2Q04A

Crystal structure of acetoin utilization protein (zp_00540088.1) from exiguobacterium sibiricum 255-15 at 2.33 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
GMFEKQFNHRTLETSLGPVEIEGPVTSQILATYKLDPGLTAFRQPAEQHEALVEIAALEEGRIIIARQGNDIIGYVTFLYPDPYETWSEGNNPYILELGAIEVAARFRGQQIGKKLLEVSMLDPAMEHYLILTTEYYWHWDLKGSGLSVWDYRKIMEKMMNHGGLVFFPTDDPEIASHPANCLMARIGKHVAPEVVAHFDALRLRRRFMYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetoin utilization protein
publication title Crystal structure of acetoin utilization protein (ZP_00540088.1) from Exiguobacterium sibiricum 255-15 at 2.33 A resolution
rcsb
source organism Exiguobacterium sibiricum
molecule tags Transferase
total genus 59
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q04A00
4U9YA 2B58A 2BSWA 2R8VA 4CRYB 2BEIA 5C82A 4AG7A 2P6FA 2B3UA 1KUYA 3IGRA 4OLLA 3KKWA 4OADA 1VHSA 1XEBA 1KUXA 4KOXA 4II9A 3W6XA 2O28A 2Q0YA 2VI7A 3F5BA 3R9FA 1WWZA 2J8NA 4NXYA 3D2MA 3K9UA 3QAHA 1MJAA 3GYAA 2P0WA 3TFYA 1S7KA 4KOVA 2ZW4A 5H86A 4PSXA 3FB3A 1MJ9A 4ORFA 3G3SA 4PV6A 3FRMA 2FT0A 4KVXA 4E2AA 1K4JA 5ISVA 4B5PB 4GS4A 3T9YA 1S60A 2D4OA 1QSMA 4PK2A 3VWDA 5IB0A 4KLWA 2P6GA 2Y0MA 2PQ8A 4UA3A 2HUZA 4RI1A 3TTHA 1VKCA 4CRZB 4AVCA 4JXRA 4B5OA 2Z11A 1NMTA 2FSRA 3DNSA 4KUBA 3MGDA 2ARHA 2OH1A 1QSRA 4NF1A 4KOYA 3W91A 5J8FA 2B4DA 4ZBGA 4NCZA 3CXSA 3D3SA 5CNPA 4HKFA 1YVOA 3LODA 1ON0A 4UWJA 5HH1A 3E0KA 3NE7A 3TOAA 1I1DA 1RO5A 5J8CA 1MJBA 4CAXA 3S6KA 4QB9A 2Z10A 4R57A 5EBVA 4M3SA 3LD2A 1M4DA 2Q04A 2X7BA 4HNYB 2FE7A 2VQYA 2F5IA 4J3GA 3R9GA 3R1KA 2NMTA 1MK4A 1P0HA 2BUEA 1PU9A 2J8MA 4R3KA 3CXQA 2K5TA 2IL4A 1Y9WA 3JVNA 1UFHA 2PR1A 4UWIA 3BLNA 3G8WA 2H5MA 2B5GB 3SHPA 3S6GA 3WR7A 3PZJA 4LUAA 2VXKA 2ZW5A 2RC4A 5F48A 3FIXA 2R1IA 3SXNA 3EC4A 1IYKA 3GKRA 2PRBA 2VEZA 1YGHA 3ZZIA 4KLVA 4XPLA 5FVJA 2JDDA 1XF8A 3D8PA 2B4DB 4JWPA 4R3LA 4NSQA 1TIQA 1R57A 1BO4A 1B6BA 1YVKA 3BJ8A 4RS2A 4AB7A 1XE4A 1S7NA 4U9ZA 2FIAA 1M1DA 3TE4A 2WPWA 4MHDA 2KCWA 4I49A 1Z4EA 2A4NA 5IV0A 1Q2DA 2JEVA 2D4PA 3S6FA 4MBUA 2G0BA 3H4QA 3I3GA 2HV2A 1CJWA 2C27A 4ONUA 1YLEA 1IICA 3TT2A 1P4NA 4X5KA 3OWCA 4IF5A 3V8IA 4H89A 4XPKA 3ZJ0A 1QSTA 4F6AA 2OB0A 1I21A 2OZGA 2ATRA 2OU2A 2I79A 5H84A 2ZW6A 1WK4A 1NSLA 2DXQA 2HQYA 3DSBA 4F0YA 2JLMA 2CNMA 2CNTA 4JJXA 4CAWA 3QB8A 4YRHA 4KOWA 4M85A 2Q4VA 4BMHA 3TO6A 4XNHC 3EY5A 1S7FA 2GE3A 4EVYA 2QMLA 3UY5A 3PGPA 4FD6A 5C88A 2EVNA 1OZPA 3F0AA 2FL4A 3I9SA 1YX0A 4QC6A 1B87A 4XPDC 4MY3A 1S7LA 1I12A 1J4JA 4PK3A 2Q4YA 4FD7A 5GCNA 4YFJA 4KOUA 2GANA 1L0CA 4UBRA 2VZZA 4AVAA 5HMNA 2G3TA 4KOSA 2PR8A 4PSWA 1M4GA 4AG9A 1IIDA 2GIVA 4MJ8A 2FS5A 1KZFA 4R87A 3C26A 4MI4A 4QUSA 4H6UA 1U6MA 3TO7A 4KVME 2VZYA 2FXFA 4KOTA 4AVBA 3TCVA 1QSNA 2QIRA 4DNCA 1Y7RA 2R98A 4B5PA 4E0AA 3B8GA 4LX9A 4XNHB 3F8KA 1Z9UA 1CM0A 3JUWA 1V0CA 1YR0A 2CNSA 3D2PA 3CXPA 1FY7A 4XPDB 1BOBA 2CY2A 4Y49C 1Q2YA 2J8RA 2Q7BA 5IX3A 1YREA 2B4BA 3P2HA 2QECA 3DR8A 3FNCA 2BL1A 3FXTA 4MY0A 2ZXVA 1LRZA 4NEXA 2B3VA 1IYLA 2PC1A 2REEA 4QBJA 4L8AA 2Z0ZA 4HNXB 1M4IA 1S3ZA 5DWNA 4YGOA 4K30A 1XIXA 2P6EA 3TO9A 4JXQA 4HNWB 2ZW7A 3SXOA 2FIWA 4CS0B 2VBQA 1YK3A 3VWEA 1NE9A 3EO4A 5F49A 4E8OA 3P2FA 5E96A 3EXNA 1SQHA 2JDCA 4FD5A 4H6ZA 2B5GA 2OZUA 3PP9A 2ZPAA 4Y49B 4KZTA 4L89A 3DDDA 2G3AA 5F46A 5JQ4A 3T90A 1XMTA 2AJ6A 3R9EA 5KTDA 5DWMA 3GY9A 5I0CA 1GHEA 2EUIA 3TOBA 1Y9KA 5F47A 2REFA 4QVTA 2OZHA 5KTCA 3BJ7A 1Z4RA 4IUSA 4JLYA 4KORA 2FCKA 1M44A 3FBUA 5KTAA 3R95A 2PDOA 1QSOA 3RYOA 3DR6A 3R96A 1PUAA 2WPXA 4KUAA 5JPHA 3FYNA 2Q44A 4JD6A 1KUVA 4FD4A 1N71A 2I00A 4KVOE 4U5YA 2PSWA 4CAVA 3EFAA 5EC4A 1Q2CA 3IWGA 3W6SA 1IB1E 3S6HA 3N7ZA 1S5KA 2R7HA 4R9MA 4OAEA 1RXTA 2AE6A
chains in the Genus database with same CATH superfamily
1RTQA 2PJ2A 2AFSA 3KQXA 2ODFA 4U9YA 3D67A 1CPXA 1R3NA 4B11A 4CYNA 2B58A 2BSWA 2R8VA 4TNUA 4CRYB 3D68A 2BEIA 5C82A 1ZG8A 2P6FA 4AG7A 4MCRA 2B3UA 4NJQA 1KUYA 3TX8A 4M6HA 3IGRA 4OLLA 2IJZA 3IC1A 3FMCA 3KKWA 1XMBA 4OADA 2DPTA 4UFXA 1VHSA 1XEBA 1KUXA 1Q7LA 2IMOA 4KOXA 4CYPA 4II9A 2GU2A 4F9UA 3W6XA 1YMEA 2O28A 5LYFA 4MHZA 5K8NA 2PE3A 2Q0YA 2VI7A 3F5BA 4F8ZA 3ISZA 3R9FA 4WWVA 4OC5A 1WWZA 2J8NA 5JH9A 1PYTB 1CG2A 1F2OA 4NXYA 3D2MA 3K9UA 3JRUA 4MFQA 3QAHA 4ZY2A 1MJAA 1F57A 3GYAA 5JGFA 4BINA 3B7IA 2G9DA 4MHPA 4RN7A 2P0WA 3TFYA 1S7KA 2XEGA 4FUUA 4KOVA 2ZW4A 5H86A 1ELMP 2PJ5A 4LQ6A 2CTBA 1MJ9A 3FB3A 3G3SA 4ORFA 3FRMA 4PSXA 2AFUA 2FT0A 1VIXA 2NSMA 2ZELA 4KVXA 4PXCA 3WC5A 1K4JA 3PEIA 4E2AA 5ISVA 3IU1A 4B5PB 2XEIA 4GS4A 4Q7AA 3T9YA 4CYOA 1VHEA 1S60A 4NGNA 2D4OA 1QSMA 3RO0A 4C2ZA 4PPZA 4UEZA 2NYQA 4GM5A 4PK2A 5D29A 3VWDA 5IB0A 4KLWA 2DF5A 3S9MA 2P6GA 2Y0MA 2PQ8A 4UA3A 2EWBA 2HUZA 2JBJA 3B35A 4RI1A 5LRGA 1IU8A 3TTHA 1PCAA 4NGMA 1VKCA 4P4DA 4PXEA 4CRZB 4AVCA 3NH4A 1JQGA 4B6ZA 3CPXA 3H5ZA 3NH5A 4JXRA 2Z11A 1NMTA 4B5OA 2QJ8A 2FSRA 3DNSA 4KUBA 3N5FA 3KHXA 4A31A 2AFWA 4ZYQA 3MGDA 2ARHA 2OH1A 1QSRA 4NF1A 4KOYA 1A2ZA 2Z3OA 3W91A 3WC7A 5AG4A 2QYVA 4C2YA 6CPAA 5J8FA 2B4DA 4ZBGA 4NCZA 3CXSA 3TC8A 3D3SA 4NGTA 5CNPA 4HKFA 3V7ZA 1YVOA 1YLOA 3VATA 3LODA 1ON0A 4UWJA 1HDQA 4CAFA 1OBRA 5HH1A 2ZEEA 3NE8A 3E0KA 3NE7A 4KS9A 4MCQA 5AG6A 3TOAA 1I1DA 1RO5A 2RFHA 5J8CA 4Z65A 1MJBA 2Z3PA 4CAXA 5K8PA 3S6KA 1YW4A 4QB9A 2Z10A 5A28A 5AG5A 4R57A 5EBVA 3IIBA 1UWYA 3LD2A 4M3SA 3LMSA 3PRTA 4YU9A 4A94A 1M4DA 2Q04A 2X7BA 4HNYB 2ZEHA 2FE7A 3IWEA 2VQYA 4FBEA 2F5IA 8CPAA 4J3GA 1Y7EA 3IEHA 7CPAA 2VL1A 3R9GA 2Z3MA 2PJ1A 2C6PA 3R1KA 1LANA 2NMTA 3D7GA 5K8OA 1MK4A 4EMEA 1P0HA 4B12A 1LAMA 2BUEA 2OR4A 2V8VA 1PU9A 2J8MA 3B3SA 4R3KA 3CXQA 4CPAA 3FX6A 2K5TA 2IL4A 2Q43A 1Y9WA 3JVNA 1X12A 2JBKA 2YNCC 1UFHA 4RUHA 2PR1A 4MRIA 5THWA 1AMPA 4UWIA 3BLNA 3G8WA 2H5MA 2B5GB 3SHPA 4G1PA 1XFOA 2ZOGA 3V38A 1ELLP 1Z8XA 3S6GA 3IU2A 3BHXA 3PZJA 3FF3A 3WR7A 5JM6A 3KR5A 4LUAA 4B13A 2VXKA 4P6YA 3BI0A 4IK2A 2ZEGA 3B2YA 3FECA 2ZW5A 4R6TA 3SI2A 2RC4A 2PJ6A 5F48A 2EK9A 3FIXA 2R1IA 3SXNA 3EC4A 1IYKA 1FT7A 3GKRA 2PRBA 2VEZA 2ZEDA 1YGHA 4NGSA 4KLVA 4XPLA 5FVJA 3VARA 2JDDA 1XF8A 3ZZIA 3D8PA 4ZY0A 2B4DB 4JWPA 4R3LA 1YW6A 2BO9A 4NSQA 1TIQA 1R57A 1BO4A 1B6BA 2FVGA 3FEEA 2GLJA 4IHMA 4R8FA 4UCNA 5CBMA 5K8MA 1YVKA 2PJCA 3BJ8A 5HVGA 4RS2A 4AB7A 1Y0YA 1XE4A 1IY7A 1S7NA 4OC0A 4U9ZA 5HVFA 4UEFA 2FIAA 5DS0A 3A9LA 3S9LA 1M1DA 4B14A 3TE4A 3D7FA 3B3VA 1TF8A 2WPWA 2BCOA 4MHDA 2XEJA 3LWUA 3PBBA 2KCWA 1ARMA 4I49A 1Z4EA 2A4NA 5IV0A 1Q2DA 2JEVA 2Z3LA 2D4PA 4O23A 4NGRA 2JEWA 3MN8A 3S6FA 4MBUA 2PJ8A 2G0BA 4A38A 1BPNA 1LFWA 3VH9A 3H4QA 3I3GA 3K2KA 1JWQA 1ZO0A 2HV2A 2GREA 3QNVA 2ABZA 1CJWA 2C27A 4ONUA 1YLEA 1IICA 4P4EA 3TT2A 4OC2A 4UF4A 1ZLHA 1P4NA 4X5KA 3OWCA 4IF5A 4MFJA 4P4JA 5EMIA 3RBUA 4H89A 4NJRA 3V8IA 2Z3KA 4XPKA 3SI0A 3ZJ0A 2RB7A 4A32A 4C7IA 3L2NA 1QSTA 3S9NA 4F6AA 4ZY1A 4DYOA 2YGWA 4MCSA 4OMEA 2OB0A 1I21A 2C1CA 4X2TA 2OZGA 4OC1A 5F09A 5LYDA 1ARLA 2ATRA 2EBJA 3B3WA 2OU2A 3K9TA 2I79A 4CGMA 4OP4A 5H84A 4FAIA 2ZW6A 1WK4A 1NSLA 4R76A 2DXQA 2HQYA 3DSBA 4MFZA 4F0YA 2JLMA 4CAEA 2CNMA 2CNTA 2YNDA 4DUKA 4F9VA 3SJEA 1YSJA 4JJXA 4CAWA 2AFOA 5AG7A 3QB8A 4YRHA 4B10A 4KOWA 4M85A 2Q4VA 3HUVA 3MRUA 4BMHA 3TO6A 4MHNA 2V8GA 4ONWA 3EY5A 2PJ4A 4XNHC 3JTKA 1S7FA 4C7HA 2AFZA 2GE3A 1IOFA 2ZEMA 3D4UA 4EVYA 2V8DA 2QMLA 3UY5A 4YWYA 1HEEA 3SJXA 3PGPA 4FD6A 5D8NA 5C88A 2GFQA 2EVNA 1OZPA 4R7MA 3F0AA 2FL4A 4ZGYB 4MFKA 2AFXA 2C6CA 1HDUA 4OC4A 4ZX8A 3I9SA 4A95A 5A27A 1YX0A 4QC6A 1B87A 4XPDC 5G21A 4UFWA 1BPMA 4KSAA 1VHOA 4MFPA 2DEAA 4MY3A 1TXRA 1S7LA 1I12A 2PIYA 3SJGA 3CT9A 3KASA 2EO8A 1J4JA 4PK3A 2Q4YA 4FD7A 4UCMA 1IOIA 5GCNA 4X3RA 2V77A 4YFJA 4ZI6A 3D66A 3FH4A 4KOUA 4M6GA 2GANA 3KZWA 2ZEOA 1L0CA 4F0XA 4K3NA 2Q51A 2PJAA 4OIDA 2ZENA 4UBRA 2ANPA 2XEFA 4PV6A 5ELYA 2VZZA 4AVAA 4FWUA 5LYIA 3KHZA 2G3TA 5HMNA 4KOSA 2PR8A 4AXVA 4PSWA 3GB0A 4UIAA 1M4GA 4AG9A 1IIDA 2GIVA 4MJ8A 2FS5A 4OIWA 4PXDA 1KZFA 1XOVA 4IAVA 3C26A 4MI4A 4R87A 4QUSA 2CXAA 4H6UA 1U6MA 4JZ0A 3TO7A 5LRKA 4KVME 2VZYA 3RZAA 4MHYA 2PJ7A 2FXFA 2PRQA 4KOTA 1AYEA 4AVBA 2HB6A 1QSNA 2QIRA 3TCVA 1LAPA 4DNCA 1FNOA 1Y7RA 2EK8A 2R98A 2PIZA 4B5PA 4E0AA 3FJUA 3ISXA 4BBHA 3B8GA 4LX9A 1CX8A 4XNHB 5J1QA 3F8KA 1Z9UA 1CM0A 3PB4X 4UFVA 3JUWA 1BAVA 1TKFA 3GUXA 4P4IA 1V0CA 3KR4A 2POKA 1YR0A 2AFMA 1F2PA 3PFEA 2CNSA 3DGVA 3SI1A 3D2PA 1CBXA 1R43A 2CF4A 3CXPA 1EE3P 1FY7A 2O4HA 1X10A 3PB9X 4XPDB 1BOBA 2CY2A 5LYLA 1IGBA 2O53A 1KWMA 4BD9A 1ZG7A 4GXHA 2PJ9A 4Y49C 3WC6A 4CGNA 1Q2YA 3BI1A 2IQ6A 2J8RA 2Q7BA 5IX3A 1YREA 4EWTA 1Z8TA 5HVHA 2B4BA 2DPSA 4P44A 2Z3NA 2GLFA 3CPAA 3IJ3A 2PJ0A 3P2HA 2QECA 3PB7X 4MXUA 4KSIA 3DR8A 3QAYA 4P4BA 3NH8A 4UEEA 4ZX9A 3FNCA 4C68A 2WUUA 4OC3A 2C6GA 2ZOFA 2BL1A 1TF9A 3FXTA 4A37A 1CP7A 4MY0A 3NFZA 2ZXVA 1LRZA 5G22A 2PVWA 3PFOA 4NEXA 5LRJA 4LQGA 2B3VA 3T8WA 4CYQA 1IYLA 1XBUA 2PC1A 2REEA 5CPAA 1H8LA 4MMOA 4QBJA 3IWWA 2Z0ZA 3PB8X 1NSAA 4HNXB 1M4IA 4L8AA 1S3ZA 1Y0RA 5DWNA 4YGOA 1ZG9A 3PBEA 4K30A 4DJLA 1Z8WA 4W9YA 2WSAA 1XIXA 2P6EA 3FEDA 5BWAB 3TO9A 3B3TA 4JXQA 3I1UA 4HNWB 3SJFA 4NGQA 4M6IA 2ZEPA 1VGYA 2ZW7A 3SXOA 2FIWA 4OKOA 4CS0B 4P45A 4JYWA 2VBQA 1YK3A 1AUGA 1CPSA 3VWEA 1NE9A 2Q7SA 1DTDA 3EO4A 4KSFA 1LOKA 5F49A 4E8OA 3P2FA 5E96A 2CTCA 3EXNA 1SQHA 2JDCA 2ZEFA 1TKHA 4FD5A 4H6ZA 4UCPA 2PVVA 2B5GA 3IO1A 3KGQA 2OZUA 1ZLIA 3HLPA 3PP9A 3WT4A 2ZPAA 2YNEA 4Y49B 1YQEA 5IB9A 4KZTA 4L89A 4TWEA 3RNZA 1BLLE 4UIBA 5G1ZA 4A33A 1QMUA 2G3AA 3DDDA 3KI9A 2HC9A 4Q38A 2WYRA 5F46A 5JQ4A 1LCPA 3T90A 1CP6A 1M4LA 1XMTA 2AJ6A 2PCUA 4P10A 4PXBA 3R9EA 1Z2LA 2F8HA 5KTDA 5DWMA 2QVPA 3GY9A 3IFEA 2Q4ZA 5I0CA 1GYTA 1XRYA 1GHEA 4PQAA 2EUIA 2V8HA 3TOBA 1Y9KA 2F7VA 5F47A 3D7HA 3BXMA 3D7DA 2REFA 4QVTA 2OZHA 5KTCA 3CDXA 3B3CA 2WZNA 4C2XA 3BJ7A 1Z4RA 4IUSA 2OOTA 2BOAA 3GIUA 4EFDA 3H8FA 4JLYA 4KORA 2FCKA 4CGPA 3GLJA 1XJOA 3H8GA 4NGPA 1M44A 5HXDA 4A30A 3FBUA 3NA6A 2J9AA 3R95A 5KTAA 2PDOA 1DE4C 1QSOA 4HPSA 4MCPA 3RYOA 3DR6A 3R96A 1PUAA 4WJBA 2PJ3A 3KL9A 2WPXA 3H8EA 5G20A 4KUAA 4X8IA 5JPHA 3FYNA 2PJBA 4CGOA 2Q44A 1QQ9A 5I4MA 4NFRA 4JD6A 3WABA 1KUVA 4Q36A 3LACA 4MFLA 4FD4A 1N71A 2I00A 5AGEA 2CIJA 4KVOE 2I3CA 4A39A 4U5YA 4A2ZA 3DLJA 2PSWA 2YNCA 3KQZA 4P4FA 3EFAA 5EC4A 1Q2CA 3IWGA 3W6SA 4H2KA 4CAVA 1IB1E 3S6HA 4CGLA 3N7ZA 1S5KA 2R7HA 3PB6X 1TKJA 4R9MA 1Z5RA 4OAEA 3RAMA 1RXTA 2AE6A 3CZXA 1Z8LA 3FVLA
chains in the Genus database with same CATH topology
4U9YA 4B11A 2B58A 2BSWA 2R8VA 4CRYB 2BEIA 5C82A 4AG7A 2P6FA 2B3UA 1KUYA 3IGRA 4OLLA 3KKWA 4OADA 2DPTA 4UFXA 1VHSA 1XEBA 1KUXA 4KOXA 4CYPA 4II9A 3W6XA 2O28A 2Q0YA 2VI7A 3F5BA 3R9FA 1WWZA 2J8NA 4NXYA 3D2MA 3K9UA 4MFQA 3QAHA 1MJAA 3GYAA 2P0WA 3TFYA 1S7KA 4KOVA 2ZW4A 5H86A 4PSXA 3FB3A 1MJ9A 4ORFA 3G3SA 4PV6A 3FRMA 2FT0A 4KVXA 4E2AA 1K4JA 5ISVA 3IU1A 4B5PB 4GS4A 3T9YA 4CYOA 1S60A 2D4OA 1QSMA 4C2ZA 4PK2A 3VWDA 5IB0A 4KLWA 2P6GA 2Y0MA 2PQ8A 4UA3A 2HUZA 4RI1A 3TTHA 1VKCA 4CRZB 4AVCA 3H5ZA 4JXRA 4B5OA 2Z11A 1NMTA 2FSRA 3DNSA 4KUBA 4A31A 3MGDA 2ARHA 2OH1A 1QSRA 4NF1A 4KOYA 2Z3OA 3W91A 5AG4A 4C2YA 5J8FA 2B4DA 4ZBGA 4NCZA 3CXSA 3D3SA 5CNPA 4HKFA 1YVOA 3LODA 1ON0A 4UWJA 4CAFA 5HH1A 4KS9A 3E0KA 3NE7A 5AG6A 3TOAA 1I1DA 1RO5A 5J8CA 1MJBA 2Z3PA 4CAXA 3S6KA 4QB9A 2Z10A 5A28A 5AG5A 4R57A 5EBVA 4M3SA 3LD2A 1M4DA 2Q04A 2X7BA 4HNYB 2FE7A 3IWEA 2VQYA 2F5IA 4J3GA 3R9GA 2Z3MA 3R1KA 2NMTA 1MK4A 1P0HA 4B12A 2BUEA 1PU9A 2J8MA 4R3KA 3CXQA 2K5TA 2IL4A 1Y9WA 3JVNA 2YNCC 1UFHA 2PR1A 4UWIA 3BLNA 3G8WA 2H5MA 2B5GB 3SHPA 3S6GA 3WR7A 3IU2A 3PZJA 4LUAA 4B13A 2VXKA 2ZW5A 2RC4A 5F48A 3FIXA 2R1IA 3SXNA 3EC4A 1IYKA 3GKRA 2PRBA 2VEZA 1YGHA 3ZZIA 4KLVA 4XPLA 5FVJA 2JDDA 1XF8A 3D8PA 2B4DB 4JWPA 4R3LA 4NSQA 1TIQA 1R57A 1BO4A 1B6BA 4UCNA 1YVKA 3BJ8A 4RS2A 4AB7A 1XE4A 1S7NA 4U9ZA 2FIAA 3A9LA 1M1DA 4B14A 3TE4A 2WPWA 4MHDA 2KCWA 4I49A 1Z4EA 2A4NA 5IV0A 1Q2DA 2JEVA 2Z3LA 2D4PA 3S6FA 4MBUA 2G0BA 3H4QA 3I3GA 1ZO0A 2HV2A 1CJWA 2C27A 4ONUA 1YLEA 1IICA 3TT2A 1P4NA 4X5KA 3OWCA 4IF5A 4MFJA 3V8IA 4H89A 2Z3KA 4XPKA 3ZJ0A 4A32A 4C7IA 1QSTA 4F6AA 2YGWA 2OB0A 1I21A 2OZGA 2ATRA 2OU2A 2I79A 4CGMA 5H84A 2ZW6A 1WK4A 1NSLA 2DXQA 2HQYA 3DSBA 4MFZA 4F0YA 2JLMA 4CAEA 2CNMA 2CNTA 2YNDA 4JJXA 4CAWA 5AG7A 3QB8A 4YRHA 4B10A 4KOWA 4M85A 2Q4VA 4BMHA 3TO6A 4XNHC 3EY5A 3JTKA 1S7FA 4C7HA 2GE3A 4EVYA 2QMLA 3UY5A 3PGPA 4FD6A 5C88A 2EVNA 1OZPA 4ZGYB 3F0AA 2FL4A 4MFKA 3I9SA 4A95A 5A27A 1YX0A 4QC6A 1B87A 4XPDC 5G21A 4UFWA 4KSAA 4MY3A 4MFPA 1S7LA 1I12A 1J4JA 4PK3A 2Q4YA 4FD7A 4UCMA 5GCNA 4YFJA 4KOUA 2GANA 1L0CA 4F0XA 4UBRA 2VZZA 4AVAA 5HMNA 2G3TA 4KOSA 2PR8A 4PSWA 1M4GA 4AG9A 1IIDA 2GIVA 4MJ8A 2FS5A 1KZFA 4R87A 3C26A 4MI4A 4QUSA 2CXAA 4H6UA 1U6MA 3TO7A 4KVME 2VZYA 2FXFA 4KOTA 4AVBA 3TCVA 1QSNA 2QIRA 4DNCA 1Y7RA 2R98A 4B5PA 4E0AA 4BBHA 3B8GA 4LX9A 4XNHB 3F8KA 1Z9UA 1CM0A 4UFVA 3JUWA 1V0CA 1YR0A 2CNSA 3D2PA 3CXPA 1FY7A 4XPDB 1BOBA 2CY2A 4Y49C 4CGNA 1Q2YA 2J8RA 2Q7BA 5IX3A 1YREA 2B4BA 2DPSA 2Z3NA 3P2HA 2QECA 3DR8A 3FNCA 2WUUA 2BL1A 3FXTA 5G22A 4MY0A 2ZXVA 1LRZA 4NEXA 2B3VA 1IYLA 2PC1A 2REEA 4QBJA 4L8AA 2Z0ZA 4HNXB 1M4IA 1S3ZA 5DWNA 4YGOA 4K30A 2WSAA 1XIXA 2P6EA 5BWAB 3TO9A 4JXQA 4HNWB 2ZW7A 3SXOA 2FIWA 4CS0B 2VBQA 1YK3A 3VWEA 1NE9A 4KSFA 3EO4A 5F49A 4E8OA 3P2FA 5E96A 3EXNA 4CYQA 1SQHA 2JDCA 4FD5A 4H6ZA 4UCPA 2B5GA 2OZUA 3PP9A 2ZPAA 2YNEA 4Y49B 4KZTA 4L89A 4CYNA 5G1ZA 4A33A 3DDDA 2G3AA 5F46A 4Q38A 5JQ4A 3T90A 1XMTA 2AJ6A 3R9EA 5KTDA 5DWMA 3GY9A 5I0CA 1GHEA 2EUIA 3TOBA 1Y9KA 5F47A 2REFA 4QVTA 2OZHA 5KTCA 4C2XA 3BJ7A 1Z4RA 4IUSA 4JLYA 4KORA 2FCKA 4CGPA 1M44A 4A30A 3FBUA 5KTAA 3R95A 2PDOA 1QSOA 3RYOA 3DR6A 3R96A 1PUAA 2WPXA 5G20A 4KUAA 5JPHA 3FYNA 4CGOA 2Q44A 4JD6A 1KUVA 4Q36A 4MFLA 4FD4A 1N71A 2I00A 5AGEA 4KVOE 4U5YA 4A2ZA 2PSWA 2YNCA 4CAVA 3EFAA 5EC4A 1Q2CA 3IWGA 3W6SA 1IB1E 3S6HA 4CGLA 3N7ZA 1S5KA 2R7HA 4R9MA 4OAEA 1RXTA 2AE6A 4C68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Y A;  2B58 A;  2BSW A;  2R8V A;  4CRY B;  2BEI A;  5C82 A;  4AG7 A;  2P6F A;  2B3U A;  1KUY A;  3IGR A;  4OLL A;  3KKW A;  4OAD A;  1VHS A;  1XEB A;  1KUX A;  4KOX A;  4II9 A;  3W6X A;  2O28 A;  2Q0Y A;  2VI7 A;  3F5B A;  3R9F A;  1WWZ A;  2J8N A;  4NXY A;  3D2M A;  3K9U A;  3QAH A;  1MJA A;  3GYA A;  2P0W A;  3TFY A;  1S7K A;  4KOV A;  2ZW4 A;  5H86 A;  4PSX A;  3FB3 A;  1MJ9 A;  4ORF A;  3G3S A;  4PV6 A;  3FRM A;  2FT0 A;  4KVX A;  4E2A A;  1K4J A;  5ISV A;  4B5P B;  4GS4 A;  3T9Y A;  1S60 A;  2D4O A;  1QSM A;  4PK2 A;  3VWD A;  5IB0 A;  4KLW A;  2P6G A;  2Y0M A;  2PQ8 A;  4UA3 A;  2HUZ A;  4RI1 A;  3TTH A;  1VKC A;  4CRZ B;  4AVC A;  4JXR A;  4B5O A;  2Z11 A;  1NMT A;  2FSR A;  3DNS A;  4KUB A;  3MGD A;  2ARH A;  2OH1 A;  1QSR A;  4NF1 A;  4KOY A;  3W91 A;  5J8F A;  2B4D A;  4ZBG A;  4NCZ A;  3CXS A;  3D3S A;  5CNP A;  4HKF A;  1YVO A;  3LOD A;  1ON0 A;  4UWJ A;  5HH1 A;  3E0K A;  3NE7 A;  3TOA A;  1I1D A;  1RO5 A;  5J8C A;  1MJB A;  4CAX A;  3S6K A;  4QB9 A;  2Z10 A;  4R57 A;  5EBV A;  4M3S A;  3LD2 A;  1M4D A;  2Q04 A;  2X7B A;  4HNY B;  2FE7 A;  2VQY A;  2F5I A;  4J3G A;  3R9G A;  3R1K A;  2NMT A;  1MK4 A;  1P0H A;  2BUE A;  1PU9 A;  2J8M A;  4R3K A;  3CXQ A;  2K5T A;  2IL4 A;  1Y9W A;  3JVN A;  1UFH A;  2PR1 A;  4UWI A;  3BLN A;  3G8W A;  2H5M A;  2B5G B;  3SHP A;  3S6G A;  3WR7 A;  3PZJ A;  4LUA A;  2VXK A;  2ZW5 A;  2RC4 A;  5F48 A;  3FIX A;  2R1I A;  3SXN A;  3EC4 A;  1IYK A;  3GKR A;  2PRB A;  2VEZ A;  1YGH A;  3ZZI A;  4KLV A;  4XPL A;  5FVJ A;  2JDD A;  1XF8 A;  3D8P A;  2B4D B;  4JWP A;  4R3L A;  4NSQ A;  1TIQ A;  1R57 A;  1BO4 A;  1B6B A;  1YVK A;  3BJ8 A;  4RS2 A;  4AB7 A;  1XE4 A;  1S7N A;  4U9Z A;  2FIA A;  1M1D A;  3TE4 A;  2WPW A;  4MHD A;  2KCW A;  4I49 A;  1Z4E A;  2A4N A;  5IV0 A;  1Q2D A;  2JEV A;  2D4P A;  3S6F A;  4MBU A;  2G0B A;  3H4Q A;  3I3G A;  2HV2 A;  1CJW A;  2C27 A;  4ONU A;  1YLE A;  1IIC A;  3TT2 A;  1P4N A;  4X5K A;  3OWC A;  4IF5 A;  3V8I A;  4H89 A;  4XPK A;  3ZJ0 A;  1QST A;  4F6A A;  2OB0 A;  1I21 A;  2OZG A;  2ATR A;  2OU2 A;  2I79 A;  5H84 A;  2ZW6 A;  1WK4 A;  1NSL A;  2DXQ A;  2HQY A;  3DSB A;  4F0Y A;  2JLM A;  2CNM A;  2CNT A;  4JJX A;  4CAW A;  3QB8 A;  4YRH A;  4KOW A;  4M85 A;  2Q4V A;  4BMH A;  3TO6 A;  4XNH C;  3EY5 A;  1S7F A;  2GE3 A;  4EVY A;  2QML A;  3UY5 A;  3PGP A;  4FD6 A;  5C88 A;  2EVN A;  1OZP A;  3F0A A;  2FL4 A;  3I9S A;  1YX0 A;  4QC6 A;  1B87 A;  4XPD C;  4MY3 A;  1S7L A;  1I12 A;  1J4J A;  4PK3 A;  2Q4Y A;  4FD7 A;  5GCN A;  4YFJ A;  4KOU A;  2GAN A;  1L0C A;  4UBR A;  2VZZ A;  4AVA A;  5HMN A;  2G3T A;  4KOS A;  2PR8 A;  4PSW A;  1M4G A;  4AG9 A;  1IID A;  2GIV A;  4MJ8 A;  2FS5 A;  1KZF A;  4R87 A;  3C26 A;  4MI4 A;  4QUS A;  4H6U A;  1U6M A;  3TO7 A;  4KVM E;  2VZY A;  2FXF A;  4KOT A;  4AVB A;  3TCV A;  1QSN A;  2QIR A;  4DNC A;  1Y7R A;  2R98 A;  4B5P A;  4E0A A;  3B8G A;  4LX9 A;  4XNH B;  3F8K A;  1Z9U A;  1CM0 A;  3JUW A;  1V0C A;  1YR0 A;  2CNS A;  3D2P A;  3CXP A;  1FY7 A;  4XPD B;  1BOB A;  2CY2 A;  4Y49 C;  1Q2Y A;  2J8R A;  2Q7B A;  5IX3 A;  1YRE A;  2B4B A;  3P2H A;  2QEC A;  3DR8 A;  3FNC A;  2BL1 A;  3FXT A;  4MY0 A;  2ZXV A;  1LRZ A;  4NEX A;  2B3V A;  1IYL A;  2PC1 A;  2REE A;  4QBJ A;  4L8A A;  2Z0Z A;  4HNX B;  1M4I A;  1S3Z A;  5DWN A;  4YGO A;  4K30 A;  1XIX A;  2P6E A;  3TO9 A;  4JXQ A;  4HNW B;  2ZW7 A;  3SXO A;  2FIW A;  4CS0 B;  2VBQ A;  1YK3 A;  3VWE A;  1NE9 A;  3EO4 A;  5F49 A;  4E8O A;  3P2F A;  5E96 A;  3EXN A;  1SQH A;  2JDC A;  4FD5 A;  4H6Z A;  2B5G A;  2OZU A;  3PP9 A;  2ZPA A;  4Y49 B;  4KZT A;  4L89 A;  3DDD A;  2G3A A;  5F46 A;  5JQ4 A;  3T90 A;  1XMT A;  2AJ6 A;  3R9E A;  5KTD A;  5DWM A;  3GY9 A;  5I0C A;  1GHE A;  2EUI A;  3TOB A;  1Y9K A;  5F47 A;  2REF A;  4QVT A;  2OZH A;  5KTC A;  3BJ7 A;  1Z4R A;  4IUS A;  4JLY A;  4KOR A;  2FCK A;  1M44 A;  3FBU A;  5KTA A;  3R95 A;  2PDO A;  1QSO A;  3RYO A;  3DR6 A;  3R96 A;  1PUA A;  2WPX A;  4KUA A;  5JPH A;  3FYN A;  2Q44 A;  4JD6 A;  1KUV A;  4FD4 A;  1N71 A;  2I00 A;  4KVO E;  4U5Y A;  2PSW A;  4CAV A;  3EFA A;  5EC4 A;  1Q2C A;  3IWG A;  3W6S A;  1IB1 E;  3S6H A;  3N7Z A;  1S5K A;  2R7H A;  4R9M A;  4OAE A;  1RXT A;  2AE6 A; 
#chains in the Genus database with same CATH topology
 1RTQ A;  2PJ2 A;  2AFS A;  3KQX A;  2ODF A;  4U9Y A;  3D67 A;  1CPX A;  1R3N A;  4B11 A;  4CYN A;  2B58 A;  2BSW A;  2R8V A;  4TNU A;  4CRY B;  3D68 A;  2BEI A;  5C82 A;  1ZG8 A;  2P6F A;  4AG7 A;  4MCR A;  2B3U A;  4NJQ A;  1KUY A;  3TX8 A;  4M6H A;  3IGR A;  4OLL A;  2IJZ A;  3IC1 A;  3FMC A;  3KKW A;  1XMB A;  4OAD A;  2DPT A;  4UFX A;  1VHS A;  1XEB A;  1KUX A;  1Q7L A;  2IMO A;  4KOX A;  4CYP A;  4II9 A;  2GU2 A;  4F9U A;  3W6X A;  1YME A;  2O28 A;  5LYF A;  4MHZ A;  5K8N A;  2PE3 A;  2Q0Y A;  2VI7 A;  3F5B A;  4F8Z A;  3ISZ A;  3R9F A;  4WWV A;  4OC5 A;  1WWZ A;  2J8N A;  5JH9 A;  1PYT B;  1CG2 A;  1F2O A;  4NXY A;  3D2M A;  3K9U A;  3JRU A;  4MFQ A;  3QAH A;  4ZY2 A;  1MJA A;  1F57 A;  3GYA A;  5JGF A;  4BIN A;  3B7I A;  2G9D A;  4MHP A;  4RN7 A;  2P0W A;  3TFY A;  1S7K A;  2XEG A;  4FUU A;  4KOV A;  2ZW4 A;  5H86 A;  1ELM P;  2PJ5 A;  4LQ6 A;  2CTB A;  1MJ9 A;  3FB3 A;  3G3S A;  4ORF A;  3FRM A;  4PSX A;  2AFU A;  2FT0 A;  1VIX A;  2NSM A;  2ZEL A;  4KVX A;  4PXC A;  3WC5 A;  1K4J A;  3PEI A;  4E2A A;  5ISV A;  3IU1 A;  4B5P B;  2XEI A;  4GS4 A;  4Q7A A;  3T9Y A;  4CYO A;  1VHE A;  1S60 A;  4NGN A;  2D4O A;  1QSM A;  3RO0 A;  4C2Z A;  4PPZ A;  4UEZ A;  2NYQ A;  4GM5 A;  4PK2 A;  5D29 A;  3VWD A;  5IB0 A;  4KLW A;  2DF5 A;  3S9M A;  2P6G A;  2Y0M A;  2PQ8 A;  4UA3 A;  2EWB A;  2HUZ A;  2JBJ A;  3B35 A;  4RI1 A;  5LRG A;  1IU8 A;  3TTH A;  1PCA A;  4NGM A;  1VKC A;  4P4D A;  4PXE A;  4CRZ B;  4AVC A;  3NH4 A;  1JQG A;  4B6Z A;  3CPX A;  3H5Z A;  3NH5 A;  4JXR A;  2Z11 A;  1NMT A;  4B5O A;  2QJ8 A;  2FSR A;  3DNS A;  4KUB A;  3N5F A;  3KHX A;  4A31 A;  2AFW A;  4ZYQ A;  3MGD A;  2ARH A;  2OH1 A;  1QSR A;  4NF1 A;  4KOY A;  1A2Z A;  2Z3O A;  3W91 A;  3WC7 A;  5AG4 A;  2QYV A;  4C2Y A;  6CPA A;  5J8F A;  2B4D A;  4ZBG A;  4NCZ A;  3CXS A;  3TC8 A;  3D3S A;  4NGT A;  5CNP A;  4HKF A;  3V7Z A;  1YVO A;  1YLO A;  3VAT A;  3LOD A;  1ON0 A;  4UWJ A;  1HDQ A;  4CAF A;  1OBR A;  5HH1 A;  2ZEE A;  3NE8 A;  3E0K A;  3NE7 A;  4KS9 A;  4MCQ A;  5AG6 A;  3TOA A;  1I1D A;  1RO5 A;  2RFH A;  5J8C A;  4Z65 A;  1MJB A;  2Z3P A;  4CAX A;  5K8P A;  3S6K A;  1YW4 A;  4QB9 A;  2Z10 A;  5A28 A;  5AG5 A;  4R57 A;  5EBV A;  3IIB A;  1UWY A;  3LD2 A;  4M3S A;  3LMS A;  3PRT A;  4YU9 A;  4A94 A;  1M4D A;  2Q04 A;  2X7B A;  4HNY B;  2ZEH A;  2FE7 A;  3IWE A;  2VQY A;  4FBE A;  2F5I A;  8CPA A;  4J3G A;  1Y7E A;  3IEH A;  7CPA A;  2VL1 A;  3R9G A;  2Z3M A;  2PJ1 A;  2C6P A;  3R1K A;  1LAN A;  2NMT A;  3D7G A;  5K8O A;  1MK4 A;  4EME A;  1P0H A;  4B12 A;  1LAM A;  2BUE A;  2OR4 A;  2V8V A;  1PU9 A;  2J8M A;  3B3S A;  4R3K A;  3CXQ A;  4CPA A;  3FX6 A;  2K5T A;  2IL4 A;  2Q43 A;  1Y9W A;  3JVN A;  1X12 A;  2JBK A;  2YNC C;  1UFH A;  4RUH A;  2PR1 A;  4MRI A;  5THW A;  1AMP A;  4UWI A;  3BLN A;  3G8W A;  2H5M A;  2B5G B;  3SHP A;  4G1P A;  1XFO A;  2ZOG A;  3V38 A;  1ELL P;  1Z8X A;  3S6G A;  3IU2 A;  3BHX A;  3PZJ A;  3FF3 A;  3WR7 A;  5JM6 A;  3KR5 A;  4LUA A;  4B13 A;  2VXK A;  4P6Y A;  3BI0 A;  4IK2 A;  2ZEG A;  3B2Y A;  3FEC A;  2ZW5 A;  4R6T A;  3SI2 A;  2RC4 A;  2PJ6 A;  5F48 A;  2EK9 A;  3FIX A;  2R1I A;  3SXN A;  3EC4 A;  1IYK A;  1FT7 A;  3GKR A;  2PRB A;  2VEZ A;  2ZED A;  1YGH A;  4NGS A;  4KLV A;  4XPL A;  5FVJ A;  3VAR A;  2JDD A;  1XF8 A;  3ZZI A;  3D8P A;  4ZY0 A;  2B4D B;  4JWP A;  4R3L A;  1YW6 A;  2BO9 A;  4NSQ A;  1TIQ A;  1R57 A;  1BO4 A;  1B6B A;  2FVG A;  3FEE A;  2GLJ A;  4IHM A;  4R8F A;  4UCN A;  5CBM A;  5K8M A;  1YVK A;  2PJC A;  3BJ8 A;  5HVG A;  4RS2 A;  4AB7 A;  1Y0Y A;  1XE4 A;  1IY7 A;  1S7N A;  4OC0 A;  4U9Z A;  5HVF A;  4UEF A;  2FIA A;  5DS0 A;  3A9L A;  3S9L A;  1M1D A;  4B14 A;  3TE4 A;  3D7F A;  3B3V A;  1TF8 A;  2WPW A;  2BCO A;  4MHD A;  2XEJ A;  3LWU A;  3PBB A;  2KCW A;  1ARM A;  4I49 A;  1Z4E A;  2A4N A;  5IV0 A;  1Q2D A;  2JEV A;  2Z3L A;  2D4P A;  4O23 A;  4NGR A;  2JEW A;  3MN8 A;  3S6F A;  4MBU A;  2PJ8 A;  2G0B A;  4A38 A;  1BPN A;  1LFW A;  3VH9 A;  3H4Q A;  3I3G A;  3K2K A;  1JWQ A;  1ZO0 A;  2HV2 A;  2GRE A;  3QNV A;  2ABZ A;  1CJW A;  2C27 A;  4ONU A;  1YLE A;  1IIC A;  4P4E A;  3TT2 A;  4OC2 A;  4UF4 A;  1ZLH A;  1P4N A;  4X5K A;  3OWC A;  4IF5 A;  4MFJ A;  4P4J A;  5EMI A;  3RBU A;  4H89 A;  4NJR A;  3V8I A;  2Z3K A;  4XPK A;  3SI0 A;  3ZJ0 A;  2RB7 A;  4A32 A;  4C7I A;  3L2N A;  1QST A;  3S9N A;  4F6A A;  4ZY1 A;  4DYO A;  2YGW A;  4MCS A;  4OME A;  2OB0 A;  1I21 A;  2C1C A;  4X2T A;  2OZG A;  4OC1 A;  5F09 A;  5LYD A;  1ARL A;  2ATR A;  2EBJ A;  3B3W A;  2OU2 A;  3K9T A;  2I79 A;  4CGM A;  4OP4 A;  5H84 A;  4FAI A;  2ZW6 A;  1WK4 A;  1NSL A;  4R76 A;  2DXQ A;  2HQY A;  3DSB A;  4MFZ A;  4F0Y A;  2JLM A;  4CAE A;  2CNM A;  2CNT A;  2YND A;  4DUK A;  4F9V A;  3SJE A;  1YSJ A;  4JJX A;  4CAW A;  2AFO A;  5AG7 A;  3QB8 A;  4YRH A;  4B10 A;  4KOW A;  4M85 A;  2Q4V A;  3HUV A;  3MRU A;  4BMH A;  3TO6 A;  4MHN A;  2V8G A;  4ONW A;  3EY5 A;  2PJ4 A;  4XNH C;  3JTK A;  1S7F A;  4C7H A;  2AFZ A;  2GE3 A;  1IOF A;  2ZEM A;  3D4U A;  4EVY A;  2V8D A;  2QML A;  3UY5 A;  4YWY A;  1HEE A;  3SJX A;  3PGP A;  4FD6 A;  5D8N A;  5C88 A;  2GFQ A;  2EVN A;  1OZP A;  4R7M A;  3F0A A;  2FL4 A;  4ZGY B;  4MFK A;  2AFX A;  2C6C A;  1HDU A;  4OC4 A;  4ZX8 A;  3I9S A;  4A95 A;  5A27 A;  1YX0 A;  4QC6 A;  1B87 A;  4XPD C;  5G21 A;  4UFW A;  1BPM A;  4KSA A;  1VHO A;  4MFP A;  2DEA A;  4MY3 A;  1TXR A;  1S7L A;  1I12 A;  2PIY A;  3SJG A;  3CT9 A;  3KAS A;  2EO8 A;  1J4J A;  4PK3 A;  2Q4Y A;  4FD7 A;  4UCM A;  1IOI A;  5GCN A;  4X3R A;  2V77 A;  4YFJ A;  4ZI6 A;  3D66 A;  3FH4 A;  4KOU A;  4M6G A;  2GAN A;  3KZW A;  2ZEO A;  1L0C A;  4F0X A;  4K3N A;  2Q51 A;  2PJA A;  4OID A;  2ZEN A;  4UBR A;  2ANP A;  2XEF A;  4PV6 A;  5ELY A;  2VZZ A;  4AVA A;  4FWU A;  5LYI A;  3KHZ A;  2G3T A;  5HMN A;  4KOS A;  2PR8 A;  4AXV A;  4PSW A;  3GB0 A;  4UIA A;  1M4G A;  4AG9 A;  1IID A;  2GIV A;  4MJ8 A;  2FS5 A;  4OIW A;  4PXD A;  1KZF A;  1XOV A;  4IAV A;  3C26 A;  4MI4 A;  4R87 A;  4QUS A;  2CXA A;  4H6U A;  1U6M A;  4JZ0 A;  3TO7 A;  5LRK A;  4KVM E;  2VZY A;  3RZA A;  4MHY A;  2PJ7 A;  2FXF A;  2PRQ A;  4KOT A;  1AYE A;  4AVB A;  2HB6 A;  1QSN A;  2QIR A;  3TCV A;  1LAP A;  4DNC A;  1FNO A;  1Y7R A;  2EK8 A;  2R98 A;  2PIZ A;  4B5P A;  4E0A A;  3FJU A;  3ISX A;  4BBH A;  3B8G A;  4LX9 A;  1CX8 A;  4XNH B;  5J1Q A;  3F8K A;  1Z9U A;  1CM0 A;  3PB4 X;  4UFV A;  3JUW A;  1BAV A;  1TKF A;  3GUX A;  4P4I A;  1V0C A;  3KR4 A;  2POK A;  1YR0 A;  2AFM A;  1F2P A;  3PFE A;  2CNS A;  3DGV A;  3SI1 A;  3D2P A;  1CBX A;  1R43 A;  2CF4 A;  3CXP A;  1EE3 P;  1FY7 A;  2O4H A;  1X10 A;  3PB9 X;  4XPD B;  1BOB A;  2CY2 A;  5LYL A;  1IGB A;  2O53 A;  1KWM A;  4BD9 A;  1ZG7 A;  4GXH A;  2PJ9 A;  4Y49 C;  3WC6 A;  4CGN A;  1Q2Y A;  3BI1 A;  2IQ6 A;  2J8R A;  2Q7B A;  5IX3 A;  1YRE A;  4EWT A;  1Z8T A;  5HVH A;  2B4B A;  2DPS A;  4P44 A;  2Z3N A;  2GLF A;  3CPA A;  3IJ3 A;  2PJ0 A;  3P2H A;  2QEC A;  3PB7 X;  4MXU A;  4KSI A;  3DR8 A;  3QAY A;  4P4B A;  3NH8 A;  4UEE A;  4ZX9 A;  3FNC A;  4C68 A;  2WUU A;  4OC3 A;  2C6G A;  2ZOF A;  2BL1 A;  1TF9 A;  3FXT A;  4A37 A;  1CP7 A;  4MY0 A;  3NFZ A;  2ZXV A;  1LRZ A;  5G22 A;  2PVW A;  3PFO A;  4NEX A;  5LRJ A;  4LQG A;  2B3V A;  3T8W A;  4CYQ A;  1IYL A;  1XBU A;  2PC1 A;  2REE A;  5CPA A;  1H8L A;  4MMO A;  4QBJ A;  3IWW A;  2Z0Z A;  3PB8 X;  1NSA A;  4HNX B;  1M4I A;  4L8A A;  1S3Z A;  1Y0R A;  5DWN A;  4YGO A;  1ZG9 A;  3PBE A;  4K30 A;  4DJL A;  1Z8W A;  4W9Y A;  2WSA A;  1XIX A;  2P6E A;  3FED A;  5BWA B;  3TO9 A;  3B3T A;  4JXQ A;  3I1U A;  4HNW B;  3SJF A;  4NGQ A;  4M6I A;  2ZEP A;  1VGY A;  2ZW7 A;  3SXO A;  2FIW A;  4OKO A;  4CS0 B;  4P45 A;  4JYW A;  2VBQ A;  1YK3 A;  1AUG A;  1CPS A;  3VWE A;  1NE9 A;  2Q7S A;  1DTD A;  3EO4 A;  4KSF A;  1LOK A;  5F49 A;  4E8O A;  3P2F A;  5E96 A;  2CTC A;  3EXN A;  1SQH A;  2JDC A;  2ZEF A;  1TKH A;  4FD5 A;  4H6Z A;  4UCP A;  2PVV A;  2B5G A;  3IO1 A;  3KGQ A;  2OZU A;  1ZLI A;  3HLP A;  3PP9 A;  3WT4 A;  2ZPA A;  2YNE A;  4Y49 B;  1YQE A;  5IB9 A;  4KZT A;  4L89 A;  4TWE A;  3RNZ A;  1BLL E;  4UIB A;  5G1Z A;  4A33 A;  1QMU A;  2G3A A;  3DDD A;  3KI9 A;  2HC9 A;  4Q38 A;  2WYR A;  5F46 A;  5JQ4 A;  1LCP A;  3T90 A;  1CP6 A;  1M4L A;  1XMT A;  2AJ6 A;  2PCU A;  4P10 A;  4PXB A;  3R9E A;  1Z2L A;  2F8H A;  5KTD A;  5DWM A;  2QVP A;  3GY9 A;  3IFE A;  2Q4Z A;  5I0C A;  1GYT A;  1XRY A;  1GHE A;  4PQA A;  2EUI A;  2V8H A;  3TOB A;  1Y9K A;  2F7V A;  5F47 A;  3D7H A;  3BXM A;  3D7D A;  2REF A;  4QVT A;  2OZH A;  5KTC A;  3CDX A;  3B3C A;  2WZN A;  4C2X A;  3BJ7 A;  1Z4R A;  4IUS A;  2OOT A;  2BOA A;  3GIU A;  4EFD A;  3H8F A;  4JLY A;  4KOR A;  2FCK A;  4CGP A;  3GLJ A;  1XJO A;  3H8G A;  4NGP A;  1M44 A;  5HXD A;  4A30 A;  3FBU A;  3NA6 A;  2J9A A;  3R95 A;  5KTA A;  2PDO A;  1DE4 C;  1QSO A;  4HPS A;  4MCP A;  3RYO A;  3DR6 A;  3R96 A;  1PUA A;  4WJB A;  2PJ3 A;  3KL9 A;  2WPX A;  3H8E A;  5G20 A;  4KUA A;  4X8I A;  5JPH A;  3FYN A;  2PJB A;  4CGO A;  2Q44 A;  1QQ9 A;  5I4M A;  4NFR A;  4JD6 A;  3WAB A;  1KUV A;  4Q36 A;  3LAC A;  4MFL A;  4FD4 A;  1N71 A;  2I00 A;  5AGE A;  2CIJ A;  4KVO E;  2I3C A;  4A39 A;  4U5Y A;  4A2Z A;  3DLJ A;  2PSW A;  2YNC A;  3KQZ A;  4P4F A;  3EFA A;  5EC4 A;  1Q2C A;  3IWG A;  3W6S A;  4H2K A;  4CAV A;  1IB1 E;  3S6H A;  4CGL A;  3N7Z A;  1S5K A;  2R7H A;  3PB6 X;  1TKJ A;  4R9M A;  1Z5R A;  4OAE A;  3RAM A;  1RXT A;  2AE6 A;  3CZX A;  1Z8L A;  3FVL A; 
#chains in the Genus database with same CATH homology
 4U9Y A;  4B11 A;  2B58 A;  2BSW A;  2R8V A;  4CRY B;  2BEI A;  5C82 A;  4AG7 A;  2P6F A;  2B3U A;  1KUY A;  3IGR A;  4OLL A;  3KKW A;  4OAD A;  2DPT A;  4UFX A;  1VHS A;  1XEB A;  1KUX A;  4KOX A;  4CYP A;  4II9 A;  3W6X A;  2O28 A;  2Q0Y A;  2VI7 A;  3F5B A;  3R9F A;  1WWZ A;  2J8N A;  4NXY A;  3D2M A;  3K9U A;  4MFQ A;  3QAH A;  1MJA A;  3GYA A;  2P0W A;  3TFY A;  1S7K A;  4KOV A;  2ZW4 A;  5H86 A;  4PSX A;  3FB3 A;  1MJ9 A;  4ORF A;  3G3S A;  4PV6 A;  3FRM A;  2FT0 A;  4KVX A;  4E2A A;  1K4J A;  5ISV A;  3IU1 A;  4B5P B;  4GS4 A;  3T9Y A;  4CYO A;  1S60 A;  2D4O A;  1QSM A;  4C2Z A;  4PK2 A;  3VWD A;  5IB0 A;  4KLW A;  2P6G A;  2Y0M A;  2PQ8 A;  4UA3 A;  2HUZ A;  4RI1 A;  3TTH A;  1VKC A;  4CRZ B;  4AVC A;  3H5Z A;  4JXR A;  4B5O A;  2Z11 A;  1NMT A;  2FSR A;  3DNS A;  4KUB A;  4A31 A;  3MGD A;  2ARH A;  2OH1 A;  1QSR A;  4NF1 A;  4KOY A;  2Z3O A;  3W91 A;  5AG4 A;  4C2Y A;  5J8F A;  2B4D A;  4ZBG A;  4NCZ A;  3CXS A;  3D3S A;  5CNP A;  4HKF A;  1YVO A;  3LOD A;  1ON0 A;  4UWJ A;  4CAF A;  5HH1 A;  4KS9 A;  3E0K A;  3NE7 A;  5AG6 A;  3TOA A;  1I1D A;  1RO5 A;  5J8C A;  1MJB A;  2Z3P A;  4CAX A;  3S6K A;  4QB9 A;  2Z10 A;  5A28 A;  5AG5 A;  4R57 A;  5EBV A;  4M3S A;  3LD2 A;  1M4D A;  2Q04 A;  2X7B A;  4HNY B;  2FE7 A;  3IWE A;  2VQY A;  2F5I A;  4J3G A;  3R9G A;  2Z3M A;  3R1K A;  2NMT A;  1MK4 A;  1P0H A;  4B12 A;  2BUE A;  1PU9 A;  2J8M A;  4R3K A;  3CXQ A;  2K5T A;  2IL4 A;  1Y9W A;  3JVN A;  2YNC C;  1UFH A;  2PR1 A;  4UWI A;  3BLN A;  3G8W A;  2H5M A;  2B5G B;  3SHP A;  3S6G A;  3WR7 A;  3IU2 A;  3PZJ A;  4LUA A;  4B13 A;  2VXK A;  2ZW5 A;  2RC4 A;  5F48 A;  3FIX A;  2R1I A;  3SXN A;  3EC4 A;  1IYK A;  3GKR A;  2PRB A;  2VEZ A;  1YGH A;  3ZZI A;  4KLV A;  4XPL A;  5FVJ A;  2JDD A;  1XF8 A;  3D8P A;  2B4D B;  4JWP A;  4R3L A;  4NSQ A;  1TIQ A;  1R57 A;  1BO4 A;  1B6B A;  4UCN A;  1YVK A;  3BJ8 A;  4RS2 A;  4AB7 A;  1XE4 A;  1S7N A;  4U9Z A;  2FIA A;  3A9L A;  1M1D A;  4B14 A;  3TE4 A;  2WPW A;  4MHD A;  2KCW A;  4I49 A;  1Z4E A;  2A4N A;  5IV0 A;  1Q2D A;  2JEV A;  2Z3L A;  2D4P A;  3S6F A;  4MBU A;  2G0B A;  3H4Q A;  3I3G A;  1ZO0 A;  2HV2 A;  1CJW A;  2C27 A;  4ONU A;  1YLE A;  1IIC A;  3TT2 A;  1P4N A;  4X5K A;  3OWC A;  4IF5 A;  4MFJ A;  3V8I A;  4H89 A;  2Z3K A;  4XPK A;  3ZJ0 A;  4A32 A;  4C7I A;  1QST A;  4F6A A;  2YGW A;  2OB0 A;  1I21 A;  2OZG A;  2ATR A;  2OU2 A;  2I79 A;  4CGM A;  5H84 A;  2ZW6 A;  1WK4 A;  1NSL A;  2DXQ A;  2HQY A;  3DSB A;  4MFZ A;  4F0Y A;  2JLM A;  4CAE A;  2CNM A;  2CNT A;  2YND A;  4JJX A;  4CAW A;  5AG7 A;  3QB8 A;  4YRH A;  4B10 A;  4KOW A;  4M85 A;  2Q4V A;  4BMH A;  3TO6 A;  4XNH C;  3EY5 A;  3JTK A;  1S7F A;  4C7H A;  2GE3 A;  4EVY A;  2QML A;  3UY5 A;  3PGP A;  4FD6 A;  5C88 A;  2EVN A;  1OZP A;  4ZGY B;  3F0A A;  2FL4 A;  4MFK A;  3I9S A;  4A95 A;  5A27 A;  1YX0 A;  4QC6 A;  1B87 A;  4XPD C;  5G21 A;  4UFW A;  4KSA A;  4MY3 A;  4MFP A;  1S7L A;  1I12 A;  1J4J A;  4PK3 A;  2Q4Y A;  4FD7 A;  4UCM A;  5GCN A;  4YFJ A;  4KOU A;  2GAN A;  1L0C A;  4F0X A;  4UBR A;  2VZZ A;  4AVA A;  5HMN A;  2G3T A;  4KOS A;  2PR8 A;  4PSW A;  1M4G A;  4AG9 A;  1IID A;  2GIV A;  4MJ8 A;  2FS5 A;  1KZF A;  4R87 A;  3C26 A;  4MI4 A;  4QUS A;  2CXA A;  4H6U A;  1U6M A;  3TO7 A;  4KVM E;  2VZY A;  2FXF A;  4KOT A;  4AVB A;  3TCV A;  1QSN A;  2QIR A;  4DNC A;  1Y7R A;  2R98 A;  4B5P A;  4E0A A;  4BBH A;  3B8G A;  4LX9 A;  4XNH B;  3F8K A;  1Z9U A;  1CM0 A;  4UFV A;  3JUW A;  1V0C A;  1YR0 A;  2CNS A;  3D2P A;  3CXP A;  1FY7 A;  4XPD B;  1BOB A;  2CY2 A;  4Y49 C;  4CGN A;  1Q2Y A;  2J8R A;  2Q7B A;  5IX3 A;  1YRE A;  2B4B A;  2DPS A;  2Z3N A;  3P2H A;  2QEC A;  3DR8 A;  3FNC A;  2WUU A;  2BL1 A;  3FXT A;  5G22 A;  4MY0 A;  2ZXV A;  1LRZ A;  4NEX A;  2B3V A;  1IYL A;  2PC1 A;  2REE A;  4QBJ A;  4L8A A;  2Z0Z A;  4HNX B;  1M4I A;  1S3Z A;  5DWN A;  4YGO A;  4K30 A;  2WSA A;  1XIX A;  2P6E A;  5BWA B;  3TO9 A;  4JXQ A;  4HNW B;  2ZW7 A;  3SXO A;  2FIW A;  4CS0 B;  2VBQ A;  1YK3 A;  3VWE A;  1NE9 A;  4KSF A;  3EO4 A;  5F49 A;  4E8O A;  3P2F A;  5E96 A;  3EXN A;  4CYQ A;  1SQH A;  2JDC A;  4FD5 A;  4H6Z A;  4UCP A;  2B5G A;  2OZU A;  3PP9 A;  2ZPA A;  2YNE A;  4Y49 B;  4KZT A;  4L89 A;  4CYN A;  5G1Z A;  4A33 A;  3DDD A;  2G3A A;  5F46 A;  4Q38 A;  5JQ4 A;  3T90 A;  1XMT A;  2AJ6 A;  3R9E A;  5KTD A;  5DWM A;  3GY9 A;  5I0C A;  1GHE A;  2EUI A;  3TOB A;  1Y9K A;  5F47 A;  2REF A;  4QVT A;  2OZH A;  5KTC A;  4C2X A;  3BJ7 A;  1Z4R A;  4IUS A;  4JLY A;  4KOR A;  2FCK A;  4CGP A;  1M44 A;  4A30 A;  3FBU A;  5KTA A;  3R95 A;  2PDO A;  1QSO A;  3RYO A;  3DR6 A;  3R96 A;  1PUA A;  2WPX A;  5G20 A;  4KUA A;  5JPH A;  3FYN A;  4CGO A;  2Q44 A;  4JD6 A;  1KUV A;  4Q36 A;  4MFL A;  4FD4 A;  1N71 A;  2I00 A;  5AGE A;  4KVO E;  4U5Y A;  4A2Z A;  2PSW A;  2YNC A;  4CAV A;  3EFA A;  5EC4 A;  1Q2C A;  3IWG A;  3W6S A;  1IB1 E;  3S6H A;  4CGL A;  3N7Z A;  1S5K A;  2R7H A;  4R9M A;  4OAE A;  1RXT A;  2AE6 A;  4C68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...