EBVA 2Q4VA 4PSXA 4JJXA 4FD6A 4HNWB 2F5IA 4LX9A 3R9GA 3K9UA 4KOTA 1GHEA 4E2AA 4CRYB 1VHSA 3EFAA 4KOVA 1XF8A 1WK4A 2PC1A 4AVBA 1CM0A 4CAWA 2KCWA 2B5GA 3EXNA 3W6XA 1QSOA 1YREA 2D4PA 5KTCA 4MJ8A 4JXRA 3DDDA 1QSTA 2Q44A 4QUSA 3DR8A 3FRMA 3JVNA 4MY3A 4CAVA 3MGDA 2BL1A 4CAXA 2B4BA 3LODA 4YRHA 4KOUA 1OZPA 1S5KA 1V0CA 2DXQA 4E0AA 5E96A 1M44A 4NSQA 1YGHA 4UWJA 4F0YA 2R1IA 3IWGA 3ZZIA 1Q2DA 4AB7A 1Q2CA 2J8NA 3P2FA 1M4DA 5FVJA 4B5PA 4KLWA 3D3SA 2GE3A 3TO9A 3DNSA 1QSMA 1RXTA 4PK2A 3BJ7A 1BOBA 2P6GA 2ZPAA
chains in the Genus database with same CATH superfamily
1F2OA 4M6HA 4UIAA 3GKRA 3ZJ0A 4AVCA 1Z4RA 3G3SA 3C26A 4UEZA 1FNOA 2AJ6A 2ZEEA 5K8PA 3H8FA 2WZNA 1K4JA 2CNMA 2POKA 5DWMA 4Q7AA 3TX8A 3B3CA 3W6SA 1HDQA 1TF8A 4K30A 2Q7BA 4F6AA 1ARMA 3W91A 3NH4A 2CIJA 4PXCA 3BXMA 4A95A 3T90A 4LUAA 3PGPA 2OZGA 2V8GA 2ZEHA 2ZEPA 2Q0YA 3EY5A 2JBJA 4MCPA 1B6BA 4CGLA 4NCZA 5F48A 5K8MA 2Q7SA 4U5YA 5ISVA 3D67A 3FF3A 4TWEA 1KUXA 4PQAA 4FWUA 4H2KA 3I3GA 2EUIA 1UFHA 5JH9A 1IGBA 2OOTA 5J1QA 2VZZA 3CPAA 4KVOE 4YWYA 3VATA 1QSRA 2Z0ZA 1Y7RA 4FD7A 2PJ7A 4XPDB 5HVHA 3VWEA 3N7ZA 2BOAA 2FSRA 1B87A 4C2XA 1PYTB 3DLJA 2PRBA 2HUZA 3FH4A 1R57A 4OC5A 2DPSA 2I00A 3TC8A 2I79A 3VWDA 4R8FA 2PCUA 1VIXA 1YSJA 1S60A 4ONWA 1M4GA 4B10A 4UBRA 3CXPA 1Z2LA 4MHYA 1IOIA 1TKFA 2C27A 4QVTA 1IIDA 1YLOA 1ZG8A 5H86A 4JWPA 1WWZA 2GANA 4BBHA 4R57A 4ZX8A 3PB4X 1XEBA 1XMTA 4BD9A 2FL4A 3SJXA 2QMLA 3DSBA 4KSFA 3CDXA 4GM5A 4FUUA 2J8MA 3KHXA 2GU2A 4QC6A 3TCVA 1PUAA 5IX3A 5LYDA 4FD4A 3BJ8A 3KR4A 2RFHA 4RUHA 2VQYA 1IYKA 2QECA 1ON0A 5DS0A 3EC4A 3LD2A 2B4DB 4AG9A 2WPXA 4P4BA 2BEIA 3FXTA 4TNUA 4CRZB 3PEIA 2FCKA 2JBKA 2ZW6A 4MFKA 4ZBGA 4CGOA 2XEGA 4BMHA 3TO6A 3GIUA 4I49A 2Z3LA 5EC4A 3NE7A 2BO9A 1XMBA 2G3TA 2QIRA 2JEVA 2Y0MA 4IF5A 4QB9A 1ELLP 3VH9A 1H8LA 1VKCA 2F7VA 5AGEA 4P4IA 4H89A 4R76A 5IV0A 4XNHB 3H8EA 2FXFA 3B35A 3BHXA 4CGNA 2J8RA 1ZLHA 2Q51A 2AFWA 4JZ0A 4KOYA 3SXNA 2PJAA 4PK3A 4B14A 2Q04A 2AFUA 4JXQA 3FECA 4PSWA 4IUSA 4X2TA 1CPSA 2RB7A 4RI1A 5AG4A 1X12A 3FX6A 1Y9KA 5A28A 3FYNA 4CS0B 4M3SA 2FIAA 4ZY2A 4EWTA 1IICA 1I12A 2D4OA 3G8WA 3F0AA 4XNHC 1NSLA 2PE3A 3R1KA 1Z8WA 3GYAA 2BUEA 3SJFA 1M1DA 1A2ZA 4KOXA 3FVLA 4B5OA 4C7IA 5F49A 3PBEA 1EE3P 1KWMA 4R3KA 4MCRA 2PJ0A 4JLYA 2C6GA 4C68A 3SHPA 4KUBA 4OIDA 5AG7A 5H84A 5LYIA 3IGRA 2EK8A 4NGNA 2ZEFA 1CPXA 3B7IA 4UEFA 4R7MA 3S6KA 3A9LA 2VI7A 3HLPA 5D29A 3FMCA 1S7KA 3T9YA 4OAEA 5AG6A 1YX0A 4A2ZA 4AG7A 2PJ5A 4ZY0A 3FNCA 3OWCA 5IB0A 4P10A 4ZYQA 1N71A 4MHDA 2P6EA 5GCNA 1IU8A 1Z9UA 2AFXA 1Q7LA 4DUKA 2B3UA 1YLEA 2CNSA 2WPWA 2PJ9A 3S6HA 5ELYA 4DJLA 4E8OA 3SI0A 1Z8XA 4MFQA 1DE4C 2ZW7A 4NGSA 3V7ZA 4P4JA 5CBMA 1RO5A 4KOSA 4JYWA 1F2PA 3TOAA 8CPAA 2X7BA 4R87A 3EO4A 4MFZA 5DWNA 2IL4A 4KVME 1NMTA 3NH5A 4F0XA 3V38A 2QYVA 2YNCA 2Z3KA 2EVNA 1HDUA 1LOKA 1ZG7A 4YFJA 2P0WA 1YW6A 1P0HA 2OU2A 1KZFA 1XRYA 4CPAA 1LFWA 3B2YA 1JQGA 2Z3NA 2ZENA 2EK9A 1S7LA 1U6MA 2QJ8A 2VXKA 1MJAA 4P4EA 3IIBA 3H4QA 2XEJA 2EO8A 1LCPA 2ATRA 2QVPA 3IFEA 2H5MA 2PSWA 2PJCA 2WSAA 1IOFA 4UFWA 3D7HA 3NH8A 2GLFA 2B4DA 4Z65A 2PIZA 2AFSA 1IYLA 4B13A 2B58A 1Q2YA 3I9SA 5LRGA 4IK2A 2HC9A 2O4HA 1VHEA 1LANA 3BLNA 3HUVA 2OB0A 2OZUA 5HVGA 3D7GA 4OC3A 4U9YA 4MBUA 4J3GA 1RTQA 2AFZA 1MJBA 1YVKA 4UFXA 3PBBA 2FE7A 4HKFA 3IWWA 4NEXA 4HNXB 4CYPA 5F47A 5HVFA 4HNYB 3WC5A 4CGPA 1XJOA 3B3VA 1S3ZA 2VZYA 3NA6A 2OZHA 4NXYA 1L0CA 2CTBA 2Q4YA 3P2HA 4XPKA 3RBUA 1AMPA 3FB3A 3IWEA 4F9VA 4II9A 2Q4ZA 3D66A 4FAIA 3IU1A 2V8DA 5HMNA 1LRZA 4MFLA 3S6FA 2ZEGA 4OC4A 1BO4A 2FIWA 2CY2A 1ZO0A 4K3NA 4YU9A 2DEAA 4M85A 3B3SA 5D8NA 5IB9A 3QAHA 1TKHA 2Z3OA 4P4FA 1QSNA 3PP9A 4ZX9A 2PJ2A 5CPAA 3NE8A 3WABA 3R95A 3F8KA 4R6TA 5HXDA 4PPZA 3PFOA 4Y49C 2G3AA 4GXHA 4KOWA 1MJ9A 4CAEA 1BPNA 5HH1A 2V8VA 4NF1A 2Z11A 5G22A 3MRUA 4KUAA 4YGOA 1BPMA 1PU9A 1XE4A 4UF4A 4ORFA 4R9MA 3WR7A 3B8GA 4KVXA 2BCOA 4X5KA 4A30A 4MI4A 5KTAA 2ZW5A 1SQHA 4IAVA 4UFVA 5JPHA 2EWBA 1S7NA 2GREA 2HV2A 2XEFA 1YQEA 2PVVA 3H5ZA 3MN8A 4A33A 4B6ZA 5J8CA 1YVOA 1YR0A 1Z8TA 4Y49B 3TFYA 5AG5A 4UCPA 5JGFA 1CBXA 1FY7A 2ZXVA 1M4IA 2F8HA 3K9TA 1S7FA 3SI1A 1VHOA 4JD6A 4UIBA 1CX8A 2FVGA 1F57A 3D2PA 2GIVA 3DR6A 1YW4A 2VEZA 4BINA 3DGVA 4ZI6A 3I1UA 3H8GA 3D4UA 3IJ3A 3PZJA 4UCNA 2ZOFA 4ZGYB 3CZXA 3NFZA 1Z8LA 1KUVA 1Z5RA 3B3TA 2Z10A 4MCQA 3R96A 1XOVA 4GS4A 4EMEA 5J8FA 2BSWA 2C6CA 2OH1A 4H6ZA 1R3NA 1Y7EA 1TXRA 4QBJA 3FEDA 1YMEA 2O28A 4MY0A 4OADA 2JLMA 3RNZA 2REFA 1MK4A 4CYQA 4KZTA 2GLJA 3PB9X 4OKOA 4DYOA 3QNVA 4ZY1A 2ZW4A 2CF4A 3CXSA 4XPDC 2IQ6A 2PVWA 4AXVA 4MFJA 5CNPA 4CYOA 4NGQA 3TO7A 4CYNA 5A27A 2XEIA 4A32A 2ABZA 1NE9A 3SI2A 2FS5A 3KQZA 6CPAA 1I21A 3UY5A 2ZEOA 2IJZA 3D7DA 5LYFA 2V8HA 2DPTA 2PR8A 2YGWA 4H6UA 4KS9A 2RC4A 2IMOA 4NJRA 5C88A 2P6FA 2R98A 2YNEA 3D8PA 5I4MA 3PB8X 2PJ6A 4NFRA 4MHPA 4KLVA 4M6GA 3SXOA 1ARLA 2C6PA 4M6IA 2WUUA 4B5PB 3PB6X 2HB6A 4L8AA 1Y9WA 4Q38A 3WC7A 3B3WA 4XPLA 1BLLE 5F46A 3CXQA 3FJUA 4P6YA 1IB1E 2HQYA 1XIXA 2PQ8A 3D68A 3IEHA 4OP4A 3GY9A 4PXBA 3SJGA 3TTHA 4WWVA 3PB7X 4C7HA 5JQ4A 1Z4EA 4KORA 4L89A 1IY7A 2O53A 3R9FA 4B11A 1QMUA 2C1CA 2R8VA 4MHNA 3ISZA 2Z3PA 1LAMA 2NSMA 4FD5A 3RYOA 4PXDA 5C82A 2PDOA 3LACA 3GB0A 1I1DA 3JRUA 1YK3A 4G1PA 5EMIA 3D2MA 2V77A 3TOBA 4ONUA 2A4NA 2FT0A 2JDDA 4MXUA 1KUYA 3V8IA 3R9EA 2ZOGA 3KKWA 4UEEA 3RO0A 3E0KA 4A37A 2G9DA 2ODFA 4CGMA 1LAPA 3TE4A 1XFOA 4DNCA 3BI0A 4MFPA 2AE6A 3CPXA 3F5BA 1JWQA 2NMTA 2R7HA 2JDCA 4MRIA 4NGMA 1J4JA 3KL9A 3JUWA 2VBQA 4RS2A 3TT2A 2PRQA 1TIQA 4LQGA 3S6GA 1CJWA 2G0BA 4U9ZA 7CPAA 5I0CA 5KTDA 1HEEA 4OLLA 5LRJA 4R3LA 3LWUA 2ARHA 2PJ1A 3KHZA 4IHMA 3QB8A 2K5TA 4NGRA 4UWIA 4X3RA 2Z3MA 1UWYA 2B5GB 2CNTA 4C2ZA 4UA3A 1AYEA 3KZWA 4OC2A 4EVYA 4C2YA 1X10A 3S9LA 4PV6A 3SJEA 3FIXA 4AVAA 5K8NA 2J9AA 2B3VA 2PR1A 2REEA 2WYRA 3PRTA 3S9NA 2PJ4A 1OBRA 1P4NA 3FBUA 5G20A 5EBVA 2Q4VA 4PSXA 4JJXA 4FD6A 4HNWB 1Y0RA 2F5IA 4LX9A 3K9UA 3R9GA 4F8ZA 4A31A 3WC6A 3KI9A 4NGPA 4KOTA 1GHEA 4LQ6A 5JM6A 1XBUA 1CG2A 3KASA 1PCAA 3IU2A 4MHZA 4B12A 2I3CA 4E2AA 3VARA 1NSAA 1M4LA 4CRYB 1VHSA 1R43A 1ELMP 2PJBA 2YNDA 3QAYA 4HPSA 3EFAA 1XF8A 4KOVA 1WK4A 1CP7A 4OC1A 2PC1A 3D7FA 3L2NA 2AFOA 4X8IA 4AVBA 3JTKA 2ZELA 1CM0A 5G21A 4CAWA 1TF9A 4NGTA 4P4DA 2KCWA 2B5GA 3EXNA 3W6XA 1QSOA 1YREA 1ZLIA 2D4PA 1VGYA 4CAFA 5KTCA 3FEEA 4MJ8A 1AUGA 3IO1A 4JXRA 3DDDA 2CXAA 1QSTA 2Q44A 2NYQA 1CP6A 2EBJA 3N5FA 2ZEDA 1FT7A 2DF5A 4QUSA 2JEWA 3DR8A 4F9UA 3FRMA 3JVNA 4OIWA 5THWA 4MY3A 5BWAB 4CAVA 1GYTA 3MGDA 3S9MA 3RAMA 5LYLA 2BL1A 4MCSA 4CAXA 2B4BA 3LODA 1BAVA 4O23A 4KOUA 4YRHA 1OZPA 1S5KA 4OC0A 1V0CA 2DXQA 3CT9A 3BI1A 5G1ZA 4FBEA 1QQ9A 2ZEMA 4P44A 5E96A 4E0AA 1M44A 4NSQA 4Q36A 3GLJA 2Q43A 1YGHA 4UWJA 1DTDA 4EFDA 2ANPA 5LRKA 4F0YA 1Y0YA 4WJBA 2R1IA 3GUXA 4A94A 2VL1A 4W9YA 3IWGA 3WT4A 2OR4A 4UCMA 3ZZIA 1Q2DA 2PJ3A 4AB7A 3KQXA 4OMEA 4MMOA 3KGQA 1Q2CA 2YNCC 4KSIA 5K8OA 5F09A 4A38A 2J8NA 3IC1A 3LMSA 2AFMA 3P2FA 1TKJA 1M4DA 5FVJA 4B5PA 4KLWA 4PXEA 1ZG9A 3RZAA 2CTCA 3D3SA 2GE3A 4RN7A 3KR5A 4NJQA 3K2KA 4KSAA 4P45A 2PIYA 4A39A 3TO9A 3ISXA 3T8WA 3DNSA 1QSMA 1RXTA 4PK2A 3BJ7A 1BOBA 2P6GA 2ZPAA 2PJ8A 2GFQA 3PFEA
chains in the Genus database with same CATH topology
3GKRA 3ZJ0A 4AVCA 1Z4RA 3G3SA 3C26A 2AJ6A 3W6SA 1K4JA 2CNMA 5DWMA 4K30A 4F6AA 2Q7BA 3W91A 4A95A 3T90A 4LUAA 3PGPA 2OZGA 2Q0YA 3EY5A 4CGLA 1B6BA 4NCZA 5F48A 4U5YA 5ISVA 1KUXA 3I3GA 2EUIA 1UFHA 2VZZA 4KVOE 1QSRA 2Z0ZA 1Y7RA 4FD7A 4XPDB 3VWEA 3N7ZA 2FSRA 1B87A 4C2XA 2PRBA 2HUZA 1R57A 2DPSA 2I00A 2I79A 3VWDA 1S60A 1M4GA 4B10A 4UBRA 3CXPA 2C27A 4QVTA 1IIDA 4BBHA 5H86A 4JWPA 1WWZA 2GANA 4R57A 1XEBA 1XMTA 2FL4A 2QMLA 3DSBA 4KSFA 2J8MA 4QC6A 3TCVA 1PUAA 5IX3A 4FD4A 3BJ8A 2VQYA 1IYKA 2QECA 1ON0A 4AG9A 3EC4A 3LD2A 2B4DB 2WPXA 2BEIA 3FXTA 4CRZB 2FCKA 4ZBGA 2ZW6A 4MFKA 4CGOA 4BMHA 3TO6A 4I49A 2Z3LA 5EC4A 3NE7A 2G3TA 2QIRA 2JEVA 2Y0MA 4IF5A 4QB9A 1VKCA 5AGEA 4H89A 5IV0A 4XNHB 2FXFA 4CGNA 2J8RA 4KOYA 3SXNA 4B14A 4PK3A 2Q04A 4JXQA 4PSWA 4IUSA 4RI1A 1Y9KA 5A28A 3FYNA 4CS0B 4M3SA 2FIAA 1IICA 1I12A 2D4OA 3G8WA 3F0AA 4XNHC 1NSLA 3R1KA 3GYAA 2BUEA 1M1DA 4KOXA 4B5OA 4C7IA 5F49A 4R3KA 4JLYA 4C68A 3SHPA 4KUBA 5AG7A 5H84A 3IGRA 3S6KA 3A9LA 2VI7A 3T9YA 4A2ZA 1S7KA 4AG7A 4OAEA 5AG6A 1YX0A 3FNCA 3OWCA 5IB0A 1N71A 4MHDA 2P6EA 5GCNA 1Z9UA 2B3UA 1YLEA 2CNSA 2WPWA 3S6HA 4E8OA 4MFQA 2ZW7A 3TFYA 1RO5A 4KOSA 3TOAA 2X7BA 4R87A 3EO4A 4MFZA 5DWNA 2IL4A 4KVME 1NMTA 4F0XA 2YNCA 2Z3KA 2EVNA 4YFJA 2P0WA 1P0HA 2OU2A 1KZFA 2Z3NA 1S7LA 1U6MA 2VXKA 1MJAA 3H4QA 2ATRA 2H5MA 2PSWA 2WSAA 4UFWA 2B4DA 1IYLA 4B13A 2B58A 1Q2YA 3I9SA 3BLNA 2OB0A 2OZUA 4U9YA 4MBUA 4J3GA 1MJBA 1YVKA 4UFXA 2FE7A 4HKFA 4NEXA 4HNXB 4CYPA 5F47A 4HNYB 4CGPA 1S3ZA 2VZYA 2OZHA 4NXYA 1L0CA 2Q4YA 3P2HA 4XPKA 3FB3A 3IWEA 4II9A 3IU1A 5HMNA 1LRZA 4MFLA 3S6FA 1BO4A 2FIWA 2CY2A 1ZO0A 4M85A 3QAHA 2Z3OA 1QSNA 3PP9A 3R95A 3F8KA 4Y49C 2G3AA 4KOWA 1MJ9A 4CAEA 5HH1A 4NF1A 2Z11A 5G22A 4KUAA 4YGOA 1XE4A 1PU9A 4ORFA 4R9MA 3WR7A 3B8GA 4KVXA 4X5KA 4A30A 4MI4A 5KTAA 2ZW5A 1SQHA 4UFVA 5JPHA 2HV2A 1S7NA 5AG4A 3H5ZA 5J8CA 1YVOA 1YR0A 4Y49B 5AG5A 4UCPA 1FY7A 2ZXVA 1M4IA 1S7FA 4JD6A 3D2PA 2GIVA 3DR6A 2VEZA 3PZJA 4UCNA 4ZGYB 1KUVA 2Z10A 3R96A 4GS4A 5J8FA 2BSWA 2OH1A 4H6ZA 4QBJA 2O28A 4MY0A 4OADA 2JLMA 2REFA 1MK4A 4CYQA 4KZTA 2ZW4A 3CXSA 4XPDC 4MFJA 5CNPA 4CYOA 4CYNA 3TO7A 5A27A 4A32A 1NE9A 2FS5A 1I21A 3UY5A 2DPTA 2PR8A 2YGWA 4H6UA 4KS9A 2RC4A 5C88A 2P6FA 2R98A 2YNEA 3D8PA 3SXOA 4KLVA 2WUUA 4B5PB 4L8AA 1Y9WA 4Q38A 4XPLA 5F46A 3CXQA 1IB1E 2HQYA 1XIXA 2PQ8A 4A33A 3TTHA 3GY9A 4C7HA 5JQ4A 1Z4EA 4KORA 4L89A 3R9FA 4B11A 2R8VA 2Z3PA 4FD5A 3RYOA 5C82A 2PDOA 1I1DA 3TOBA 1YK3A 3D2MA 4ONUA 2A4NA 2FT0A 2JDDA 1KUYA 3V8IA 3R9EA 3KKWA 3E0KA 4CGMA 3TE4A 4DNCA 4MFPA 2AE6A 3F5BA 2R7HA 2NMTA 2JDCA 1J4JA 3JUWA 2VBQA 4RS2A 3TT2A 1TIQA 3S6GA 1CJWA 2G0BA 4U9ZA 5I0CA 5KTDA 4OLLA 4R3LA 2ARHA 4UWIA 3QB8A 2K5TA 2Z3MA 2B5GB 2CNTA 4C2ZA 4UA3A 4EVYA 4C2YA 4PV6A 3FIXA 4AVAA 2PR1A 2B3VA 2REEA 3FBUA 1P4NA 5G20A 5EBVA 2Q4VA 4PSXA 4JJXA 4FD6A 4HNWB 2F5IA 4LX9A 3R9GA 3K9UA 4A31A 4KOTA 1GHEA 3IU2A 4B12A 4E2AA 4CRYB 1VHSA 2YNDA 3EFAA 4KOVA 1XF8A 1WK4A 2PC1A 4AVBA 3JTKA 1CM0A 5G21A 4CAWA 2KCWA 2B5GA 3EXNA 3W6XA 1QSOA 1YREA 2D4PA 5KTCA 4CAFA 4MJ8A 4JXRA 3DDDA 2CXAA 1QSTA 2Q44A 4QUSA 3DR8A 3FRMA 3JVNA 4MY3A 5BWAB 4CAVA 3MGDA 2BL1A 4CAXA 2B4BA 3LODA 4YRHA 4KOUA 1OZPA 1S5KA 1V0CA 2DXQA 5G1ZA 4E0AA 5E96A 1M44A 4NSQA 4Q36A 1YGHA 4UWJA 4F0YA 2R1IA 3IWGA 4UCMA 3ZZIA 1Q2DA 4AB7A 1Q2CA 2YNCC 2J8NA 3P2FA 1M4DA 5FVJA 4B5PA 4KLWA 3D3SA 2GE3A 4KSAA 3TO9A 3DNSA 1QSMA 1RXTA 4PK2A 3BJ7A 1BOBA 2P6GA 2ZPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKR A;  3ZJ0 A;  4AVC A;  1Z4R A;  3G3S A;  3C26 A;  2AJ6 A;  3W6S A;  1K4J A;  2CNM A;  5DWM A;  4K30 A;  4F6A A;  2Q7B A;  3W91 A;  3T90 A;  4LUA A;  3PGP A;  2OZG A;  2Q0Y A;  3EY5 A;  1B6B A;  4NCZ A;  5F48 A;  4U5Y A;  5ISV A;  1KUX A;  3I3G A;  2EUI A;  1UFH A;  2VZZ A;  4KVO E;  1QSR A;  2Z0Z A;  1Y7R A;  4FD7 A;  4XPD B;  3VWE A;  3N7Z A;  2FSR A;  1B87 A;  2PRB A;  2HUZ A;  1R57 A;  2I00 A;  2I79 A;  3VWD A;  1S60 A;  1M4G A;  4UBR A;  3CXP A;  2C27 A;  4QVT A;  1IID A;  5H86 A;  4JWP A;  1WWZ A;  2GAN A;  4R57 A;  1XEB A;  1XMT A;  2FL4 A;  2QML A;  3DSB A;  2J8M A;  4QC6 A;  3TCV A;  1PUA A;  5IX3 A;  4FD4 A;  3BJ8 A;  2VQY A;  1IYK A;  2QEC A;  1ON0 A;  4AG9 A;  3EC4 A;  3LD2 A;  2B4D B;  2WPX A;  2BEI A;  3FXT A;  4CRZ B;  2FCK A;  4ZBG A;  2ZW6 A;  4BMH A;  3TO6 A;  4I49 A;  5EC4 A;  3NE7 A;  2G3T A;  2QIR A;  2JEV A;  2Y0M A;  4IF5 A;  4QB9 A;  1VKC A;  4H89 A;  5IV0 A;  4XNH B;  2FXF A;  2J8R A;  4KOY A;  3SXN A;  4PK3 A;  2Q04 A;  4JXQ A;  4PSW A;  4IUS A;  4RI1 A;  1Y9K A;  3FYN A;  4CS0 B;  4M3S A;  2FIA A;  1IIC A;  1I12 A;  2D4O A;  3G8W A;  3F0A A;  4XNH C;  1NSL A;  3R1K A;  3GYA A;  2BUE A;  1M1D A;  4KOX A;  4B5O A;  5F49 A;  4R3K A;  4JLY A;  3SHP A;  4KUB A;  5H84 A;  3IGR A;  3S6K A;  2VI7 A;  3T9Y A;  1S7K A;  4AG7 A;  4OAE A;  1YX0 A;  3FNC A;  3OWC A;  5IB0 A;  1N71 A;  4MHD A;  2P6E A;  5GCN A;  1Z9U A;  2B3U A;  1YLE A;  2CNS A;  2WPW A;  3S6H A;  4E8O A;  2ZW7 A;  3TFY A;  1RO5 A;  4KOS A;  3TOA A;  2X7B A;  4R87 A;  3EO4 A;  5DWN A;  2IL4 A;  4KVM E;  1NMT A;  2EVN A;  4YFJ A;  2P0W A;  1P0H A;  2OU2 A;  1KZF A;  1S7L A;  1U6M A;  2VXK A;  1MJA A;  3H4Q A;  2ATR A;  2H5M A;  2PSW A;  2B4D A;  1IYL A;  2B58 A;  1Q2Y A;  3I9S A;  3BLN A;  2OB0 A;  2OZU A;  4U9Y A;  4MBU A;  4J3G A;  1MJB A;  1YVK A;  2FE7 A;  4HKF A;  4NEX A;  4HNX B;  5F47 A;  4HNY B;  1S3Z A;  2VZY A;  2OZH A;  4NXY A;  1L0C A;  2Q4Y A;  3P2H A;  4XPK A;  3FB3 A;  4II9 A;  5HMN A;  1LRZ A;  3S6F A;  1BO4 A;  2FIW A;  2CY2 A;  4M85 A;  3QAH A;  1QSN A;  3PP9 A;  3R95 A;  3F8K A;  4Y49 C;  2G3A A;  4KOW A;  1MJ9 A;  5HH1 A;  4NF1 A;  2Z11 A;  4KUA A;  4YGO A;  1XE4 A;  1PU9 A;  4ORF A;  4R9M A;  3WR7 A;  3B8G A;  4KVX A;  4X5K A;  5KTA A;  4MI4 A;  2ZW5 A;  1SQH A;  5JPH A;  2HV2 A;  1S7N A;  5J8C A;  1YVO A;  1YR0 A;  4Y49 B;  1FY7 A;  2ZXV A;  1M4I A;  1S7F A;  4JD6 A;  3D2P A;  2GIV A;  3DR6 A;  2VEZ A;  3PZJ A;  1KUV A;  2Z10 A;  3R96 A;  4GS4 A;  5J8F A;  2BSW A;  2OH1 A;  4H6Z A;  4QBJ A;  2O28 A;  4MY0 A;  4OAD A;  2JLM A;  2REF A;  1MK4 A;  4KZT A;  2ZW4 A;  3CXS A;  4XPD C;  5CNP A;  3TO7 A;  1NE9 A;  2FS5 A;  1I21 A;  3UY5 A;  2PR8 A;  4H6U A;  2RC4 A;  5C88 A;  2P6F A;  2R98 A;  3D8P A;  3SXO A;  4KLV A;  4B5P B;  4L8A A;  1Y9W A;  4XPL A;  5F46 A;  3CXQ A;  1IB1 E;  2HQY A;  1XIX A;  2PQ8 A;  3TTH A;  3GY9 A;  5JQ4 A;  1Z4E A;  4KOR A;  4L89 A;  3R9F A;  2R8V A;  4FD5 A;  3RYO A;  5C82 A;  2PDO A;  1I1D A;  3TOB A;  1YK3 A;  3D2M A;  4ONU A;  2A4N A;  2FT0 A;  2JDD A;  1KUY A;  3V8I A;  3R9E A;  3KKW A;  3E0K A;  3TE4 A;  4DNC A;  2AE6 A;  3F5B A;  2R7H A;  2NMT A;  2JDC A;  1J4J A;  3JUW A;  2VBQ A;  4RS2 A;  3TT2 A;  1TIQ A;  3S6G A;  1CJW A;  2G0B A;  4U9Z A;  5I0C A;  5KTD A;  4OLL A;  4R3L A;  2ARH A;  4UWI A;  3QB8 A;  2K5T A;  2B5G B;  2CNT A;  4UA3 A;  4EVY A;  4PV6 A;  3FIX A;  4AVA A;  2PR1 A;  2B3V A;  2REE A;  3FBU A;  1P4N A;  5EBV A;  2Q4V A;  4PSX A;  4JJX A;  4FD6 A;  4HNW B;  2F5I A;  4LX9 A;  3R9G A;  3K9U A;  4KOT A;  1GHE A;  4E2A A;  4CRY B;  1VHS A;  3EFA A;  4KOV A;  1XF8 A;  1WK4 A;  2PC1 A;  4AVB A;  1CM0 A;  4CAW A;  2KCW A;  2B5G A;  3EXN A;  3W6X A;  1QSO A;  1YRE A;  2D4P A;  5KTC A;  4MJ8 A;  4JXR A;  3DDD A;  1QST A;  2Q44 A;  4QUS A;  3DR8 A;  3FRM A;  3JVN A;  4MY3 A;  4CAV A;  3MGD A;  2BL1 A;  4CAX A;  2B4B A;  3LOD A;  4YRH A;  4KOU A;  1OZP A;  1S5K A;  1V0C A;  2DXQ A;  4E0A A;  5E96 A;  1M44 A;  4NSQ A;  1YGH A;  4UWJ A;  4F0Y A;  2R1I A;  3IWG A;  3ZZI A;  1Q2D A;  4AB7 A;  1Q2C A;  2J8N A;  3P2F A;  1M4D A;  5FVJ A;  4B5P A;  4KLW A;  3D3S A;  2GE3 A;  3TO9 A;  3DNS A;  1QSM A;  1RXT A;  4PK2 A;  3BJ7 A;  1BOB A;  2P6G A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 1F2O A;  4M6H A;  4UIA A;  3GKR A;  3ZJ0 A;  4AVC A;  1Z4R A;  3G3S A;  3C26 A;  4UEZ A;  1FNO A;  2AJ6 A;  2ZEE A;  5K8P A;  3H8F A;  2WZN A;  1K4J A;  2CNM A;  2POK A;  5DWM A;  4Q7A A;  3TX8 A;  3B3C A;  3W6S A;  1HDQ A;  1TF8 A;  4K30 A;  2Q7B A;  4F6A A;  1ARM A;  3W91 A;  3NH4 A;  2CIJ A;  4PXC A;  3BXM A;  4A95 A;  3T90 A;  4LUA A;  3PGP A;  2OZG A;  2V8G A;  2ZEH A;  2ZEP A;  2Q0Y A;  3EY5 A;  2JBJ A;  4MCP A;  1B6B A;  4CGL A;  4NCZ A;  5F48 A;  5K8M A;  2Q7S A;  4U5Y A;  5ISV A;  3D67 A;  3FF3 A;  4TWE A;  1KUX A;  4PQA A;  4FWU A;  4H2K A;  3I3G A;  2EUI A;  1UFH A;  5JH9 A;  1IGB A;  2OOT A;  5J1Q A;  2VZZ A;  3CPA A;  4KVO E;  4YWY A;  3VAT A;  1QSR A;  2Z0Z A;  1Y7R A;  4FD7 A;  2PJ7 A;  4XPD B;  5HVH A;  3VWE A;  3N7Z A;  2BOA A;  2FSR A;  1B87 A;  4C2X A;  1PYT B;  3DLJ A;  2PRB A;  2HUZ A;  3FH4 A;  1R57 A;  4OC5 A;  2DPS A;  2I00 A;  3TC8 A;  2I79 A;  3VWD A;  4R8F A;  2PCU A;  1VIX A;  1YSJ A;  1S60 A;  4ONW A;  1M4G A;  4B10 A;  4UBR A;  3CXP A;  1Z2L A;  4MHY A;  1IOI A;  1TKF A;  2C27 A;  4QVT A;  1IID A;  1YLO A;  1ZG8 A;  5H86 A;  4JWP A;  1WWZ A;  2GAN A;  4BBH A;  4R57 A;  4ZX8 A;  3PB4 X;  1XEB A;  1XMT A;  4BD9 A;  2FL4 A;  3SJX A;  2QML A;  3DSB A;  4KSF A;  3CDX A;  4GM5 A;  4FUU A;  2J8M A;  3KHX A;  2GU2 A;  4QC6 A;  3TCV A;  1PUA A;  5IX3 A;  5LYD A;  4FD4 A;  3BJ8 A;  3KR4 A;  2RFH A;  4RUH A;  2VQY A;  1IYK A;  2QEC A;  1ON0 A;  5DS0 A;  3EC4 A;  3LD2 A;  2B4D B;  4AG9 A;  2WPX A;  4P4B A;  2BEI A;  3FXT A;  4TNU A;  4CRZ B;  3PEI A;  2FCK A;  2JBK A;  2ZW6 A;  4MFK A;  4ZBG A;  4CGO A;  2XEG A;  4BMH A;  3TO6 A;  3GIU A;  4I49 A;  2Z3L A;  5EC4 A;  3NE7 A;  2BO9 A;  1XMB A;  2G3T A;  2QIR A;  2JEV A;  2Y0M A;  4IF5 A;  4QB9 A;  1ELL P;  3VH9 A;  1H8L A;  1VKC A;  2F7V A;  5AGE A;  4P4I A;  4H89 A;  4R76 A;  5IV0 A;  4XNH B;  3H8E A;  2FXF A;  3B35 A;  3BHX A;  4CGN A;  2J8R A;  1ZLH A;  2Q51 A;  2AFW A;  4JZ0 A;  4KOY A;  3SXN A;  2PJA A;  4PK3 A;  4B14 A;  2Q04 A;  2AFU A;  4JXQ A;  3FEC A;  4PSW A;  4IUS A;  4X2T A;  1CPS A;  2RB7 A;  4RI1 A;  5AG4 A;  1X12 A;  3FX6 A;  1Y9K A;  5A28 A;  3FYN A;  4CS0 B;  4M3S A;  2FIA A;  4ZY2 A;  4EWT A;  1IIC A;  1I12 A;  2D4O A;  3G8W A;  3F0A A;  4XNH C;  1NSL A;  2PE3 A;  3R1K A;  1Z8W A;  3GYA A;  2BUE A;  3SJF A;  1M1D A;  1A2Z A;  4KOX A;  3FVL A;  4B5O A;  4C7I A;  5F49 A;  3PBE A;  1EE3 P;  1KWM A;  4R3K A;  4MCR A;  2PJ0 A;  4JLY A;  2C6G A;  4C68 A;  3SHP A;  4KUB A;  4OID A;  5AG7 A;  5H84 A;  5LYI A;  3IGR A;  2EK8 A;  4NGN A;  2ZEF A;  1CPX A;  3B7I A;  4UEF A;  4R7M A;  3S6K A;  3A9L A;  2VI7 A;  3HLP A;  5D29 A;  3FMC A;  1S7K A;  3T9Y A;  4OAE A;  5AG6 A;  1YX0 A;  4A2Z A;  4AG7 A;  2PJ5 A;  4ZY0 A;  3FNC A;  3OWC A;  5IB0 A;  4P10 A;  4ZYQ A;  1N71 A;  4MHD A;  2P6E A;  5GCN A;  1IU8 A;  1Z9U A;  2AFX A;  1Q7L A;  4DUK A;  2B3U A;  1YLE A;  2CNS A;  2WPW A;  2PJ9 A;  3S6H A;  5ELY A;  4DJL A;  4E8O A;  3SI0 A;  1Z8X A;  4MFQ A;  1DE4 C;  2ZW7 A;  4NGS A;  3V7Z A;  4P4J A;  5CBM A;  1RO5 A;  4KOS A;  4JYW A;  1F2P A;  3TOA A;  8CPA A;  2X7B A;  4R87 A;  3EO4 A;  4MFZ A;  5DWN A;  2IL4 A;  4KVM E;  1NMT A;  3NH5 A;  4F0X A;  3V38 A;  2QYV A;  2YNC A;  2Z3K A;  2EVN A;  1HDU A;  1LOK A;  1ZG7 A;  4YFJ A;  2P0W A;  1YW6 A;  1P0H A;  2OU2 A;  1KZF A;  1XRY A;  4CPA A;  1LFW A;  3B2Y A;  1JQG A;  2Z3N A;  2ZEN A;  2EK9 A;  1S7L A;  1U6M A;  2QJ8 A;  2VXK A;  1MJA A;  4P4E A;  3IIB A;  3H4Q A;  2XEJ A;  2EO8 A;  1LCP A;  2ATR A;  2QVP A;  3IFE A;  2H5M A;  2PSW A;  2PJC A;  2WSA A;  1IOF A;  4UFW A;  3D7H A;  3NH8 A;  2GLF A;  2B4D A;  4Z65 A;  2PIZ A;  2AFS A;  1IYL A;  4B13 A;  2B58 A;  1Q2Y A;  3I9S A;  5LRG A;  4IK2 A;  2HC9 A;  2O4H A;  1VHE A;  1LAN A;  3BLN A;  3HUV A;  2OB0 A;  2OZU A;  5HVG A;  3D7G A;  4OC3 A;  4U9Y A;  4MBU A;  4J3G A;  1RTQ A;  2AFZ A;  1MJB A;  1YVK A;  4UFX A;  3PBB A;  2FE7 A;  4HKF A;  3IWW A;  4NEX A;  4HNX B;  4CYP A;  5F47 A;  5HVF A;  4HNY B;  3WC5 A;  4CGP A;  1XJO A;  3B3V A;  1S3Z A;  2VZY A;  3NA6 A;  2OZH A;  4NXY A;  1L0C A;  2CTB A;  2Q4Y A;  3P2H A;  4XPK A;  3RBU A;  1AMP A;  3FB3 A;  3IWE A;  4F9V A;  4II9 A;  2Q4Z A;  3D66 A;  4FAI A;  3IU1 A;  2V8D A;  5HMN A;  1LRZ A;  4MFL A;  3S6F A;  2ZEG A;  4OC4 A;  1BO4 A;  2FIW A;  2CY2 A;  1ZO0 A;  4K3N A;  4YU9 A;  2DEA A;  4M85 A;  3B3S A;  5D8N A;  5IB9 A;  3QAH A;  1TKH A;  2Z3O A;  4P4F A;  1QSN A;  3PP9 A;  4ZX9 A;  2PJ2 A;  5CPA A;  3NE8 A;  3WAB A;  3R95 A;  3F8K A;  4R6T A;  5HXD A;  4PPZ A;  3PFO A;  4Y49 C;  2G3A A;  4GXH A;  4KOW A;  1MJ9 A;  4CAE A;  1BPN A;  5HH1 A;  2V8V A;  4NF1 A;  2Z11 A;  5G22 A;  3MRU A;  4KUA A;  4YGO A;  1BPM A;  1PU9 A;  1XE4 A;  4UF4 A;  4ORF A;  4R9M A;  3WR7 A;  3B8G A;  4KVX A;  2BCO A;  4X5K A;  4A30 A;  4MI4 A;  5KTA A;  2ZW5 A;  1SQH A;  4IAV A;  4UFV A;  5JPH A;  2EWB A;  1S7N A;  2GRE A;  2HV2 A;  2XEF A;  1YQE A;  2PVV A;  3H5Z A;  3MN8 A;  4A33 A;  4B6Z A;  5J8C A;  1YVO A;  1YR0 A;  1Z8T A;  4Y49 B;  3TFY A;  5AG5 A;  4UCP A;  5JGF A;  1CBX A;  1FY7 A;  2ZXV A;  1M4I A;  2F8H A;  3K9T A;  1S7F A;  3SI1 A;  1VHO A;  4JD6 A;  4UIB A;  1CX8 A;  2FVG A;  1F57 A;  3D2P A;  2GIV A;  3DR6 A;  1YW4 A;  2VEZ A;  4BIN A;  3DGV A;  4ZI6 A;  3I1U A;  3H8G A;  3D4U A;  3IJ3 A;  3PZJ A;  4UCN A;  2ZOF A;  4ZGY B;  3CZX A;  3NFZ A;  1Z8L A;  1KUV A;  1Z5R A;  3B3T A;  2Z10 A;  4MCQ A;  3R96 A;  1XOV A;  4GS4 A;  4EME A;  5J8F A;  2BSW A;  2C6C A;  2OH1 A;  4H6Z A;  1R3N A;  1Y7E A;  1TXR A;  4QBJ A;  3FED A;  1YME A;  2O28 A;  4MY0 A;  4OAD A;  2JLM A;  3RNZ A;  2REF A;  1MK4 A;  4CYQ A;  4KZT A;  2GLJ A;  3PB9 X;  4OKO A;  4DYO A;  3QNV A;  4ZY1 A;  2ZW4 A;  2CF4 A;  3CXS A;  4XPD C;  2IQ6 A;  2PVW A;  4AXV A;  4MFJ A;  5CNP A;  4CYO A;  4NGQ A;  3TO7 A;  4CYN A;  5A27 A;  2XEI A;  4A32 A;  2ABZ A;  1NE9 A;  3SI2 A;  2FS5 A;  3KQZ A;  6CPA A;  1I21 A;  3UY5 A;  2ZEO A;  2IJZ A;  3D7D A;  5LYF A;  2V8H A;  2DPT A;  2PR8 A;  2YGW A;  4H6U A;  4KS9 A;  2RC4 A;  2IMO A;  4NJR A;  5C88 A;  2P6F A;  2R98 A;  2YNE A;  3D8P A;  5I4M A;  3PB8 X;  2PJ6 A;  4NFR A;  4MHP A;  4KLV A;  4M6G A;  3SXO A;  1ARL A;  2C6P A;  4M6I A;  2WUU A;  4B5P B;  3PB6 X;  2HB6 A;  4L8A A;  1Y9W A;  4Q38 A;  3WC7 A;  3B3W A;  4XPL A;  1BLL E;  5F46 A;  3CXQ A;  3FJU A;  4P6Y A;  1IB1 E;  2HQY A;  1XIX A;  2PQ8 A;  3D68 A;  3IEH A;  4OP4 A;  3GY9 A;  4PXB A;  3SJG A;  3TTH A;  4WWV A;  3PB7 X;  4C7H A;  5JQ4 A;  1Z4E A;  4KOR A;  4L89 A;  1IY7 A;  2O53 A;  3R9F A;  4B11 A;  1QMU A;  2C1C A;  2R8V A;  4MHN A;  3ISZ A;  2Z3P A;  1LAM A;  2NSM A;  4FD5 A;  3RYO A;  4PXD A;  5C82 A;  2PDO A;  3LAC A;  3GB0 A;  1I1D A;  3JRU A;  1YK3 A;  4G1P A;  5EMI A;  3D2M A;  2V77 A;  3TOB A;  4ONU A;  2A4N A;  2FT0 A;  2JDD A;  4MXU A;  1KUY A;  3V8I A;  3R9E A;  2ZOG A;  3KKW A;  4UEE A;  3RO0 A;  3E0K A;  4A37 A;  2G9D A;  2ODF A;  4CGM A;  1LAP A;  3TE4 A;  1XFO A;  4DNC A;  3BI0 A;  4MFP A;  2AE6 A;  3CPX A;  3F5B A;  1JWQ A;  2NMT A;  2R7H A;  2JDC A;  4MRI A;  4NGM A;  1J4J A;  3KL9 A;  3JUW A;  2VBQ A;  4RS2 A;  3TT2 A;  2PRQ A;  1TIQ A;  4LQG A;  3S6G A;  1CJW A;  2G0B A;  4U9Z A;  7CPA A;  5I0C A;  5KTD A;  1HEE A;  4OLL A;  5LRJ A;  4R3L A;  3LWU A;  2ARH A;  2PJ1 A;  3KHZ A;  4IHM A;  3QB8 A;  2K5T A;  4NGR A;  4UWI A;  4X3R A;  2Z3M A;  1UWY A;  2B5G B;  2CNT A;  4C2Z A;  4UA3 A;  1AYE A;  3KZW A;  4OC2 A;  4EVY A;  4C2Y A;  1X10 A;  3S9L A;  4PV6 A;  3SJE A;  3FIX A;  4AVA A;  5K8N A;  2J9A A;  2B3V A;  2PR1 A;  2REE A;  2WYR A;  3PRT A;  3S9N A;  2PJ4 A;  1OBR A;  1P4N A;  3FBU A;  5G20 A;  5EBV A;  2Q4V A;  4PSX A;  4JJX A;  4FD6 A;  4HNW B;  1Y0R A;  2F5I A;  4LX9 A;  3K9U A;  3R9G A;  4F8Z A;  4A31 A;  3WC6 A;  3KI9 A;  4NGP A;  4KOT A;  1GHE A;  4LQ6 A;  5JM6 A;  1XBU A;  1CG2 A;  3KAS A;  1PCA A;  3IU2 A;  4MHZ A;  4B12 A;  2I3C A;  4E2A A;  3VAR A;  1NSA A;  1M4L A;  4CRY B;  1VHS A;  1R43 A;  1ELM P;  2PJB A;  2YND A;  3QAY A;  4HPS A;  3EFA A;  1XF8 A;  4KOV A;  1WK4 A;  1CP7 A;  4OC1 A;  2PC1 A;  3D7F A;  3L2N A;  2AFO A;  4X8I A;  4AVB A;  3JTK A;  2ZEL A;  1CM0 A;  5G21 A;  4CAW A;  1TF9 A;  4NGT A;  4P4D A;  2KCW A;  2B5G A;  3EXN A;  3W6X A;  1QSO A;  1YRE A;  1ZLI A;  2D4P A;  1VGY A;  4CAF A;  5KTC A;  3FEE A;  4MJ8 A;  1AUG A;  3IO1 A;  4JXR A;  3DDD A;  2CXA A;  1QST A;  2Q44 A;  2NYQ A;  1CP6 A;  2EBJ A;  3N5F A;  2ZED A;  1FT7 A;  2DF5 A;  4QUS A;  2JEW A;  3DR8 A;  4F9U A;  3FRM A;  3JVN A;  4OIW A;  5THW A;  4MY3 A;  5BWA B;  4CAV A;  1GYT A;  3MGD A;  3S9M A;  3RAM A;  5LYL A;  2BL1 A;  4MCS A;  4CAX A;  2B4B A;  3LOD A;  1BAV A;  4O23 A;  4KOU A;  4YRH A;  1OZP A;  1S5K A;  4OC0 A;  1V0C A;  2DXQ A;  3CT9 A;  3BI1 A;  5G1Z A;  4FBE A;  1QQ9 A;  2ZEM A;  4P44 A;  5E96 A;  4E0A A;  1M44 A;  4NSQ A;  4Q36 A;  3GLJ A;  2Q43 A;  1YGH A;  4UWJ A;  1DTD A;  4EFD A;  2ANP A;  5LRK A;  4F0Y A;  1Y0Y A;  4WJB A;  2R1I A;  3GUX A;  4A94 A;  2VL1 A;  4W9Y A;  3IWG A;  3WT4 A;  2OR4 A;  4UCM A;  3ZZI A;  1Q2D A;  2PJ3 A;  4AB7 A;  3KQX A;  4OME A;  4MMO A;  3KGQ A;  1Q2C A;  2YNC C;  4KSI A;  5K8O A;  5F09 A;  4A38 A;  2J8N A;  3IC1 A;  3LMS A;  2AFM A;  3P2F A;  1TKJ A;  1M4D A;  5FVJ A;  4B5P A;  4KLW A;  4PXE A;  1ZG9 A;  3RZA A;  2CTC A;  3D3S A;  2GE3 A;  4RN7 A;  3KR5 A;  4NJQ A;  3K2K A;  4KSA A;  4P45 A;  2PIY A;  4A39 A;  3TO9 A;  3ISX A;  3T8W A;  3DNS A;  1QSM A;  1RXT A;  4PK2 A;  3BJ7 A;  1BOB A;  2P6G A;  2ZPA A;  2PJ8 A;  2GFQ A;  3PFE A; 
#chains in the Genus database with same CATH homology
 3GKR A;  3ZJ0 A;  4AVC A;  1Z4R A;  3G3S A;  3C26 A;  2AJ6 A;  3W6S A;  1K4J A;  2CNM A;  5DWM A;  4K30 A;  4F6A A;  2Q7B A;  3W91 A;  4A95 A;  3T90 A;  4LUA A;  3PGP A;  2OZG A;  2Q0Y A;  3EY5 A;  4CGL A;  1B6B A;  4NCZ A;  5F48 A;  4U5Y A;  5ISV A;  1KUX A;  3I3G A;  2EUI A;  1UFH A;  2VZZ A;  4KVO E;  1QSR A;  2Z0Z A;  1Y7R A;  4FD7 A;  4XPD B;  3VWE A;  3N7Z A;  2FSR A;  1B87 A;  4C2X A;  2PRB A;  2HUZ A;  1R57 A;  2DPS A;  2I00 A;  2I79 A;  3VWD A;  1S60 A;  1M4G A;  4B10 A;  4UBR A;  3CXP A;  2C27 A;  4QVT A;  1IID A;  4BBH A;  5H86 A;  4JWP A;  1WWZ A;  2GAN A;  4R57 A;  1XEB A;  1XMT A;  2FL4 A;  2QML A;  3DSB A;  4KSF A;  2J8M A;  4QC6 A;  3TCV A;  1PUA A;  5IX3 A;  4FD4 A;  3BJ8 A;  2VQY A;  1IYK A;  2QEC A;  1ON0 A;  4AG9 A;  3EC4 A;  3LD2 A;  2B4D B;  2WPX A;  2BEI A;  3FXT A;  4CRZ B;  2FCK A;  4ZBG A;  2ZW6 A;  4MFK A;  4CGO A;  4BMH A;  3TO6 A;  4I49 A;  2Z3L A;  5EC4 A;  3NE7 A;  2G3T A;  2QIR A;  2JEV A;  2Y0M A;  4IF5 A;  4QB9 A;  1VKC A;  5AGE A;  4H89 A;  5IV0 A;  4XNH B;  2FXF A;  4CGN A;  2J8R A;  4KOY A;  3SXN A;  4B14 A;  4PK3 A;  2Q04 A;  4JXQ A;  4PSW A;  4IUS A;  4RI1 A;  1Y9K A;  5A28 A;  3FYN A;  4CS0 B;  4M3S A;  2FIA A;  1IIC A;  1I12 A;  2D4O A;  3G8W A;  3F0A A;  4XNH C;  1NSL A;  3R1K A;  3GYA A;  2BUE A;  1M1D A;  4KOX A;  4B5O A;  4C7I A;  5F49 A;  4R3K A;  4JLY A;  4C68 A;  3SHP A;  4KUB A;  5AG7 A;  5H84 A;  3IGR A;  3S6K A;  3A9L A;  2VI7 A;  3T9Y A;  4A2Z A;  1S7K A;  4AG7 A;  4OAE A;  5AG6 A;  1YX0 A;  3FNC A;  3OWC A;  5IB0 A;  1N71 A;  4MHD A;  2P6E A;  5GCN A;  1Z9U A;  2B3U A;  1YLE A;  2CNS A;  2WPW A;  3S6H A;  4E8O A;  4MFQ A;  2ZW7 A;  3TFY A;  1RO5 A;  4KOS A;  3TOA A;  2X7B A;  4R87 A;  3EO4 A;  4MFZ A;  5DWN A;  2IL4 A;  4KVM E;  1NMT A;  4F0X A;  2YNC A;  2Z3K A;  2EVN A;  4YFJ A;  2P0W A;  1P0H A;  2OU2 A;  1KZF A;  2Z3N A;  1S7L A;  1U6M A;  2VXK A;  1MJA A;  3H4Q A;  2ATR A;  2H5M A;  2PSW A;  2WSA A;  4UFW A;  2B4D A;  1IYL A;  4B13 A;  2B58 A;  1Q2Y A;  3I9S A;  3BLN A;  2OB0 A;  2OZU A;  4U9Y A;  4MBU A;  4J3G A;  1MJB A;  1YVK A;  4UFX A;  2FE7 A;  4HKF A;  4NEX A;  4HNX B;  4CYP A;  5F47 A;  4HNY B;  4CGP A;  1S3Z A;  2VZY A;  2OZH A;  4NXY A;  1L0C A;  2Q4Y A;  3P2H A;  4XPK A;  3FB3 A;  3IWE A;  4II9 A;  3IU1 A;  5HMN A;  1LRZ A;  4MFL A;  3S6F A;  1BO4 A;  2FIW A;  2CY2 A;  1ZO0 A;  4M85 A;  3QAH A;  2Z3O A;  1QSN A;  3PP9 A;  3R95 A;  3F8K A;  4Y49 C;  2G3A A;  4KOW A;  1MJ9 A;  4CAE A;  5HH1 A;  4NF1 A;  2Z11 A;  5G22 A;  4KUA A;  4YGO A;  1XE4 A;  1PU9 A;  4ORF A;  4R9M A;  3WR7 A;  3B8G A;  4KVX A;  4X5K A;  4A30 A;  4MI4 A;  5KTA A;  2ZW5 A;  1SQH A;  4UFV A;  5JPH A;  2HV2 A;  1S7N A;  5AG4 A;  3H5Z A;  5J8C A;  1YVO A;  1YR0 A;  4Y49 B;  5AG5 A;  4UCP A;  1FY7 A;  2ZXV A;  1M4I A;  1S7F A;  4JD6 A;  3D2P A;  2GIV A;  3DR6 A;  2VEZ A;  3PZJ A;  4UCN A;  4ZGY B;  1KUV A;  2Z10 A;  3R96 A;  4GS4 A;  5J8F A;  2BSW A;  2OH1 A;  4H6Z A;  4QBJ A;  2O28 A;  4MY0 A;  4OAD A;  2JLM A;  2REF A;  1MK4 A;  4CYQ A;  4KZT A;  2ZW4 A;  3CXS A;  4XPD C;  4MFJ A;  5CNP A;  4CYO A;  4CYN A;  3TO7 A;  5A27 A;  4A32 A;  1NE9 A;  2FS5 A;  1I21 A;  3UY5 A;  2DPT A;  2PR8 A;  2YGW A;  4H6U A;  4KS9 A;  2RC4 A;  5C88 A;  2P6F A;  2R98 A;  2YNE A;  3D8P A;  3SXO A;  4KLV A;  2WUU A;  4B5P B;  4L8A A;  1Y9W A;  4Q38 A;  4XPL A;  5F46 A;  3CXQ A;  1IB1 E;  2HQY A;  1XIX A;  2PQ8 A;  4A33 A;  3TTH A;  3GY9 A;  4C7H A;  5JQ4 A;  1Z4E A;  4KOR A;  4L89 A;  3R9F A;  4B11 A;  2R8V A;  2Z3P A;  4FD5 A;  3RYO A;  5C82 A;  2PDO A;  1I1D A;  3TOB A;  1YK3 A;  3D2M A;  4ONU A;  2A4N A;  2FT0 A;  2JDD A;  1KUY A;  3V8I A;  3R9E A;  3KKW A;  3E0K A;  4CGM A;  3TE4 A;  4DNC A;  4MFP A;  2AE6 A;  3F5B A;  2R7H A;  2NMT A;  2JDC A;  1J4J A;  3JUW A;  2VBQ A;  4RS2 A;  3TT2 A;  1TIQ A;  3S6G A;  1CJW A;  2G0B A;  4U9Z A;  5I0C A;  5KTD A;  4OLL A;  4R3L A;  2ARH A;  4UWI A;  3QB8 A;  2K5T A;  2Z3M A;  2B5G B;  2CNT A;  4C2Z A;  4UA3 A;  4EVY A;  4C2Y A;  4PV6 A;  3FIX A;  4AVA A;  2PR1 A;  2B3V A;  2REE A;  3FBU A;  1P4N A;  5G20 A;  5EBV A;  2Q4V A;  4PSX A;  4JJX A;  4FD6 A;  4HNW B;  2F5I A;  4LX9 A;  3R9G A;  3K9U A;  4A31 A;  4KOT A;  1GHE A;  3IU2 A;  4B12 A;  4E2A A;  4CRY B;  1VHS A;  2YND A;  3EFA A;  4KOV A;  1XF8 A;  1WK4 A;  2PC1 A;  4AVB A;  3JTK A;  1CM0 A;  5G21 A;  4CAW A;  2KCW A;  2B5G A;  3EXN A;  3W6X A;  1QSO A;  1YRE A;  2D4P A;  5KTC A;  4CAF A;  4MJ8 A;  4JXR A;  3DDD A;  2CXA A;  1QST A;  2Q44 A;  4QUS A;  3DR8 A;  3FRM A;  3JVN A;  4MY3 A;  5BWA B;  4CAV A;  3MGD A;  2BL1 A;  4CAX A;  2B4B A;  3LOD A;  4YRH A;  4KOU A;  1OZP A;  1S5K A;  1V0C A;  2DXQ A;  5G1Z A;  4E0A A;  5E96 A;  1M44 A;  4NSQ A;  4Q36 A;  1YGH A;  4UWJ A;  4F0Y A;  2R1I A;  3IWG A;  4UCM A;  3ZZI A;  1Q2D A;  4AB7 A;  1Q2C A;  2YNC C;  2J8N A;  3P2F A;  1M4D A;  5FVJ A;  4B5P A;  4KLW A;  3D3S A;  2GE3 A;  4KSA A;  3TO9 A;  3DNS A;  1QSM A;  1RXT A;  4PK2 A;  3BJ7 A;  1BOB A;  2P6G A;  2ZPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...