2Q0KA

Oxidized thioredoxin reductase from helicobacter pylori in complex with nadp+
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
310
structure length
310
Chain Sequence
b'MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title High-resolution structures of oxidized and reduced thioredoxin reductase from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 90
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0kA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0kA02
1RSGA 4BURA 5FS7A 1O5WA 2WETA 1CF3A 1L9DA 4B66A 3QSMA 4H4PA 3KKJA 1CC6A 2C7GA 1TRBA 1PJ7A 3GD3A 3UOYA 4Z26A 2BA9A 4HA6A 1S3BA 1NAAA 3AE3A 2PHHA 3CNDA 1BGJA 3L1RA 1GRTA 1P2EA 4FK1C 4N9XA 4YSYA 1YY5A 2RGOA 5TR3A 4BV6A 3AYJA 1K0JA 2YR6A 1TDEA 3UKPA 3P1WA 1RYIA 2CFYA 3NTAA 3C4AA 4OCGA 2XLTA 4OPCA 5KOXA 3LOVA 2IVEA 4IA6A 4UDPA 3SM8A 2OALA 3NYCA 1XDIA 2QA1A 4YTNA 2WDVA 1MOKA 2C3CA 2VVLG 2XLSA 3NLCA 3GWDA 3VRAA 4JNQA 4YKFA 3CGBA 1PXCA 2RGJA 2NPXA 2YLWA 1NG3A 4U2TA 4BK1A 2X50A 4JNAA 4GDPA 1DJNA 1NHRA 4U8MA 1M6IA 2GAGB 2JB1A 3VRDB 5BULA 1FECA 3HZLA 1QO8A 5HHFA 3LZWA 3AE1A 1NDAA 3G5QA 5EB5A 3D8XA 1QJDA 1YKJA 3EF6A 1Z6LA 3AYIA 2JBVA 3ATQA 2YG3A 4YT0A 3CPHG 1JRXA 1B37A 3AEFA 4EQSA 3SFDA 1GPEA 1ZMCA 2XVHA 1KF6A 1ZY8A 2JKCA 1LJ1A 3EANA 3NK0X 2R0PA 3F8PA 1F8WA 3DA1A 3H8IA 3PS9A 4K5SA 4EMWA 3RP6A 3M12A 1UKVG 1GXFA 2XVJA 2B7SA 4U8PA 4U8JA 4XXGA 1L9CA 3C4NA 5EOWA 1PBFA 5JCIA 3E1TA 4JDRA 4Y4NA 2GV8A 1ZX9A 3Q6JA 3SFEA 1PHHA 1HYUA 4Z2TA 4H2RA 4NTDA 4H4RA 3GD4A 3CGDA 3IHMA 5J60A 2ZZ0A 4U8LA 4ZCDA 4B1BA 1IJHA 4AT2A 1DODA 3EAOA 3NG7X 3UTHA 3R9UA 3EPTA 1TDOA 5KWFA 1NG4A 2WDRA 4EIPA 4USQA 4Y4LA 2GRTA 2VQBA 3AEEA 1AOGA 3K7QX 1F8SA 2XVFA 3KD9A 3KU9A 3NK2X 4H50A 4O5QA 1CBOA 2YLZA 3V3OA 1DOCA 3NRNA 2C76A 4K7ZA 2E1MA 1BZLA 5GSNA 2V5ZA 1GESA 3FMWA 3AD9B 1ZOYA 4ECHA 4H7UA 5BVAA 4H4TA 4U8IA 2R0CA 1X31B 1F3PA 3V3NA 5U25A 3NYFA 2YG7A 1DNCA 1GRBA 5GRTA 2YM1A 3CGCA 4YSXA 4J34A 5CQFA 3URHA 2WOWA 2EQ7A 3B3RA 1H86A 1KDGA 2WP6A 1PJ6A 2BACA 2XYOA 3ICSA 1OJTA 2Z5XA 3DJGX 4Y4MA 1JU2A 4TLXA 1RP0A 1GRAA 1GALA 1IUWA 1GV4A 2JAEA 1H6VA 2R4JA 2B76A 4TM1A 3VRBA 4B64A 4BJYA 3DK8A 1CJCA 2WOIA 4EMIA 1E39A 4XWRA 1FCDA 2GR0A 3QFAA 2XVIA 4C3XA 4A79A 2EQ9A 5KVHA 2Q0KA 2YVFA 3GRTA 4YKGA 2YAUA 4A9WA 2WU2A 3SQPA 2AR8A 2C3DA 1GRHA 2XCGA 4E0VA 3QVRA 3QFBA 2WPEA 4JY2A 3OC4A 1D4CA 2GQFA 4B68A 5HY5A 4J56A 1Q1WA 4X4JA 3NHOX 1S2QA 1DOEA 1MO9A 1YQ3A 1D7LA 1H81A 4H4VA 1IUXA 2YR5A 3NYEA 4USRA 2AQJA 3AB1A 4APNA 1OJAA 4GF7A 1P2HA 3NTDA 3IWAA 3I6DA 2X99A 3UKHA 2H88A 2C75A 2I0ZA 4B65A 1BF3A 4UDQA 3QSEA 3KVEA 4Z24A 4ADWA 4D03A 3AE6A 1PXAA 4WCTA 4AP1A 3ITJA 3GWFA 1BGNA 1B4VA 1GERA 1REOA 3V76A 3ALJA 4K2XA 2C72A 1B5QA 1Q9IA 3UCLA 2GMHA 2H89A 2BYBA 4C5OA 3AEGA 3P4SA 2AAQA 1Y0PA 4C74A 4GUVA 2ZZCA 2XDOA 4IVMB 5FS6A 4GR1A 1NHPA 2C73A 3UOXA 2JB3A 2XLPA 5KXJA 4JN9A 4FK1A 2GR3A 2WP5A 3P9UA 2WBAA 2YG4A 1VG9A 1IUUA 4MJWA 2V3AA 3ATRA 2E5VA 3AE4A 1GETA 1O95A 2XLUA 3T37A 1DJQA 2WESA 2YG6A 5BRTA 4AP3A 1TDFA 3RP8A 2Z5YA 1PBBA 4HB9A 1ZMDA 3AE9A 1E7PA 2BCPA 3KA7A 3AE7A 3VR8A 2XLRA 4OVIA 2WDQA 2EQ8A 3DH9A 1W4XA 2XFOA 1LQUA 2VOUA 3C96A 4H4XA 1EL9A 4J57A 4C77A 2WS3A 3II4A 4X9MA 5IQ4A 2OLNA 3NT6A 1K0IA 3VQRA 1E1MA 1KSSA 1V59A 1N1PA 3GMCA 3LXDA 2YLXA 3CN8A 2VVLA 2YM2A 3QJ4A 2FJEA 1O94A 2R0GA 2WEUA 5BUKA 1D4DA 2A89A 2BS3A 3UKAA 4AOXA 2FBWA 1PN0A 4AOSA 2Q7VA 4NTCA 4DNAA 4GRTA 1F6MA 3ZYXA 3UTGA 4BJZA 4WX1A 2TMDA 3BNMA 1L9EA 3FG2P 3B6DA 1OJCA 2ACZA 4FDCB 3PO7A 3GSIA 4H4ZA 4J36A 4EIQA 4BK2A 3RHAA 1ZK7A 4J33A 1PDHA 5IPYA 2YR4A 2YVGA 1E1LA 3BI5A 1ELIA 2X3NA 1N4UA 3DJJA 4EM3A 3I3LA 1F8RA 2EQ6A 4H4YA 5EBKA 3S5WA 1EL7A 4PABA 3ADAB 3DMEA 3F8DA 3G5RA 4CY8A 3SGLA 5HXIA 4AT0A 3H8LA 1CC2A 3KPFA 5J7XA 5KRQA 2GMJA 3LB8A 2VZ2A 4I58A 5LV9A 2V6OA 3RP7A 2WQYA 1GNDA 1VQWA 1N4VA 4KPRA 5JCNA 4YSHA 1CL0A 1FL2A 1NHSA 2Y6RA 3F8RA 1TYPA 3AEDA 4TLZA 3CPJG 3BI2A 2BS2A 3GRSA 4DGKA 1PBCA 1NHQA 1FEAA 4ZCCA 4J2WA 5FS9A 4Z2RA 4NEWA 2VVMA 4BK3A 1D4EA 1GREA 4XWZA 2FJDA 2X8GA 2BXRA 1BWCA 3DJDA 1DOBA 3NH3X 1JRYA 3NN6X 4TM3A 2X8CA 3LZXA 4CNJA 1EL8A 1KNPA 1NENA 2GQWA 4EMJA 2CDUA 1GOSA 4DSGA 3ZDNA 1KSUA 1Q1RA 1PJ5A 2VRMA 4H4QA 4Z2UA 3NIXA 4IA5A 1OJDA 1S3EA 2VRLA 3DK9A 3M0OA 3AEAA 1LTXR 2BK3A 2E4GA 2FJBA 2HQMA 3P4PA 2YG5A 4GCMA 2GH5A 1LV0A 2R45A 3CIRA 4PAAA 4YTPA 2GAHB 3GYIA 3K7MX 1COYA 5L46A 3AWIA 2F5ZA 2WPCA 4RG4A 1ZKQA 2BC1A 4U2LA 2V60A 2YLTA 4GDEA 5KVIA 3NGCX 2XFPA 4J31A 3DJEA 1EL5A 2XFUA 2CULA 1LVLA 3AXBA 2UZZA 2ARDA 2R4EA 2WPFA 1SEZA 3O0HA 3BHFA 3UTEA 4CBQA 2DKIA 3REDA 3AE8A 4EQXA 1PBDA 4P9SA 1JNZA 5U1OA 5U63A 3DGHA 4RSLA 3UOVA 5C2TA 4ZN0A 1ZOVA 2XFNA 2A87A 4OPGA 4H4UA 2R46A 4H2QA 4YWOA 1LPFA 2XFQA 4A7AA 3NK1X 1CJ4A 2QAEA 2Y6QA 4K22A 1IUTA 4OPLA 3VR9A 3G5SA 1PS9A 2BK4A 1H7XA 3AE2A 3CNSA 3OZ2A 3QVPA 4UP3A 4A99A 1E6EA 3UKFA 4A6NA 1FEBA 4U8NA 5JCLA 1H84A 4LU6A 1JRZA 4EQWA 2B9XA 3ISHA 2OAMA 3LJPA 3UP5A 3UKQA 4DSHA 3AECA 2QA2A 2C70A 2A8XA 1IUVA 1Y56A 2ZZBA 1E1NA 3GMBA 3KLJA 4TM0A 4U8OA 2B7RA 2WP9A 4EQRA 4IVOB 2BABA 5HYMA 1E1KA 1KFYA 3CNPA 1CHUA 3CGEA 3DGZA 3LADA 5EB4A 2YQUA 2BC0A 4RG3A 4CCRA 2J3NA 2BK5A 4H4WA 4A6NB 2OLOA 3UTFA 4X9NA 4IV9A 4OPTA 4K5RA 2GVCA 2JB2A 1XPQA 4LIIA 5FS8A 2PYXA 4D04A 5M10A 2YWLA 2GR1A 2RABA 4OPIA 1D5TA 3UP4A 3AYLA 2QCUA 3AD7B 3AEBA 1H7WA 1M64A 1H82A 1JNRA 4I59A 3D1CA 4U8KA 1Y56B 1K0LA 3IC9A 2C64A 1DXLA 3CNJA 3ICTA 2BCGG 1FOHA 1D7YA 2YVJA 5M0ZA 3K7TA 2NVKX 4Z44A 4CRTA 4YXDA 2YLSA 3K30A 2WHDA 2C66A 4U2SA 1ONFA 2C67A 2BXSA 3BNUA 2B9WA 2GF3A 1JOAA 1B8SA 3QSSA 2YLRA 4H2PA 2GEWA 2B9YA 3P4RA 2OA1A 3FBSA 3GDPA 1GTHA 3L8KA 3ICRA 4Z43A 1N4WA 2R9ZA 5ER0A 3CNTA 5C3JA 2C65A 2BS4A 1CJ3A 1GRGA 3AD8B 2X8HA 4NZHA 2TPRA 3GYJA 3UKLA 4B69A 4B67A 5JCKA 2ZBWA 2VQ7A 4A65A 1IUSA 3UKKA 5FMHA 2GR2A 4NTEA 1L0VA 4K8DA 1ZP0A 4JQ9A 1YQ4A 3WE0A 3NN0X 1CC4A 3DK4A 3Q9TA 3GDNA 4CY6A 1EBDA 1GSNA 2DKHA 1NPXA 4YTMA 1ZDLA 1VG0A 1KNRA 4CNKA 4OPDA 3M13A 1OJ9A 2V61A 1LQTA 4H4SA 4OPUA 2W0HA 1QLBA 2FJAA 1BKWA 2GB0A 1CJ2A 3ALMA 1XHCA 3P4QA 1TDKA 2IIDA 4B63A 3COXA 3CPIG 1VDCA 1JEHA 1VRQB 1XANA 4EM4A 5KOWA 4M52A 2V3BA 1NEKA 3S61A 5DBJA 3CTYA 1TYTA 3IF9A 4LA1A 3RNMA 4Z25A 5CKUA 1GTEA 4REKA 2O9ZA 4ICYA 2WOVA 2APGA 2JK6A 4TM4A 3UOZA 4NEVA 2XVEA 4CCQA 2RGHA 1H83A 1GT8A 3JSKA 4O5UA 3ALLA 5IQ1A 3FIMB 4JY3A 1YQZA 2CVJA 5JCMA 1MXTA 3FPZA 3ABVA 4FX9A 1PBEA 1K4QA 2IVDA 3PVCA 3BI4A 2Q0LA 3IHGA 4H2NA 3BHKA 3NKSA 4C3YA 3AE5A 3H4KA 4UDRA 4YSZA 1GEUA 1PXBA 1S2YA 4KX6A 1GRFA 1TDNA 2WU5A 4A5LA 3NNEA 2Q6UA
chains in the Genus database with same CATH superfamily
1RSGA 3HYXA 4BURA 5FS7A 1O5WA 2WETA 1CF3A 1L9DA 3SZWA 4B66A 3QSMA 4H4PA 3KKJA 1CC6A 2C7GA 1TRBA 1PJ7A 3GD3A 3UOYA 4Z26A 2BA9A 4HA6A 1S3BA 1NAAA 3AE3A 2PHHA 3CNDA 1BGJA 3L1RA 1GRTA 1P2EA 4FK1C 4N9XA 4YSYA 1YY5A 2RGOA 5TR3A 4BV6A 3AYJA 1K0JA 2YR6A 1TDEA 3UKPA 3P1WA 1RYIA 2CFYA 3NTAA 3C4AA 4OCGA 2XLTA 4OPCA 5KOXA 3LOVA 2IVEA 4IA6A 4UDPA 3SM8A 2OALA 3NYCA 1XDIA 2QA1A 4YTNA 2WDVA 1MOKA 2C3CA 2VVLG 2XLSA 3NLCA 3GWDA 3VRAA 4JNQA 4YKFA 3CGBA 1PXCA 2RGJA 2NPXA 2YLWA 1NG3A 4U2TA 4BK1A 2X50A 4JNAA 4GDPA 1DJNA 1NHRA 4U8MA 1M6IA 2GAGB 2JB1A 3VRDB 5BULA 1FECA 3HZLA 1QO8A 5HHFA 3LZWA 3AE1A 1NDAA 3G5QA 5EB5A 3D8XA 1QJDA 1YKJA 3EF6A 1Z6LA 3AYIA 2JBVA 3ATQA 2YG3A 4YT0A 3CPHG 1JRXA 1B37A 3AEFA 4EQSA 3SFDA 1GPEA 1ZMCA 2XVHA 1KF6A 1ZY8A 2JKCA 1LJ1A 3EANA 3NK0X 2R0PA 3F8PA 1F8WA 3DA1A 3H8IA 3PS9A 4K5SA 4EMWA 5KMSA 3RP6A 3M12A 1UKVG 1GXFA 2XVJA 2B7SA 4U8PA 4U8JA 4XXGA 1L9CA 3C4NA 5EOWA 1PBFA 5JCIA 3E1TA 4JDRA 4Y4NA 2GV8A 1ZX9A 3Q6JA 3SFEA 1PHHA 1HYUA 4Z2TA 4H2RA 3T14A 4NTDA 4H4RA 3GD4A 3CGDA 3IHMA 5J60A 2ZZ0A 4U8LA 4ZCDA 3SX6A 3SZFA 4B1BA 1IJHA 4AT2A 1DODA 3EAOA 3NG7X 3UTHA 3R9UA 3EPTA 1TDOA 5KWFA 1NG4A 2WDRA 4EIPA 4USQA 4Y4LA 2GRTA 2VQBA 3AEEA 1AOGA 3K7QX 1F8SA 2XVFA 3KD9A 3KU9A 3NK2X 3CMMA 4H50A 1CBOA 2YLZA 4O5QA 3V3OA 1DOCA 3NRNA 2C76A 4K7ZA 2E1MA 1BZLA 5GSNA 2V5ZA 1GESA 3FMWA 3AD9B 1ZOYA 4G6GA 4ECHA 4H7UA 5BVAA 4H4TA 4U8IA 4GAPA 2R0CA 1X31B 1F3PA 3V3NA 5U25A 3NYFA 2YG7A 1DNCA 1GRBA 5GRTA 2YM1A 3CGCA 4YSXA 4J34A 2BRAA 5CQFA 2WOWA 2EQ7A 3B3RA 3URHA 1H86A 1KDGA 2WP6A 1PJ6A 2BACA 2XYOA 3ICSA 1OJTA 4II2A 2Z5XA 3DJGX 4Y4MA 1JU2A 4TLXA 1RP0A 1GRAA 1GALA 1IUWA 1GV4A 2JAEA 1H6VA 2R4JA 2B76A 4G73A 4TM1A 3SY4A 3VRBA 4B64A 4BJYA 3DK8A 1CJCA 5KMRA 2WOIA 4EMIA 4II3A 1E39A 4XWRA 1FCDA 2GR0A 3QFAA 2XVIA 4C3XA 4A79A 2EQ9A 5KVHA 2Q0KA 2YVFA 3GRTA 5KMQA 4YKGA 2YAUA 4A9WA 2WU2A 3SQPA 2AR8A 4G74A 2C3DA 1GRHA 2XCGA 4E0VA 3QVRA 3QFBA 2WPEA 4JY2A 3OC4A 1D4CA 2GQFA 4B68A 5HY5A 4J56A 1Q1WA 4X4JA 3NHOX 1S2QA 1DOEA 1MO9A 1YQ3A 1D7LA 1H81A 4H4VA 1IUXA 2YR5A 3NYEA 4USRA 2AQJA 3AB1A 4APNA 1OJAA 4GF7A 1P2HA 3NTDA 3IWAA 3I6DA 2X99A 3UKHA 2H88A 2C75A 2I0ZA 4B65A 1BF3A 4UDQA 3QSEA 3KVEA 4Z24A 4ADWA 4D03A 3T0KA 3AE6A 1PXAA 4WCTA 4AP1A 3ITJA 3GWFA 1BGNA 1B4VA 1GERA 1REOA 3V76A 3ALJA 4K2XA 2C72A 1B5QA 1Q9IA 3UCLA 2GMHA 2H89A 2BYBA 4C5OA 3AEGA 4G6HA 3P4SA 2AAQA 1Y0PA 4C74A 4GUVA 2ZZCA 2XDOA 4IVMB 5FS6A 4GR1A 1NHPA 2C73A 3UOXA 2JB3A 2XLPA 3KPKA 5KXJA 4JN9A 4FK1A 3SXIA 2GR3A 2WP5A 3P9UA 5KNLA 2WBAA 2YG4A 1VG9A 1IUUA 4MJWA 2V3AA 3ATRA 2E5VA 3AE4A 3T31A 1GETA 1O95A 2XLUA 3T37A 1DJQA 2WESA 2YG6A 5BRTA 4AP3A 1TDFA 3RP8A 3T2ZA 2Z5YA 1PBBA 4HB9A 1ZMDA 3AE9A 1E7PA 2BCPA 3KA7A 3AE7A 3VR8A 2XLRA 4OVIA 2WDQA 2EQ8A 3DH9A 1W4XA 2XFOA 1LQUA 2VOUA 3C96A 4H4XA 1EL9A 4J57A 4C77A 2C4CA 2WS3A 3II4A 4X9MA 5IQ4A 2OLNA 3NT6A 1K0IA 3VQRA 1E1MA 1KSSA 1V59A 1N1PA 3GMCA 3LXDA 2YLXA 3CN8A 2VVLA 2YM2A 3QJ4A 2FJEA 1O94A 2R0GA 2WEUA 5BUKA 1D4DA 2A89A 2BS3A 3UKAA 4AOXA 2FBWA 1PN0A 4AOSA 2Q7VA 4NTCA 4DNAA 4GRTA 1F6MA 3ZYXA 3UTGA 4BJZA 4WX1A 2TMDA 3BNMA 1L9EA 3FG2P 3B6DA 1OJCA 2ACZA 4FDCB 3PO7A 4NNJA 3GSIA 4H4ZA 4J36A 4EIQA 4BK2A 3RHAA 1ZK7A 4J33A 1PDHA 5IPYA 2YR4A 2YVGA 1E1LA 3BI5A 1ELIA 2X3NA 1N4UA 3DJJA 4EM3A 3I3LA 1F8RA 2EQ6A 4H4YA 5EBKA 3S5WA 1EL7A 4PABA 3ADAB 3DMEA 3F8DA 3G5RA 4CY8A 3SGLA 5HXIA 4AT0A 3H8LA 1CC2A 3KPFA 5J7XA 5KRQA 2GMJA 3LB8A 2VZ2A 4I58A 5LV9A 2V6OA 3RP7A 2WQYA 1GNDA 1VQWA 1N4VA 4KPRA 5JCNA 4NWZA 4YSHA 1CL0A 1FL2A 1NHSA 2Y6RA 3F8RA 1TYPA 3AEDA 3SZ0A 4TLZA 3CPJG 3BI2A 2BS2A 3GRSA 4DGKA 1PBCA 1NHQA 1FEAA 4ZCCA 4J2WA 5FS9A 4Z2RA 4NEWA 2VVMA 4BK3A 1D4EA 1GREA 4XWZA 2FJDA 2X8GA 2BXRA 1BWCA 3DJDA 1DOBA 3NH3X 1JRYA 3NN6X 4TM3A 2X8CA 3LZXA 4CNJA 1EL8A 1KNPA 1NENA 2GQWA 4EMJA 2CDUA 1GOSA 4DSGA 3ZDNA 1KSUA 1Q1RA 1PJ5A 2VRMA 4H4QA 4Z2UA 3NIXA 4IA5A 1OJDA 1S3EA 2VRLA 3DK9A 3M0OA 3AEAA 1LTXR 2BK3A 2E4GA 2FJBA 2HQMA 3P4PA 2YG5A 4GCMA 2GH5A 1LV0A 2R45A 3CIRA 4PAAA 4YTPA 2GAHB 3GYIA 3K7MX 1COYA 5L46A 3AWIA 2F5ZA 2WPCA 4RG4A 1ZKQA 2BC1A 4U2LA 2V60A 2YLTA 4GDEA 5KVIA 3NGCX 2XFPA 4J31A 3DJEA 1EL5A 2XFUA 2CULA 1LVLA 3AXBA 2UZZA 2ARDA 2R4EA 2WPFA 1SEZA 3O0HA 3BHFA 3UTEA 4CBQA 2DKIA 3REDA 3AE8A 4EQXA 1PBDA 4P9SA 4G9KA 1JNZA 5U1OA 5U63A 3DGHA 4RSLA 3UOVA 5C2TA 4ZN0A 1ZOVA 2XFNA 2A87A 4OPGA 4H4UA 2R46A 4H2QA 4YWOA 1LPFA 2XFQA 4A7AA 3NK1X 1CJ4A 2QAEA 2Y6QA 4K22A 1IUTA 4OPLA 3VR9A 3G5SA 1PS9A 2BK4A 1H7XA 3AE2A 3CNSA 3OZ2A 3QVPA 4UP3A 4A99A 1E6EA 3UKFA 4A6NA 1FEBA 3GYXA 4U8NA 5JCLA 1H84A 4LU6A 1JRZA 4EQWA 2B9XA 3ISHA 2OAMA 3LJPA 3UP5A 3UKQA 4DSHA 3AECA 2QA2A 4GAVA 2C70A 2A8XA 1IUVA 1Y56A 2ZZBA 1E1NA 3GMBA 3KLJA 4TM0A 4U8OA 2B7RA 2WP9A 4EQRA 4IVOB 2BABA 5HYMA 1E1KA 1KFYA 3CNPA 1CHUA 3CGEA 3DGZA 3LADA 5EB4A 2YQUA 2BC0A 4RG3A 4CCRA 2J3NA 2BK5A 4H4WA 4A6NB 2OLOA 3UTFA 4X9NA 4IV9A 4OPTA 4K5RA 2GVCA 2JB2A 1XPQA 4LIIA 5FS8A 3HYWA 2PYXA 4D04A 5M10A 2YWLA 2GR1A 2RABA 3HYVA 1D5TA 4OPIA 3AYLA 2QCUA 3UP4A 3AD7B 3AEBA 1H7WA 1M64A 1H82A 1JNRA 4I59A 3D1CA 4U8KA 1Y56B 1K0LA 3T2KA 3IC9A 2C64A 1DXLA 3CNJA 3ICTA 2BCGG 1FOHA 1D7YA 2YVJA 5M0ZA 3K7TA 2NVKX 4Z44A 3T2YA 4CRTA 4YXDA 2YLSA 3K30A 2WHDA 2C66A 4U2SA 1ONFA 2C67A 2BXSA 3BNUA 2B9WA 2GF3A 1JOAA 1B8SA 3QSSA 2YLRA 4H2PA 2GEWA 2B9YA 3P4RA 2OA1A 3FBSA 3GDPA 1GTHA 3L8KA 3ICRA 4Z43A 1N4WA 2R9ZA 5ER0A 3CNTA 5C3JA 2C65A 2BS4A 1CJ3A 1GRGA 3AD8B 2X8HA 4NZHA 2TPRA 3GYJA 3UKLA 4B69A 4B67A 5JCKA 2ZBWA 2VQ7A 4A65A 1IUSA 3UKKA 5FMHA 2GR2A 4NTEA 1L0VA 4K8DA 1ZP0A 4JQ9A 1YQ4A 3WE0A 3NN0X 1CC4A 3DK4A 3Q9TA 3GDNA 4CY6A 1EBDA 1GSNA 2DKHA 1NPXA 4YTMA 1ZDLA 1VG0A 1KNRA 4CNKA 4OPDA 3M13A 1OJ9A 2V61A 1LQTA 4H4SA 4OPUA 2W0HA 1QLBA 2FJAA 1BKWA 2GB0A 1CJ2A 3ALMA 1XHCA 3P4QA 1TDKA 2IIDA 3SZCA 4B63A 3SYIA 3COXA 3CPIG 1VDCA 1JEHA 1VRQB 5KMPA 1XANA 4EM4A 5KOWA 4M52A 2V3BA 1NEKA 3S61A 5DBJA 3CTYA 1TYTA 3IF9A 4LA1A 3RNMA 4Z25A 5CKUA 1GTEA 4REKA 2O9ZA 4ICYA 2WOVA 2APGA 2JK6A 4TM4A 3UOZA 4NEVA 2XVEA 4CCQA 2RGHA 1H83A 1GT8A 3JSKA 4O5UA 3ALLA 5IQ1A 3FIMB 4JY3A 1YQZA 2CVJA 5JCMA 1MXTA 3FPZA 3ABVA 2BRYA 1PBEA 1K4QA 4FX9A 2IVDA 3PVCA 3BI4A 2Q0LA 3IHGA 4H2NA 3BHKA 3NKSA 4C3YA 3AE5A 3H4KA 4UDRA 4YSZA 1GEUA 1PXBA 1S2YA 4KX6A 1GRFA 1TDNA 2WU5A 4A5LA 3NNEA 2Q6UA
chains in the Genus database with same CATH topology
1RSGA 3HYXA 4BURA 5FS7A 1O5WA 2WETA 1CF3A 1L9DA 3SZWA 4B66A 3QSMA 4H4PA 3KKJA 1CC6A 2C7GA 1TRBA 1PJ7A 3GD3A 3UOYA 4Z26A 2BA9A 4HA6A 1S3BA 1NAAA 3AE3A 2PHHA 3CNDA 1BGJA 3L1RA 1GRTA 1P2EA 4FK1C 4N9XA 4YSYA 1YY5A 2RGOA 5TR3A 4BV6A 3AYJA 1K0JA 2YR6A 1TDEA 3UKPA 3P1WA 1RYIA 2CFYA 3NTAA 3C4AA 4OCGA 2XLTA 4OPCA 5KOXA 3LOVA 2IVEA 4IA6A 4UDPA 3SM8A 2OALA 3NYCA 1XDIA 2QA1A 4YTNA 2WDVA 1MOKA 2C3CA 2VVLG 2XLSA 3NLCA 3GWDA 3VRAA 4JNQA 4YKFA 3CGBA 1PXCA 2RGJA 2NPXA 2YLWA 1NG3A 4U2TA 4BK1A 2X50A 4JNAA 4GDPA 1DJNA 1NHRA 4U8MA 1M6IA 2GAGB 2JB1A 3VRDB 5BULA 1FECA 3HZLA 1QO8A 5HHFA 3LZWA 3AE1A 1NDAA 3G5QA 5EB5A 3D8XA 1QJDA 1YKJA 3EF6A 1Z6LA 3AYIA 2JBVA 3ATQA 2YG3A 4YT0A 3CPHG 1JRXA 1B37A 3AEFA 4EQSA 3SFDA 1GPEA 1ZMCA 2XVHA 1KF6A 1ZY8A 2JKCA 1LJ1A 3EANA 3NK0X 2R0PA 3F8PA 1F8WA 3DA1A 3H8IA 3PS9A 4K5SA 4EMWA 5KMSA 3RP6A 3M12A 1UKVG 1GXFA 2XVJA 2B7SA 4U8PA 4U8JA 4XXGA 1L9CA 3C4NA 5EOWA 1PBFA 5JCIA 3E1TA 4JDRA 4Y4NA 2GV8A 1ZX9A 3Q6JA 3SFEA 1PHHA 1HYUA 4Z2TA 4H2RA 3T14A 4NTDA 4H4RA 3GD4A 3CGDA 3IHMA 5J60A 2ZZ0A 4U8LA 4ZCDA 3SX6A 3SZFA 4B1BA 1IJHA 4AT2A 1DODA 3EAOA 3NG7X 3UTHA 3R9UA 3EPTA 1TDOA 5KWFA 1NG4A 2WDRA 4EIPA 4USQA 4Y4LA 2GRTA 2VQBA 3AEEA 1AOGA 3K7QX 1F8SA 2XVFA 3KD9A 3KU9A 3NK2X 3CMMA 4H50A 1CBOA 2YLZA 4O5QA 3V3OA 1DOCA 3NRNA 2C76A 4K7ZA 2E1MA 1BZLA 5GSNA 2V5ZA 1GESA 3FMWA 3AD9B 1ZOYA 4G6GA 4ECHA 4H7UA 5BVAA 4H4TA 4U8IA 4GAPA 2R0CA 1X31B 1F3PA 3V3NA 5U25A 3NYFA 2YG7A 1DNCA 1GRBA 5GRTA 2YM1A 3CGCA 4YSXA 4J34A 2BRAA 5CQFA 2WOWA 2EQ7A 3B3RA 3URHA 1H86A 1KDGA 2WP6A 1PJ6A 2BACA 2XYOA 3ICSA 1OJTA 4II2A 2Z5XA 3DJGX 4Y4MA 1JU2A 4TLXA 1RP0A 1GRAA 1GALA 1IUWA 1GV4A 2JAEA 1H6VA 2R4JA 2B76A 4G73A 4TM1A 3SY4A 3VRBA 4B64A 4BJYA 3DK8A 1CJCA 5KMRA 2WOIA 4EMIA 4II3A 1E39A 4XWRA 1FCDA 2GR0A 3QFAA 2XVIA 4C3XA 4A79A 2EQ9A 5KVHA 2Q0KA 2YVFA 3GRTA 5KMQA 4YKGA 2YAUA 4A9WA 2WU2A 3SQPA 2AR8A 4G74A 2C3DA 1GRHA 2XCGA 4E0VA 3QVRA 3QFBA 2WPEA 4JY2A 3OC4A 1D4CA 2GQFA 4B68A 5HY5A 4J56A 1Q1WA 4X4JA 3NHOX 1S2QA 1DOEA 1MO9A 1YQ3A 1D7LA 1H81A 4H4VA 1IUXA 2YR5A 3NYEA 4USRA 2AQJA 3AB1A 4APNA 1OJAA 4GF7A 1P2HA 3NTDA 3IWAA 3I6DA 2X99A 3UKHA 2H88A 2C75A 2I0ZA 4B65A 1BF3A 4UDQA 3QSEA 3KVEA 4Z24A 4ADWA 4D03A 3T0KA 3AE6A 1PXAA 4WCTA 4AP1A 3ITJA 3GWFA 1BGNA 1B4VA 1GERA 1REOA 3V76A 3ALJA 4K2XA 2C72A 1B5QA 1Q9IA 3UCLA 2GMHA 2H89A 2BYBA 4C5OA 3AEGA 4G6HA 3P4SA 2AAQA 1Y0PA 4C74A 4GUVA 2ZZCA 2XDOA 4IVMB 5FS6A 4GR1A 1NHPA 2C73A 3UOXA 2JB3A 2XLPA 3KPKA 5KXJA 4JN9A 4FK1A 3SXIA 2GR3A 2WP5A 3P9UA 5KNLA 2WBAA 2YG4A 1VG9A 1IUUA 4MJWA 2V3AA 3ATRA 2E5VA 3AE4A 3T31A 1GETA 1O95A 2XLUA 3T37A 1DJQA 2WESA 2YG6A 5BRTA 4AP3A 1TDFA 3RP8A 3T2ZA 2Z5YA 1PBBA 4HB9A 1ZMDA 3AE9A 1E7PA 2BCPA 3KA7A 3AE7A 3VR8A 2XLRA 4OVIA 2WDQA 2EQ8A 3DH9A 1W4XA 2XFOA 1LQUA 2VOUA 3C96A 4H4XA 1EL9A 4J57A 4C77A 2C4CA 2WS3A 3II4A 4X9MA 5IQ4A 2OLNA 3NT6A 1K0IA 3VQRA 1E1MA 1KSSA 1V59A 1N1PA 3GMCA 3LXDA 2YLXA 3CN8A 2VVLA 2YM2A 3QJ4A 2FJEA 1O94A 2R0GA 2WEUA 5BUKA 1D4DA 2A89A 2BS3A 3UKAA 4AOXA 2FBWA 1PN0A 4AOSA 2Q7VA 4NTCA 4DNAA 4GRTA 1F6MA 3ZYXA 3UTGA 4BJZA 4WX1A 2TMDA 3BNMA 1L9EA 3FG2P 3B6DA 1OJCA 2ACZA 4FDCB 3PO7A 4NNJA 3GSIA 4H4ZA 4J36A 4EIQA 4BK2A 3RHAA 1ZK7A 4J33A 1PDHA 5IPYA 2YR4A 2YVGA 1E1LA 3BI5A 1ELIA 2X3NA 1N4UA 3DJJA 4EM3A 3I3LA 1F8RA 2EQ6A 4H4YA 5EBKA 3S5WA 1EL7A 4PABA 3ADAB 3DMEA 3F8DA 3G5RA 4CY8A 3SGLA 5HXIA 4AT0A 3H8LA 1CC2A 3KPFA 5J7XA 5KRQA 2GMJA 3LB8A 2VZ2A 4I58A 5LV9A 2V6OA 3RP7A 2WQYA 1GNDA 1VQWA 1N4VA 4KPRA 5JCNA 4NWZA 4YSHA 1CL0A 1FL2A 1NHSA 2Y6RA 3F8RA 1TYPA 3AEDA 3SZ0A 4TLZA 3CPJG 3BI2A 2BS2A 3GRSA 4DGKA 1PBCA 1NHQA 1FEAA 4ZCCA 4J2WA 5FS9A 4Z2RA 4NEWA 2VVMA 4BK3A 1D4EA 1GREA 4XWZA 2FJDA 2X8GA 2BXRA 1BWCA 3DJDA 1DOBA 3NH3X 1JRYA 3NN6X 4TM3A 2X8CA 3LZXA 4CNJA 1EL8A 1KNPA 1NENA 2GQWA 4EMJA 2CDUA 1GOSA 4DSGA 3ZDNA 1KSUA 1Q1RA 1PJ5A 2VRMA 4H4QA 4Z2UA 3NIXA 4IA5A 1OJDA 1S3EA 2VRLA 3DK9A 3M0OA 3AEAA 1LTXR 2BK3A 2E4GA 2FJBA 2HQMA 3P4PA 2YG5A 4GCMA 2GH5A 1LV0A 2R45A 3CIRA 4PAAA 4YTPA 2GAHB 3GYIA 3K7MX 1COYA 5L46A 3AWIA 2F5ZA 2WPCA 4RG4A 1ZKQA 2BC1A 4U2LA 2V60A 2YLTA 4GDEA 5KVIA 3NGCX 2XFPA 4J31A 3DJEA 1EL5A 2XFUA 2CULA 1LVLA 3AXBA 2UZZA 2ARDA 2R4EA 2WPFA 1SEZA 3O0HA 3BHFA 3UTEA 4CBQA 2DKIA 3REDA 3AE8A 4EQXA 1PBDA 4P9SA 4G9KA 1JNZA 5U1OA 5U63A 3DGHA 4RSLA 3UOVA 5C2TA 4ZN0A 1ZOVA 2XFNA 2A87A 4OPGA 4H4UA 2R46A 4H2QA 4YWOA 1LPFA 2XFQA 4A7AA 3NK1X 1CJ4A 2QAEA 2Y6QA 4K22A 1IUTA 4OPLA 3VR9A 3G5SA 1PS9A 2BK4A 1H7XA 3AE2A 3CNSA 3OZ2A 3QVPA 4UP3A 4A99A 1E6EA 3UKFA 4A6NA 1FEBA 3GYXA 4U8NA 5JCLA 1H84A 4LU6A 1JRZA 4EQWA 2B9XA 3ISHA 2OAMA 3LJPA 3UP5A 3UKQA 4DSHA 3AECA 2QA2A 4GAVA 2C70A 2A8XA 1IUVA 1Y56A 2ZZBA 1E1NA 3GMBA 3KLJA 4TM0A 4U8OA 2B7RA 2WP9A 4EQRA 4IVOB 2BABA 5HYMA 1E1KA 1KFYA 3CNPA 1CHUA 3CGEA 3DGZA 3LADA 5EB4A 2YQUA 2BC0A 4RG3A 4CCRA 2J3NA 2BK5A 4H4WA 4A6NB 2OLOA 3UTFA 4X9NA 4IV9A 4OPTA 4K5RA 2GVCA 2JB2A 1XPQA 4LIIA 5FS8A 3HYWA 2PYXA 4D04A 5M10A 2YWLA 2GR1A 2RABA 3HYVA 1D5TA 4OPIA 3AYLA 2QCUA 3UP4A 3AD7B 3AEBA 1H7WA 1M64A 1H82A 1JNRA 4I59A 3D1CA 4U8KA 1Y56B 1K0LA 3T2KA 3IC9A 2C64A 1DXLA 3CNJA 3ICTA 2BCGG 1FOHA 1D7YA 2YVJA 5M0ZA 3K7TA 2NVKX 4Z44A 3T2YA 4CRTA 4YXDA 2YLSA 3K30A 2WHDA 2C66A 4U2SA 1ONFA 2C67A 2BXSA 3BNUA 2B9WA 2GF3A 1JOAA 1B8SA 3QSSA 2YLRA 4H2PA 2GEWA 2B9YA 3P4RA 2OA1A 3FBSA 3GDPA 1GTHA 3L8KA 3ICRA 4Z43A 1N4WA 2R9ZA 5ER0A 3CNTA 5C3JA 2C65A 2BS4A 1CJ3A 1GRGA 3AD8B 2X8HA 4NZHA 2TPRA 3GYJA 3UKLA 4B69A 4B67A 5JCKA 2ZBWA 2VQ7A 4A65A 1IUSA 3UKKA 5FMHA 2GR2A 4NTEA 1L0VA 4K8DA 1ZP0A 4JQ9A 1YQ4A 3WE0A 3NN0X 1CC4A 3DK4A 3Q9TA 3GDNA 4CY6A 1EBDA 1GSNA 2DKHA 1NPXA 4YTMA 1ZDLA 1VG0A 1KNRA 4CNKA 4OPDA 3M13A 1OJ9A 2V61A 1LQTA 4H4SA 4OPUA 2W0HA 1QLBA 2FJAA 1BKWA 2GB0A 1CJ2A 3ALMA 1XHCA 3P4QA 1TDKA 2IIDA 3SZCA 4B63A 3SYIA 3COXA 3CPIG 1VDCA 1JEHA 1VRQB 5KMPA 1XANA 4EM4A 5KOWA 4M52A 2V3BA 1NEKA 3S61A 5DBJA 3CTYA 1TYTA 3IF9A 4LA1A 3RNMA 4Z25A 5CKUA 1GTEA 4REKA 2O9ZA 4ICYA 2WOVA 2APGA 2JK6A 4TM4A 3UOZA 4NEVA 2XVEA 4CCQA 2RGHA 1H83A 1GT8A 3JSKA 4O5UA 3ALLA 5IQ1A 3FIMB 4JY3A 1YQZA 2CVJA 5JCMA 1MXTA 3FPZA 3ABVA 2BRYA 1PBEA 1K4QA 4FX9A 2IVDA 3PVCA 3BI4A 2Q0LA 3IHGA 4H2NA 3BHKA 3NKSA 4C3YA 3AE5A 3H4KA 4UDRA 4YSZA 1GEUA 1PXBA 1S2YA 4KX6A 1GRFA 1TDNA 2WU5A 4A5LA 3NNEA 2Q6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSG A;  4BUR A;  5FS7 A;  1O5W A;  2WET A;  1CF3 A;  1L9D A;  4B66 A;  3QSM A;  4H4P A;  3KKJ A;  1CC6 A;  2C7G A;  1TRB A;  1PJ7 A;  3GD3 A;  3UOY A;  4Z26 A;  2BA9 A;  4HA6 A;  1S3B A;  1NAA A;  3AE3 A;  2PHH A;  3CND A;  1BGJ A;  3L1R A;  1GRT A;  1P2E A;  4FK1 C;  4N9X A;  4YSY A;  1YY5 A;  2RGO A;  5TR3 A;  4BV6 A;  3AYJ A;  1K0J A;  2YR6 A;  1TDE A;  3UKP A;  3P1W A;  1RYI A;  2CFY A;  3NTA A;  3C4A A;  4OCG A;  2XLT A;  4OPC A;  5KOX A;  3LOV A;  2IVE A;  4IA6 A;  4UDP A;  3SM8 A;  2OAL A;  3NYC A;  1XDI A;  2QA1 A;  4YTN A;  2WDV A;  1MOK A;  2C3C A;  2VVL G;  2XLS A;  3NLC A;  3GWD A;  3VRA A;  4JNQ A;  4YKF A;  3CGB A;  1PXC A;  2RGJ A;  2NPX A;  2YLW A;  1NG3 A;  4U2T A;  4BK1 A;  2X50 A;  4JNA A;  4GDP A;  1DJN A;  1NHR A;  4U8M A;  1M6I A;  2GAG B;  2JB1 A;  3VRD B;  5BUL A;  1FEC A;  3HZL A;  1QO8 A;  5HHF A;  3LZW A;  3AE1 A;  1NDA A;  3G5Q A;  5EB5 A;  3D8X A;  1QJD A;  1YKJ A;  3EF6 A;  1Z6L A;  3AYI A;  2JBV A;  3ATQ A;  2YG3 A;  4YT0 A;  3CPH G;  1JRX A;  1B37 A;  3AEF A;  4EQS A;  3SFD A;  1GPE A;  1ZMC A;  2XVH A;  1KF6 A;  1ZY8 A;  2JKC A;  1LJ1 A;  3EAN A;  3NK0 X;  2R0P A;  3F8P A;  1F8W A;  3DA1 A;  3H8I A;  3PS9 A;  4K5S A;  4EMW A;  3RP6 A;  3M12 A;  1UKV G;  1GXF A;  2XVJ A;  2B7S A;  4U8P A;  4U8J A;  4XXG A;  1L9C A;  3C4N A;  5EOW A;  1PBF A;  5JCI A;  3E1T A;  4JDR A;  4Y4N A;  2GV8 A;  1ZX9 A;  3Q6J A;  3SFE A;  1PHH A;  1HYU A;  4Z2T A;  4H2R A;  4NTD A;  4H4R A;  3GD4 A;  3CGD A;  3IHM A;  5J60 A;  2ZZ0 A;  4U8L A;  4ZCD A;  4B1B A;  1IJH A;  4AT2 A;  1DOD A;  3EAO A;  3NG7 X;  3UTH A;  3R9U A;  3EPT A;  1TDO A;  5KWF A;  1NG4 A;  2WDR A;  4EIP A;  4USQ A;  4Y4L A;  2GRT A;  2VQB A;  3AEE A;  1AOG A;  3K7Q X;  1F8S A;  2XVF A;  3KD9 A;  3KU9 A;  3NK2 X;  4H50 A;  4O5Q A;  1CBO A;  2YLZ A;  3V3O A;  1DOC A;  3NRN A;  2C76 A;  4K7Z A;  2E1M A;  1BZL A;  5GSN A;  2V5Z A;  1GES A;  3FMW A;  3AD9 B;  1ZOY A;  4ECH A;  4H7U A;  5BVA A;  4H4T A;  4U8I A;  2R0C A;  1X31 B;  1F3P A;  3V3N A;  5U25 A;  3NYF A;  2YG7 A;  1DNC A;  1GRB A;  5GRT A;  2YM1 A;  3CGC A;  4YSX A;  4J34 A;  5CQF A;  3URH A;  2WOW A;  2EQ7 A;  3B3R A;  1H86 A;  1KDG A;  2WP6 A;  1PJ6 A;  2BAC A;  2XYO A;  3ICS A;  1OJT A;  2Z5X A;  3DJG X;  4Y4M A;  1JU2 A;  4TLX A;  1RP0 A;  1GRA A;  1GAL A;  1IUW A;  1GV4 A;  2JAE A;  1H6V A;  2R4J A;  2B76 A;  4TM1 A;  3VRB A;  4B64 A;  4BJY A;  3DK8 A;  1CJC A;  2WOI A;  4EMI A;  1E39 A;  4XWR A;  1FCD A;  2GR0 A;  3QFA A;  2XVI A;  4C3X A;  4A79 A;  2EQ9 A;  5KVH A;  2Q0K A;  2YVF A;  3GRT A;  4YKG A;  2YAU A;  4A9W A;  2WU2 A;  3SQP A;  2AR8 A;  2C3D A;  1GRH A;  2XCG A;  4E0V A;  3QVR A;  3QFB A;  2WPE A;  4JY2 A;  3OC4 A;  1D4C A;  2GQF A;  4B68 A;  5HY5 A;  4J56 A;  1Q1W A;  4X4J A;  3NHO X;  1S2Q A;  1DOE A;  1MO9 A;  1YQ3 A;  1D7L A;  1H81 A;  4H4V A;  1IUX A;  2YR5 A;  3NYE A;  4USR A;  2AQJ A;  3AB1 A;  4APN A;  1OJA A;  4GF7 A;  1P2H A;  3NTD A;  3IWA A;  3I6D A;  2X99 A;  3UKH A;  2H88 A;  2C75 A;  2I0Z A;  4B65 A;  1BF3 A;  4UDQ A;  3QSE A;  3KVE A;  4Z24 A;  4ADW A;  4D03 A;  3AE6 A;  1PXA A;  4WCT A;  4AP1 A;  3ITJ A;  3GWF A;  1BGN A;  1B4V A;  1GER A;  1REO A;  3V76 A;  3ALJ A;  4K2X A;  2C72 A;  1B5Q A;  1Q9I A;  3UCL A;  2GMH A;  2H89 A;  2BYB A;  4C5O A;  3AEG A;  3P4S A;  2AAQ A;  1Y0P A;  4C74 A;  4GUV A;  2ZZC A;  2XDO A;  4IVM B;  5FS6 A;  4GR1 A;  1NHP A;  2C73 A;  3UOX A;  2JB3 A;  2XLP A;  5KXJ A;  4JN9 A;  4FK1 A;  2GR3 A;  2WP5 A;  3P9U A;  2WBA A;  2YG4 A;  1VG9 A;  1IUU A;  4MJW A;  2V3A A;  3ATR A;  2E5V A;  3AE4 A;  1GET A;  1O95 A;  2XLU A;  3T37 A;  1DJQ A;  2WES A;  2YG6 A;  5BRT A;  4AP3 A;  1TDF A;  3RP8 A;  2Z5Y A;  1PBB A;  4HB9 A;  1ZMD A;  3AE9 A;  1E7P A;  2BCP A;  3KA7 A;  3AE7 A;  3VR8 A;  2XLR A;  4OVI A;  2WDQ A;  2EQ8 A;  3DH9 A;  1W4X A;  2XFO A;  1LQU A;  2VOU A;  3C96 A;  4H4X A;  1EL9 A;  4J57 A;  4C77 A;  2WS3 A;  3II4 A;  4X9M A;  5IQ4 A;  2OLN A;  3NT6 A;  1K0I A;  3VQR A;  1E1M A;  1KSS A;  1V59 A;  1N1P A;  3GMC A;  3LXD A;  2YLX A;  3CN8 A;  2VVL A;  2YM2 A;  3QJ4 A;  2FJE A;  1O94 A;  2R0G A;  2WEU A;  5BUK A;  1D4D A;  2A89 A;  2BS3 A;  3UKA A;  4AOX A;  2FBW A;  1PN0 A;  4AOS A;  2Q7V A;  4NTC A;  4DNA A;  4GRT A;  1F6M A;  3ZYX A;  3UTG A;  4BJZ A;  4WX1 A;  2TMD A;  3BNM A;  1L9E A;  3FG2 P;  3B6D A;  1OJC A;  2ACZ A;  4FDC B;  3PO7 A;  3GSI A;  4H4Z A;  4J36 A;  4EIQ A;  4BK2 A;  3RHA A;  1ZK7 A;  4J33 A;  1PDH A;  5IPY A;  2YR4 A;  2YVG A;  1E1L A;  3BI5 A;  1ELI A;  2X3N A;  1N4U A;  3DJJ A;  4EM3 A;  3I3L A;  1F8R A;  2EQ6 A;  4H4Y A;  5EBK A;  3S5W A;  1EL7 A;  4PAB A;  3ADA B;  3DME A;  3F8D A;  3G5R A;  4CY8 A;  3SGL A;  5HXI A;  4AT0 A;  3H8L A;  1CC2 A;  3KPF A;  5J7X A;  5KRQ A;  2GMJ A;  3LB8 A;  2VZ2 A;  4I58 A;  5LV9 A;  2V6O A;  3RP7 A;  2WQY A;  1GND A;  1VQW A;  1N4V A;  4KPR A;  5JCN A;  4YSH A;  1CL0 A;  1FL2 A;  1NHS A;  2Y6R A;  3F8R A;  1TYP A;  3AED A;  4TLZ A;  3CPJ G;  3BI2 A;  2BS2 A;  3GRS A;  4DGK A;  1PBC A;  1NHQ A;  1FEA A;  4ZCC A;  4J2W A;  5FS9 A;  4Z2R A;  4NEW A;  2VVM A;  4BK3 A;  1D4E A;  1GRE A;  4XWZ A;  2FJD A;  2X8G A;  2BXR A;  1BWC A;  3DJD A;  1DOB A;  3NH3 X;  1JRY A;  3NN6 X;  4TM3 A;  2X8C A;  3LZX A;  4CNJ A;  1EL8 A;  1KNP A;  1NEN A;  2GQW A;  4EMJ A;  2CDU A;  1GOS A;  4DSG A;  3ZDN A;  1KSU A;  1Q1R A;  1PJ5 A;  2VRM A;  4H4Q A;  4Z2U A;  3NIX A;  4IA5 A;  1OJD A;  1S3E A;  2VRL A;  3DK9 A;  3M0O A;  3AEA A;  1LTX R;  2BK3 A;  2E4G A;  2FJB A;  2HQM A;  3P4P A;  2YG5 A;  4GCM A;  2GH5 A;  1LV0 A;  2R45 A;  3CIR A;  4PAA A;  4YTP A;  2GAH B;  3GYI A;  3K7M X;  1COY A;  5L46 A;  3AWI A;  2F5Z A;  2WPC A;  4RG4 A;  1ZKQ A;  2BC1 A;  4U2L A;  2V60 A;  2YLT A;  4GDE A;  5KVI A;  3NGC X;  2XFP A;  4J31 A;  3DJE A;  1EL5 A;  2XFU A;  2CUL A;  1LVL A;  3AXB A;  2UZZ A;  2ARD A;  2R4E A;  2WPF A;  1SEZ A;  3O0H A;  3BHF A;  3UTE A;  4CBQ A;  2DKI A;  3RED A;  3AE8 A;  4EQX A;  1PBD A;  4P9S A;  1JNZ A;  5U1O A;  5U63 A;  3DGH A;  4RSL A;  3UOV A;  5C2T A;  4ZN0 A;  1ZOV A;  2XFN A;  2A87 A;  4OPG A;  4H4U A;  2R46 A;  4H2Q A;  4YWO A;  1LPF A;  2XFQ A;  4A7A A;  3NK1 X;  1CJ4 A;  2QAE A;  2Y6Q A;  4K22 A;  1IUT A;  4OPL A;  3VR9 A;  3G5S A;  1PS9 A;  2BK4 A;  1H7X A;  3AE2 A;  3CNS A;  3OZ2 A;  3QVP A;  4UP3 A;  4A99 A;  1E6E A;  3UKF A;  4A6N A;  1FEB A;  4U8N A;  5JCL A;  1H84 A;  4LU6 A;  1JRZ A;  4EQW A;  2B9X A;  3ISH A;  2OAM A;  3LJP A;  3UP5 A;  3UKQ A;  4DSH A;  3AEC A;  2QA2 A;  2C70 A;  2A8X A;  1IUV A;  1Y56 A;  2ZZB A;  1E1N A;  3GMB A;  3KLJ A;  4TM0 A;  4U8O A;  2B7R A;  2WP9 A;  4EQR A;  4IVO B;  2BAB A;  5HYM A;  1E1K A;  1KFY A;  3CNP A;  1CHU A;  3CGE A;  3DGZ A;  3LAD A;  5EB4 A;  2YQU A;  2BC0 A;  4RG3 A;  4CCR A;  2J3N A;  2BK5 A;  4H4W A;  4A6N B;  2OLO A;  3UTF A;  4X9N A;  4IV9 A;  4OPT A;  4K5R A;  2GVC A;  2JB2 A;  1XPQ A;  4LII A;  5FS8 A;  2PYX A;  4D04 A;  5M10 A;  2YWL A;  2GR1 A;  2RAB A;  4OPI A;  1D5T A;  3UP4 A;  3AYL A;  2QCU A;  3AD7 B;  3AEB A;  1H7W A;  1M64 A;  1H82 A;  1JNR A;  4I59 A;  3D1C A;  4U8K A;  1Y56 B;  1K0L A;  3IC9 A;  2C64 A;  1DXL A;  3CNJ A;  3ICT A;  2BCG G;  1FOH A;  1D7Y A;  2YVJ A;  5M0Z A;  3K7T A;  2NVK X;  4Z44 A;  4CRT A;  4YXD A;  2YLS A;  3K30 A;  2WHD A;  2C66 A;  4U2S A;  1ONF A;  2C67 A;  2BXS A;  3BNU A;  2B9W A;  2GF3 A;  1JOA A;  1B8S A;  3QSS A;  2YLR A;  4H2P A;  2GEW A;  2B9Y A;  3P4R A;  2OA1 A;  3FBS A;  3GDP A;  1GTH A;  3L8K A;  3ICR A;  4Z43 A;  1N4W A;  2R9Z A;  5ER0 A;  3CNT A;  5C3J A;  2C65 A;  2BS4 A;  1CJ3 A;  1GRG A;  3AD8 B;  2X8H A;  4NZH A;  2TPR A;  3GYJ A;  3UKL A;  4B69 A;  4B67 A;  5JCK A;  2ZBW A;  2VQ7 A;  4A65 A;  1IUS A;  3UKK A;  5FMH A;  2GR2 A;  4NTE A;  1L0V A;  4K8D A;  1ZP0 A;  4JQ9 A;  1YQ4 A;  3WE0 A;  3NN0 X;  1CC4 A;  3DK4 A;  3Q9T A;  3GDN A;  4CY6 A;  1EBD A;  1GSN A;  2DKH A;  1NPX A;  4YTM A;  1ZDL A;  1VG0 A;  1KNR A;  4CNK A;  4OPD A;  3M13 A;  1OJ9 A;  2V61 A;  1LQT A;  4H4S A;  4OPU A;  2W0H A;  1QLB A;  2FJA A;  1BKW A;  2GB0 A;  1CJ2 A;  3ALM A;  1XHC A;  3P4Q A;  1TDK A;  2IID A;  4B63 A;  3COX A;  3CPI G;  1VDC A;  1JEH A;  1VRQ B;  1XAN A;  4EM4 A;  5KOW A;  4M52 A;  2V3B A;  1NEK A;  3S61 A;  5DBJ A;  3CTY A;  1TYT A;  3IF9 A;  4LA1 A;  3RNM A;  4Z25 A;  5CKU A;  1GTE A;  4REK A;  2O9Z A;  4ICY A;  2WOV A;  2APG A;  2JK6 A;  4TM4 A;  3UOZ A;  4NEV A;  2XVE A;  4CCQ A;  2RGH A;  1H83 A;  1GT8 A;  3JSK A;  4O5U A;  3ALL A;  5IQ1 A;  3FIM B;  4JY3 A;  1YQZ A;  2CVJ A;  5JCM A;  1MXT A;  3FPZ A;  3ABV A;  4FX9 A;  1PBE A;  1K4Q A;  2IVD A;  3PVC A;  3BI4 A;  2Q0L A;  3IHG A;  4H2N A;  3BHK A;  3NKS A;  4C3Y A;  3AE5 A;  3H4K A;  4UDR A;  4YSZ A;  1GEU A;  1PXB A;  1S2Y A;  4KX6 A;  1GRF A;  1TDN A;  2WU5 A;  4A5L A;  3NNE A;  2Q6U A; 
#chains in the Genus database with same CATH topology
 1RSG A;  3HYX A;  4BUR A;  5FS7 A;  1O5W A;  2WET A;  1CF3 A;  1L9D A;  3SZW A;  4B66 A;  3QSM A;  4H4P A;  3KKJ A;  1CC6 A;  2C7G A;  1TRB A;  1PJ7 A;  3GD3 A;  3UOY A;  4Z26 A;  2BA9 A;  4HA6 A;  1S3B A;  1NAA A;  3AE3 A;  2PHH A;  3CND A;  1BGJ A;  3L1R A;  1GRT A;  1P2E A;  4FK1 C;  4N9X A;  4YSY A;  1YY5 A;  2RGO A;  5TR3 A;  4BV6 A;  3AYJ A;  1K0J A;  2YR6 A;  1TDE A;  3UKP A;  3P1W A;  1RYI A;  2CFY A;  3NTA A;  3C4A A;  4OCG A;  2XLT A;  4OPC A;  5KOX A;  3LOV A;  2IVE A;  4IA6 A;  4UDP A;  3SM8 A;  2OAL A;  3NYC A;  1XDI A;  2QA1 A;  4YTN A;  2WDV A;  1MOK A;  2C3C A;  2VVL G;  2XLS A;  3NLC A;  3GWD A;  3VRA A;  4JNQ A;  4YKF A;  3CGB A;  1PXC A;  2RGJ A;  2NPX A;  2YLW A;  1NG3 A;  4U2T A;  4BK1 A;  2X50 A;  4JNA A;  4GDP A;  1DJN A;  1NHR A;  4U8M A;  1M6I A;  2GAG B;  2JB1 A;  3VRD B;  5BUL A;  1FEC A;  3HZL A;  1QO8 A;  5HHF A;  3LZW A;  3AE1 A;  1NDA A;  3G5Q A;  5EB5 A;  3D8X A;  1QJD A;  1YKJ A;  3EF6 A;  1Z6L A;  3AYI A;  2JBV A;  3ATQ A;  2YG3 A;  4YT0 A;  3CPH G;  1JRX A;  1B37 A;  3AEF A;  4EQS A;  3SFD A;  1GPE A;  1ZMC A;  2XVH A;  1KF6 A;  1ZY8 A;  2JKC A;  1LJ1 A;  3EAN A;  3NK0 X;  2R0P A;  3F8P A;  1F8W A;  3DA1 A;  3H8I A;  3PS9 A;  4K5S A;  4EMW A;  5KMS A;  3RP6 A;  3M12 A;  1UKV G;  1GXF A;  2XVJ A;  2B7S A;  4U8P A;  4U8J A;  4XXG A;  1L9C A;  3C4N A;  5EOW A;  1PBF A;  5JCI A;  3E1T A;  4JDR A;  4Y4N A;  2GV8 A;  1ZX9 A;  3Q6J A;  3SFE A;  1PHH A;  1HYU A;  4Z2T A;  4H2R A;  3T14 A;  4NTD A;  4H4R A;  3GD4 A;  3CGD A;  3IHM A;  5J60 A;  2ZZ0 A;  4U8L A;  4ZCD A;  3SX6 A;  3SZF A;  4B1B A;  1IJH A;  4AT2 A;  1DOD A;  3EAO A;  3NG7 X;  3UTH A;  3R9U A;  3EPT A;  1TDO A;  5KWF A;  1NG4 A;  2WDR A;  4EIP A;  4USQ A;  4Y4L A;  2GRT A;  2VQB A;  3AEE A;  1AOG A;  3K7Q X;  1F8S A;  2XVF A;  3KD9 A;  3KU9 A;  3NK2 X;  3CMM A;  4H50 A;  1CBO A;  2YLZ A;  4O5Q A;  3V3O A;  1DOC A;  3NRN A;  2C76 A;  4K7Z A;  2E1M A;  1BZL A;  5GSN A;  2V5Z A;  1GES A;  3FMW A;  3AD9 B;  1ZOY A;  4G6G A;  4ECH A;  4H7U A;  5BVA A;  4H4T A;  4U8I A;  4GAP A;  2R0C A;  1X31 B;  1F3P A;  3V3N A;  5U25 A;  3NYF A;  2YG7 A;  1DNC A;  1GRB A;  5GRT A;  2YM1 A;  3CGC A;  4YSX A;  4J34 A;  2BRA A;  5CQF A;  2WOW A;  2EQ7 A;  3B3R A;  3URH A;  1H86 A;  1KDG A;  2WP6 A;  1PJ6 A;  2BAC A;  2XYO A;  3ICS A;  1OJT A;  4II2 A;  2Z5X A;  3DJG X;  4Y4M A;  1JU2 A;  4TLX A;  1RP0 A;  1GRA A;  1GAL A;  1IUW A;  1GV4 A;  2JAE A;  1H6V A;  2R4J A;  2B76 A;  4G73 A;  4TM1 A;  3SY4 A;  3VRB A;  4B64 A;  4BJY A;  3DK8 A;  1CJC A;  5KMR A;  2WOI A;  4EMI A;  4II3 A;  1E39 A;  4XWR A;  1FCD A;  2GR0 A;  3QFA A;  2XVI A;  4C3X A;  4A79 A;  2EQ9 A;  5KVH A;  2Q0K A;  2YVF A;  3GRT A;  5KMQ A;  4YKG A;  2YAU A;  4A9W A;  2WU2 A;  3SQP A;  2AR8 A;  4G74 A;  2C3D A;  1GRH A;  2XCG A;  4E0V A;  3QVR A;  3QFB A;  2WPE A;  4JY2 A;  3OC4 A;  1D4C A;  2GQF A;  4B68 A;  5HY5 A;  4J56 A;  1Q1W A;  4X4J A;  3NHO X;  1S2Q A;  1DOE A;  1MO9 A;  1YQ3 A;  1D7L A;  1H81 A;  4H4V A;  1IUX A;  2YR5 A;  3NYE A;  4USR A;  2AQJ A;  3AB1 A;  4APN A;  1OJA A;  4GF7 A;  1P2H A;  3NTD A;  3IWA A;  3I6D A;  2X99 A;  3UKH A;  2H88 A;  2C75 A;  2I0Z A;  4B65 A;  1BF3 A;  4UDQ A;  3QSE A;  3KVE A;  4Z24 A;  4ADW A;  4D03 A;  3T0K A;  3AE6 A;  1PXA A;  4WCT A;  4AP1 A;  3ITJ A;  3GWF A;  1BGN A;  1B4V A;  1GER A;  1REO A;  3V76 A;  3ALJ A;  4K2X A;  2C72 A;  1B5Q A;  1Q9I A;  3UCL A;  2GMH A;  2H89 A;  2BYB A;  4C5O A;  3AEG A;  4G6H A;  3P4S A;  2AAQ A;  1Y0P A;  4C74 A;  4GUV A;  2ZZC A;  2XDO A;  4IVM B;  5FS6 A;  4GR1 A;  1NHP A;  2C73 A;  3UOX A;  2JB3 A;  2XLP A;  3KPK A;  5KXJ A;  4JN9 A;  4FK1 A;  3SXI A;  2GR3 A;  2WP5 A;  3P9U A;  5KNL A;  2WBA A;  2YG4 A;  1VG9 A;  1IUU A;  4MJW A;  2V3A A;  3ATR A;  2E5V A;  3AE4 A;  3T31 A;  1GET A;  1O95 A;  2XLU A;  3T37 A;  1DJQ A;  2WES A;  2YG6 A;  5BRT A;  4AP3 A;  1TDF A;  3RP8 A;  3T2Z A;  2Z5Y A;  1PBB A;  4HB9 A;  1ZMD A;  3AE9 A;  1E7P A;  2BCP A;  3KA7 A;  3AE7 A;  3VR8 A;  2XLR A;  4OVI A;  2WDQ A;  2EQ8 A;  3DH9 A;  1W4X A;  2XFO A;  1LQU A;  2VOU A;  3C96 A;  4H4X A;  1EL9 A;  4J57 A;  4C77 A;  2C4C A;  2WS3 A;  3II4 A;  4X9M A;  5IQ4 A;  2OLN A;  3NT6 A;  1K0I A;  3VQR A;  1E1M A;  1KSS A;  1V59 A;  1N1P A;  3GMC A;  3LXD A;  2YLX A;  3CN8 A;  2VVL A;  2YM2 A;  3QJ4 A;  2FJE A;  1O94 A;  2R0G A;  2WEU A;  5BUK A;  1D4D A;  2A89 A;  2BS3 A;  3UKA A;  4AOX A;  2FBW A;  1PN0 A;  4AOS A;  2Q7V A;  4NTC A;  4DNA A;  4GRT A;  1F6M A;  3ZYX A;  3UTG A;  4BJZ A;  4WX1 A;  2TMD A;  3BNM A;  1L9E A;  3FG2 P;  3B6D A;  1OJC A;  2ACZ A;  4FDC B;  3PO7 A;  4NNJ A;  3GSI A;  4H4Z A;  4J36 A;  4EIQ A;  4BK2 A;  3RHA A;  1ZK7 A;  4J33 A;  1PDH A;  5IPY A;  2YR4 A;  2YVG A;  1E1L A;  3BI5 A;  1ELI A;  2X3N A;  1N4U A;  3DJJ A;  4EM3 A;  3I3L A;  1F8R A;  2EQ6 A;  4H4Y A;  5EBK A;  3S5W A;  1EL7 A;  4PAB A;  3ADA B;  3DME A;  3F8D A;  3G5R A;  4CY8 A;  3SGL A;  5HXI A;  4AT0 A;  3H8L A;  1CC2 A;  3KPF A;  5J7X A;  5KRQ A;  2GMJ A;  3LB8 A;  2VZ2 A;  4I58 A;  5LV9 A;  2V6O A;  3RP7 A;  2WQY A;  1GND A;  1VQW A;  1N4V A;  4KPR A;  5JCN A;  4NWZ A;  4YSH A;  1CL0 A;  1FL2 A;  1NHS A;  2Y6R A;  3F8R A;  1TYP A;  3AED A;  3SZ0 A;  4TLZ A;  3CPJ G;  3BI2 A;  2BS2 A;  3GRS A;  4DGK A;  1PBC A;  1NHQ A;  1FEA A;  4ZCC A;  4J2W A;  5FS9 A;  4Z2R A;  4NEW A;  2VVM A;  4BK3 A;  1D4E A;  1GRE A;  4XWZ A;  2FJD A;  2X8G A;  2BXR A;  1BWC A;  3DJD A;  1DOB A;  3NH3 X;  1JRY A;  3NN6 X;  4TM3 A;  2X8C A;  3LZX A;  4CNJ A;  1EL8 A;  1KNP A;  1NEN A;  2GQW A;  4EMJ A;  2CDU A;  1GOS A;  4DSG A;  3ZDN A;  1KSU A;  1Q1R A;  1PJ5 A;  2VRM A;  4H4Q A;  4Z2U A;  3NIX A;  4IA5 A;  1OJD A;  1S3E A;  2VRL A;  3DK9 A;  3M0O A;  3AEA A;  1LTX R;  2BK3 A;  2E4G A;  2FJB A;  2HQM A;  3P4P A;  2YG5 A;  4GCM A;  2GH5 A;  1LV0 A;  2R45 A;  3CIR A;  4PAA A;  4YTP A;  2GAH B;  3GYI A;  3K7M X;  1COY A;  5L46 A;  3AWI A;  2F5Z A;  2WPC A;  4RG4 A;  1ZKQ A;  2BC1 A;  4U2L A;  2V60 A;  2YLT A;  4GDE A;  5KVI A;  3NGC X;  2XFP A;  4J31 A;  3DJE A;  1EL5 A;  2XFU A;  2CUL A;  1LVL A;  3AXB A;  2UZZ A;  2ARD A;  2R4E A;  2WPF A;  1SEZ A;  3O0H A;  3BHF A;  3UTE A;  4CBQ A;  2DKI A;  3RED A;  3AE8 A;  4EQX A;  1PBD A;  4P9S A;  4G9K A;  1JNZ A;  5U1O A;  5U63 A;  3DGH A;  4RSL A;  3UOV A;  5C2T A;  4ZN0 A;  1ZOV A;  2XFN A;  2A87 A;  4OPG A;  4H4U A;  2R46 A;  4H2Q A;  4YWO A;  1LPF A;  2XFQ A;  4A7A A;  3NK1 X;  1CJ4 A;  2QAE A;  2Y6Q A;  4K22 A;  1IUT A;  4OPL A;  3VR9 A;  3G5S A;  1PS9 A;  2BK4 A;  1H7X A;  3AE2 A;  3CNS A;  3OZ2 A;  3QVP A;  4UP3 A;  4A99 A;  1E6E A;  3UKF A;  4A6N A;  1FEB A;  3GYX A;  4U8N A;  5JCL A;  1H84 A;  4LU6 A;  1JRZ A;  4EQW A;  2B9X A;  3ISH A;  2OAM A;  3LJP A;  3UP5 A;  3UKQ A;  4DSH A;  3AEC A;  2QA2 A;  4GAV A;  2C70 A;  2A8X A;  1IUV A;  1Y56 A;  2ZZB A;  1E1N A;  3GMB A;  3KLJ A;  4TM0 A;  4U8O A;  2B7R A;  2WP9 A;  4EQR A;  4IVO B;  2BAB A;  5HYM A;  1E1K A;  1KFY A;  3CNP A;  1CHU A;  3CGE A;  3DGZ A;  3LAD A;  5EB4 A;  2YQU A;  2BC0 A;  4RG3 A;  4CCR A;  2J3N A;  2BK5 A;  4H4W A;  4A6N B;  2OLO A;  3UTF A;  4X9N A;  4IV9 A;  4OPT A;  4K5R A;  2GVC A;  2JB2 A;  1XPQ A;  4LII A;  5FS8 A;  3HYW A;  2PYX A;  4D04 A;  5M10 A;  2YWL A;  2GR1 A;  2RAB A;  3HYV A;  1D5T A;  4OPI A;  3AYL A;  2QCU A;  3UP4 A;  3AD7 B;  3AEB A;  1H7W A;  1M64 A;  1H82 A;  1JNR A;  4I59 A;  3D1C A;  4U8K A;  1Y56 B;  1K0L A;  3T2K A;  3IC9 A;  2C64 A;  1DXL A;  3CNJ A;  3ICT A;  2BCG G;  1FOH A;  1D7Y A;  2YVJ A;  5M0Z A;  3K7T A;  2NVK X;  4Z44 A;  3T2Y A;  4CRT A;  4YXD A;  2YLS A;  3K30 A;  2WHD A;  2C66 A;  4U2S A;  1ONF A;  2C67 A;  2BXS A;  3BNU A;  2B9W A;  2GF3 A;  1JOA A;  1B8S A;  3QSS A;  2YLR A;  4H2P A;  2GEW A;  2B9Y A;  3P4R A;  2OA1 A;  3FBS A;  3GDP A;  1GTH A;  3L8K A;  3ICR A;  4Z43 A;  1N4W A;  2R9Z A;  5ER0 A;  3CNT A;  5C3J A;  2C65 A;  2BS4 A;  1CJ3 A;  1GRG A;  3AD8 B;  2X8H A;  4NZH A;  2TPR A;  3GYJ A;  3UKL A;  4B69 A;  4B67 A;  5JCK A;  2ZBW A;  2VQ7 A;  4A65 A;  1IUS A;  3UKK A;  5FMH A;  2GR2 A;  4NTE A;  1L0V A;  4K8D A;  1ZP0 A;  4JQ9 A;  1YQ4 A;  3WE0 A;  3NN0 X;  1CC4 A;  3DK4 A;  3Q9T A;  3GDN A;  4CY6 A;  1EBD A;  1GSN A;  2DKH A;  1NPX A;  4YTM A;  1ZDL A;  1VG0 A;  1KNR A;  4CNK A;  4OPD A;  3M13 A;  1OJ9 A;  2V61 A;  1LQT A;  4H4S A;  4OPU A;  2W0H A;  1QLB A;  2FJA A;  1BKW A;  2GB0 A;  1CJ2 A;  3ALM A;  1XHC A;  3P4Q A;  1TDK A;  2IID A;  3SZC A;  4B63 A;  3SYI A;  3COX A;  3CPI G;  1VDC A;  1JEH A;  1VRQ B;  5KMP A;  1XAN A;  4EM4 A;  5KOW A;  4M52 A;  2V3B A;  1NEK A;  3S61 A;  5DBJ A;  3CTY A;  1TYT A;  3IF9 A;  4LA1 A;  3RNM A;  4Z25 A;  5CKU A;  1GTE A;  4REK A;  2O9Z A;  4ICY A;  2WOV A;  2APG A;  2JK6 A;  4TM4 A;  3UOZ A;  4NEV A;  2XVE A;  4CCQ A;  2RGH A;  1H83 A;  1GT8 A;  3JSK A;  4O5U A;  3ALL A;  5IQ1 A;  3FIM B;  4JY3 A;  1YQZ A;  2CVJ A;  5JCM A;  1MXT A;  3FPZ A;  3ABV A;  2BRY A;  1PBE A;  1K4Q A;  4FX9 A;  2IVD A;  3PVC A;  3BI4 A;  2Q0L A;  3IHG A;  4H2N A;  3BHK A;  3NKS A;  4C3Y A;  3AE5 A;  3H4K A;  4UDR A;  4YSZ A;  1GEU A;  1PXB A;  1S2Y A;  4KX6 A;  1GRF A;  1TDN A;  2WU5 A;  4A5L A;  3NNE A;  2Q6U A; 
#chains in the Genus database with same CATH homology
 1RSG A;  3HYX A;  4BUR A;  5FS7 A;  1O5W A;  2WET A;  1CF3 A;  1L9D A;  3SZW A;  4B66 A;  3QSM A;  4H4P A;  3KKJ A;  1CC6 A;  2C7G A;  1TRB A;  1PJ7 A;  3GD3 A;  3UOY A;  4Z26 A;  2BA9 A;  4HA6 A;  1S3B A;  1NAA A;  3AE3 A;  2PHH A;  3CND A;  1BGJ A;  3L1R A;  1GRT A;  1P2E A;  4FK1 C;  4N9X A;  4YSY A;  1YY5 A;  2RGO A;  5TR3 A;  4BV6 A;  3AYJ A;  1K0J A;  2YR6 A;  1TDE A;  3UKP A;  3P1W A;  1RYI A;  2CFY A;  3NTA A;  3C4A A;  4OCG A;  2XLT A;  4OPC A;  5KOX A;  3LOV A;  2IVE A;  4IA6 A;  4UDP A;  3SM8 A;  2OAL A;  3NYC A;  1XDI A;  2QA1 A;  4YTN A;  2WDV A;  1MOK A;  2C3C A;  2VVL G;  2XLS A;  3NLC A;  3GWD A;  3VRA A;  4JNQ A;  4YKF A;  3CGB A;  1PXC A;  2RGJ A;  2NPX A;  2YLW A;  1NG3 A;  4U2T A;  4BK1 A;  2X50 A;  4JNA A;  4GDP A;  1DJN A;  1NHR A;  4U8M A;  1M6I A;  2GAG B;  2JB1 A;  3VRD B;  5BUL A;  1FEC A;  3HZL A;  1QO8 A;  5HHF A;  3LZW A;  3AE1 A;  1NDA A;  3G5Q A;  5EB5 A;  3D8X A;  1QJD A;  1YKJ A;  3EF6 A;  1Z6L A;  3AYI A;  2JBV A;  3ATQ A;  2YG3 A;  4YT0 A;  3CPH G;  1JRX A;  1B37 A;  3AEF A;  4EQS A;  3SFD A;  1GPE A;  1ZMC A;  2XVH A;  1KF6 A;  1ZY8 A;  2JKC A;  1LJ1 A;  3EAN A;  3NK0 X;  2R0P A;  3F8P A;  1F8W A;  3DA1 A;  3H8I A;  3PS9 A;  4K5S A;  4EMW A;  5KMS A;  3RP6 A;  3M12 A;  1UKV G;  1GXF A;  2XVJ A;  2B7S A;  4U8P A;  4U8J A;  4XXG A;  1L9C A;  3C4N A;  5EOW A;  1PBF A;  5JCI A;  3E1T A;  4JDR A;  4Y4N A;  2GV8 A;  1ZX9 A;  3Q6J A;  3SFE A;  1PHH A;  1HYU A;  4Z2T A;  4H2R A;  3T14 A;  4NTD A;  4H4R A;  3GD4 A;  3CGD A;  3IHM A;  5J60 A;  2ZZ0 A;  4U8L A;  4ZCD A;  3SX6 A;  3SZF A;  4B1B A;  1IJH A;  4AT2 A;  1DOD A;  3EAO A;  3NG7 X;  3UTH A;  3R9U A;  3EPT A;  1TDO A;  5KWF A;  1NG4 A;  2WDR A;  4EIP A;  4USQ A;  4Y4L A;  2GRT A;  2VQB A;  3AEE A;  1AOG A;  3K7Q X;  1F8S A;  2XVF A;  3KD9 A;  3KU9 A;  3NK2 X;  3CMM A;  4H50 A;  1CBO A;  2YLZ A;  4O5Q A;  3V3O A;  1DOC A;  3NRN A;  2C76 A;  4K7Z A;  2E1M A;  1BZL A;  5GSN A;  2V5Z A;  1GES A;  3FMW A;  3AD9 B;  1ZOY A;  4G6G A;  4ECH A;  4H7U A;  5BVA A;  4H4T A;  4U8I A;  4GAP A;  2R0C A;  1X31 B;  1F3P A;  3V3N A;  5U25 A;  3NYF A;  2YG7 A;  1DNC A;  1GRB A;  5GRT A;  2YM1 A;  3CGC A;  4YSX A;  4J34 A;  2BRA A;  5CQF A;  2WOW A;  2EQ7 A;  3B3R A;  3URH A;  1H86 A;  1KDG A;  2WP6 A;  1PJ6 A;  2BAC A;  2XYO A;  3ICS A;  1OJT A;  4II2 A;  2Z5X A;  3DJG X;  4Y4M A;  1JU2 A;  4TLX A;  1RP0 A;  1GRA A;  1GAL A;  1IUW A;  1GV4 A;  2JAE A;  1H6V A;  2R4J A;  2B76 A;  4G73 A;  4TM1 A;  3SY4 A;  3VRB A;  4B64 A;  4BJY A;  3DK8 A;  1CJC A;  5KMR A;  2WOI A;  4EMI A;  4II3 A;  1E39 A;  4XWR A;  1FCD A;  2GR0 A;  3QFA A;  2XVI A;  4C3X A;  4A79 A;  2EQ9 A;  5KVH A;  2Q0K A;  2YVF A;  3GRT A;  5KMQ A;  4YKG A;  2YAU A;  4A9W A;  2WU2 A;  3SQP A;  2AR8 A;  4G74 A;  2C3D A;  1GRH A;  2XCG A;  4E0V A;  3QVR A;  3QFB A;  2WPE A;  4JY2 A;  3OC4 A;  1D4C A;  2GQF A;  4B68 A;  5HY5 A;  4J56 A;  1Q1W A;  4X4J A;  3NHO X;  1S2Q A;  1DOE A;  1MO9 A;  1YQ3 A;  1D7L A;  1H81 A;  4H4V A;  1IUX A;  2YR5 A;  3NYE A;  4USR A;  2AQJ A;  3AB1 A;  4APN A;  1OJA A;  4GF7 A;  1P2H A;  3NTD A;  3IWA A;  3I6D A;  2X99 A;  3UKH A;  2H88 A;  2C75 A;  2I0Z A;  4B65 A;  1BF3 A;  4UDQ A;  3QSE A;  3KVE A;  4Z24 A;  4ADW A;  4D03 A;  3T0K A;  3AE6 A;  1PXA A;  4WCT A;  4AP1 A;  3ITJ A;  3GWF A;  1BGN A;  1B4V A;  1GER A;  1REO A;  3V76 A;  3ALJ A;  4K2X A;  2C72 A;  1B5Q A;  1Q9I A;  3UCL A;  2GMH A;  2H89 A;  2BYB A;  4C5O A;  3AEG A;  4G6H A;  3P4S A;  2AAQ A;  1Y0P A;  4C74 A;  4GUV A;  2ZZC A;  2XDO A;  4IVM B;  5FS6 A;  4GR1 A;  1NHP A;  2C73 A;  3UOX A;  2JB3 A;  2XLP A;  3KPK A;  5KXJ A;  4JN9 A;  4FK1 A;  3SXI A;  2GR3 A;  2WP5 A;  3P9U A;  5KNL A;  2WBA A;  2YG4 A;  1VG9 A;  1IUU A;  4MJW A;  2V3A A;  3ATR A;  2E5V A;  3AE4 A;  3T31 A;  1GET A;  1O95 A;  2XLU A;  3T37 A;  1DJQ A;  2WES A;  2YG6 A;  5BRT A;  4AP3 A;  1TDF A;  3RP8 A;  3T2Z A;  2Z5Y A;  1PBB A;  4HB9 A;  1ZMD A;  3AE9 A;  1E7P A;  2BCP A;  3KA7 A;  3AE7 A;  3VR8 A;  2XLR A;  4OVI A;  2WDQ A;  2EQ8 A;  3DH9 A;  1W4X A;  2XFO A;  1LQU A;  2VOU A;  3C96 A;  4H4X A;  1EL9 A;  4J57 A;  4C77 A;  2C4C A;  2WS3 A;  3II4 A;  4X9M A;  5IQ4 A;  2OLN A;  3NT6 A;  1K0I A;  3VQR A;  1E1M A;  1KSS A;  1V59 A;  1N1P A;  3GMC A;  3LXD A;  2YLX A;  3CN8 A;  2VVL A;  2YM2 A;  3QJ4 A;  2FJE A;  1O94 A;  2R0G A;  2WEU A;  5BUK A;  1D4D A;  2A89 A;  2BS3 A;  3UKA A;  4AOX A;  2FBW A;  1PN0 A;  4AOS A;  2Q7V A;  4NTC A;  4DNA A;  4GRT A;  1F6M A;  3ZYX A;  3UTG A;  4BJZ A;  4WX1 A;  2TMD A;  3BNM A;  1L9E A;  3FG2 P;  3B6D A;  1OJC A;  2ACZ A;  4FDC B;  3PO7 A;  4NNJ A;  3GSI A;  4H4Z A;  4J36 A;  4EIQ A;  4BK2 A;  3RHA A;  1ZK7 A;  4J33 A;  1PDH A;  5IPY A;  2YR4 A;  2YVG A;  1E1L A;  3BI5 A;  1ELI A;  2X3N A;  1N4U A;  3DJJ A;  4EM3 A;  3I3L A;  1F8R A;  2EQ6 A;  4H4Y A;  5EBK A;  3S5W A;  1EL7 A;  4PAB A;  3ADA B;  3DME A;  3F8D A;  3G5R A;  4CY8 A;  3SGL A;  5HXI A;  4AT0 A;  3H8L A;  1CC2 A;  3KPF A;  5J7X A;  5KRQ A;  2GMJ A;  3LB8 A;  2VZ2 A;  4I58 A;  5LV9 A;  2V6O A;  3RP7 A;  2WQY A;  1GND A;  1VQW A;  1N4V A;  4KPR A;  5JCN A;  4NWZ A;  4YSH A;  1CL0 A;  1FL2 A;  1NHS A;  2Y6R A;  3F8R A;  1TYP A;  3AED A;  3SZ0 A;  4TLZ A;  3CPJ G;  3BI2 A;  2BS2 A;  3GRS A;  4DGK A;  1PBC A;  1NHQ A;  1FEA A;  4ZCC A;  4J2W A;  5FS9 A;  4Z2R A;  4NEW A;  2VVM A;  4BK3 A;  1D4E A;  1GRE A;  4XWZ A;  2FJD A;  2X8G A;  2BXR A;  1BWC A;  3DJD A;  1DOB A;  3NH3 X;  1JRY A;  3NN6 X;  4TM3 A;  2X8C A;  3LZX A;  4CNJ A;  1EL8 A;  1KNP A;  1NEN A;  2GQW A;  4EMJ A;  2CDU A;  1GOS A;  4DSG A;  3ZDN A;  1KSU A;  1Q1R A;  1PJ5 A;  2VRM A;  4H4Q A;  4Z2U A;  3NIX A;  4IA5 A;  1OJD A;  1S3E A;  2VRL A;  3DK9 A;  3M0O A;  3AEA A;  1LTX R;  2BK3 A;  2E4G A;  2FJB A;  2HQM A;  3P4P A;  2YG5 A;  4GCM A;  2GH5 A;  1LV0 A;  2R45 A;  3CIR A;  4PAA A;  4YTP A;  2GAH B;  3GYI A;  3K7M X;  1COY A;  5L46 A;  3AWI A;  2F5Z A;  2WPC A;  4RG4 A;  1ZKQ A;  2BC1 A;  4U2L A;  2V60 A;  2YLT A;  4GDE A;  5KVI A;  3NGC X;  2XFP A;  4J31 A;  3DJE A;  1EL5 A;  2XFU A;  2CUL A;  1LVL A;  3AXB A;  2UZZ A;  2ARD A;  2R4E A;  2WPF A;  1SEZ A;  3O0H A;  3BHF A;  3UTE A;  4CBQ A;  2DKI A;  3RED A;  3AE8 A;  4EQX A;  1PBD A;  4P9S A;  4G9K A;  1JNZ A;  5U1O A;  5U63 A;  3DGH A;  4RSL A;  3UOV A;  5C2T A;  4ZN0 A;  1ZOV A;  2XFN A;  2A87 A;  4OPG A;  4H4U A;  2R46 A;  4H2Q A;  4YWO A;  1LPF A;  2XFQ A;  4A7A A;  3NK1 X;  1CJ4 A;  2QAE A;  2Y6Q A;  4K22 A;  1IUT A;  4OPL A;  3VR9 A;  3G5S A;  1PS9 A;  2BK4 A;  1H7X A;  3AE2 A;  3CNS A;  3OZ2 A;  3QVP A;  4UP3 A;  4A99 A;  1E6E A;  3UKF A;  4A6N A;  1FEB A;  3GYX A;  4U8N A;  5JCL A;  1H84 A;  4LU6 A;  1JRZ A;  4EQW A;  2B9X A;  3ISH A;  2OAM A;  3LJP A;  3UP5 A;  3UKQ A;  4DSH A;  3AEC A;  2QA2 A;  4GAV A;  2C70 A;  2A8X A;  1IUV A;  1Y56 A;  2ZZB A;  1E1N A;  3GMB A;  3KLJ A;  4TM0 A;  4U8O A;  2B7R A;  2WP9 A;  4EQR A;  4IVO B;  2BAB A;  5HYM A;  1E1K A;  1KFY A;  3CNP A;  1CHU A;  3CGE A;  3DGZ A;  3LAD A;  5EB4 A;  2YQU A;  2BC0 A;  4RG3 A;  4CCR A;  2J3N A;  2BK5 A;  4H4W A;  4A6N B;  2OLO A;  3UTF A;  4X9N A;  4IV9 A;  4OPT A;  4K5R A;  2GVC A;  2JB2 A;  1XPQ A;  4LII A;  5FS8 A;  3HYW A;  2PYX A;  4D04 A;  5M10 A;  2YWL A;  2GR1 A;  2RAB A;  3HYV A;  1D5T A;  4OPI A;  3AYL A;  2QCU A;  3UP4 A;  3AD7 B;  3AEB A;  1H7W A;  1M64 A;  1H82 A;  1JNR A;  4I59 A;  3D1C A;  4U8K A;  1Y56 B;  1K0L A;  3T2K A;  3IC9 A;  2C64 A;  1DXL A;  3CNJ A;  3ICT A;  2BCG G;  1FOH A;  1D7Y A;  2YVJ A;  5M0Z A;  3K7T A;  2NVK X;  4Z44 A;  3T2Y A;  4CRT A;  4YXD A;  2YLS A;  3K30 A;  2WHD A;  2C66 A;  4U2S A;  1ONF A;  2C67 A;  2BXS A;  3BNU A;  2B9W A;  2GF3 A;  1JOA A;  1B8S A;  3QSS A;  2YLR A;  4H2P A;  2GEW A;  2B9Y A;  3P4R A;  2OA1 A;  3FBS A;  3GDP A;  1GTH A;  3L8K A;  3ICR A;  4Z43 A;  1N4W A;  2R9Z A;  5ER0 A;  3CNT A;  5C3J A;  2C65 A;  2BS4 A;  1CJ3 A;  1GRG A;  3AD8 B;  2X8H A;  4NZH A;  2TPR A;  3GYJ A;  3UKL A;  4B69 A;  4B67 A;  5JCK A;  2ZBW A;  2VQ7 A;  4A65 A;  1IUS A;  3UKK A;  5FMH A;  2GR2 A;  4NTE A;  1L0V A;  4K8D A;  1ZP0 A;  4JQ9 A;  1YQ4 A;  3WE0 A;  3NN0 X;  1CC4 A;  3DK4 A;  3Q9T A;  3GDN A;  4CY6 A;  1EBD A;  1GSN A;  2DKH A;  1NPX A;  4YTM A;  1ZDL A;  1VG0 A;  1KNR A;  4CNK A;  4OPD A;  3M13 A;  1OJ9 A;  2V61 A;  1LQT A;  4H4S A;  4OPU A;  2W0H A;  1QLB A;  2FJA A;  1BKW A;  2GB0 A;  1CJ2 A;  3ALM A;  1XHC A;  3P4Q A;  1TDK A;  2IID A;  3SZC A;  4B63 A;  3SYI A;  3COX A;  3CPI G;  1VDC A;  1JEH A;  1VRQ B;  5KMP A;  1XAN A;  4EM4 A;  5KOW A;  4M52 A;  2V3B A;  1NEK A;  3S61 A;  5DBJ A;  3CTY A;  1TYT A;  3IF9 A;  4LA1 A;  3RNM A;  4Z25 A;  5CKU A;  1GTE A;  4REK A;  2O9Z A;  4ICY A;  2WOV A;  2APG A;  2JK6 A;  4TM4 A;  3UOZ A;  4NEV A;  2XVE A;  4CCQ A;  2RGH A;  1H83 A;  1GT8 A;  3JSK A;  4O5U A;  3ALL A;  5IQ1 A;  3FIM B;  4JY3 A;  1YQZ A;  2CVJ A;  5JCM A;  1MXT A;  3FPZ A;  3ABV A;  2BRY A;  1PBE A;  1K4Q A;  4FX9 A;  2IVD A;  3PVC A;  3BI4 A;  2Q0L A;  3IHG A;  4H2N A;  3BHK A;  3NKS A;  4C3Y A;  3AE5 A;  3H4K A;  4UDR A;  4YSZ A;  1GEU A;  1PXB A;  1S2Y A;  4KX6 A;  1GRF A;  1TDN A;  2WU5 A;  4A5L A;  3NNE A;  2Q6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...