2Q04A

Crystal structure of acetoin utilization protein (zp_00540088.1) from exiguobacterium sibiricum 255-15 at 2.33 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
GMFEKQFNHRTLETSLGPVEIEGPVTSQILATYKLDPGLTAFRQPAEQHEALVEIAALEEGRIIIARQGNDIIGYVTFLYPDPYETWSEGNNPYILELGAIEVAARFRGQQIGKKLLEVSMLDPAMEHYLILTTEYYWHWDLKGSGLSVWDYRKIMEKMMNHGGLVFFPTDDPEIASHPANCLMARIGKHVAPEVVAHFDALRLRRRFMYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetoin utilization protein (ZP_00540088.1) from Exiguobacterium sibiricum 255-15 at 2.33 A resolution
rcsb
molecule keywords Acetoin utilization protein
molecule tags Transferase
source organism Exiguobacterium sibiricum
total genus 59
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q04A00
2B4DA 3P2HA 4HNYB 4B5PA 3FRMA 3W6SA 1S5KA 5KTCA 2PC1A 1XEBA 3KKWA 2B3VA 2P6EA 4UWJA 1Z4RA 5F48A 4FD7A 3E0KA 4FD4A 4R3LA 3D8PA 3TTHA 2WPWA 1B6BA 1YX0A 2OZUA 3CXPA 4U5YA 4AVCA 3BJ8A 3NE7A 4CS0B 4CAWA 2ZPAA 2G0BA 3QAHA 2J8RA 4JLYA 3SXNA 1Q2CA 4OLLA 2B4DB 2PQ8A 3TO7A 1KUYA 4II9A 4B5PB 2ZW6A 4U9ZA 3DSBA 1NSLA 4XPDB 1RO5A 4IUSA 4U9YA 4KLVA 1GHEA 3S6GA 4QVTA 2R98A 1KUXA 2PSWA 2CNTA 2REEA 3R96A 2B4BA 4L89A 1BO4A 5DWMA 3R95A 2Z10A 4MY0A 2PRBA 4H6UA 5GCNA 4LX9A 4ZBGA 1YR0A 2HQYA 3K9UA 3TE4A 3D3SA 4KORA 1YVOA 2FL4A 4PSXA 5FVJA 1IYLA 4B5OA 2BEIA 4JD6A 1Y7RA 5IV0A 4CRYB 2R7HA 4KVXA 4UWIA 2BSWA 4L8AA 4XNHC 3EC4A 4Y49C 1WWZA 3WR7A 3C26A 1S7NA 1CJWA 2A4NA 2FXFA 2REFA 5J8FA 3T9YA 4KOTA 2JLMA 2KCWA 2ATRA 5HH1A 2Q7BA 3GY9A 1XIXA 1M4DA 4DNCA 1S7LA 4AVAA 3GKRA 3R1KA 2FT0A 3G3SA 2WPXA 4QBJA 3S6KA 4RI1A 2Y0MA 4GS4A 4NF1A 4H89A 3EY5A 1NE9A 1Z9UA 4MHDA 4KLWA 4JXRA 4PSWA 2C27A 3I3GA 4YRHA 2ZW5A 3TT2A 2PR1A 2VBQA 2QIRA 5IB0A 3B8GA 2Q0YA 4RS2A 4MJ8A 3R9FA 4F0YA 2B58A 5I0CA 3DDDA 1R57A 4IF5A 4J3GA 2P6FA 1XE4A 3D2MA 4KOSA 2I79A 2EVNA 2BL1A 3DR8A 2Z0ZA 3FBUA 2BUEA 2FIWA 5CNPA 4R87A 1YREA 1QSNA 2OU2A 3PP9A 4E8OA 1I21A 4LUAA 5F46A 1LRZA 4NCZA 3W91A 5KTDA 1IICA 1PU9A 1S60A 5IX3A 5H84A 5HMNA 2OB0A 5JPHA 4E2AA 3CXQA 3EO4A 3RYOA 4HNXB 2HV2A 3PGPA 1P4NA 3UY5A 1S7FA 3PZJA 2OH1A 1I1DA 1Z4EA 3TCVA 5C82A 4XPDC 3BLNA 1QSTA 1I12A 4KUAA 3H4QA 3S6FA 3IWGA 1CM0A 2VZZA 5ISVA 1MJAA 1MJ9A 4KUBA 1OZPA 4QC6A 3T90A 2OZGA 2P6GA 1M1DA 3TO6A 3JUWA 1QSRA 4KOYA 2X7BA 2PR8A 4JWPA 3FB3A 4R9MA 4CRZB 1M44A 3BJ7A 5EC4A 1UFHA 4PV6A 4F6AA 3IGRA 4MI4A 2VXKA 5F49A 2FIAA 1RXTA 2PDOA 2VEZA 3DNSA 2RC4A 1TIQA 2K5TA 3D2PA 4AG9A 1NMTA 1M4GA 2HUZA 4EVYA 3I9SA 4XPLA 1S7KA 2EUIA 3P2FA 3TFYA 2J8NA 3DR6A 4KVOE 1B87A 3VWDA 3G8WA 1IYKA 1WK4A 1M4IA 4FD5A 3JVNA 1VHSA 1V0CA 5J8CA 3QB8A 1KUVA 4PK3A 1P0HA 4MBUA 4ONUA 3EFAA 4YFJA 4NXYA 2AE6A 4KOUA 1YK3A 5JQ4A 1YGHA 1VKCA 4OADA 3V8IA 2QECA 2B5GA 2R1IA 3SHPA 2FS5A 2P0WA 2ZW7A 3F8KA 5DWNA 3S6HA 1S3ZA 2O28A 4K30A 3MGDA 2FE7A 3GYAA 1YLEA 2D4PA 2FCKA 1Q2YA 4M3SA 2CY2A 4M85A 2F5IA 3R9EA 2OZHA 4YGOA 3LD2A 2Q44A 1U6MA 2DXQA 4KOXA 2Q4YA 3FYNA 3TOBA 4UA3A 2VI7A 1QSMA 1Q2DA 1MK4A 4H6ZA 5F47A 3CXSA 1KZFA 2D4OA 2QMLA 4KOVA 1ON0A 4KZTA 3TOAA 3ZZIA 4NSQA 4KVME 3FXTA 3LODA 1IIDA 5EBVA 1L0CA 2B5GB 2AJ6A 4CAXA 4R3KA 1QSOA 4AVBA 4XNHB 3EXNA 2ZXVA 2VZYA 4Y49B 2R8VA 4JXQA 4PK2A 2CNMA 4I49A 1J4JA 3F0AA 2GANA 5C88A 1XMTA 3FNCA 3ZJ0A 4AG7A 2NMTA 1SQHA 3F5BA 1XF8A 3W6XA 4NEXA 4KOWA 4AB7A 4FD6A 1IB1E 2J8MA 4HKFA 1Y9KA 2Q4VA 4MY3A 2VQYA 2GIVA 2I00A 3N7ZA 1YVKA 2FSRA 2GE3A 2Z11A 5H86A 1Y9WA 2G3AA 2B3UA 3VWEA 4XPKA 2H5MA 2JEVA 1MJBA 2JDDA 4X5KA 1K4JA 2G3TA 4BMHA 4CAVA 2JDCA 4QUSA 1FY7A 4R57A 4OAEA 3FIXA 4UBRA 3OWCA 4JJXA 3SXOA 2Q04A 1N71A 4E0AA 2IL4A 4ORFA 4HNWB 2CNSA 5KTAA 5E96A 2ZW4A 3TO9A 1BOBA 3R9GA 2ARHA 1PUAA 4QB9A
chains in the Genus database with same CATH superfamily
2B4DA 3P2HA 3VATA 3FEEA 2FVGA 5K8PA 3IC1A 2PRQA 4HNYB 4B5PA 3FRMA 4MCRA 3W6SA 1S5KA 3PRTA 3L2NA 4GXHA 4PXCA 4EMEA 5KTCA 2PC1A 1XEBA 2PJ4A 2POKA 1IOFA 3KKWA 2Q51A 3KZWA 4TNUA 1HDQA 2AFUA 2B3VA 2EBJA 2P6EA 4UWJA 1BAVA 1Z4RA 3GB0A 3SJEA 3FMCA 1ZLHA 5F48A 4Q36A 2GFQA 4F9VA 4OIWA 4FD7A 4LQGA 3E0KA 4FD4A 1UWYA 2ZOFA 4R3LA 1LAPA 2YNCC 3D8PA 3TTHA 5A27A 4MHYA 2PJ5A 4UFVA 4ZGYB 2WPWA 2NSMA 1B6BA 1CG2A 1YX0A 2OZUA 2ZEMA 3CXPA 4U5YA 3BJ8A 4AVCA 5AG4A 3NE7A 4CPAA 4CS0B 4OC0A 3T8WA 4CAWA 5CBMA 1BPNA 2PCUA 2ZPAA 5K8OA 2G0BA 3QAHA 2J8RA 4P10A 4JLYA 3SXNA 2XEFA 1Q2CA 2HC9A 4OLLA 4P44A 2B4DB 2PQ8A 3TO7A 5G22A 1KUYA 4K3NA 1IU8A 3SI0A 4B5PB 2ZW6A 4II9A 3TX8A 2YNDA 4U9ZA 3DSBA 4UIAA 4MFLA 1NSLA 1HDUA 4XPDB 2ZEGA 1RO5A 5THWA 4IUSA 1VIXA 4NGRA 3PBBA 4U9YA 4KLVA 1GHEA 1ZLIA 3KQZA 4QVTA 3S6GA 2R98A 1KUXA 2OOTA 2PSWA 4P6YA 3D4UA 2PJCA 3B35A 4P4FA 2CNTA 2REEA 4JYWA 3R96A 4A31A 2B4BA 4DYOA 4M6HA 1QMUA 4ZY0A 4L89A 1BO4A 5DWMA 3R95A 2Z10A 4MY0A 4M6GA 2Q7SA 2CTBA 4NGTA 2PRBA 4H6UA 3VH9A 4Z65A 3NH5A 1PYTB 5GCNA 4LX9A 4ZBGA 2Z3MA 4A32A 1F2OA 5HVGA 1YR0A 2HQYA 3K9UA 3TE4A 4MFKA 2CTCA 3D3SA 1YVOA 2FL4A 4KORA 2PJAA 3CPXA 4ONWA 4PSXA 4R76A 4NGPA 2HB6A 1FNOA 5FVJA 5IB9A 4X2TA 4MCSA 1IYLA 4P4DA 2BEIA 4JD6A 4B5OA 1RTQA 5JM6A 1Y7RA 5IV0A 3D7HA 2NYQA 4C2XA 2V8HA 2R7HA 4KVXA 4UWIA 4CRYB 2BSWA 4PPZA 4L8AA 4XNHC 3BI1A 2BOAA 2PJ9A 4ZYQA 3EC4A 5I4MA 5JGFA 4Y49C 3FVLA 2ZEOA 1WWZA 3H8EA 4R6TA 5AGEA 3WR7A 3C26A 1A2ZA 4C7HA 1LFWA 2AFMA 1S7NA 5K8MA 1CJWA 2A4NA 1R43A 1TF9A 2FXFA 2REFA 4UIBA 5J8FA 5LRKA 2V8VA 2PVWA 1XMBA 4P4IA 2CXAA 3T9YA 3B3TA 2JLMA 4KOTA 4DJLA 2KCWA 4A39A 1JWQA 2I3CA 2ODFA 4OC1A 4KSFA 2ATRA 2ZOGA 5HH1A 1HEEA 2Q7BA 3GY9A 1XIXA 3D7GA 3IU1A 4GM5A 1M4DA 4DNCA 3WC6A 1S7LA 3PB8X 4AVAA 5HXDA 2C6CA 4ZX9A 3PFOA 3GKRA 4JZ0A 5LRGA 4A30A 4DUKA 4ZI6A 4B12A 3R1KA 2FT0A 4F8ZA 3G3SA 3PFEA 1ELLP 3TC8A 1XFOA 3S9NA 2WPXA 3H8FA 3V7ZA 4QBJA 1ARLA 7CPAA 4YU9A 3S6KA 4RI1A 2Q4ZA 4ZY2A 1CP6A 2Y0MA 4KSAA 4GS4A 4NF1A 4PXEA 4B14A 4H89A 1Z8WA 3K9TA 3EY5A 4UFWA 1JQGA 3MRUA 4X8IA 4CGPA 2EWBA 1NE9A 1Z9UA 3JRUA 4MHDA 5ELYA 2Z3PA 4BD9A 4KSIA 4KLWA 1CBXA 4EFDA 4JXRA 4PSWA 2PIYA 2C27A 2F7VA 3PBEA 4UCPA 3I3GA 2GREA 4YRHA 2ZW5A 3TT2A 2PR1A 2C6PA 4BINA 1ZG7A 3IU2A 2VBQA 5J1QA 3KR5A 2QIRA 4UFXA 5IB0A 2GLJA 3B8GA 2Q0YA 1VHOA 4MJ8A 4RS2A 5HVHA 1TKHA 2VL1A 3KGQA 3R9FA 4KS9A 3B2YA 4F0YA 1CP7A 1F2PA 2B58A 5I0CA 3DDDA 1R57A 4YWYA 2WUUA 4MCPA 2GU2A 1TKJA 4NJRA 4IF5A 1QQ9A 4J3GA 2F8HA 3K2KA 2P6FA 1XE4A 3B3VA 3D2MA 4KOSA 2I79A 3WC5A 4ZY1A 2EVNA 4IK2A 4CGNA 1AYEA 2V8DA 3FX6A 2BL1A 3DR8A 2Z0ZA 2AFZA 2AFWA 1Z8XA 3QNVA 2EO8A 4MFJA 2AFOA 3FBUA 2BUEA 2FIWA 4IHMA 4FAIA 5CNPA 4R87A 1YREA 1QSNA 2OU2A 2Z3OA 3PP9A 4E8OA 5F09A 3IO1A 3RNZA 1ZG8A 1I21A 4LUAA 5F46A 2JBJA 5G21A 1LRZA 4A37A 4NCZA 3W91A 5KTDA 1IICA 2C1CA 1PU9A 1S60A 3FJUA 4P4BA 5IX3A 3KQXA 5H84A 5HMNA 2OB0A 4CGOA 5JPHA 3NA6A 4E2AA 3DGVA 4UEEA 3CXQA 3EO4A 3RYOA 5AG6A 5HVFA 4HNXB 2HV2A 3LWUA 4ZX8A 3PGPA 1P4NA 4F0XA 4TWEA 1S7FA 3UY5A 3PZJA 2OH1A 1I1DA 1Z4EA 3B3CA 2QJ8A 4WJBA 3TCVA 5C82A 4XPDC 3PB4X 4UCNA 3BLNA 1QSTA 1XBUA 1I12A 1IGBA 4C2YA 4KUAA 4CYQA 3S9MA 1Q7LA 4CYNA 5AG5A 1IOIA 3H4QA 3MN8A 3B3SA 5LYDA 3IWGA 2RFHA 3S6FA 3PB6X 1CM0A 2Z3LA 3KI9A 4UEFA 2VZZA 3FEDA 3D66A 3LACA 5ISVA 1MJAA 1MJ9A 2PIZA 4WWVA 3HUVA 4KUBA 1OZPA 3D67A 4QC6A 2ZEEA 3T90A 2OZGA 3NH8A 2P6GA 1M1DA 3TO6A 3JUWA 4RUHA 1QSRA 4KOYA 2X7BA 1YSJA 3PEIA 5DS0A 4A2ZA 4C2ZA 2PR8A 4A94A 4OC2A 2PJ2A 4JWPA 3FB3A 1ARMA 1LAMA 2ZEFA 4R9MA 4CRZB 2V8GA 4MFPA 3GIUA 2Z3KA 4OC5A 2WZNA 4EWTA 1M44A 2PJ8A 3BJ7A 4H2KA 5EC4A 1UFHA 1ZG9A 3IIBA 4PV6A 4NGQA 3VARA 1Z5RA 2WYRA 1CPXA 3ISXA 1BPMA 2ZELA 3IGRA 2VXKA 4MI4A 4F6AA 2BO9A 3CZXA 5F49A 4IAVA 2FIAA 3NFZA 4NGSA 2Z3NA 1CPSA 1RXTA 4F9UA 2PDOA 2VEZA 3S9LA 3DNSA 2RC4A 5K8NA 3B7IA 4M6IA 1TIQA 2K5TA 3D2PA 3IFEA 5EMIA 4AG9A 1ZO0A 3NH4A 4MXUA 4OP4A 5LYIA 1LANA 1NMTA 3GUXA 4R8FA 1M4GA 2HUZA 4EVYA 5G20A 3KL9A 4MMOA 3NE8A 3I9SA 4AXVA 4XPLA 1VHEA 1AMPA 4W9YA 1S7KA 3SJFA 2EUIA 3P2FA 3TFYA 2J8NA 3H5ZA 3DR6A 4KVOE 1LCPA 2DEAA 1B87A 4NFRA 3V38A 3I1UA 4FUUA 2IQ6A 4PQAA 3CPAA 3VWDA 4CGLA 3G8WA 1IYKA 4MFQA 1WK4A 1IY7A 3RAMA 3WT4A 3IEHA 1M4IA 4Q38A 3RBUA 4CYPA 4FD5A 4MHZA 4PXBA 3HLPA 5A28A 3JVNA 1VHSA 4B10A 1V0CA 1X12A 1ELMP 4MHPA 3QB8A 5J8CA 1KUVA 4PK3A 1P0HA 3FECA 4NJQA 4MBUA 4ONUA 3EFAA 4YFJA 4NXYA 1EE3P 4UCMA 2AE6A 1DTDA 2DPSA 4B11A 4CAEA 3RO0A 4KOUA 1YK3A 5JQ4A 2PJ1A 2PJ6A 5D29A 3B3WA 1YGHA 1YLOA 1VKCA 1XRYA 4OADA 1Z8TA 3V8IA 2ABZA 4C68A 2QECA 2WSAA 2IJZA 4BBHA 2C6GA 4FBEA 3KASA 3SJXA 2B5GA 2R1IA 3CT9A 3SHPA 4A95A 2YGWA 1TF8A 2FS5A 2P0WA 4B6ZA 2ZW7A 3F8KA 5DWNA 3S6HA 1CX8A 3SI2A 1S3ZA 1TKFA 2O28A 2QYVA 2OR4A 3MGDA 4K30A 5JH9A 1PCAA 2FE7A 3GYAA 1YLEA 2BCOA 2D4PA 2G9DA 2DF5A 1FT7A 2FCKA 2ZEDA 3D68A 3PB7X 1Q2YA 4M3SA 3WC7A 1Y0RA 2CY2A 4M85A 1Y7EA 3RZAA 1LOKA 2F5IA 4FWUA 2OZHA 3N5FA 3R9EA 4YGOA 1YW4A 4NGMA 4OKOA 3LD2A 2Q44A 2DPTA 1U6MA 3FF3A 2DXQA 4KOXA 2Q4YA 2AFSA 2ZENA 3FYNA 3TOBA 4UA3A 1NSAA 2VI7A 3GLJA 3ISZA 3DLJA 3PB9X 1QSMA 2QVPA 3WABA 3IWWA 2EK9A 2ZEHA 1Q2DA 1MK4A 4H6ZA 5F47A 2PJBA 1X10A 2ZEPA 1Y0YA 3CXSA 3SI1A 3LMSA 2JEWA 1KZFA 2GLFA 2D4OA 4MCQA 4NGNA 4A38A 2QMLA 2PJ0A 4KOVA 1ON0A 4KZTA 3TOAA 4PXDA 4NSQA 4RN7A 3ZZIA 4KVME 3FXTA 1YMEA 3A9LA 3CDXA 3LODA 1IIDA 5EBVA 1L0CA 2ANPA 4G1PA 2Q43A 4R7MA 2B5GB 3D7FA 1BLLE 2AJ6A 4HPSA 4CAXA 1YQEA 1AUGA 2IMOA 1QSOA 3IWEA 4R3KA 4AVBA 5LYLA 2XEJA 5AG7A 3H8GA 4XNHB 5G1ZA 4OIDA 3EXNA 2ZXVA 2VZYA 4Y49B 2R8VA 4JXQA 4PK2A 2CNMA 4I49A 1J4JA 1OBRA 1Z2LA 4OC3A 4CAFA 3F0AA 2GANA 4P4JA 4O23A 4P4EA 5C88A 8CPAA 1XMTA 3FNCA 3D7DA 3ZJ0A 5CPAA 2J9AA 4AG7A 2NMTA 4A33A 2YNEA 3QAYA 1SQHA 4MRIA 4CGMA 3F5BA 1XF8A 2EK8A 3W6XA 3BHXA 1H8LA 4NEXA 2JBKA 4KOWA 5LRJA 2AFXA 4AB7A 3KHZA 4FD6A 4LQ6A 1IB1E 2J8MA 5LYFA 1DE4C 1KWMA 4HKFA 1GYTA 1Y9KA 4OC4A 2Q4VA 2RB7A 4MY3A 4MHNA 2VQYA 2GIVA 2I00A 2YNCA 2O53A 3N7ZA 1YVKA 2FSRA 2O4HA 1M4LA 5D8NA 1XOVA 2GE3A 2Z11A 2CF4A 1Y9WA 2G3AA 2B3UA 2XEIA 4X3RA 5H86A 3VWEA 2CIJA 4XPKA 2H5MA 2JEVA 1MJBA 2JDDA 2PE3A 4X5KA 1F57A 2XEGA 4UF4A 3BI0A 2PJ3A 1K4JA 1YW6A 2G3TA 3SJGA 4BMHA 4CAVA 2JDCA 4QUSA 1FY7A 3JTKA 4R57A 4OAEA 3FIXA 4UBRA 2V77A 4B13A 6CPAA 3OWCA 4JJXA 1XJOA 3SXOA 4UEZA 3KHXA 2Q04A 4OMEA 1N71A 1R3NA 2PVVA 4E0AA 4MFZA 2IL4A 4ORFA 4Q7AA 4HNWB 2CNSA 3IJ3A 5BWAB 3BXMA 3KR4A 5KTAA 1Z8LA 5E96A 2ZW4A 1TXRA 4CYOA 4C7IA 3TO9A 1BOBA 2PJ7A 2ARHA 3FH4A 4P45A 3R9GA 1VGYA 1PUAA 4QB9A
chains in the Genus database with same CATH topology
2B4DA 3P2HA 4HNYB 4B5PA 3FRMA 3W6SA 1S5KA 5KTCA 2PC1A 1XEBA 3KKWA 2B3VA 2P6EA 4UWJA 1Z4RA 5F48A 4Q36A 4FD7A 3E0KA 4FD4A 4R3LA 2YNCC 3D8PA 3TTHA 5A27A 4UFVA 4ZGYB 2WPWA 1B6BA 1YX0A 2OZUA 3CXPA 4U5YA 4AVCA 3BJ8A 5AG4A 3NE7A 4CS0B 4CAWA 2ZPAA 2G0BA 3QAHA 2J8RA 4JLYA 3SXNA 1Q2CA 4OLLA 2B4DB 2PQ8A 3TO7A 5G22A 1KUYA 4II9A 4B5PB 2ZW6A 2YNDA 4U9ZA 3DSBA 4MFLA 1NSLA 4XPDB 1RO5A 4IUSA 4U9YA 4KLVA 1GHEA 3S6GA 4QVTA 2R98A 1KUXA 2PSWA 2CNTA 2REEA 3R96A 4A31A 2B4BA 4L89A 1BO4A 5DWMA 3R95A 2Z10A 4MY0A 2PRBA 4H6UA 5GCNA 4LX9A 4ZBGA 2Z3MA 4A32A 1YR0A 2HQYA 3K9UA 3TE4A 4MFKA 3D3SA 4KORA 1YVOA 2FL4A 4PSXA 5FVJA 1IYLA 4B5OA 2BEIA 4JD6A 1Y7RA 5IV0A 4C2XA 4CRYB 2R7HA 4KVXA 4UWIA 2BSWA 4L8AA 4XNHC 3EC4A 4Y49C 1WWZA 5AGEA 3WR7A 3C26A 4C7HA 1S7NA 1CJWA 2A4NA 2FXFA 2REFA 5J8FA 2CXAA 3T9YA 2JLMA 4KOTA 2KCWA 4KSFA 2ATRA 5HH1A 2Q7BA 3GY9A 1XIXA 3IU1A 1M4DA 4DNCA 1S7LA 4AVAA 3GKRA 4A30A 4B12A 3R1KA 2FT0A 3G3SA 2WPXA 4QBJA 3S6KA 4RI1A 2Y0MA 4KSAA 4GS4A 4NF1A 4B14A 4H89A 3EY5A 4UFWA 4CGPA 1NE9A 1Z9UA 4MHDA 2Z3PA 4KLWA 4JXRA 4PSWA 2C27A 4UCPA 3I3GA 4YRHA 2ZW5A 3TT2A 2PR1A 3IU2A 2VBQA 2QIRA 4UFXA 5IB0A 3B8GA 2Q0YA 4RS2A 4MJ8A 3R9FA 4KS9A 4F0YA 2B58A 5I0CA 3DDDA 1R57A 2WUUA 4IF5A 4J3GA 2P6FA 1XE4A 3D2MA 4KOSA 2I79A 2EVNA 4CGNA 2BL1A 3DR8A 2Z0ZA 4MFJA 3FBUA 2BUEA 2FIWA 5CNPA 4R87A 1YREA 1QSNA 2OU2A 2Z3OA 3PP9A 4E8OA 1I21A 4LUAA 5F46A 5G21A 1LRZA 4NCZA 3W91A 5KTDA 1IICA 1PU9A 1S60A 5IX3A 5H84A 5HMNA 2OB0A 4CGOA 5JPHA 4E2AA 3CXQA 3EO4A 3RYOA 5AG6A 4HNXB 2HV2A 3PGPA 1P4NA 4F0XA 3UY5A 1S7FA 3PZJA 2OH1A 1I1DA 1Z4EA 3TCVA 5C82A 4XPDC 4UCNA 3BLNA 1QSTA 1I12A 4CYQA 4C2YA 4KUAA 4CYNA 5AG5A 3H4QA 3S6FA 3IWGA 1CM0A 2Z3LA 2VZZA 5ISVA 1MJAA 1MJ9A 4KUBA 1OZPA 4QC6A 3T90A 2OZGA 2P6GA 1M1DA 3TO6A 3JUWA 1QSRA 4KOYA 2X7BA 4A2ZA 4C2ZA 2PR8A 4JWPA 3FB3A 4R9MA 4CRZB 4MFPA 2Z3KA 1M44A 3BJ7A 5EC4A 1UFHA 4PV6A 4F6AA 3IGRA 4MI4A 2VXKA 5F49A 2FIAA 2Z3NA 1RXTA 2PDOA 2VEZA 3DNSA 2RC4A 1TIQA 2K5TA 3D2PA 4AG9A 1ZO0A 1NMTA 1M4GA 2HUZA 4EVYA 5G20A 3I9SA 4XPLA 1S7KA 2EUIA 3P2FA 3TFYA 2J8NA 3H5ZA 3DR6A 4KVOE 1B87A 4CGLA 3VWDA 3G8WA 1IYKA 4MFQA 1WK4A 4CYPA 1M4IA 4Q38A 4FD5A 5A28A 3JVNA 1VHSA 4B10A 1V0CA 5J8CA 3QB8A 1KUVA 4PK3A 1P0HA 4MBUA 4ONUA 3EFAA 4YFJA 4NXYA 4UCMA 2AE6A 2DPSA 4B11A 4CAEA 4KOUA 1YK3A 5JQ4A 1YGHA 1VKCA 4OADA 3V8IA 4C68A 2QECA 2WSAA 4BBHA 2B5GA 2R1IA 3SHPA 2YGWA 2FS5A 2P0WA 2ZW7A 3F8KA 5DWNA 3S6HA 1S3ZA 2O28A 4K30A 3MGDA 2FE7A 3GYAA 1YLEA 2D4PA 2FCKA 1Q2YA 4M3SA 2CY2A 4M85A 2F5IA 3R9EA 2OZHA 4YGOA 3LD2A 2Q44A 2DPTA 1U6MA 2DXQA 4KOXA 2Q4YA 3FYNA 3TOBA 4UA3A 2VI7A 1QSMA 1Q2DA 1MK4A 4H6ZA 5F47A 3CXSA 1KZFA 2D4OA 2QMLA 4KOVA 1ON0A 4KZTA 3TOAA 3ZZIA 4NSQA 4KVME 3FXTA 3A9LA 3LODA 1IIDA 5EBVA 1L0CA 2B5GB 2AJ6A 4CAXA 4R3KA 1QSOA 3IWEA 4AVBA 5AG7A 4XNHB 5G1ZA 3EXNA 2ZXVA 2VZYA 4Y49B 2R8VA 4JXQA 4PK2A 2CNMA 4I49A 1J4JA 4CAFA 3F0AA 2GANA 5C88A 1XMTA 3FNCA 3ZJ0A 4AG7A 2NMTA 4A33A 2YNEA 1SQHA 4CGMA 3F5BA 1XF8A 3W6XA 4NEXA 4KOWA 4AB7A 4FD6A 1IB1E 2J8MA 4HKFA 1Y9KA 2Q4VA 4MY3A 2VQYA 2GIVA 2I00A 2YNCA 3N7ZA 1YVKA 2FSRA 2GE3A 2Z11A 5H86A 1Y9WA 2G3AA 2B3UA 3VWEA 4A95A 4XPKA 2H5MA 2JEVA 1MJBA 2JDDA 4X5KA 1K4JA 2G3TA 4BMHA 4CAVA 2JDCA 4QUSA 1FY7A 3JTKA 4R57A 4OAEA 3FIXA 4UBRA 4B13A 3OWCA 4JJXA 3SXOA 2Q04A 1N71A 4E0AA 4MFZA 2IL4A 4ORFA 4HNWB 2CNSA 5BWAB 5KTAA 5E96A 2ZW4A 4CYOA 4C7IA 3TO9A 1BOBA 3R9GA 2ARHA 1PUAA 4QB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4D A;  3P2H A;  4HNY B;  4B5P A;  3FRM A;  3W6S A;  1S5K A;  5KTC A;  2PC1 A;  1XEB A;  3KKW A;  2B3V A;  2P6E A;  4UWJ A;  1Z4R A;  5F48 A;  4FD7 A;  3E0K A;  4FD4 A;  4R3L A;  3D8P A;  3TTH A;  2WPW A;  1B6B A;  1YX0 A;  2OZU A;  3CXP A;  4U5Y A;  4AVC A;  3BJ8 A;  3NE7 A;  4CS0 B;  4CAW A;  2ZPA A;  2G0B A;  3QAH A;  2J8R A;  4JLY A;  3SXN A;  1Q2C A;  4OLL A;  2B4D B;  2PQ8 A;  3TO7 A;  1KUY A;  4II9 A;  4B5P B;  2ZW6 A;  4U9Z A;  3DSB A;  1NSL A;  4XPD B;  1RO5 A;  4IUS A;  4U9Y A;  4KLV A;  1GHE A;  3S6G A;  4QVT A;  2R98 A;  1KUX A;  2PSW A;  2CNT A;  2REE A;  3R96 A;  2B4B A;  4L89 A;  1BO4 A;  5DWM A;  3R95 A;  2Z10 A;  4MY0 A;  2PRB A;  4H6U A;  5GCN A;  4LX9 A;  4ZBG A;  1YR0 A;  2HQY A;  3K9U A;  3TE4 A;  3D3S A;  4KOR A;  1YVO A;  2FL4 A;  4PSX A;  5FVJ A;  1IYL A;  4B5O A;  2BEI A;  4JD6 A;  1Y7R A;  5IV0 A;  4CRY B;  2R7H A;  4KVX A;  4UWI A;  2BSW A;  4L8A A;  4XNH C;  3EC4 A;  4Y49 C;  1WWZ A;  3WR7 A;  3C26 A;  1S7N A;  1CJW A;  2A4N A;  2FXF A;  2REF A;  5J8F A;  3T9Y A;  4KOT A;  2JLM A;  2KCW A;  2ATR A;  5HH1 A;  2Q7B A;  3GY9 A;  1XIX A;  1M4D A;  4DNC A;  1S7L A;  4AVA A;  3GKR A;  3R1K A;  2FT0 A;  3G3S A;  2WPX A;  4QBJ A;  3S6K A;  4RI1 A;  2Y0M A;  4GS4 A;  4NF1 A;  4H89 A;  3EY5 A;  1NE9 A;  1Z9U A;  4MHD A;  4KLW A;  4JXR A;  4PSW A;  2C27 A;  3I3G A;  4YRH A;  2ZW5 A;  3TT2 A;  2PR1 A;  2VBQ A;  2QIR A;  5IB0 A;  3B8G A;  2Q0Y A;  4RS2 A;  4MJ8 A;  3R9F A;  4F0Y A;  2B58 A;  5I0C A;  3DDD A;  1R57 A;  4IF5 A;  4J3G A;  2P6F A;  1XE4 A;  3D2M A;  4KOS A;  2I79 A;  2EVN A;  2BL1 A;  3DR8 A;  2Z0Z A;  3FBU A;  2BUE A;  2FIW A;  5CNP A;  4R87 A;  1YRE A;  1QSN A;  2OU2 A;  3PP9 A;  4E8O A;  1I21 A;  4LUA A;  5F46 A;  1LRZ A;  4NCZ A;  3W91 A;  5KTD A;  1IIC A;  1PU9 A;  1S60 A;  5IX3 A;  5H84 A;  5HMN A;  2OB0 A;  5JPH A;  4E2A A;  3CXQ A;  3EO4 A;  3RYO A;  4HNX B;  2HV2 A;  3PGP A;  1P4N A;  3UY5 A;  1S7F A;  3PZJ A;  2OH1 A;  1I1D A;  1Z4E A;  3TCV A;  5C82 A;  4XPD C;  3BLN A;  1QST A;  1I12 A;  4KUA A;  3H4Q A;  3S6F A;  3IWG A;  1CM0 A;  2VZZ A;  5ISV A;  1MJA A;  1MJ9 A;  4KUB A;  1OZP A;  4QC6 A;  3T90 A;  2OZG A;  2P6G A;  1M1D A;  3TO6 A;  3JUW A;  1QSR A;  4KOY A;  2X7B A;  2PR8 A;  4JWP A;  3FB3 A;  4R9M A;  4CRZ B;  1M44 A;  3BJ7 A;  5EC4 A;  1UFH A;  4PV6 A;  4F6A A;  3IGR A;  4MI4 A;  2VXK A;  5F49 A;  2FIA A;  1RXT A;  2PDO A;  2VEZ A;  3DNS A;  2RC4 A;  1TIQ A;  2K5T A;  3D2P A;  4AG9 A;  1NMT A;  1M4G A;  2HUZ A;  4EVY A;  3I9S A;  4XPL A;  1S7K A;  2EUI A;  3P2F A;  3TFY A;  2J8N A;  3DR6 A;  4KVO E;  1B87 A;  3VWD A;  3G8W A;  1IYK A;  1WK4 A;  1M4I A;  4FD5 A;  3JVN A;  1VHS A;  1V0C A;  5J8C A;  3QB8 A;  1KUV A;  4PK3 A;  1P0H A;  4MBU A;  4ONU A;  3EFA A;  4YFJ A;  4NXY A;  2AE6 A;  4KOU A;  1YK3 A;  5JQ4 A;  1YGH A;  1VKC A;  4OAD A;  3V8I A;  2QEC A;  2B5G A;  2R1I A;  3SHP A;  2FS5 A;  2P0W A;  2ZW7 A;  3F8K A;  5DWN A;  3S6H A;  1S3Z A;  2O28 A;  4K30 A;  3MGD A;  2FE7 A;  3GYA A;  1YLE A;  2D4P A;  2FCK A;  1Q2Y A;  4M3S A;  2CY2 A;  4M85 A;  2F5I A;  3R9E A;  2OZH A;  4YGO A;  3LD2 A;  2Q44 A;  1U6M A;  2DXQ A;  4KOX A;  2Q4Y A;  3FYN A;  3TOB A;  4UA3 A;  2VI7 A;  1QSM A;  1Q2D A;  1MK4 A;  4H6Z A;  5F47 A;  3CXS A;  1KZF A;  2D4O A;  2QML A;  4KOV A;  1ON0 A;  4KZT A;  3TOA A;  3ZZI A;  4NSQ A;  4KVM E;  3FXT A;  3LOD A;  1IID A;  5EBV A;  1L0C A;  2B5G B;  2AJ6 A;  4CAX A;  4R3K A;  1QSO A;  4AVB A;  4XNH B;  3EXN A;  2ZXV A;  2VZY A;  4Y49 B;  2R8V A;  4JXQ A;  4PK2 A;  2CNM A;  4I49 A;  1J4J A;  3F0A A;  2GAN A;  5C88 A;  1XMT A;  3FNC A;  3ZJ0 A;  4AG7 A;  2NMT A;  1SQH A;  3F5B A;  1XF8 A;  3W6X A;  4NEX A;  4KOW A;  4AB7 A;  4FD6 A;  1IB1 E;  2J8M A;  4HKF A;  1Y9K A;  2Q4V A;  4MY3 A;  2VQY A;  2GIV A;  2I00 A;  3N7Z A;  1YVK A;  2FSR A;  2GE3 A;  2Z11 A;  5H86 A;  1Y9W A;  2G3A A;  2B3U A;  3VWE A;  4XPK A;  2H5M A;  2JEV A;  1MJB A;  2JDD A;  4X5K A;  1K4J A;  2G3T A;  4BMH A;  4CAV A;  2JDC A;  4QUS A;  1FY7 A;  4R57 A;  4OAE A;  3FIX A;  4UBR A;  3OWC A;  4JJX A;  3SXO A;  2Q04 A;  1N71 A;  4E0A A;  2IL4 A;  4ORF A;  4HNW B;  2CNS A;  5KTA A;  5E96 A;  2ZW4 A;  3TO9 A;  1BOB A;  3R9G A;  2ARH A;  1PUA A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 2B4D A;  3P2H A;  3VAT A;  3FEE A;  2FVG A;  5K8P A;  3IC1 A;  2PRQ A;  4HNY B;  4B5P A;  3FRM A;  4MCR A;  3W6S A;  1S5K A;  3PRT A;  3L2N A;  4GXH A;  4PXC A;  4EME A;  5KTC A;  2PC1 A;  1XEB A;  2PJ4 A;  2POK A;  1IOF A;  3KKW A;  2Q51 A;  3KZW A;  4TNU A;  1HDQ A;  2AFU A;  2B3V A;  2EBJ A;  2P6E A;  4UWJ A;  1BAV A;  1Z4R A;  3GB0 A;  3SJE A;  3FMC A;  1ZLH A;  5F48 A;  4Q36 A;  2GFQ A;  4F9V A;  4OIW A;  4FD7 A;  4LQG A;  3E0K A;  4FD4 A;  1UWY A;  2ZOF A;  4R3L A;  1LAP A;  2YNC C;  3D8P A;  3TTH A;  5A27 A;  4MHY A;  2PJ5 A;  4UFV A;  4ZGY B;  2WPW A;  2NSM A;  1B6B A;  1CG2 A;  1YX0 A;  2OZU A;  2ZEM A;  3CXP A;  4U5Y A;  3BJ8 A;  4AVC A;  5AG4 A;  3NE7 A;  4CPA A;  4CS0 B;  4OC0 A;  3T8W A;  4CAW A;  5CBM A;  1BPN A;  2PCU A;  2ZPA A;  5K8O A;  2G0B A;  3QAH A;  2J8R A;  4P10 A;  4JLY A;  3SXN A;  2XEF A;  1Q2C A;  2HC9 A;  4OLL A;  4P44 A;  2B4D B;  2PQ8 A;  3TO7 A;  5G22 A;  1KUY A;  4K3N A;  1IU8 A;  3SI0 A;  4B5P B;  2ZW6 A;  4II9 A;  3TX8 A;  2YND A;  4U9Z A;  3DSB A;  4UIA A;  4MFL A;  1NSL A;  1HDU A;  4XPD B;  2ZEG A;  1RO5 A;  5THW A;  4IUS A;  1VIX A;  4NGR A;  3PBB A;  4U9Y A;  4KLV A;  1GHE A;  1ZLI A;  3KQZ A;  4QVT A;  3S6G A;  2R98 A;  1KUX A;  2OOT A;  2PSW A;  4P6Y A;  3D4U A;  2PJC A;  3B35 A;  4P4F A;  2CNT A;  2REE A;  4JYW A;  3R96 A;  4A31 A;  2B4B A;  4DYO A;  4M6H A;  1QMU A;  4ZY0 A;  4L89 A;  1BO4 A;  5DWM A;  3R95 A;  2Z10 A;  4MY0 A;  4M6G A;  2Q7S A;  2CTB A;  4NGT A;  2PRB A;  4H6U A;  3VH9 A;  4Z65 A;  3NH5 A;  1PYT B;  5GCN A;  4LX9 A;  4ZBG A;  2Z3M A;  4A32 A;  1F2O A;  5HVG A;  1YR0 A;  2HQY A;  3K9U A;  3TE4 A;  4MFK A;  2CTC A;  3D3S A;  1YVO A;  2FL4 A;  4KOR A;  2PJA A;  3CPX A;  4ONW A;  4PSX A;  4R76 A;  4NGP A;  2HB6 A;  1FNO A;  5FVJ A;  5IB9 A;  4X2T A;  4MCS A;  1IYL A;  4P4D A;  2BEI A;  4JD6 A;  4B5O A;  1RTQ A;  5JM6 A;  1Y7R A;  5IV0 A;  3D7H A;  2NYQ A;  4C2X A;  2V8H A;  2R7H A;  4KVX A;  4UWI A;  4CRY B;  2BSW A;  4PPZ A;  4L8A A;  4XNH C;  3BI1 A;  2BOA A;  2PJ9 A;  4ZYQ A;  3EC4 A;  5I4M A;  5JGF A;  4Y49 C;  3FVL A;  2ZEO A;  1WWZ A;  3H8E A;  4R6T A;  5AGE A;  3WR7 A;  3C26 A;  1A2Z A;  4C7H A;  1LFW A;  2AFM A;  1S7N A;  5K8M A;  1CJW A;  2A4N A;  1R43 A;  1TF9 A;  2FXF A;  2REF A;  4UIB A;  5J8F A;  5LRK A;  2V8V A;  2PVW A;  1XMB A;  4P4I A;  2CXA A;  3T9Y A;  3B3T A;  2JLM A;  4KOT A;  4DJL A;  2KCW A;  4A39 A;  1JWQ A;  2I3C A;  2ODF A;  4OC1 A;  4KSF A;  2ATR A;  2ZOG A;  5HH1 A;  1HEE A;  2Q7B A;  3GY9 A;  1XIX A;  3D7G A;  3IU1 A;  4GM5 A;  1M4D A;  4DNC A;  3WC6 A;  1S7L A;  3PB8 X;  4AVA A;  5HXD A;  2C6C A;  4ZX9 A;  3PFO A;  3GKR A;  4JZ0 A;  5LRG A;  4A30 A;  4DUK A;  4ZI6 A;  4B12 A;  3R1K A;  2FT0 A;  4F8Z A;  3G3S A;  3PFE A;  1ELL P;  3TC8 A;  1XFO A;  3S9N A;  2WPX A;  3H8F A;  3V7Z A;  4QBJ A;  1ARL A;  7CPA A;  4YU9 A;  3S6K A;  4RI1 A;  2Q4Z A;  4ZY2 A;  1CP6 A;  2Y0M A;  4KSA A;  4GS4 A;  4NF1 A;  4PXE A;  4B14 A;  4H89 A;  1Z8W A;  3K9T A;  3EY5 A;  4UFW A;  1JQG A;  3MRU A;  4X8I A;  4CGP A;  2EWB A;  1NE9 A;  1Z9U A;  3JRU A;  4MHD A;  5ELY A;  2Z3P A;  4BD9 A;  4KSI A;  4KLW A;  1CBX A;  4EFD A;  4JXR A;  4PSW A;  2PIY A;  2C27 A;  2F7V A;  3PBE A;  4UCP A;  3I3G A;  2GRE A;  4YRH A;  2ZW5 A;  3TT2 A;  2PR1 A;  2C6P A;  4BIN A;  1ZG7 A;  3IU2 A;  2VBQ A;  5J1Q A;  3KR5 A;  2QIR A;  4UFX A;  5IB0 A;  2GLJ A;  3B8G A;  2Q0Y A;  1VHO A;  4MJ8 A;  4RS2 A;  5HVH A;  1TKH A;  2VL1 A;  3KGQ A;  3R9F A;  4KS9 A;  3B2Y A;  4F0Y A;  1CP7 A;  1F2P A;  2B58 A;  5I0C A;  3DDD A;  1R57 A;  4YWY A;  2WUU A;  4MCP A;  2GU2 A;  1TKJ A;  4NJR A;  4IF5 A;  1QQ9 A;  4J3G A;  2F8H A;  3K2K A;  2P6F A;  1XE4 A;  3B3V A;  3D2M A;  4KOS A;  2I79 A;  3WC5 A;  4ZY1 A;  2EVN A;  4IK2 A;  4CGN A;  1AYE A;  2V8D A;  3FX6 A;  2BL1 A;  3DR8 A;  2Z0Z A;  2AFZ A;  2AFW A;  1Z8X A;  3QNV A;  2EO8 A;  4MFJ A;  2AFO A;  3FBU A;  2BUE A;  2FIW A;  4IHM A;  4FAI A;  5CNP A;  4R87 A;  1YRE A;  1QSN A;  2OU2 A;  2Z3O A;  3PP9 A;  4E8O A;  5F09 A;  3IO1 A;  3RNZ A;  1ZG8 A;  1I21 A;  4LUA A;  5F46 A;  2JBJ A;  5G21 A;  1LRZ A;  4A37 A;  4NCZ A;  3W91 A;  5KTD A;  1IIC A;  2C1C A;  1PU9 A;  1S60 A;  3FJU A;  4P4B A;  5IX3 A;  3KQX A;  5H84 A;  5HMN A;  2OB0 A;  4CGO A;  5JPH A;  3NA6 A;  4E2A A;  3DGV A;  4UEE A;  3CXQ A;  3EO4 A;  3RYO A;  5AG6 A;  5HVF A;  4HNX B;  2HV2 A;  3LWU A;  4ZX8 A;  3PGP A;  1P4N A;  4F0X A;  4TWE A;  1S7F A;  3UY5 A;  3PZJ A;  2OH1 A;  1I1D A;  1Z4E A;  3B3C A;  2QJ8 A;  4WJB A;  3TCV A;  5C82 A;  4XPD C;  3PB4 X;  4UCN A;  3BLN A;  1QST A;  1XBU A;  1I12 A;  1IGB A;  4C2Y A;  4KUA A;  4CYQ A;  3S9M A;  1Q7L A;  4CYN A;  5AG5 A;  1IOI A;  3H4Q A;  3MN8 A;  3B3S A;  5LYD A;  3IWG A;  2RFH A;  3S6F A;  3PB6 X;  1CM0 A;  2Z3L A;  3KI9 A;  4UEF A;  2VZZ A;  3FED A;  3D66 A;  3LAC A;  5ISV A;  1MJA A;  1MJ9 A;  2PIZ A;  4WWV A;  3HUV A;  4KUB A;  1OZP A;  3D67 A;  4QC6 A;  2ZEE A;  3T90 A;  2OZG A;  3NH8 A;  2P6G A;  1M1D A;  3TO6 A;  3JUW A;  4RUH A;  1QSR A;  4KOY A;  2X7B A;  1YSJ A;  3PEI A;  5DS0 A;  4A2Z A;  4C2Z A;  2PR8 A;  4A94 A;  4OC2 A;  2PJ2 A;  4JWP A;  3FB3 A;  1ARM A;  1LAM A;  2ZEF A;  4R9M A;  4CRZ B;  2V8G A;  4MFP A;  3GIU A;  2Z3K A;  4OC5 A;  2WZN A;  4EWT A;  1M44 A;  2PJ8 A;  3BJ7 A;  4H2K A;  5EC4 A;  1UFH A;  1ZG9 A;  3IIB A;  4PV6 A;  4NGQ A;  3VAR A;  1Z5R A;  2WYR A;  1CPX A;  3ISX A;  1BPM A;  2ZEL A;  3IGR A;  2VXK A;  4MI4 A;  4F6A A;  2BO9 A;  3CZX A;  5F49 A;  4IAV A;  2FIA A;  3NFZ A;  4NGS A;  2Z3N A;  1CPS A;  1RXT A;  4F9U A;  2PDO A;  2VEZ A;  3S9L A;  3DNS A;  2RC4 A;  5K8N A;  3B7I A;  4M6I A;  1TIQ A;  2K5T A;  3D2P A;  3IFE A;  5EMI A;  4AG9 A;  1ZO0 A;  3NH4 A;  4MXU A;  4OP4 A;  5LYI A;  1LAN A;  1NMT A;  3GUX A;  4R8F A;  1M4G A;  2HUZ A;  4EVY A;  5G20 A;  3KL9 A;  4MMO A;  3NE8 A;  3I9S A;  4AXV A;  4XPL A;  1VHE A;  1AMP A;  4W9Y A;  1S7K A;  3SJF A;  2EUI A;  3P2F A;  3TFY A;  2J8N A;  3H5Z A;  3DR6 A;  4KVO E;  1LCP A;  2DEA A;  1B87 A;  4NFR A;  3V38 A;  3I1U A;  4FUU A;  2IQ6 A;  4PQA A;  3CPA A;  3VWD A;  4CGL A;  3G8W A;  1IYK A;  4MFQ A;  1WK4 A;  1IY7 A;  3RAM A;  3WT4 A;  3IEH A;  1M4I A;  4Q38 A;  3RBU A;  4CYP A;  4FD5 A;  4MHZ A;  4PXB A;  3HLP A;  5A28 A;  3JVN A;  1VHS A;  4B10 A;  1V0C A;  1X12 A;  1ELM P;  4MHP A;  3QB8 A;  5J8C A;  1KUV A;  4PK3 A;  1P0H A;  3FEC A;  4NJQ A;  4MBU A;  4ONU A;  3EFA A;  4YFJ A;  4NXY A;  1EE3 P;  4UCM A;  2AE6 A;  1DTD A;  2DPS A;  4B11 A;  4CAE A;  3RO0 A;  4KOU A;  1YK3 A;  5JQ4 A;  2PJ1 A;  2PJ6 A;  5D29 A;  3B3W A;  1YGH A;  1YLO A;  1VKC A;  1XRY A;  4OAD A;  1Z8T A;  3V8I A;  2ABZ A;  4C68 A;  2QEC A;  2WSA A;  2IJZ A;  4BBH A;  2C6G A;  4FBE A;  3KAS A;  3SJX A;  2B5G A;  2R1I A;  3CT9 A;  3SHP A;  4A95 A;  2YGW A;  1TF8 A;  2FS5 A;  2P0W A;  4B6Z A;  2ZW7 A;  3F8K A;  5DWN A;  3S6H A;  1CX8 A;  3SI2 A;  1S3Z A;  1TKF A;  2O28 A;  2QYV A;  2OR4 A;  3MGD A;  4K30 A;  5JH9 A;  1PCA A;  2FE7 A;  3GYA A;  1YLE A;  2BCO A;  2D4P A;  2G9D A;  2DF5 A;  1FT7 A;  2FCK A;  2ZED A;  3D68 A;  3PB7 X;  1Q2Y A;  4M3S A;  3WC7 A;  1Y0R A;  2CY2 A;  4M85 A;  1Y7E A;  3RZA A;  1LOK A;  2F5I A;  4FWU A;  2OZH A;  3N5F A;  3R9E A;  4YGO A;  1YW4 A;  4NGM A;  4OKO A;  3LD2 A;  2Q44 A;  2DPT A;  1U6M A;  3FF3 A;  2DXQ A;  4KOX A;  2Q4Y A;  2AFS A;  2ZEN A;  3FYN A;  3TOB A;  4UA3 A;  1NSA A;  2VI7 A;  3GLJ A;  3ISZ A;  3DLJ A;  3PB9 X;  1QSM A;  2QVP A;  3WAB A;  3IWW A;  2EK9 A;  2ZEH A;  1Q2D A;  1MK4 A;  4H6Z A;  5F47 A;  2PJB A;  1X10 A;  2ZEP A;  1Y0Y A;  3CXS A;  3SI1 A;  3LMS A;  2JEW A;  1KZF A;  2GLF A;  2D4O A;  4MCQ A;  4NGN A;  4A38 A;  2QML A;  2PJ0 A;  4KOV A;  1ON0 A;  4KZT A;  3TOA A;  4PXD A;  4NSQ A;  4RN7 A;  3ZZI A;  4KVM E;  3FXT A;  1YME A;  3A9L A;  3CDX A;  3LOD A;  1IID A;  5EBV A;  1L0C A;  2ANP A;  4G1P A;  2Q43 A;  4R7M A;  2B5G B;  3D7F A;  1BLL E;  2AJ6 A;  4HPS A;  4CAX A;  1YQE A;  1AUG A;  2IMO A;  1QSO A;  3IWE A;  4R3K A;  4AVB A;  5LYL A;  2XEJ A;  5AG7 A;  3H8G A;  4XNH B;  5G1Z A;  4OID A;  3EXN A;  2ZXV A;  2VZY A;  4Y49 B;  2R8V A;  4JXQ A;  4PK2 A;  2CNM A;  4I49 A;  1J4J A;  1OBR A;  1Z2L A;  4OC3 A;  4CAF A;  3F0A A;  2GAN A;  4P4J A;  4O23 A;  4P4E A;  5C88 A;  8CPA A;  1XMT A;  3FNC A;  3D7D A;  3ZJ0 A;  5CPA A;  2J9A A;  4AG7 A;  2NMT A;  4A33 A;  2YNE A;  3QAY A;  1SQH A;  4MRI A;  4CGM A;  3F5B A;  1XF8 A;  2EK8 A;  3W6X A;  3BHX A;  1H8L A;  4NEX A;  2JBK A;  4KOW A;  5LRJ A;  2AFX A;  4AB7 A;  3KHZ A;  4FD6 A;  4LQ6 A;  1IB1 E;  2J8M A;  5LYF A;  1DE4 C;  1KWM A;  4HKF A;  1GYT A;  1Y9K A;  4OC4 A;  2Q4V A;  2RB7 A;  4MY3 A;  4MHN A;  2VQY A;  2GIV A;  2I00 A;  2YNC A;  2O53 A;  3N7Z A;  1YVK A;  2FSR A;  2O4H A;  1M4L A;  5D8N A;  1XOV A;  2GE3 A;  2Z11 A;  2CF4 A;  1Y9W A;  2G3A A;  2B3U A;  2XEI A;  4X3R A;  5H86 A;  3VWE A;  2CIJ A;  4XPK A;  2H5M A;  2JEV A;  1MJB A;  2JDD A;  2PE3 A;  4X5K A;  1F57 A;  2XEG A;  4UF4 A;  3BI0 A;  2PJ3 A;  1K4J A;  1YW6 A;  2G3T A;  3SJG A;  4BMH A;  4CAV A;  2JDC A;  4QUS A;  1FY7 A;  3JTK A;  4R57 A;  4OAE A;  3FIX A;  4UBR A;  2V77 A;  4B13 A;  6CPA A;  3OWC A;  4JJX A;  1XJO A;  3SXO A;  4UEZ A;  3KHX A;  2Q04 A;  4OME A;  1N71 A;  1R3N A;  2PVV A;  4E0A A;  4MFZ A;  2IL4 A;  4ORF A;  4Q7A A;  4HNW B;  2CNS A;  3IJ3 A;  5BWA B;  3BXM A;  3KR4 A;  5KTA A;  1Z8L A;  5E96 A;  2ZW4 A;  1TXR A;  4CYO A;  4C7I A;  3TO9 A;  1BOB A;  2PJ7 A;  2ARH A;  3FH4 A;  4P45 A;  3R9G A;  1VGY A;  1PUA A;  4QB9 A; 
#chains in the Genus database with same CATH homology
 2B4D A;  3P2H A;  4HNY B;  4B5P A;  3FRM A;  3W6S A;  1S5K A;  5KTC A;  2PC1 A;  1XEB A;  3KKW A;  2B3V A;  2P6E A;  4UWJ A;  1Z4R A;  5F48 A;  4Q36 A;  4FD7 A;  3E0K A;  4FD4 A;  4R3L A;  2YNC C;  3D8P A;  3TTH A;  5A27 A;  4UFV A;  4ZGY B;  2WPW A;  1B6B A;  1YX0 A;  2OZU A;  3CXP A;  4U5Y A;  4AVC A;  3BJ8 A;  5AG4 A;  3NE7 A;  4CS0 B;  4CAW A;  2ZPA A;  2G0B A;  3QAH A;  2J8R A;  4JLY A;  3SXN A;  1Q2C A;  4OLL A;  2B4D B;  2PQ8 A;  3TO7 A;  5G22 A;  1KUY A;  4II9 A;  4B5P B;  2ZW6 A;  2YND A;  4U9Z A;  3DSB A;  4MFL A;  1NSL A;  4XPD B;  1RO5 A;  4IUS A;  4U9Y A;  4KLV A;  1GHE A;  3S6G A;  4QVT A;  2R98 A;  1KUX A;  2PSW A;  2CNT A;  2REE A;  3R96 A;  4A31 A;  2B4B A;  4L89 A;  1BO4 A;  5DWM A;  3R95 A;  2Z10 A;  4MY0 A;  2PRB A;  4H6U A;  5GCN A;  4LX9 A;  4ZBG A;  2Z3M A;  4A32 A;  1YR0 A;  2HQY A;  3K9U A;  3TE4 A;  4MFK A;  3D3S A;  4KOR A;  1YVO A;  2FL4 A;  4PSX A;  5FVJ A;  1IYL A;  4B5O A;  2BEI A;  4JD6 A;  1Y7R A;  5IV0 A;  4C2X A;  4CRY B;  2R7H A;  4KVX A;  4UWI A;  2BSW A;  4L8A A;  4XNH C;  3EC4 A;  4Y49 C;  1WWZ A;  5AGE A;  3WR7 A;  3C26 A;  4C7H A;  1S7N A;  1CJW A;  2A4N A;  2FXF A;  2REF A;  5J8F A;  2CXA A;  3T9Y A;  2JLM A;  4KOT A;  2KCW A;  4KSF A;  2ATR A;  5HH1 A;  2Q7B A;  3GY9 A;  1XIX A;  3IU1 A;  1M4D A;  4DNC A;  1S7L A;  4AVA A;  3GKR A;  4A30 A;  4B12 A;  3R1K A;  2FT0 A;  3G3S A;  2WPX A;  4QBJ A;  3S6K A;  4RI1 A;  2Y0M A;  4KSA A;  4GS4 A;  4NF1 A;  4B14 A;  4H89 A;  3EY5 A;  4UFW A;  4CGP A;  1NE9 A;  1Z9U A;  4MHD A;  2Z3P A;  4KLW A;  4JXR A;  4PSW A;  2C27 A;  4UCP A;  3I3G A;  4YRH A;  2ZW5 A;  3TT2 A;  2PR1 A;  3IU2 A;  2VBQ A;  2QIR A;  4UFX A;  5IB0 A;  3B8G A;  2Q0Y A;  4RS2 A;  4MJ8 A;  3R9F A;  4KS9 A;  4F0Y A;  2B58 A;  5I0C A;  3DDD A;  1R57 A;  2WUU A;  4IF5 A;  4J3G A;  2P6F A;  1XE4 A;  3D2M A;  4KOS A;  2I79 A;  2EVN A;  4CGN A;  2BL1 A;  3DR8 A;  2Z0Z A;  4MFJ A;  3FBU A;  2BUE A;  2FIW A;  5CNP A;  4R87 A;  1YRE A;  1QSN A;  2OU2 A;  2Z3O A;  3PP9 A;  4E8O A;  1I21 A;  4LUA A;  5F46 A;  5G21 A;  1LRZ A;  4NCZ A;  3W91 A;  5KTD A;  1IIC A;  1PU9 A;  1S60 A;  5IX3 A;  5H84 A;  5HMN A;  2OB0 A;  4CGO A;  5JPH A;  4E2A A;  3CXQ A;  3EO4 A;  3RYO A;  5AG6 A;  4HNX B;  2HV2 A;  3PGP A;  1P4N A;  4F0X A;  3UY5 A;  1S7F A;  3PZJ A;  2OH1 A;  1I1D A;  1Z4E A;  3TCV A;  5C82 A;  4XPD C;  4UCN A;  3BLN A;  1QST A;  1I12 A;  4CYQ A;  4C2Y A;  4KUA A;  4CYN A;  5AG5 A;  3H4Q A;  3S6F A;  3IWG A;  1CM0 A;  2Z3L A;  2VZZ A;  5ISV A;  1MJA A;  1MJ9 A;  4KUB A;  1OZP A;  4QC6 A;  3T90 A;  2OZG A;  2P6G A;  1M1D A;  3TO6 A;  3JUW A;  1QSR A;  4KOY A;  2X7B A;  4A2Z A;  4C2Z A;  2PR8 A;  4JWP A;  3FB3 A;  4R9M A;  4CRZ B;  4MFP A;  2Z3K A;  1M44 A;  3BJ7 A;  5EC4 A;  1UFH A;  4PV6 A;  4F6A A;  3IGR A;  4MI4 A;  2VXK A;  5F49 A;  2FIA A;  2Z3N A;  1RXT A;  2PDO A;  2VEZ A;  3DNS A;  2RC4 A;  1TIQ A;  2K5T A;  3D2P A;  4AG9 A;  1ZO0 A;  1NMT A;  1M4G A;  2HUZ A;  4EVY A;  5G20 A;  3I9S A;  4XPL A;  1S7K A;  2EUI A;  3P2F A;  3TFY A;  2J8N A;  3H5Z A;  3DR6 A;  4KVO E;  1B87 A;  4CGL A;  3VWD A;  3G8W A;  1IYK A;  4MFQ A;  1WK4 A;  4CYP A;  1M4I A;  4Q38 A;  4FD5 A;  5A28 A;  3JVN A;  1VHS A;  4B10 A;  1V0C A;  5J8C A;  3QB8 A;  1KUV A;  4PK3 A;  1P0H A;  4MBU A;  4ONU A;  3EFA A;  4YFJ A;  4NXY A;  4UCM A;  2AE6 A;  2DPS A;  4B11 A;  4CAE A;  4KOU A;  1YK3 A;  5JQ4 A;  1YGH A;  1VKC A;  4OAD A;  3V8I A;  4C68 A;  2QEC A;  2WSA A;  4BBH A;  2B5G A;  2R1I A;  3SHP A;  2YGW A;  2FS5 A;  2P0W A;  2ZW7 A;  3F8K A;  5DWN A;  3S6H A;  1S3Z A;  2O28 A;  4K30 A;  3MGD A;  2FE7 A;  3GYA A;  1YLE A;  2D4P A;  2FCK A;  1Q2Y A;  4M3S A;  2CY2 A;  4M85 A;  2F5I A;  3R9E A;  2OZH A;  4YGO A;  3LD2 A;  2Q44 A;  2DPT A;  1U6M A;  2DXQ A;  4KOX A;  2Q4Y A;  3FYN A;  3TOB A;  4UA3 A;  2VI7 A;  1QSM A;  1Q2D A;  1MK4 A;  4H6Z A;  5F47 A;  3CXS A;  1KZF A;  2D4O A;  2QML A;  4KOV A;  1ON0 A;  4KZT A;  3TOA A;  3ZZI A;  4NSQ A;  4KVM E;  3FXT A;  3A9L A;  3LOD A;  1IID A;  5EBV A;  1L0C A;  2B5G B;  2AJ6 A;  4CAX A;  4R3K A;  1QSO A;  3IWE A;  4AVB A;  5AG7 A;  4XNH B;  5G1Z A;  3EXN A;  2ZXV A;  2VZY A;  4Y49 B;  2R8V A;  4JXQ A;  4PK2 A;  2CNM A;  4I49 A;  1J4J A;  4CAF A;  3F0A A;  2GAN A;  5C88 A;  1XMT A;  3FNC A;  3ZJ0 A;  4AG7 A;  2NMT A;  4A33 A;  2YNE A;  1SQH A;  4CGM A;  3F5B A;  1XF8 A;  3W6X A;  4NEX A;  4KOW A;  4AB7 A;  4FD6 A;  1IB1 E;  2J8M A;  4HKF A;  1Y9K A;  2Q4V A;  4MY3 A;  2VQY A;  2GIV A;  2I00 A;  2YNC A;  3N7Z A;  1YVK A;  2FSR A;  2GE3 A;  2Z11 A;  5H86 A;  1Y9W A;  2G3A A;  2B3U A;  3VWE A;  4A95 A;  4XPK A;  2H5M A;  2JEV A;  1MJB A;  2JDD A;  4X5K A;  1K4J A;  2G3T A;  4BMH A;  4CAV A;  2JDC A;  4QUS A;  1FY7 A;  3JTK A;  4R57 A;  4OAE A;  3FIX A;  4UBR A;  4B13 A;  3OWC A;  4JJX A;  3SXO A;  2Q04 A;  1N71 A;  4E0A A;  4MFZ A;  2IL4 A;  4ORF A;  4HNW B;  2CNS A;  5BWA B;  5KTA A;  5E96 A;  2ZW4 A;  4CYO A;  4C7I A;  3TO9 A;  1BOB A;  3R9G A;  2ARH A;  1PUA A;  4QB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...