2Q0KA

Oxidized thioredoxin reductase from helicobacter pylori in complex with nadp+
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of oxidized and reduced thioredoxin reductase from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 90
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0kA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0kA02
3O0HA 1ZY8A 1NHRA 5HY5A 4GF7A 3QFAA 4A5LA 1GRTA 1L9CA 1CJCA 2BC1A 2C73A 2V5ZA 3D1CA 3AYJA 2WP5A 3SFDA 3NGCX 2C75A 2GRTA 1EL7A 4B1BA 3FMWA 3BI2A 5IQ1A 4CNJA 2CVJA 1L9EA 1S3EA 3T37A 2EQ8A 4AOXA 4XXGA 2CDUA 3CNTA 4USQA 4H4TA 4GDPA 1KDGA 3ALJA 4H4PA 2GB0A 1PXCA 4Z2RA 3WE0A 4GRTA 3ICRA 1NEKA 4IVMB 5J7XA 3F8PA 2BABA 5FS6A 3DGHA 1YQ4A 1E1KA 4OVIA 1ONFA 2GQWA 3NN0X 2H89A 1O5WA 4X9MA 2WPEA 3QSSA 4UDQA 3VRDB 5L46A 2EQ7A 4ZN0A 4P9SA 3NYFA 4A6NA 4BK3A 5M10A 1E7PA 2DKIA 4O5QA 4RG4A 1D5TA 1E6EA 1GNDA 2C64A 2X50A 1O95A 4H4RA 1E1NA 3BHFA 2FJAA 3CGDA 3V76A 3NRNA 2RGOA 4Z43A 1B4VA 2VVMA 1BGJA 1GRAA 3VQRA 4U8KA 3LADA 4GR1A 4K7ZA 2TPRA 1CF3A 3V3OA 3KA7A 4AP3A 3CNPA 2XVIA 2BXRA 2R9ZA 1H82A 5BRTA 2R4EA 3EAOA 3IHMA 4U8LA 2AR8A 1LPFA 1RYIA 2YG6A 2PHHA 3RNMA 4OPDA 5J60A 2OALA 1KF6A 4H4WA 1P2HA 4H7UA 4CNKA 1GPEA 2GMJA 2ZZCA 2WDQA 2B9WA 1PDHA 1S2QA 2BC0A 2WOVA 1JRZA 2YVFA 3IHGA 4OPGA 4D03A 3RP7A 2J3NA 2DKHA 1OJTA 2YR5A 5HHFA 2BXSA 1BKWA 3K30A 2BS2A 1TRBA 2WPCA 3AECA 4WCTA 4YTPA 3UOZA 2VVLG 1H7WA 2XLRA 5GRTA 1Z6LA 1QLBA 1FCDA 2GV8A 2GMHA 3FIMB 4PABA 2YLRA 1JOAA 1M64A 1GRBA 2Z5XA 3URHA 4BJZA 4B69A 4H50A 1NG3A 3UOXA 2VRLA 1TDEA 2CFYA 5CKUA 2WDRA 4YSYA 1YKJA 3ALLA 2C70A 4OPCA 4YSZA 3UKQA 4TM1A 4JY3A 4OPIA 3V3NA 4BK1A 3VR8A 3NLCA 2E5VA 3UTHA 4EIPA 1F8WA 3SFEA 4H2QA 1OJDA 1XANA 3SM8A 1S3BA 2XFUA 2R0GA 2E1MA 2FJDA 2Q0LA 1TDFA 4ICYA 4RG3A 3S5WA 3Q9TA 1DJQA 3Q6JA 5IPYA 4EQSA 3JSKA 3NG7X 1BWCA 2HQMA 3CGEA 2NPXA 1H84A 3P4PA 2X8GA 1N4WA 4U2SA 3UKFA 1L9DA 5JCNA 2Z5YA 4Y4MA 2UZZA 3NYCA 2VQBA 2EQ6A 1ZP0A 2JB2A 2C7GA 3M0OA 2YLSA 4C3XA 2WBAA 3H4KA 1LTXR 1K0JA 3CPJG 3M12A 2GH5A 3ATQA 1ZKQA 1P2EA 3GMBA 1GEUA 2XDOA 3II4A 1S2YA 2B9YA 1H7XA 4UP3A 5IQ4A 3ICTA 4MJWA 3GDPA 4LA1A 1OJ9A 1JRYA 4K5RA 2E4GA 4B68A 3DGZA 4H2PA 2CULA 1QO8A 3IC9A 4GUVA 4NTCA 3F8DA 5JCKA 2YG7A 4D04A 2WHDA 1PBBA 4J31A 3AEDA 3I3LA 1ZX9A 1CC4A 4GCMA 5FS8A 2XFOA 1PJ5A 1KNRA 2WP9A 3AEGA 3BNMA 1XDIA 1PN0A 3OZ2A 3ISHA 1VG0A 2XLTA 5EB5A 1GREA 3AYIA 4U8JA 3QVRA 3I6DA 1X31B 2XLPA 3QSEA 1D7YA 2YG3A 3NK2X 1VDCA 2I0ZA 3VRBA 3AEEA 2RGHA 1ZMDA 3AE2A 4U8IA 3AD7B 1H86A 1OJAA 2JB3A 1VG9A 3L1RA 4C5OA 3SGLA 4FDCB 1L0VA 1DOBA 2V6OA 3BI5A 2BS3A 4O5UA 4U8OA 4C3YA 4ECHA 5LV9A 2YAUA 1OJCA 2Q7VA 3G5SA 2XCGA 3CGBA 1TDOA 1XHCA 4Y4NA 3UTGA 4FK1C 2YG5A 1TDKA 2NVKX 4U2LA 4J36A 4A9WA 3AE8A 2WETA 1FEAA 2YWLA 3B6DA 3ZDNA 4DGKA 4Z26A 4DSGA 4E0VA 1NAAA 1CL0A 1LQTA 3AE7A 1NHPA 3COXA 3M13A 3H8LA 1F8RA 4APNA 4EQXA 4YKFA 3CN8A 4PAAA 2GVCA 4CBQA 1ELIA 4K8DA 4OCGA 3GSIA 1H81A 4NTEA 3LOVA 4A7AA 1XPQA 3EF6A 4YTNA 5BULA 4J34A 4A99A 1Q1WA 2YLZA 2A8XA 3GMCA 4H4SA 2OA1A 3QFBA 1K0IA 4H4XA 3AEAA 3GD4A 3AE4A 2IVDA 2V3AA 4Z2UA 4M52A 4EQWA 1EL8A 3AE6A 3DJEA 2Q6UA 3BI4A 1GTEA 1NDAA 2WQYA 1PS9A 2YLWA 4YKGA 1REOA 4BK2A 4HA6A 1GERA 1YY5A 4UDRA 2WU5A 3NH3X 4NTDA 4YSHA 1VQWA 2GF3A 3AD8B 2C76A 3K7MX 2VVLA 2JB1A 2OLNA 4H4UA 5HXIA 3GWFA 2BK4A 3SQPA 3ITJA 4GDEA 1JEHA 1DODA 1K4QA 4RSLA 3NT6A 3KLJA 2XLUA 1YQ3A 4U2TA 3UTFA 2WOIA 4K22A 3DMEA 5KOWA 1CC2A 3K7TA 4I59A 5FS9A 4K2XA 2APGA 2XVJA 2GR2A 3KD9A 4IA6A 3CPIG 1N4VA 1NHSA 3KKJA 3B3RA 2BCGG 2AQJA 4LU6A 5GSNA 4EMIA 1PBEA 1DJNA 2AAQA 1BF3A 2WS3A 1GRFA 2YR6A 3AE1A 1D4CA 5M0ZA 2ZZBA 1F3PA 1LV0A 2X8CA 3C4AA 1TYTA 1EBDA 1GALA 4N9XA 1N1PA 4NEVA 4ZCCA 4EM3A 2R46A 3AE3A 4Z25A 4AOSA 3NTAA 3IF9A 2ACZA 1PBCA 2H88A 4Y4LA 1GSNA 1JNRA 4EQRA 5HYMA 3BNUA 2C3CA 4JN9A 2C72A 3HZLA 4H4YA 3K7QX 4JQ9A 3AD9B 4A6NB 1ZOVA 4JNAA 4FK1A 1PBFA 1PJ6A 2FJBA 2FJEA 5BUKA 4IA5A 3CTYA 2TMDA 2X8HA 4LIIA 2JBVA 4YSXA 1K0LA 1KSSA 5KOXA 2XVHA 2WP6A 4I58A 2WEUA 5JCLA 1D4DA 1FEBA 2QCUA 2B9XA 3ABVA 4J2WA 3UOVA 2YVGA 2JK6A 2QA1A 3DA1A 2WPFA 4XWZA 4Z2TA 1SEZA 5FS7A 5JCIA 3H8IA 3C4NA 1NHQA 4BV6A 1AOGA 1LJ1A 3P9UA 1F8SA 2ZZ0A 1GRGA 2BYBA 5KVIA 3DJGX 3BHKA 3GYIA 2C67A 1GV4A 2V60A 3QJ4A 2OAMA 2YG4A 3VR9A 3AEBA 5FMHA 2BCPA 4IV9A 3QSMA 2GR3A 5KVHA 4KX6A 4YWOA 4X4JA 5DBJA 5C3JA 4CCRA 3NTDA 4JY2A 2JKCA 1NG4A 4OPLA 4H4ZA 1TYPA 2V61A 1MOKA 5TR3A 3NYEA 4UDPA 5JCMA 1CC6A 5U63A 1E39A 2WDVA 2XFPA 3AEFA 4X9NA 2YLTA 4TM0A 1E1LA 2YM1A 3AYLA 1H6VA 3CPHG 3UKAA 4B63A 4REKA 1IJHA 1COYA 5CQFA 3NNEA 4U8NA 1M6IA 1PXBA 4USRA 2VQ7A 5KRQA 4B67A 1GRHA 3GWDA 1DOEA 1GESA 3RHAA 1KNPA 2B76A 4YXDA 4WX1A 3L8KA 1RSGA 1RP0A 4AT0A 2XVEA 4BURA 5C2TA 5ER0A 4KPRA 4J57A 1E1MA 4NEWA 3P4SA 1PXAA 1GTHA 2R45A 1CJ2A 3G5RA 3DK8A 3FPZA 4YT0A 2GEWA 3P1WA 3S61A 2XVFA 3UKPA 3RP8A 3EANA 3CNSA 2V3BA 3OC4A 4C77A 1QJDA 1ZK7A 4TM3A 2Q0KA 1GOSA 2XFQA 3F8RA 1MXTA 2BK3A 2X99A 3LJPA 3AE9A 4Z24A 3VRAA 1FECA 1Y0PA 3GD3A 4J56A 3LZWA 3LB8A 5EB4A 2BK5A 3LZXA 3NK0X 1UKVG 4TLZA 4IVOB 3PO7A 3G5QA 3ZYXA 1ZMCA 1LVLA 1B8SA 2C66A 1Y56B 5U25A 4EMWA 1B37A 4OPUA 2ARDA 2JAEA 1D7LA 4A65A 3DH9A 3AE5A 2C65A 3FG2P 5EBKA 1BZLA 4EM4A 3GYJA 3ICSA 3KVEA 1DOCA 1JU2A 1YQZA 3P4QA 1N4UA 1H83A 4K5SA 2IIDA 2WESA 3REDA 2R4JA 4JDRA 3CNDA 3FBSA 1CJ3A 3NN6X 3UKLA 3AWIA 3CGCA 4Z44A 3UKHA 2RGJA 1JNZA 2GR0A 4H4VA 1IUUA 1EL5A 4NZHA 3NIXA 2YQUA 4AT2A 1GETA 2XYOA 1MO9A 2O9ZA 2C3DA 1CHUA 1NENA 3EPTA 2R0PA 4TLXA 1CJ4A 1EL9A 1KFYA 2WU2A 1PHHA 2X3NA 2W0HA 3ALMA 3UCLA 3NK1X 1IUXA 3UP5A 3AXBA 3KU9A 4OPTA 1IUTA 2Y6RA 2BS4A 2YVJA 3E1TA 4U8PA 1LQUA 5KXJA 1Q1RA 4H2NA 1V59A 4B65A 2YR4A 1TDNA 2Y6QA 1NPXA 1IUSA 2BA9A 3C96A 2GQFA 1PJ7A 2A89A 3GRTA 3AB1A 1KSUA 4JNQA 4B66A 1Y56A 5U1OA 2F5ZA 4DSHA 2GR1A 1PBDA 4U8MA 2EQ9A 5BVAA 1D4EA 3GDNA 2XLSA 2WOWA 2ZBWA 1FL2A 2OLOA 5EOWA 3UP4A 1CBOA 3P4RA 1ZDLA 4CRTA 2PYXA 2XFNA 2A87A 1IUWA 4YTMA 3RP6A 4AP1A 3PVCA 4H4QA 3DJDA 3ATRA 3IWAA 4B64A 1GT8A 1F6MA 3ADAB 4BJYA 1IUVA 1JRXA 3D8XA 1O94A 3KPFA 3PS9A 1B5QA 4H2RA 1DNCA 4DNAA 2GAHB 2VOUA 4EMJA 2FBWA 3LXDA 1GXFA 3UOYA 2B7SA 4XWRA 3CIRA 1VRQB 4TM4A 4CCQA 2BACA 3NKSA 4ADWA 2YM2A 1DXLA 3UTEA 3DJJA 2RABA 4FX9A 1HYUA 2QA2A 2QAEA 2R0CA 4HB9A 1Q9IA 4A79A 3NHOX 4CY6A 1FOHA 1W4XA 4J33A 3R9UA 5KWFA 2YLXA 4C74A 4CY8A 2B7RA 1ZOYA 2VZ2A 3CNJA 1BGNA 2VRMA 3QVPA 3DK9A 4ZCDA 3DK4A 3GRSA 4EIQA 2GAGB 2IVEA 3UKKA
chains in the Genus database with same CATH superfamily
3O0HA 1ZY8A 1NHRA 5HY5A 4GF7A 3QFAA 4A5LA 1GRTA 1L9CA 1CJCA 2BC1A 2C73A 2V5ZA 3D1CA 3AYJA 2WP5A 3SFDA 3NGCX 2C75A 2GRTA 1EL7A 4B1BA 3FMWA 3BI2A 5IQ1A 4CNJA 2CVJA 1L9EA 1S3EA 3T37A 2EQ8A 4AOXA 4XXGA 2CDUA 3CNTA 4G6HA 4H4TA 4GDPA 1KDGA 3ALJA 4USQA 4H4PA 2GB0A 1PXCA 4Z2RA 3WE0A 4GRTA 3ICRA 1NEKA 4IVMB 5J7XA 3F8PA 2BABA 5FS6A 3DGHA 1YQ4A 1E1KA 4OVIA 1ONFA 2GQWA 3HYXA 2H89A 3NN0X 3SZ0A 1O5WA 4X9MA 5KMSA 2WPEA 3QSSA 4UDQA 3VRDB 5L46A 2EQ7A 4ZN0A 4P9SA 3NYFA 4A6NA 4BK3A 5M10A 1E7PA 2DKIA 4O5QA 4RG4A 1D5TA 1E6EA 1GNDA 2C64A 2X50A 1O95A 4H4RA 1E1NA 3BHFA 2FJAA 3CGDA 3V76A 3NRNA 2RGOA 4Z43A 1B4VA 2VVMA 1BGJA 1GRAA 3VQRA 4U8KA 3LADA 4GR1A 4K7ZA 2TPRA 1CF3A 3SZWA 3KA7A 3V3OA 3CNPA 4AP3A 2XVIA 2BXRA 2R9ZA 1H82A 5BRTA 2R4EA 3EAOA 3IHMA 4U8LA 2AR8A 1LPFA 1RYIA 2YG6A 2PHHA 3RNMA 4OPDA 5J60A 2OALA 1KF6A 4H4WA 1P2HA 4H7UA 4CNKA 1GPEA 2GMJA 3HYVA 2ZZCA 2WDQA 2B9WA 1PDHA 1S2QA 2BC0A 2WOVA 1JRZA 2YVFA 3IHGA 4OPGA 4D03A 3RP7A 2J3NA 2DKHA 1OJTA 2YR5A 5HHFA 2BXSA 1BKWA 3K30A 2BS2A 1TRBA 2WPCA 3AECA 4WCTA 4YTPA 3UOZA 2VVLG 4G6GA 1H7WA 2XLRA 5GRTA 1Z6LA 1QLBA 1FCDA 2GV8A 2GMHA 3FIMB 4PABA 2YLRA 1JOAA 1M64A 1GRBA 2Z5XA 3URHA 4BJZA 4B69A 4H50A 1NG3A 3T2KA 3UOXA 2VRLA 1TDEA 2CFYA 5CKUA 2WDRA 4YSYA 1YKJA 3ALLA 2C70A 4GAVA 4OPCA 4YSZA 3UKQA 4TM1A 4JY3A 4OPIA 3V3NA 4BK1A 3VR8A 3NLCA 2E5VA 3UTHA 4EIPA 1F8WA 3SFEA 4H2QA 1OJDA 3T14A 1XANA 3SM8A 1S3BA 2XFUA 4NNJA 2R0GA 2E1MA 2FJDA 2Q0LA 1TDFA 4ICYA 4RG3A 3S5WA 3Q9TA 1DJQA 4G73A 3SZCA 3Q6JA 5IPYA 4EQSA 3JSKA 3NG7X 1BWCA 2HQMA 3CGEA 2NPXA 1H84A 3P4PA 2X8GA 3SZFA 1N4WA 4U2SA 3UKFA 1L9DA 5JCNA 2Z5YA 4Y4MA 2UZZA 3NYCA 2VQBA 4GAPA 3SYIA 2EQ6A 1ZP0A 2JB2A 2C7GA 3M0OA 2YLSA 4C3XA 2WBAA 3H4KA 4II3A 1LTXR 1K0JA 3CPJG 3M12A 2GH5A 3ATQA 1ZKQA 1P2EA 3GMBA 1GEUA 2XDOA 3II4A 1S2YA 2B9YA 1H7XA 4UP3A 5IQ4A 3ICTA 4MJWA 3GDPA 4LA1A 1OJ9A 1JRYA 4K5RA 2E4GA 4B68A 3DGZA 4H2PA 2CULA 1QO8A 3IC9A 4GUVA 4NTCA 3F8DA 5JCKA 2YG7A 4D04A 2WHDA 1PBBA 4J31A 3AEDA 3I3LA 1ZX9A 1CC4A 4GCMA 5FS8A 2XFOA 1PJ5A 1KNRA 2WP9A 3AEGA 3BNMA 1XDIA 1PN0A 3OZ2A 3ISHA 1VG0A 2XLTA 5EB5A 1GREA 3AYIA 4U8JA 3QVRA 3I6DA 1X31B 2XLPA 3QSEA 1D7YA 2YG3A 3NK2X 2BRAA 1VDCA 2I0ZA 3VRBA 3AEEA 2RGHA 1ZMDA 3AE2A 4U8IA 3AD7B 1H86A 1OJAA 2JB3A 1VG9A 3L1RA 4C5OA 3SGLA 4FDCB 1L0VA 1DOBA 2V6OA 3BI5A 2BS3A 4O5UA 4U8OA 4C3YA 4ECHA 5LV9A 2YAUA 1OJCA 2Q7VA 3G5SA 2XCGA 3CGBA 1TDOA 1XHCA 4Y4NA 3UTGA 4FK1C 2YG5A 1TDKA 3T31A 2NVKX 4U2LA 4J36A 4A9WA 3AE8A 2WETA 1FEAA 2YWLA 3B6DA 3ZDNA 4DGKA 4Z26A 4DSGA 4E0VA 1NAAA 1CL0A 1LQTA 3AE7A 1NHPA 3COXA 3M13A 3H8LA 1F8RA 5KMQA 4APNA 4EQXA 4YKFA 3CN8A 4PAAA 2GVCA 4CBQA 1ELIA 4K8DA 4OCGA 3GSIA 1H81A 4NTEA 3LOVA 4A7AA 1XPQA 3EF6A 4YTNA 5BULA 4J34A 4A99A 1Q1WA 2YLZA 2A8XA 3GMCA 4G9KA 2OA1A 3QFBA 1K0IA 4H4SA 3AEAA 4H4XA 3GD4A 3AE4A 2IVDA 2V3AA 4Z2UA 4M52A 4EQWA 1EL8A 3AE6A 3DJEA 2Q6UA 3BI4A 1GTEA 1NDAA 2WQYA 1PS9A 2YLWA 4YKGA 1REOA 4BK2A 4HA6A 1GERA 1YY5A 4UDRA 2WU5A 3NH3X 4NTDA 4YSHA 1VQWA 2GF3A 3AD8B 2C76A 3K7MX 2VVLA 2JB1A 5KMPA 2OLNA 4H4UA 5HXIA 3GWFA 3GYXA 2BK4A 3SQPA 3ITJA 4GDEA 1JEHA 1DODA 1K4QA 4RSLA 3NT6A 3KLJA 3SXIA 2XLUA 1YQ3A 4U2TA 3UTFA 2WOIA 4K22A 3DMEA 5KOWA 1CC2A 3K7TA 4I59A 5FS9A 4K2XA 2APGA 2XVJA 2GR2A 3KD9A 4IA6A 3CPIG 1N4VA 1NHSA 3KKJA 3B3RA 2BCGG 2AQJA 4LU6A 5GSNA 4EMIA 1PBEA 1DJNA 2AAQA 1BF3A 2WS3A 1GRFA 2YR6A 3AE1A 1D4CA 5M0ZA 2ZZBA 1F3PA 1LV0A 2X8CA 3C4AA 1TYTA 1EBDA 1GALA 4N9XA 1N1PA 4NEVA 4ZCCA 4EM3A 2R46A 3AE3A 4Z25A 4AOSA 3NTAA 3IF9A 2ACZA 1PBCA 2H88A 4Y4LA 1GSNA 1JNRA 4EQRA 5HYMA 3BNUA 2C3CA 4JN9A 2C72A 3HZLA 4H4YA 3K7QX 4JQ9A 3AD9B 5KMRA 4A6NB 1ZOVA 4NWZA 4JNAA 4FK1A 1PBFA 1PJ6A 2FJBA 2FJEA 5BUKA 4IA5A 3CTYA 2TMDA 2X8HA 4LIIA 2JBVA 4YSXA 1K0LA 1KSSA 3T0KA 5KOXA 2XVHA 2WP6A 4I58A 2WEUA 5JCLA 1D4DA 1FEBA 2QCUA 2B9XA 3ABVA 4J2WA 3UOVA 2YVGA 2JK6A 2QA1A 3DA1A 2WPFA 4XWZA 4Z2TA 1SEZA 5FS7A 5JCIA 3H8IA 3C4NA 1NHQA 4BV6A 1AOGA 1LJ1A 3P9UA 1F8SA 2ZZ0A 1GRGA 2BYBA 5KVIA 3DJGX 3BHKA 3GYIA 2C67A 1GV4A 2V60A 3QJ4A 2OAMA 2YG4A 3VR9A 3AEBA 5FMHA 2BCPA 4IV9A 3QSMA 2GR3A 5KVHA 4KX6A 4YWOA 4X4JA 5DBJA 5C3JA 4CCRA 3NTDA 4JY2A 2JKCA 1NG4A 4OPLA 4H4ZA 1TYPA 2V61A 1MOKA 5TR3A 3NYEA 4UDPA 5JCMA 3CMMA 1CC6A 5U63A 1E39A 2WDVA 2XFPA 3AEFA 4X9NA 2YLTA 4TM0A 1E1LA 2YM1A 3AYLA 1H6VA 3CPHG 3UKAA 4B63A 4REKA 1IJHA 1COYA 4G74A 5CQFA 3NNEA 4U8NA 1M6IA 1PXBA 4USRA 2VQ7A 5KRQA 4B67A 1GRHA 3GWDA 1DOEA 1GESA 3RHAA 1KNPA 2B76A 4YXDA 4WX1A 3L8KA 1RSGA 1RP0A 4AT0A 2XVEA 4BURA 5C2TA 5ER0A 4KPRA 4J57A 1E1MA 4NEWA 3P4SA 1PXAA 1GTHA 2R45A 1CJ2A 3G5RA 3DK8A 3FPZA 4YT0A 2GEWA 3P1WA 3S61A 2XVFA 3UKPA 3RP8A 3EANA 3CNSA 2V3BA 3HYWA 3OC4A 4C77A 1QJDA 1ZK7A 4TM3A 2Q0KA 1GOSA 2XFQA 3F8RA 1MXTA 2BK3A 2X99A 3LJPA 3AE9A 4Z24A 3VRAA 1FECA 1Y0PA 3GD3A 4J56A 3LZWA 3LB8A 5EB4A 2BK5A 3LZXA 3NK0X 1UKVG 4TLZA 4IVOB 3PO7A 3G5QA 3ZYXA 1ZMCA 1LVLA 1B8SA 2C66A 1Y56B 5U25A 4EMWA 1B37A 4OPUA 2ARDA 2JAEA 1D7LA 4A65A 3DH9A 3AE5A 2C65A 3FG2P 5EBKA 3T2ZA 1BZLA 4EM4A 3GYJA 3ICSA 3KVEA 1DOCA 1JU2A 1YQZA 3P4QA 1N4UA 1H83A 4K5SA 2IIDA 2WESA 3REDA 2R4JA 4JDRA 3CNDA 3FBSA 1CJ3A 3NN6X 3UKLA 3AWIA 3CGCA 4Z44A 3UKHA 2RGJA 1JNZA 2GR0A 4H4VA 1IUUA 1EL5A 4NZHA 3NIXA 2YQUA 4AT2A 1GETA 2XYOA 1MO9A 2C4CA 2O9ZA 2C3DA 1CHUA 1NENA 3EPTA 2R0PA 4TLXA 1CJ4A 1EL9A 1KFYA 2WU2A 1PHHA 2X3NA 2W0HA 3ALMA 3UCLA 3NK1X 1IUXA 3UP5A 3AXBA 3KU9A 4OPTA 4II2A 1IUTA 2Y6RA 2BS4A 2YVJA 3E1TA 3SX6A 4U8PA 1LQUA 5KXJA 1Q1RA 4H2NA 1V59A 4B65A 2YR4A 5KNLA 1TDNA 2Y6QA 1NPXA 1IUSA 2BA9A 3C96A 2GQFA 1PJ7A 2A89A 3GRTA 3AB1A 1KSUA 4JNQA 4B66A 1Y56A 5U1OA 2F5ZA 4DSHA 3KPKA 2GR1A 1PBDA 4U8MA 2EQ9A 5BVAA 1D4EA 3GDNA 2XLSA 3SY4A 2WOWA 2ZBWA 1FL2A 2OLOA 5EOWA 3UP4A 1CBOA 3P4RA 2BRYA 1ZDLA 4CRTA 2PYXA 2XFNA 2A87A 1IUWA 4YTMA 3RP6A 4AP1A 3PVCA 4H4QA 3DJDA 3ATRA 3IWAA 4B64A 1GT8A 1F6MA 3ADAB 4BJYA 1IUVA 1JRXA 3D8XA 1O94A 3KPFA 3PS9A 1B5QA 4H2RA 1DNCA 4DNAA 2GAHB 2VOUA 4EMJA 2FBWA 3LXDA 1GXFA 3UOYA 2B7SA 4XWRA 3CIRA 1VRQB 4TM4A 4CCQA 2BACA 3NKSA 4ADWA 2YM2A 1DXLA 3UTEA 3DJJA 2RABA 4FX9A 1HYUA 2QA2A 2QAEA 2R0CA 4HB9A 1Q9IA 4A79A 3NHOX 4CY6A 1FOHA 1W4XA 4J33A 3R9UA 5KWFA 2YLXA 4C74A 4CY8A 2B7RA 1ZOYA 2VZ2A 3CNJA 1BGNA 2VRMA 3QVPA 3DK9A 4ZCDA 3DK4A 3T2YA 3GRSA 4EIQA 2GAGB 2IVEA 3UKKA
chains in the Genus database with same CATH topology
3O0HA 1ZY8A 1NHRA 5HY5A 4GF7A 3QFAA 4A5LA 1GRTA 1L9CA 1CJCA 2BC1A 2C73A 2V5ZA 3D1CA 3AYJA 2WP5A 3SFDA 3NGCX 2C75A 2GRTA 1EL7A 4B1BA 3FMWA 3BI2A 5IQ1A 4CNJA 2CVJA 1L9EA 1S3EA 3T37A 2EQ8A 4AOXA 4XXGA 2CDUA 3CNTA 4G6HA 4H4TA 4GDPA 1KDGA 3ALJA 4USQA 4H4PA 2GB0A 1PXCA 4Z2RA 3WE0A 4GRTA 3ICRA 1NEKA 4IVMB 5J7XA 3F8PA 2BABA 5FS6A 3DGHA 1YQ4A 1E1KA 4OVIA 1ONFA 2GQWA 3HYXA 2H89A 3NN0X 3SZ0A 1O5WA 4X9MA 5KMSA 2WPEA 3QSSA 4UDQA 3VRDB 5L46A 2EQ7A 4ZN0A 4P9SA 3NYFA 4A6NA 4BK3A 5M10A 1E7PA 2DKIA 4O5QA 4RG4A 1D5TA 1E6EA 1GNDA 2C64A 2X50A 1O95A 4H4RA 1E1NA 3BHFA 2FJAA 3CGDA 3V76A 3NRNA 2RGOA 4Z43A 1B4VA 2VVMA 1BGJA 1GRAA 3VQRA 4U8KA 3LADA 4GR1A 4K7ZA 2TPRA 1CF3A 3SZWA 3KA7A 3V3OA 3CNPA 4AP3A 2XVIA 2BXRA 2R9ZA 1H82A 5BRTA 2R4EA 3EAOA 3IHMA 4U8LA 2AR8A 1LPFA 1RYIA 2YG6A 2PHHA 3RNMA 4OPDA 5J60A 2OALA 1KF6A 4H4WA 1P2HA 4H7UA 4CNKA 1GPEA 2GMJA 3HYVA 2ZZCA 2WDQA 2B9WA 1PDHA 1S2QA 2BC0A 2WOVA 1JRZA 2YVFA 3IHGA 4OPGA 4D03A 3RP7A 2J3NA 2DKHA 1OJTA 2YR5A 5HHFA 2BXSA 1BKWA 3K30A 2BS2A 1TRBA 2WPCA 3AECA 4WCTA 4YTPA 3UOZA 2VVLG 4G6GA 1H7WA 2XLRA 5GRTA 1Z6LA 1QLBA 1FCDA 2GV8A 2GMHA 3FIMB 4PABA 2YLRA 1JOAA 1M64A 1GRBA 2Z5XA 3URHA 4BJZA 4B69A 4H50A 1NG3A 3T2KA 3UOXA 2VRLA 1TDEA 2CFYA 5CKUA 2WDRA 4YSYA 1YKJA 3ALLA 2C70A 4GAVA 4OPCA 4YSZA 3UKQA 4TM1A 4JY3A 4OPIA 3V3NA 4BK1A 3VR8A 3NLCA 2E5VA 3UTHA 4EIPA 1F8WA 3SFEA 4H2QA 1OJDA 3T14A 1XANA 3SM8A 1S3BA 2XFUA 4NNJA 2R0GA 2E1MA 2FJDA 2Q0LA 1TDFA 4ICYA 4RG3A 3S5WA 3Q9TA 1DJQA 4G73A 3SZCA 3Q6JA 5IPYA 4EQSA 3JSKA 3NG7X 1BWCA 2HQMA 3CGEA 2NPXA 1H84A 3P4PA 2X8GA 3SZFA 1N4WA 4U2SA 3UKFA 1L9DA 5JCNA 2Z5YA 4Y4MA 2UZZA 3NYCA 2VQBA 4GAPA 3SYIA 2EQ6A 1ZP0A 2JB2A 2C7GA 3M0OA 2YLSA 4C3XA 2WBAA 3H4KA 4II3A 1LTXR 1K0JA 3CPJG 3M12A 2GH5A 3ATQA 1ZKQA 1P2EA 3GMBA 1GEUA 2XDOA 3II4A 1S2YA 2B9YA 1H7XA 4UP3A 5IQ4A 3ICTA 4MJWA 3GDPA 4LA1A 1OJ9A 1JRYA 4K5RA 2E4GA 4B68A 3DGZA 4H2PA 2CULA 1QO8A 3IC9A 4GUVA 4NTCA 3F8DA 5JCKA 2YG7A 4D04A 2WHDA 1PBBA 4J31A 3AEDA 3I3LA 1ZX9A 1CC4A 4GCMA 5FS8A 2XFOA 1PJ5A 1KNRA 2WP9A 3AEGA 3BNMA 1XDIA 1PN0A 3OZ2A 3ISHA 1VG0A 2XLTA 5EB5A 1GREA 3AYIA 4U8JA 3QVRA 3I6DA 1X31B 2XLPA 3QSEA 1D7YA 2YG3A 3NK2X 2BRAA 1VDCA 2I0ZA 3VRBA 3AEEA 2RGHA 1ZMDA 3AE2A 4U8IA 3AD7B 1H86A 1OJAA 2JB3A 1VG9A 3L1RA 4C5OA 3SGLA 4FDCB 1L0VA 1DOBA 2V6OA 3BI5A 2BS3A 4O5UA 4U8OA 4C3YA 4ECHA 5LV9A 2YAUA 1OJCA 2Q7VA 3G5SA 2XCGA 3CGBA 1TDOA 1XHCA 4Y4NA 3UTGA 4FK1C 2YG5A 1TDKA 3T31A 2NVKX 4U2LA 4J36A 4A9WA 3AE8A 2WETA 1FEAA 2YWLA 3B6DA 3ZDNA 4DGKA 4Z26A 4DSGA 4E0VA 1NAAA 1CL0A 1LQTA 3AE7A 1NHPA 3COXA 3M13A 3H8LA 1F8RA 5KMQA 4APNA 4EQXA 4YKFA 3CN8A 4PAAA 2GVCA 4CBQA 1ELIA 4K8DA 4OCGA 3GSIA 1H81A 4NTEA 3LOVA 4A7AA 1XPQA 3EF6A 4YTNA 5BULA 4J34A 4A99A 1Q1WA 2YLZA 2A8XA 3GMCA 4G9KA 2OA1A 3QFBA 1K0IA 4H4SA 3AEAA 4H4XA 3GD4A 3AE4A 2IVDA 2V3AA 4Z2UA 4M52A 4EQWA 1EL8A 3AE6A 3DJEA 2Q6UA 3BI4A 1GTEA 1NDAA 2WQYA 1PS9A 2YLWA 4YKGA 1REOA 4BK2A 4HA6A 1GERA 1YY5A 4UDRA 2WU5A 3NH3X 4NTDA 4YSHA 1VQWA 2GF3A 3AD8B 2C76A 3K7MX 2VVLA 2JB1A 5KMPA 2OLNA 4H4UA 5HXIA 3GWFA 3GYXA 2BK4A 3SQPA 3ITJA 4GDEA 1JEHA 1DODA 1K4QA 4RSLA 3NT6A 3KLJA 3SXIA 2XLUA 1YQ3A 4U2TA 3UTFA 2WOIA 4K22A 3DMEA 5KOWA 1CC2A 3K7TA 4I59A 5FS9A 4K2XA 2APGA 2XVJA 2GR2A 3KD9A 4IA6A 3CPIG 1N4VA 1NHSA 3KKJA 3B3RA 2BCGG 2AQJA 4LU6A 5GSNA 4EMIA 1PBEA 1DJNA 2AAQA 1BF3A 2WS3A 1GRFA 2YR6A 3AE1A 1D4CA 5M0ZA 2ZZBA 1F3PA 1LV0A 2X8CA 3C4AA 1TYTA 1EBDA 1GALA 4N9XA 1N1PA 4NEVA 4ZCCA 4EM3A 2R46A 3AE3A 4Z25A 4AOSA 3NTAA 3IF9A 2ACZA 1PBCA 2H88A 4Y4LA 1GSNA 1JNRA 4EQRA 5HYMA 3BNUA 2C3CA 4JN9A 2C72A 3HZLA 4H4YA 3K7QX 4JQ9A 3AD9B 5KMRA 4A6NB 1ZOVA 4NWZA 4JNAA 4FK1A 1PBFA 1PJ6A 2FJBA 2FJEA 5BUKA 4IA5A 3CTYA 2TMDA 2X8HA 4LIIA 2JBVA 4YSXA 1K0LA 1KSSA 3T0KA 5KOXA 2XVHA 2WP6A 4I58A 2WEUA 5JCLA 1D4DA 1FEBA 2QCUA 2B9XA 3ABVA 4J2WA 3UOVA 2YVGA 2JK6A 2QA1A 3DA1A 2WPFA 4XWZA 4Z2TA 1SEZA 5FS7A 5JCIA 3H8IA 3C4NA 1NHQA 4BV6A 1AOGA 1LJ1A 3P9UA 1F8SA 2ZZ0A 1GRGA 2BYBA 5KVIA 3DJGX 3BHKA 3GYIA 2C67A 1GV4A 2V60A 3QJ4A 2OAMA 2YG4A 3VR9A 3AEBA 5FMHA 2BCPA 4IV9A 3QSMA 2GR3A 5KVHA 4KX6A 4YWOA 4X4JA 5DBJA 5C3JA 4CCRA 3NTDA 4JY2A 2JKCA 1NG4A 4OPLA 4H4ZA 1TYPA 2V61A 1MOKA 5TR3A 3NYEA 4UDPA 5JCMA 3CMMA 1CC6A 5U63A 1E39A 2WDVA 2XFPA 3AEFA 4X9NA 2YLTA 4TM0A 1E1LA 2YM1A 3AYLA 1H6VA 3CPHG 3UKAA 4B63A 4REKA 1IJHA 1COYA 4G74A 5CQFA 3NNEA 4U8NA 1M6IA 1PXBA 4USRA 2VQ7A 5KRQA 4B67A 1GRHA 3GWDA 1DOEA 1GESA 3RHAA 1KNPA 2B76A 4YXDA 4WX1A 3L8KA 1RSGA 1RP0A 4AT0A 2XVEA 4BURA 5C2TA 5ER0A 4KPRA 4J57A 1E1MA 4NEWA 3P4SA 1PXAA 1GTHA 2R45A 1CJ2A 3G5RA 3DK8A 3FPZA 4YT0A 2GEWA 3P1WA 3S61A 2XVFA 3UKPA 3RP8A 3EANA 3CNSA 2V3BA 3HYWA 3OC4A 4C77A 1QJDA 1ZK7A 4TM3A 2Q0KA 1GOSA 2XFQA 3F8RA 1MXTA 2BK3A 2X99A 3LJPA 3AE9A 4Z24A 3VRAA 1FECA 1Y0PA 3GD3A 4J56A 3LZWA 3LB8A 5EB4A 2BK5A 3LZXA 3NK0X 1UKVG 4TLZA 4IVOB 3PO7A 3G5QA 3ZYXA 1ZMCA 1LVLA 1B8SA 2C66A 1Y56B 5U25A 4EMWA 1B37A 4OPUA 2ARDA 2JAEA 1D7LA 4A65A 3DH9A 3AE5A 2C65A 3FG2P 5EBKA 3T2ZA 1BZLA 4EM4A 3GYJA 3ICSA 3KVEA 1DOCA 1JU2A 1YQZA 3P4QA 1N4UA 1H83A 4K5SA 2IIDA 2WESA 3REDA 2R4JA 4JDRA 3CNDA 3FBSA 1CJ3A 3NN6X 3UKLA 3AWIA 3CGCA 4Z44A 3UKHA 2RGJA 1JNZA 2GR0A 4H4VA 1IUUA 1EL5A 4NZHA 3NIXA 2YQUA 4AT2A 1GETA 2XYOA 1MO9A 2C4CA 2O9ZA 2C3DA 1CHUA 1NENA 3EPTA 2R0PA 4TLXA 1CJ4A 1EL9A 1KFYA 2WU2A 1PHHA 2X3NA 2W0HA 3ALMA 3UCLA 3NK1X 1IUXA 3UP5A 3AXBA 3KU9A 4OPTA 4II2A 1IUTA 2Y6RA 2BS4A 2YVJA 3E1TA 3SX6A 4U8PA 1LQUA 5KXJA 1Q1RA 4H2NA 1V59A 4B65A 2YR4A 5KNLA 1TDNA 2Y6QA 1NPXA 1IUSA 2BA9A 3C96A 2GQFA 1PJ7A 2A89A 3GRTA 3AB1A 1KSUA 4JNQA 4B66A 1Y56A 5U1OA 2F5ZA 4DSHA 3KPKA 2GR1A 1PBDA 4U8MA 2EQ9A 5BVAA 1D4EA 3GDNA 2XLSA 3SY4A 2WOWA 2ZBWA 1FL2A 2OLOA 5EOWA 3UP4A 1CBOA 3P4RA 2BRYA 1ZDLA 4CRTA 2PYXA 2XFNA 2A87A 1IUWA 4YTMA 3RP6A 4AP1A 3PVCA 4H4QA 3DJDA 3ATRA 3IWAA 4B64A 1GT8A 1F6MA 3ADAB 4BJYA 1IUVA 1JRXA 3D8XA 1O94A 3KPFA 3PS9A 1B5QA 4H2RA 1DNCA 4DNAA 2GAHB 2VOUA 4EMJA 2FBWA 3LXDA 1GXFA 3UOYA 2B7SA 4XWRA 3CIRA 1VRQB 4TM4A 4CCQA 2BACA 3NKSA 4ADWA 2YM2A 1DXLA 3UTEA 3DJJA 2RABA 4FX9A 1HYUA 2QA2A 2QAEA 2R0CA 4HB9A 1Q9IA 4A79A 3NHOX 4CY6A 1FOHA 1W4XA 4J33A 3R9UA 5KWFA 2YLXA 4C74A 4CY8A 2B7RA 1ZOYA 2VZ2A 3CNJA 1BGNA 2VRMA 3QVPA 3DK9A 4ZCDA 3DK4A 3T2YA 3GRSA 4EIQA 2GAGB 2IVEA 3UKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O0H A;  1ZY8 A;  1NHR A;  5HY5 A;  4GF7 A;  3QFA A;  4A5L A;  1GRT A;  1L9C A;  1CJC A;  2BC1 A;  2C73 A;  2V5Z A;  3D1C A;  3AYJ A;  2WP5 A;  3SFD A;  3NGC X;  2C75 A;  2GRT A;  1EL7 A;  4B1B A;  3FMW A;  3BI2 A;  5IQ1 A;  4CNJ A;  2CVJ A;  1L9E A;  1S3E A;  3T37 A;  2EQ8 A;  4AOX A;  4XXG A;  2CDU A;  3CNT A;  4USQ A;  4H4T A;  4GDP A;  1KDG A;  3ALJ A;  4H4P A;  2GB0 A;  1PXC A;  4Z2R A;  3WE0 A;  4GRT A;  3ICR A;  1NEK A;  4IVM B;  5J7X A;  3F8P A;  2BAB A;  5FS6 A;  3DGH A;  1YQ4 A;  1E1K A;  4OVI A;  1ONF A;  2GQW A;  3NN0 X;  2H89 A;  1O5W A;  4X9M A;  2WPE A;  3QSS A;  4UDQ A;  3VRD B;  5L46 A;  2EQ7 A;  4ZN0 A;  4P9S A;  3NYF A;  4A6N A;  4BK3 A;  5M10 A;  1E7P A;  2DKI A;  4O5Q A;  4RG4 A;  1D5T A;  1E6E A;  1GND A;  2C64 A;  2X50 A;  1O95 A;  4H4R A;  1E1N A;  3BHF A;  2FJA A;  3CGD A;  3V76 A;  3NRN A;  2RGO A;  4Z43 A;  1B4V A;  2VVM A;  1BGJ A;  1GRA A;  3VQR A;  4U8K A;  3LAD A;  4GR1 A;  4K7Z A;  2TPR A;  1CF3 A;  3V3O A;  3KA7 A;  4AP3 A;  3CNP A;  2XVI A;  2BXR A;  2R9Z A;  1H82 A;  5BRT A;  2R4E A;  3EAO A;  3IHM A;  4U8L A;  2AR8 A;  1LPF A;  1RYI A;  2YG6 A;  2PHH A;  3RNM A;  4OPD A;  5J60 A;  2OAL A;  1KF6 A;  4H4W A;  1P2H A;  4H7U A;  4CNK A;  1GPE A;  2GMJ A;  2ZZC A;  2WDQ A;  2B9W A;  1PDH A;  1S2Q A;  2BC0 A;  2WOV A;  1JRZ A;  2YVF A;  3IHG A;  4OPG A;  4D03 A;  3RP7 A;  2J3N A;  2DKH A;  1OJT A;  2YR5 A;  5HHF A;  2BXS A;  1BKW A;  3K30 A;  2BS2 A;  1TRB A;  2WPC A;  3AEC A;  4WCT A;  4YTP A;  3UOZ A;  2VVL G;  1H7W A;  2XLR A;  5GRT A;  1Z6L A;  1QLB A;  1FCD A;  2GV8 A;  2GMH A;  3FIM B;  4PAB A;  2YLR A;  1JOA A;  1M64 A;  1GRB A;  2Z5X A;  3URH A;  4BJZ A;  4B69 A;  4H50 A;  1NG3 A;  3UOX A;  2VRL A;  1TDE A;  2CFY A;  5CKU A;  2WDR A;  4YSY A;  1YKJ A;  3ALL A;  2C70 A;  4OPC A;  4YSZ A;  3UKQ A;  4TM1 A;  4JY3 A;  4OPI A;  3V3N A;  4BK1 A;  3VR8 A;  3NLC A;  2E5V A;  3UTH A;  4EIP A;  1F8W A;  3SFE A;  4H2Q A;  1OJD A;  1XAN A;  3SM8 A;  1S3B A;  2XFU A;  2R0G A;  2E1M A;  2FJD A;  2Q0L A;  1TDF A;  4ICY A;  4RG3 A;  3S5W A;  3Q9T A;  1DJQ A;  3Q6J A;  5IPY A;  4EQS A;  3JSK A;  3NG7 X;  1BWC A;  2HQM A;  3CGE A;  2NPX A;  1H84 A;  3P4P A;  2X8G A;  1N4W A;  4U2S A;  3UKF A;  1L9D A;  5JCN A;  2Z5Y A;  4Y4M A;  2UZZ A;  3NYC A;  2VQB A;  2EQ6 A;  1ZP0 A;  2JB2 A;  2C7G A;  3M0O A;  2YLS A;  4C3X A;  2WBA A;  3H4K A;  1LTX R;  1K0J A;  3CPJ G;  3M12 A;  2GH5 A;  3ATQ A;  1ZKQ A;  1P2E A;  3GMB A;  1GEU A;  2XDO A;  3II4 A;  1S2Y A;  2B9Y A;  1H7X A;  4UP3 A;  5IQ4 A;  3ICT A;  4MJW A;  3GDP A;  4LA1 A;  1OJ9 A;  1JRY A;  4K5R A;  2E4G A;  4B68 A;  3DGZ A;  4H2P A;  2CUL A;  1QO8 A;  3IC9 A;  4GUV A;  4NTC A;  3F8D A;  5JCK A;  2YG7 A;  4D04 A;  2WHD A;  1PBB A;  4J31 A;  3AED A;  3I3L A;  1ZX9 A;  1CC4 A;  4GCM A;  5FS8 A;  2XFO A;  1PJ5 A;  1KNR A;  2WP9 A;  3AEG A;  3BNM A;  1XDI A;  1PN0 A;  3OZ2 A;  3ISH A;  1VG0 A;  2XLT A;  5EB5 A;  1GRE A;  3AYI A;  4U8J A;  3QVR A;  3I6D A;  1X31 B;  2XLP A;  3QSE A;  1D7Y A;  2YG3 A;  3NK2 X;  1VDC A;  2I0Z A;  3VRB A;  3AEE A;  2RGH A;  1ZMD A;  3AE2 A;  4U8I A;  3AD7 B;  1H86 A;  1OJA A;  2JB3 A;  1VG9 A;  3L1R A;  4C5O A;  3SGL A;  4FDC B;  1L0V A;  1DOB A;  2V6O A;  3BI5 A;  2BS3 A;  4O5U A;  4U8O A;  4C3Y A;  4ECH A;  5LV9 A;  2YAU A;  1OJC A;  2Q7V A;  3G5S A;  2XCG A;  3CGB A;  1TDO A;  1XHC A;  4Y4N A;  3UTG A;  4FK1 C;  2YG5 A;  1TDK A;  2NVK X;  4U2L A;  4J36 A;  4A9W A;  3AE8 A;  2WET A;  1FEA A;  2YWL A;  3B6D A;  3ZDN A;  4DGK A;  4Z26 A;  4DSG A;  4E0V A;  1NAA A;  1CL0 A;  1LQT A;  3AE7 A;  1NHP A;  3COX A;  3M13 A;  3H8L A;  1F8R A;  4APN A;  4EQX A;  4YKF A;  3CN8 A;  4PAA A;  2GVC A;  4CBQ A;  1ELI A;  4K8D A;  4OCG A;  3GSI A;  1H81 A;  4NTE A;  3LOV A;  4A7A A;  1XPQ A;  3EF6 A;  4YTN A;  5BUL A;  4J34 A;  4A99 A;  1Q1W A;  2YLZ A;  2A8X A;  3GMC A;  4H4S A;  2OA1 A;  3QFB A;  1K0I A;  4H4X A;  3AEA A;  3GD4 A;  3AE4 A;  2IVD A;  2V3A A;  4Z2U A;  4M52 A;  4EQW A;  1EL8 A;  3AE6 A;  3DJE A;  2Q6U A;  3BI4 A;  1GTE A;  1NDA A;  2WQY A;  1PS9 A;  2YLW A;  4YKG A;  1REO A;  4BK2 A;  4HA6 A;  1GER A;  1YY5 A;  4UDR A;  2WU5 A;  3NH3 X;  4NTD A;  4YSH A;  1VQW A;  2GF3 A;  3AD8 B;  2C76 A;  3K7M X;  2VVL A;  2JB1 A;  2OLN A;  4H4U A;  5HXI A;  3GWF A;  2BK4 A;  3SQP A;  3ITJ A;  4GDE A;  1JEH A;  1DOD A;  1K4Q A;  4RSL A;  3NT6 A;  3KLJ A;  2XLU A;  1YQ3 A;  4U2T A;  3UTF A;  2WOI A;  4K22 A;  3DME A;  5KOW A;  1CC2 A;  3K7T A;  4I59 A;  5FS9 A;  4K2X A;  2APG A;  2XVJ A;  2GR2 A;  3KD9 A;  4IA6 A;  3CPI G;  1N4V A;  1NHS A;  3KKJ A;  3B3R A;  2BCG G;  2AQJ A;  4LU6 A;  5GSN A;  4EMI A;  1PBE A;  1DJN A;  2AAQ A;  1BF3 A;  2WS3 A;  1GRF A;  2YR6 A;  3AE1 A;  1D4C A;  5M0Z A;  2ZZB A;  1F3P A;  1LV0 A;  2X8C A;  3C4A A;  1TYT A;  1EBD A;  1GAL A;  4N9X A;  1N1P A;  4NEV A;  4ZCC A;  4EM3 A;  2R46 A;  3AE3 A;  4Z25 A;  4AOS A;  3NTA A;  3IF9 A;  2ACZ A;  1PBC A;  2H88 A;  4Y4L A;  1GSN A;  1JNR A;  4EQR A;  5HYM A;  3BNU A;  2C3C A;  4JN9 A;  2C72 A;  3HZL A;  4H4Y A;  3K7Q X;  4JQ9 A;  3AD9 B;  4A6N B;  1ZOV A;  4JNA A;  4FK1 A;  1PBF A;  1PJ6 A;  2FJB A;  2FJE A;  5BUK A;  4IA5 A;  3CTY A;  2TMD A;  2X8H A;  4LII A;  2JBV A;  4YSX A;  1K0L A;  1KSS A;  5KOX A;  2XVH A;  2WP6 A;  4I58 A;  2WEU A;  5JCL A;  1D4D A;  1FEB A;  2QCU A;  2B9X A;  3ABV A;  4J2W A;  3UOV A;  2YVG A;  2JK6 A;  2QA1 A;  3DA1 A;  2WPF A;  4XWZ A;  4Z2T A;  1SEZ A;  5FS7 A;  5JCI A;  3H8I A;  3C4N A;  1NHQ A;  4BV6 A;  1AOG A;  1LJ1 A;  3P9U A;  1F8S A;  2ZZ0 A;  1GRG A;  2BYB A;  5KVI A;  3DJG X;  3BHK A;  3GYI A;  2C67 A;  1GV4 A;  2V60 A;  3QJ4 A;  2OAM A;  2YG4 A;  3VR9 A;  3AEB A;  5FMH A;  2BCP A;  4IV9 A;  3QSM A;  2GR3 A;  5KVH A;  4KX6 A;  4YWO A;  4X4J A;  5DBJ A;  5C3J A;  4CCR A;  3NTD A;  4JY2 A;  2JKC A;  1NG4 A;  4OPL A;  4H4Z A;  1TYP A;  2V61 A;  1MOK A;  5TR3 A;  3NYE A;  4UDP A;  5JCM A;  1CC6 A;  5U63 A;  1E39 A;  2WDV A;  2XFP A;  3AEF A;  4X9N A;  2YLT A;  4TM0 A;  1E1L A;  2YM1 A;  3AYL A;  1H6V A;  3CPH G;  3UKA A;  4B63 A;  4REK A;  1IJH A;  1COY A;  5CQF A;  3NNE A;  4U8N A;  1M6I A;  1PXB A;  4USR A;  2VQ7 A;  5KRQ A;  4B67 A;  1GRH A;  3GWD A;  1DOE A;  1GES A;  3RHA A;  1KNP A;  2B76 A;  4YXD A;  4WX1 A;  3L8K A;  1RSG A;  1RP0 A;  4AT0 A;  2XVE A;  4BUR A;  5C2T A;  5ER0 A;  4KPR A;  4J57 A;  1E1M A;  4NEW A;  3P4S A;  1PXA A;  1GTH A;  2R45 A;  1CJ2 A;  3G5R A;  3DK8 A;  3FPZ A;  4YT0 A;  2GEW A;  3P1W A;  3S61 A;  2XVF A;  3UKP A;  3RP8 A;  3EAN A;  3CNS A;  2V3B A;  3OC4 A;  4C77 A;  1QJD A;  1ZK7 A;  4TM3 A;  2Q0K A;  1GOS A;  2XFQ A;  3F8R A;  1MXT A;  2BK3 A;  2X99 A;  3LJP A;  3AE9 A;  4Z24 A;  3VRA A;  1FEC A;  1Y0P A;  3GD3 A;  4J56 A;  3LZW A;  3LB8 A;  5EB4 A;  2BK5 A;  3LZX A;  3NK0 X;  1UKV G;  4TLZ A;  4IVO B;  3PO7 A;  3G5Q A;  3ZYX A;  1ZMC A;  1LVL A;  1B8S A;  2C66 A;  1Y56 B;  5U25 A;  4EMW A;  1B37 A;  4OPU A;  2ARD A;  2JAE A;  1D7L A;  4A65 A;  3DH9 A;  3AE5 A;  2C65 A;  3FG2 P;  5EBK A;  1BZL A;  4EM4 A;  3GYJ A;  3ICS A;  3KVE A;  1DOC A;  1JU2 A;  1YQZ A;  3P4Q A;  1N4U A;  1H83 A;  4K5S A;  2IID A;  2WES A;  3RED A;  2R4J A;  4JDR A;  3CND A;  3FBS A;  1CJ3 A;  3NN6 X;  3UKL A;  3AWI A;  3CGC A;  4Z44 A;  3UKH A;  2RGJ A;  1JNZ A;  2GR0 A;  4H4V A;  1IUU A;  1EL5 A;  4NZH A;  3NIX A;  2YQU A;  4AT2 A;  1GET A;  2XYO A;  1MO9 A;  2O9Z A;  2C3D A;  1CHU A;  1NEN A;  3EPT A;  2R0P A;  4TLX A;  1CJ4 A;  1EL9 A;  1KFY A;  2WU2 A;  1PHH A;  2X3N A;  2W0H A;  3ALM A;  3UCL A;  3NK1 X;  1IUX A;  3UP5 A;  3AXB A;  3KU9 A;  4OPT A;  1IUT A;  2Y6R A;  2BS4 A;  2YVJ A;  3E1T A;  4U8P A;  1LQU A;  5KXJ A;  1Q1R A;  4H2N A;  1V59 A;  4B65 A;  2YR4 A;  1TDN A;  2Y6Q A;  1NPX A;  1IUS A;  2BA9 A;  3C96 A;  2GQF A;  1PJ7 A;  2A89 A;  3GRT A;  3AB1 A;  1KSU A;  4JNQ A;  4B66 A;  1Y56 A;  5U1O A;  2F5Z A;  4DSH A;  2GR1 A;  1PBD A;  4U8M A;  2EQ9 A;  5BVA A;  1D4E A;  3GDN A;  2XLS A;  2WOW A;  2ZBW A;  1FL2 A;  2OLO A;  5EOW A;  3UP4 A;  1CBO A;  3P4R A;  1ZDL A;  4CRT A;  2PYX A;  2XFN A;  2A87 A;  1IUW A;  4YTM A;  3RP6 A;  4AP1 A;  3PVC A;  4H4Q A;  3DJD A;  3ATR A;  3IWA A;  4B64 A;  1GT8 A;  1F6M A;  3ADA B;  4BJY A;  1IUV A;  1JRX A;  3D8X A;  1O94 A;  3KPF A;  3PS9 A;  1B5Q A;  4H2R A;  1DNC A;  4DNA A;  2GAH B;  2VOU A;  4EMJ A;  2FBW A;  3LXD A;  1GXF A;  3UOY A;  2B7S A;  4XWR A;  3CIR A;  1VRQ B;  4TM4 A;  4CCQ A;  2BAC A;  3NKS A;  4ADW A;  2YM2 A;  1DXL A;  3UTE A;  3DJJ A;  2RAB A;  4FX9 A;  1HYU A;  2QA2 A;  2QAE A;  2R0C A;  4HB9 A;  1Q9I A;  4A79 A;  3NHO X;  4CY6 A;  1FOH A;  1W4X A;  4J33 A;  3R9U A;  5KWF A;  2YLX A;  4C74 A;  4CY8 A;  2B7R A;  1ZOY A;  2VZ2 A;  3CNJ A;  1BGN A;  2VRM A;  3QVP A;  3DK9 A;  4ZCD A;  3DK4 A;  3GRS A;  4EIQ A;  2GAG B;  2IVE A;  3UKK A; 
#chains in the Genus database with same CATH topology
 3O0H A;  1ZY8 A;  1NHR A;  5HY5 A;  4GF7 A;  3QFA A;  4A5L A;  1GRT A;  1L9C A;  1CJC A;  2BC1 A;  2C73 A;  2V5Z A;  3D1C A;  3AYJ A;  2WP5 A;  3SFD A;  3NGC X;  2C75 A;  2GRT A;  1EL7 A;  4B1B A;  3FMW A;  3BI2 A;  5IQ1 A;  4CNJ A;  2CVJ A;  1L9E A;  1S3E A;  3T37 A;  2EQ8 A;  4AOX A;  4XXG A;  2CDU A;  3CNT A;  4G6H A;  4H4T A;  4GDP A;  1KDG A;  3ALJ A;  4USQ A;  4H4P A;  2GB0 A;  1PXC A;  4Z2R A;  3WE0 A;  4GRT A;  3ICR A;  1NEK A;  4IVM B;  5J7X A;  3F8P A;  2BAB A;  5FS6 A;  3DGH A;  1YQ4 A;  1E1K A;  4OVI A;  1ONF A;  2GQW A;  3HYX A;  2H89 A;  3NN0 X;  3SZ0 A;  1O5W A;  4X9M A;  5KMS A;  2WPE A;  3QSS A;  4UDQ A;  3VRD B;  5L46 A;  2EQ7 A;  4ZN0 A;  4P9S A;  3NYF A;  4A6N A;  4BK3 A;  5M10 A;  1E7P A;  2DKI A;  4O5Q A;  4RG4 A;  1D5T A;  1E6E A;  1GND A;  2C64 A;  2X50 A;  1O95 A;  4H4R A;  1E1N A;  3BHF A;  2FJA A;  3CGD A;  3V76 A;  3NRN A;  2RGO A;  4Z43 A;  1B4V A;  2VVM A;  1BGJ A;  1GRA A;  3VQR A;  4U8K A;  3LAD A;  4GR1 A;  4K7Z A;  2TPR A;  1CF3 A;  3SZW A;  3KA7 A;  3V3O A;  3CNP A;  4AP3 A;  2XVI A;  2BXR A;  2R9Z A;  1H82 A;  5BRT A;  2R4E A;  3EAO A;  3IHM A;  4U8L A;  2AR8 A;  1LPF A;  1RYI A;  2YG6 A;  2PHH A;  3RNM A;  4OPD A;  5J60 A;  2OAL A;  1KF6 A;  4H4W A;  1P2H A;  4H7U A;  4CNK A;  1GPE A;  2GMJ A;  3HYV A;  2ZZC A;  2WDQ A;  2B9W A;  1PDH A;  1S2Q A;  2BC0 A;  2WOV A;  1JRZ A;  2YVF A;  3IHG A;  4OPG A;  4D03 A;  3RP7 A;  2J3N A;  2DKH A;  1OJT A;  2YR5 A;  5HHF A;  2BXS A;  1BKW A;  3K30 A;  2BS2 A;  1TRB A;  2WPC A;  3AEC A;  4WCT A;  4YTP A;  3UOZ A;  2VVL G;  4G6G A;  1H7W A;  2XLR A;  5GRT A;  1Z6L A;  1QLB A;  1FCD A;  2GV8 A;  2GMH A;  3FIM B;  4PAB A;  2YLR A;  1JOA A;  1M64 A;  1GRB A;  2Z5X A;  3URH A;  4BJZ A;  4B69 A;  4H50 A;  1NG3 A;  3T2K A;  3UOX A;  2VRL A;  1TDE A;  2CFY A;  5CKU A;  2WDR A;  4YSY A;  1YKJ A;  3ALL A;  2C70 A;  4GAV A;  4OPC A;  4YSZ A;  3UKQ A;  4TM1 A;  4JY3 A;  4OPI A;  3V3N A;  4BK1 A;  3VR8 A;  3NLC A;  2E5V A;  3UTH A;  4EIP A;  1F8W A;  3SFE A;  4H2Q A;  1OJD A;  3T14 A;  1XAN A;  3SM8 A;  1S3B A;  2XFU A;  4NNJ A;  2R0G A;  2E1M A;  2FJD A;  2Q0L A;  1TDF A;  4ICY A;  4RG3 A;  3S5W A;  3Q9T A;  1DJQ A;  4G73 A;  3SZC A;  3Q6J A;  5IPY A;  4EQS A;  3JSK A;  3NG7 X;  1BWC A;  2HQM A;  3CGE A;  2NPX A;  1H84 A;  3P4P A;  2X8G A;  3SZF A;  1N4W A;  4U2S A;  3UKF A;  1L9D A;  5JCN A;  2Z5Y A;  4Y4M A;  2UZZ A;  3NYC A;  2VQB A;  4GAP A;  3SYI A;  2EQ6 A;  1ZP0 A;  2JB2 A;  2C7G A;  3M0O A;  2YLS A;  4C3X A;  2WBA A;  3H4K A;  4II3 A;  1LTX R;  1K0J A;  3CPJ G;  3M12 A;  2GH5 A;  3ATQ A;  1ZKQ A;  1P2E A;  3GMB A;  1GEU A;  2XDO A;  3II4 A;  1S2Y A;  2B9Y A;  1H7X A;  4UP3 A;  5IQ4 A;  3ICT A;  4MJW A;  3GDP A;  4LA1 A;  1OJ9 A;  1JRY A;  4K5R A;  2E4G A;  4B68 A;  3DGZ A;  4H2P A;  2CUL A;  1QO8 A;  3IC9 A;  4GUV A;  4NTC A;  3F8D A;  5JCK A;  2YG7 A;  4D04 A;  2WHD A;  1PBB A;  4J31 A;  3AED A;  3I3L A;  1ZX9 A;  1CC4 A;  4GCM A;  5FS8 A;  2XFO A;  1PJ5 A;  1KNR A;  2WP9 A;  3AEG A;  3BNM A;  1XDI A;  1PN0 A;  3OZ2 A;  3ISH A;  1VG0 A;  2XLT A;  5EB5 A;  1GRE A;  3AYI A;  4U8J A;  3QVR A;  3I6D A;  1X31 B;  2XLP A;  3QSE A;  1D7Y A;  2YG3 A;  3NK2 X;  2BRA A;  1VDC A;  2I0Z A;  3VRB A;  3AEE A;  2RGH A;  1ZMD A;  3AE2 A;  4U8I A;  3AD7 B;  1H86 A;  1OJA A;  2JB3 A;  1VG9 A;  3L1R A;  4C5O A;  3SGL A;  4FDC B;  1L0V A;  1DOB A;  2V6O A;  3BI5 A;  2BS3 A;  4O5U A;  4U8O A;  4C3Y A;  4ECH A;  5LV9 A;  2YAU A;  1OJC A;  2Q7V A;  3G5S A;  2XCG A;  3CGB A;  1TDO A;  1XHC A;  4Y4N A;  3UTG A;  4FK1 C;  2YG5 A;  1TDK A;  3T31 A;  2NVK X;  4U2L A;  4J36 A;  4A9W A;  3AE8 A;  2WET A;  1FEA A;  2YWL A;  3B6D A;  3ZDN A;  4DGK A;  4Z26 A;  4DSG A;  4E0V A;  1NAA A;  1CL0 A;  1LQT A;  3AE7 A;  1NHP A;  3COX A;  3M13 A;  3H8L A;  1F8R A;  5KMQ A;  4APN A;  4EQX A;  4YKF A;  3CN8 A;  4PAA A;  2GVC A;  4CBQ A;  1ELI A;  4K8D A;  4OCG A;  3GSI A;  1H81 A;  4NTE A;  3LOV A;  4A7A A;  1XPQ A;  3EF6 A;  4YTN A;  5BUL A;  4J34 A;  4A99 A;  1Q1W A;  2YLZ A;  2A8X A;  3GMC A;  4G9K A;  2OA1 A;  3QFB A;  1K0I A;  4H4S A;  3AEA A;  4H4X A;  3GD4 A;  3AE4 A;  2IVD A;  2V3A A;  4Z2U A;  4M52 A;  4EQW A;  1EL8 A;  3AE6 A;  3DJE A;  2Q6U A;  3BI4 A;  1GTE A;  1NDA A;  2WQY A;  1PS9 A;  2YLW A;  4YKG A;  1REO A;  4BK2 A;  4HA6 A;  1GER A;  1YY5 A;  4UDR A;  2WU5 A;  3NH3 X;  4NTD A;  4YSH A;  1VQW A;  2GF3 A;  3AD8 B;  2C76 A;  3K7M X;  2VVL A;  2JB1 A;  5KMP A;  2OLN A;  4H4U A;  5HXI A;  3GWF A;  3GYX A;  2BK4 A;  3SQP A;  3ITJ A;  4GDE A;  1JEH A;  1DOD A;  1K4Q A;  4RSL A;  3NT6 A;  3KLJ A;  3SXI A;  2XLU A;  1YQ3 A;  4U2T A;  3UTF A;  2WOI A;  4K22 A;  3DME A;  5KOW A;  1CC2 A;  3K7T A;  4I59 A;  5FS9 A;  4K2X A;  2APG A;  2XVJ A;  2GR2 A;  3KD9 A;  4IA6 A;  3CPI G;  1N4V A;  1NHS A;  3KKJ A;  3B3R A;  2BCG G;  2AQJ A;  4LU6 A;  5GSN A;  4EMI A;  1PBE A;  1DJN A;  2AAQ A;  1BF3 A;  2WS3 A;  1GRF A;  2YR6 A;  3AE1 A;  1D4C A;  5M0Z A;  2ZZB A;  1F3P A;  1LV0 A;  2X8C A;  3C4A A;  1TYT A;  1EBD A;  1GAL A;  4N9X A;  1N1P A;  4NEV A;  4ZCC A;  4EM3 A;  2R46 A;  3AE3 A;  4Z25 A;  4AOS A;  3NTA A;  3IF9 A;  2ACZ A;  1PBC A;  2H88 A;  4Y4L A;  1GSN A;  1JNR A;  4EQR A;  5HYM A;  3BNU A;  2C3C A;  4JN9 A;  2C72 A;  3HZL A;  4H4Y A;  3K7Q X;  4JQ9 A;  3AD9 B;  5KMR A;  4A6N B;  1ZOV A;  4NWZ A;  4JNA A;  4FK1 A;  1PBF A;  1PJ6 A;  2FJB A;  2FJE A;  5BUK A;  4IA5 A;  3CTY A;  2TMD A;  2X8H A;  4LII A;  2JBV A;  4YSX A;  1K0L A;  1KSS A;  3T0K A;  5KOX A;  2XVH A;  2WP6 A;  4I58 A;  2WEU A;  5JCL A;  1D4D A;  1FEB A;  2QCU A;  2B9X A;  3ABV A;  4J2W A;  3UOV A;  2YVG A;  2JK6 A;  2QA1 A;  3DA1 A;  2WPF A;  4XWZ A;  4Z2T A;  1SEZ A;  5FS7 A;  5JCI A;  3H8I A;  3C4N A;  1NHQ A;  4BV6 A;  1AOG A;  1LJ1 A;  3P9U A;  1F8S A;  2ZZ0 A;  1GRG A;  2BYB A;  5KVI A;  3DJG X;  3BHK A;  3GYI A;  2C67 A;  1GV4 A;  2V60 A;  3QJ4 A;  2OAM A;  2YG4 A;  3VR9 A;  3AEB A;  5FMH A;  2BCP A;  4IV9 A;  3QSM A;  2GR3 A;  5KVH A;  4KX6 A;  4YWO A;  4X4J A;  5DBJ A;  5C3J A;  4CCR A;  3NTD A;  4JY2 A;  2JKC A;  1NG4 A;  4OPL A;  4H4Z A;  1TYP A;  2V61 A;  1MOK A;  5TR3 A;  3NYE A;  4UDP A;  5JCM A;  3CMM A;  1CC6 A;  5U63 A;  1E39 A;  2WDV A;  2XFP A;  3AEF A;  4X9N A;  2YLT A;  4TM0 A;  1E1L A;  2YM1 A;  3AYL A;  1H6V A;  3CPH G;  3UKA A;  4B63 A;  4REK A;  1IJH A;  1COY A;  4G74 A;  5CQF A;  3NNE A;  4U8N A;  1M6I A;  1PXB A;  4USR A;  2VQ7 A;  5KRQ A;  4B67 A;  1GRH A;  3GWD A;  1DOE A;  1GES A;  3RHA A;  1KNP A;  2B76 A;  4YXD A;  4WX1 A;  3L8K A;  1RSG A;  1RP0 A;  4AT0 A;  2XVE A;  4BUR A;  5C2T A;  5ER0 A;  4KPR A;  4J57 A;  1E1M A;  4NEW A;  3P4S A;  1PXA A;  1GTH A;  2R45 A;  1CJ2 A;  3G5R A;  3DK8 A;  3FPZ A;  4YT0 A;  2GEW A;  3P1W A;  3S61 A;  2XVF A;  3UKP A;  3RP8 A;  3EAN A;  3CNS A;  2V3B A;  3HYW A;  3OC4 A;  4C77 A;  1QJD A;  1ZK7 A;  4TM3 A;  2Q0K A;  1GOS A;  2XFQ A;  3F8R A;  1MXT A;  2BK3 A;  2X99 A;  3LJP A;  3AE9 A;  4Z24 A;  3VRA A;  1FEC A;  1Y0P A;  3GD3 A;  4J56 A;  3LZW A;  3LB8 A;  5EB4 A;  2BK5 A;  3LZX A;  3NK0 X;  1UKV G;  4TLZ A;  4IVO B;  3PO7 A;  3G5Q A;  3ZYX A;  1ZMC A;  1LVL A;  1B8S A;  2C66 A;  1Y56 B;  5U25 A;  4EMW A;  1B37 A;  4OPU A;  2ARD A;  2JAE A;  1D7L A;  4A65 A;  3DH9 A;  3AE5 A;  2C65 A;  3FG2 P;  5EBK A;  3T2Z A;  1BZL A;  4EM4 A;  3GYJ A;  3ICS A;  3KVE A;  1DOC A;  1JU2 A;  1YQZ A;  3P4Q A;  1N4U A;  1H83 A;  4K5S A;  2IID A;  2WES A;  3RED A;  2R4J A;  4JDR A;  3CND A;  3FBS A;  1CJ3 A;  3NN6 X;  3UKL A;  3AWI A;  3CGC A;  4Z44 A;  3UKH A;  2RGJ A;  1JNZ A;  2GR0 A;  4H4V A;  1IUU A;  1EL5 A;  4NZH A;  3NIX A;  2YQU A;  4AT2 A;  1GET A;  2XYO A;  1MO9 A;  2C4C A;  2O9Z A;  2C3D A;  1CHU A;  1NEN A;  3EPT A;  2R0P A;  4TLX A;  1CJ4 A;  1EL9 A;  1KFY A;  2WU2 A;  1PHH A;  2X3N A;  2W0H A;  3ALM A;  3UCL A;  3NK1 X;  1IUX A;  3UP5 A;  3AXB A;  3KU9 A;  4OPT A;  4II2 A;  1IUT A;  2Y6R A;  2BS4 A;  2YVJ A;  3E1T A;  3SX6 A;  4U8P A;  1LQU A;  5KXJ A;  1Q1R A;  4H2N A;  1V59 A;  4B65 A;  2YR4 A;  5KNL A;  1TDN A;  2Y6Q A;  1NPX A;  1IUS A;  2BA9 A;  3C96 A;  2GQF A;  1PJ7 A;  2A89 A;  3GRT A;  3AB1 A;  1KSU A;  4JNQ A;  4B66 A;  1Y56 A;  5U1O A;  2F5Z A;  4DSH A;  3KPK A;  2GR1 A;  1PBD A;  4U8M A;  2EQ9 A;  5BVA A;  1D4E A;  3GDN A;  2XLS A;  3SY4 A;  2WOW A;  2ZBW A;  1FL2 A;  2OLO A;  5EOW A;  3UP4 A;  1CBO A;  3P4R A;  2BRY A;  1ZDL A;  4CRT A;  2PYX A;  2XFN A;  2A87 A;  1IUW A;  4YTM A;  3RP6 A;  4AP1 A;  3PVC A;  4H4Q A;  3DJD A;  3ATR A;  3IWA A;  4B64 A;  1GT8 A;  1F6M A;  3ADA B;  4BJY A;  1IUV A;  1JRX A;  3D8X A;  1O94 A;  3KPF A;  3PS9 A;  1B5Q A;  4H2R A;  1DNC A;  4DNA A;  2GAH B;  2VOU A;  4EMJ A;  2FBW A;  3LXD A;  1GXF A;  3UOY A;  2B7S A;  4XWR A;  3CIR A;  1VRQ B;  4TM4 A;  4CCQ A;  2BAC A;  3NKS A;  4ADW A;  2YM2 A;  1DXL A;  3UTE A;  3DJJ A;  2RAB A;  4FX9 A;  1HYU A;  2QA2 A;  2QAE A;  2R0C A;  4HB9 A;  1Q9I A;  4A79 A;  3NHO X;  4CY6 A;  1FOH A;  1W4X A;  4J33 A;  3R9U A;  5KWF A;  2YLX A;  4C74 A;  4CY8 A;  2B7R A;  1ZOY A;  2VZ2 A;  3CNJ A;  1BGN A;  2VRM A;  3QVP A;  3DK9 A;  4ZCD A;  3DK4 A;  3T2Y A;  3GRS A;  4EIQ A;  2GAG B;  2IVE A;  3UKK A; 
#chains in the Genus database with same CATH homology
 3O0H A;  1ZY8 A;  1NHR A;  5HY5 A;  4GF7 A;  3QFA A;  4A5L A;  1GRT A;  1L9C A;  1CJC A;  2BC1 A;  2C73 A;  2V5Z A;  3D1C A;  3AYJ A;  2WP5 A;  3SFD A;  3NGC X;  2C75 A;  2GRT A;  1EL7 A;  4B1B A;  3FMW A;  3BI2 A;  5IQ1 A;  4CNJ A;  2CVJ A;  1L9E A;  1S3E A;  3T37 A;  2EQ8 A;  4AOX A;  4XXG A;  2CDU A;  3CNT A;  4G6H A;  4H4T A;  4GDP A;  1KDG A;  3ALJ A;  4USQ A;  4H4P A;  2GB0 A;  1PXC A;  4Z2R A;  3WE0 A;  4GRT A;  3ICR A;  1NEK A;  4IVM B;  5J7X A;  3F8P A;  2BAB A;  5FS6 A;  3DGH A;  1YQ4 A;  1E1K A;  4OVI A;  1ONF A;  2GQW A;  3HYX A;  2H89 A;  3NN0 X;  3SZ0 A;  1O5W A;  4X9M A;  5KMS A;  2WPE A;  3QSS A;  4UDQ A;  3VRD B;  5L46 A;  2EQ7 A;  4ZN0 A;  4P9S A;  3NYF A;  4A6N A;  4BK3 A;  5M10 A;  1E7P A;  2DKI A;  4O5Q A;  4RG4 A;  1D5T A;  1E6E A;  1GND A;  2C64 A;  2X50 A;  1O95 A;  4H4R A;  1E1N A;  3BHF A;  2FJA A;  3CGD A;  3V76 A;  3NRN A;  2RGO A;  4Z43 A;  1B4V A;  2VVM A;  1BGJ A;  1GRA A;  3VQR A;  4U8K A;  3LAD A;  4GR1 A;  4K7Z A;  2TPR A;  1CF3 A;  3SZW A;  3KA7 A;  3V3O A;  3CNP A;  4AP3 A;  2XVI A;  2BXR A;  2R9Z A;  1H82 A;  5BRT A;  2R4E A;  3EAO A;  3IHM A;  4U8L A;  2AR8 A;  1LPF A;  1RYI A;  2YG6 A;  2PHH A;  3RNM A;  4OPD A;  5J60 A;  2OAL A;  1KF6 A;  4H4W A;  1P2H A;  4H7U A;  4CNK A;  1GPE A;  2GMJ A;  3HYV A;  2ZZC A;  2WDQ A;  2B9W A;  1PDH A;  1S2Q A;  2BC0 A;  2WOV A;  1JRZ A;  2YVF A;  3IHG A;  4OPG A;  4D03 A;  3RP7 A;  2J3N A;  2DKH A;  1OJT A;  2YR5 A;  5HHF A;  2BXS A;  1BKW A;  3K30 A;  2BS2 A;  1TRB A;  2WPC A;  3AEC A;  4WCT A;  4YTP A;  3UOZ A;  2VVL G;  4G6G A;  1H7W A;  2XLR A;  5GRT A;  1Z6L A;  1QLB A;  1FCD A;  2GV8 A;  2GMH A;  3FIM B;  4PAB A;  2YLR A;  1JOA A;  1M64 A;  1GRB A;  2Z5X A;  3URH A;  4BJZ A;  4B69 A;  4H50 A;  1NG3 A;  3T2K A;  3UOX A;  2VRL A;  1TDE A;  2CFY A;  5CKU A;  2WDR A;  4YSY A;  1YKJ A;  3ALL A;  2C70 A;  4GAV A;  4OPC A;  4YSZ A;  3UKQ A;  4TM1 A;  4JY3 A;  4OPI A;  3V3N A;  4BK1 A;  3VR8 A;  3NLC A;  2E5V A;  3UTH A;  4EIP A;  1F8W A;  3SFE A;  4H2Q A;  1OJD A;  3T14 A;  1XAN A;  3SM8 A;  1S3B A;  2XFU A;  4NNJ A;  2R0G A;  2E1M A;  2FJD A;  2Q0L A;  1TDF A;  4ICY A;  4RG3 A;  3S5W A;  3Q9T A;  1DJQ A;  4G73 A;  3SZC A;  3Q6J A;  5IPY A;  4EQS A;  3JSK A;  3NG7 X;  1BWC A;  2HQM A;  3CGE A;  2NPX A;  1H84 A;  3P4P A;  2X8G A;  3SZF A;  1N4W A;  4U2S A;  3UKF A;  1L9D A;  5JCN A;  2Z5Y A;  4Y4M A;  2UZZ A;  3NYC A;  2VQB A;  4GAP A;  3SYI A;  2EQ6 A;  1ZP0 A;  2JB2 A;  2C7G A;  3M0O A;  2YLS A;  4C3X A;  2WBA A;  3H4K A;  4II3 A;  1LTX R;  1K0J A;  3CPJ G;  3M12 A;  2GH5 A;  3ATQ A;  1ZKQ A;  1P2E A;  3GMB A;  1GEU A;  2XDO A;  3II4 A;  1S2Y A;  2B9Y A;  1H7X A;  4UP3 A;  5IQ4 A;  3ICT A;  4MJW A;  3GDP A;  4LA1 A;  1OJ9 A;  1JRY A;  4K5R A;  2E4G A;  4B68 A;  3DGZ A;  4H2P A;  2CUL A;  1QO8 A;  3IC9 A;  4GUV A;  4NTC A;  3F8D A;  5JCK A;  2YG7 A;  4D04 A;  2WHD A;  1PBB A;  4J31 A;  3AED A;  3I3L A;  1ZX9 A;  1CC4 A;  4GCM A;  5FS8 A;  2XFO A;  1PJ5 A;  1KNR A;  2WP9 A;  3AEG A;  3BNM A;  1XDI A;  1PN0 A;  3OZ2 A;  3ISH A;  1VG0 A;  2XLT A;  5EB5 A;  1GRE A;  3AYI A;  4U8J A;  3QVR A;  3I6D A;  1X31 B;  2XLP A;  3QSE A;  1D7Y A;  2YG3 A;  3NK2 X;  2BRA A;  1VDC A;  2I0Z A;  3VRB A;  3AEE A;  2RGH A;  1ZMD A;  3AE2 A;  4U8I A;  3AD7 B;  1H86 A;  1OJA A;  2JB3 A;  1VG9 A;  3L1R A;  4C5O A;  3SGL A;  4FDC B;  1L0V A;  1DOB A;  2V6O A;  3BI5 A;  2BS3 A;  4O5U A;  4U8O A;  4C3Y A;  4ECH A;  5LV9 A;  2YAU A;  1OJC A;  2Q7V A;  3G5S A;  2XCG A;  3CGB A;  1TDO A;  1XHC A;  4Y4N A;  3UTG A;  4FK1 C;  2YG5 A;  1TDK A;  3T31 A;  2NVK X;  4U2L A;  4J36 A;  4A9W A;  3AE8 A;  2WET A;  1FEA A;  2YWL A;  3B6D A;  3ZDN A;  4DGK A;  4Z26 A;  4DSG A;  4E0V A;  1NAA A;  1CL0 A;  1LQT A;  3AE7 A;  1NHP A;  3COX A;  3M13 A;  3H8L A;  1F8R A;  5KMQ A;  4APN A;  4EQX A;  4YKF A;  3CN8 A;  4PAA A;  2GVC A;  4CBQ A;  1ELI A;  4K8D A;  4OCG A;  3GSI A;  1H81 A;  4NTE A;  3LOV A;  4A7A A;  1XPQ A;  3EF6 A;  4YTN A;  5BUL A;  4J34 A;  4A99 A;  1Q1W A;  2YLZ A;  2A8X A;  3GMC A;  4G9K A;  2OA1 A;  3QFB A;  1K0I A;  4H4S A;  3AEA A;  4H4X A;  3GD4 A;  3AE4 A;  2IVD A;  2V3A A;  4Z2U A;  4M52 A;  4EQW A;  1EL8 A;  3AE6 A;  3DJE A;  2Q6U A;  3BI4 A;  1GTE A;  1NDA A;  2WQY A;  1PS9 A;  2YLW A;  4YKG A;  1REO A;  4BK2 A;  4HA6 A;  1GER A;  1YY5 A;  4UDR A;  2WU5 A;  3NH3 X;  4NTD A;  4YSH A;  1VQW A;  2GF3 A;  3AD8 B;  2C76 A;  3K7M X;  2VVL A;  2JB1 A;  5KMP A;  2OLN A;  4H4U A;  5HXI A;  3GWF A;  3GYX A;  2BK4 A;  3SQP A;  3ITJ A;  4GDE A;  1JEH A;  1DOD A;  1K4Q A;  4RSL A;  3NT6 A;  3KLJ A;  3SXI A;  2XLU A;  1YQ3 A;  4U2T A;  3UTF A;  2WOI A;  4K22 A;  3DME A;  5KOW A;  1CC2 A;  3K7T A;  4I59 A;  5FS9 A;  4K2X A;  2APG A;  2XVJ A;  2GR2 A;  3KD9 A;  4IA6 A;  3CPI G;  1N4V A;  1NHS A;  3KKJ A;  3B3R A;  2BCG G;  2AQJ A;  4LU6 A;  5GSN A;  4EMI A;  1PBE A;  1DJN A;  2AAQ A;  1BF3 A;  2WS3 A;  1GRF A;  2YR6 A;  3AE1 A;  1D4C A;  5M0Z A;  2ZZB A;  1F3P A;  1LV0 A;  2X8C A;  3C4A A;  1TYT A;  1EBD A;  1GAL A;  4N9X A;  1N1P A;  4NEV A;  4ZCC A;  4EM3 A;  2R46 A;  3AE3 A;  4Z25 A;  4AOS A;  3NTA A;  3IF9 A;  2ACZ A;  1PBC A;  2H88 A;  4Y4L A;  1GSN A;  1JNR A;  4EQR A;  5HYM A;  3BNU A;  2C3C A;  4JN9 A;  2C72 A;  3HZL A;  4H4Y A;  3K7Q X;  4JQ9 A;  3AD9 B;  5KMR A;  4A6N B;  1ZOV A;  4NWZ A;  4JNA A;  4FK1 A;  1PBF A;  1PJ6 A;  2FJB A;  2FJE A;  5BUK A;  4IA5 A;  3CTY A;  2TMD A;  2X8H A;  4LII A;  2JBV A;  4YSX A;  1K0L A;  1KSS A;  3T0K A;  5KOX A;  2XVH A;  2WP6 A;  4I58 A;  2WEU A;  5JCL A;  1D4D A;  1FEB A;  2QCU A;  2B9X A;  3ABV A;  4J2W A;  3UOV A;  2YVG A;  2JK6 A;  2QA1 A;  3DA1 A;  2WPF A;  4XWZ A;  4Z2T A;  1SEZ A;  5FS7 A;  5JCI A;  3H8I A;  3C4N A;  1NHQ A;  4BV6 A;  1AOG A;  1LJ1 A;  3P9U A;  1F8S A;  2ZZ0 A;  1GRG A;  2BYB A;  5KVI A;  3DJG X;  3BHK A;  3GYI A;  2C67 A;  1GV4 A;  2V60 A;  3QJ4 A;  2OAM A;  2YG4 A;  3VR9 A;  3AEB A;  5FMH A;  2BCP A;  4IV9 A;  3QSM A;  2GR3 A;  5KVH A;  4KX6 A;  4YWO A;  4X4J A;  5DBJ A;  5C3J A;  4CCR A;  3NTD A;  4JY2 A;  2JKC A;  1NG4 A;  4OPL A;  4H4Z A;  1TYP A;  2V61 A;  1MOK A;  5TR3 A;  3NYE A;  4UDP A;  5JCM A;  3CMM A;  1CC6 A;  5U63 A;  1E39 A;  2WDV A;  2XFP A;  3AEF A;  4X9N A;  2YLT A;  4TM0 A;  1E1L A;  2YM1 A;  3AYL A;  1H6V A;  3CPH G;  3UKA A;  4B63 A;  4REK A;  1IJH A;  1COY A;  4G74 A;  5CQF A;  3NNE A;  4U8N A;  1M6I A;  1PXB A;  4USR A;  2VQ7 A;  5KRQ A;  4B67 A;  1GRH A;  3GWD A;  1DOE A;  1GES A;  3RHA A;  1KNP A;  2B76 A;  4YXD A;  4WX1 A;  3L8K A;  1RSG A;  1RP0 A;  4AT0 A;  2XVE A;  4BUR A;  5C2T A;  5ER0 A;  4KPR A;  4J57 A;  1E1M A;  4NEW A;  3P4S A;  1PXA A;  1GTH A;  2R45 A;  1CJ2 A;  3G5R A;  3DK8 A;  3FPZ A;  4YT0 A;  2GEW A;  3P1W A;  3S61 A;  2XVF A;  3UKP A;  3RP8 A;  3EAN A;  3CNS A;  2V3B A;  3HYW A;  3OC4 A;  4C77 A;  1QJD A;  1ZK7 A;  4TM3 A;  2Q0K A;  1GOS A;  2XFQ A;  3F8R A;  1MXT A;  2BK3 A;  2X99 A;  3LJP A;  3AE9 A;  4Z24 A;  3VRA A;  1FEC A;  1Y0P A;  3GD3 A;  4J56 A;  3LZW A;  3LB8 A;  5EB4 A;  2BK5 A;  3LZX A;  3NK0 X;  1UKV G;  4TLZ A;  4IVO B;  3PO7 A;  3G5Q A;  3ZYX A;  1ZMC A;  1LVL A;  1B8S A;  2C66 A;  1Y56 B;  5U25 A;  4EMW A;  1B37 A;  4OPU A;  2ARD A;  2JAE A;  1D7L A;  4A65 A;  3DH9 A;  3AE5 A;  2C65 A;  3FG2 P;  5EBK A;  3T2Z A;  1BZL A;  4EM4 A;  3GYJ A;  3ICS A;  3KVE A;  1DOC A;  1JU2 A;  1YQZ A;  3P4Q A;  1N4U A;  1H83 A;  4K5S A;  2IID A;  2WES A;  3RED A;  2R4J A;  4JDR A;  3CND A;  3FBS A;  1CJ3 A;  3NN6 X;  3UKL A;  3AWI A;  3CGC A;  4Z44 A;  3UKH A;  2RGJ A;  1JNZ A;  2GR0 A;  4H4V A;  1IUU A;  1EL5 A;  4NZH A;  3NIX A;  2YQU A;  4AT2 A;  1GET A;  2XYO A;  1MO9 A;  2C4C A;  2O9Z A;  2C3D A;  1CHU A;  1NEN A;  3EPT A;  2R0P A;  4TLX A;  1CJ4 A;  1EL9 A;  1KFY A;  2WU2 A;  1PHH A;  2X3N A;  2W0H A;  3ALM A;  3UCL A;  3NK1 X;  1IUX A;  3UP5 A;  3AXB A;  3KU9 A;  4OPT A;  4II2 A;  1IUT A;  2Y6R A;  2BS4 A;  2YVJ A;  3E1T A;  3SX6 A;  4U8P A;  1LQU A;  5KXJ A;  1Q1R A;  4H2N A;  1V59 A;  4B65 A;  2YR4 A;  5KNL A;  1TDN A;  2Y6Q A;  1NPX A;  1IUS A;  2BA9 A;  3C96 A;  2GQF A;  1PJ7 A;  2A89 A;  3GRT A;  3AB1 A;  1KSU A;  4JNQ A;  4B66 A;  1Y56 A;  5U1O A;  2F5Z A;  4DSH A;  3KPK A;  2GR1 A;  1PBD A;  4U8M A;  2EQ9 A;  5BVA A;  1D4E A;  3GDN A;  2XLS A;  3SY4 A;  2WOW A;  2ZBW A;  1FL2 A;  2OLO A;  5EOW A;  3UP4 A;  1CBO A;  3P4R A;  2BRY A;  1ZDL A;  4CRT A;  2PYX A;  2XFN A;  2A87 A;  1IUW A;  4YTM A;  3RP6 A;  4AP1 A;  3PVC A;  4H4Q A;  3DJD A;  3ATR A;  3IWA A;  4B64 A;  1GT8 A;  1F6M A;  3ADA B;  4BJY A;  1IUV A;  1JRX A;  3D8X A;  1O94 A;  3KPF A;  3PS9 A;  1B5Q A;  4H2R A;  1DNC A;  4DNA A;  2GAH B;  2VOU A;  4EMJ A;  2FBW A;  3LXD A;  1GXF A;  3UOY A;  2B7S A;  4XWR A;  3CIR A;  1VRQ B;  4TM4 A;  4CCQ A;  2BAC A;  3NKS A;  4ADW A;  2YM2 A;  1DXL A;  3UTE A;  3DJJ A;  2RAB A;  4FX9 A;  1HYU A;  2QA2 A;  2QAE A;  2R0C A;  4HB9 A;  1Q9I A;  4A79 A;  3NHO X;  4CY6 A;  1FOH A;  1W4X A;  4J33 A;  3R9U A;  5KWF A;  2YLX A;  4C74 A;  4CY8 A;  2B7R A;  1ZOY A;  2VZ2 A;  3CNJ A;  1BGN A;  2VRM A;  3QVP A;  3DK9 A;  4ZCD A;  3DK4 A;  3T2Y A;  3GRS A;  4EIQ A;  2GAG B;  2IVE A;  3UKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...