2Q0LA

Helicobacter pylori thioredoxin reductase reduced by sodium dithionite in complex with nadp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title High-resolution structures of oxidized and reduced thioredoxin reductase from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 93
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0lA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0lA02
1EL7A 1NENA 1RP0A 3DJDA 3RHAA 3V3NA 4XWZA 1DNCA 4YTNA 5L46A 5ER0A 4Z44A 4H50A 1YQZA 1KNPA 4APNA 3LZXA 1K0JA 3P1WA 3JSKA 2C70A 4Z43A 3QSEA 1S2YA 1NPXA 4LIIA 3BNMA 3GMBA 2XDOA 4H7UA 2YQUA 5JCKA 4OPDA 1S3EA 2DKHA 2BC0A 3AXBA 4C5OA 4I59A 2BXRA 2XLUA 3DK9A 2IIDA 1BGJA 3AB1A 3NNEA 3NN6X 2XFPA 4O5QA 1FECA 2X99A 4OCGA 2GH5A 2ACZA 5J7XA 3NT6A 4B68A 4J33A 2JKCA 1D4CA 1TDEA 2WDQA 2Q7VA 3NK1X 2XVFA 2A8XA 4P9SA 2VVMA 2YVFA 3CGBA 2WETA 3RP7A 3KVEA 1M64A 2R46A 2YR4A 1FEBA 4C77A 3G5QA 4EM4A 1JNZA 4U8JA 3IWAA 3UKQA 3M12A 4K5SA 1PN0A 2JB2A 4J31A 2YG6A 1QJDA 3AYJA 1D4DA 1K4QA 2BK5A 2Z5YA 1ZK7A 1JRYA 4YT0A 1KFYA 3ATQA 4B64A 4FK1A 1PXBA 3P4SA 2BK3A 5IPYA 2GR2A 2JB3A 1NHRA 2WPFA 4TLXA 2WEUA 1NDAA 4K8DA 1PDHA 4LA1A 2VVLG 2YG5A 2YR6A 3KKJA 4OPTA 4PABA 5FS8A 3DH9A 1DJNA 3NIXA 3IC9A 1NHQA 4GCMA 4U8KA 4UP3A 5J60A 2ZZBA 1E1MA 3AE6A 2UZZA 1YKJA 3AEFA 1ZY8A 4USRA 5M10A 1H82A 2YM1A 2WS3A 4EQWA 3NH3X 3ITJA 3UOVA 2AR8A 2R9ZA 2YG7A 1FOHA 2WDRA 5KWFA 4WCTA 3QFBA 2X50A 2RGHA 1PS9A 1NHSA 4K7ZA 2X8HA 1CJ2A 2XVEA 1DOBA 2AAQA 4GR1A 1DODA 4C3YA 2EQ7A 5BRTA 4AP3A 2QA1A 1GETA 2E4GA 4BV6A 1F8RA 4H4SA 3ATRA 1LVLA 2CDUA 3CNSA 1CJ3A 3P9UA 1DJQA 1ZKQA 3CTYA 4DGKA 3ALLA 4NEWA 4RG3A 1Y56A 1VDCA 2OA1A 2EQ6A 4ZCCA 4U8OA 5JCNA 1S3BA 3GDNA 4Z25A 1GSNA 1GNDA 4GDEA 4D04A 2WP9A 1FCDA 1TDKA 1YQ4A 1NHPA 3H4KA 4JNQA 4CCQA 1D4EA 1PBEA 2FJAA 4B67A 4A99A 4HB9A 2BC1A 2B9XA 2XVIA 1CHUA 2WBAA 4PAAA 4WX1A 4B65A 4N9XA 1F3PA 2A87A 3LB8A 1CJ4A 1B8SA 1DXLA 4XXGA 1XPQA 1GT8A 1ELIA 3ICRA 4DSGA 3LZWA 4J36A 2NVKX 1F8WA 1ZP0A 2GRTA 2XFNA 1GRGA 3CGCA 5IQ4A 2V61A 3NN0X 4NZHA 1TDOA 3AD8B 3EANA 1OJAA 2H89A 3AEDA 3CPIG 3LJPA 3COXA 2YVJA 3F8PA 2R45A 3L1RA 1GXFA 1BKWA 3PVCA 1CJCA 4ICYA 4U8IA 5KOWA 1Y0PA 3C96A 3GRTA 4TLZA 2O9ZA 4X9NA 5GRTA 3VRAA 2YLRA 1CF3A 3DGZA 2VOUA 5BULA 4YKGA 3UCLA 1BWCA 1MOKA 3LADA 3UKHA 4Z2UA 1Y56B 4TM3A 5U25A 4JY2A 1HYUA 2C64A 4H4ZA 4CCRA 3DK8A 2GVCA 2AQJA 1XHCA 3DGHA 1D7YA 4NTDA 3UKAA 3ZYXA 4YSYA 3BNUA 2GR3A 2ZZ0A 4Z2RA 5C2TA 2C66A 1N4UA 5FS6A 1OJTA 1H7XA 4KX6A 2WOIA 1EBDA 1O5WA 3E1TA 3PO7A 1ZDLA 2YLXA 1E7PA 2BS2A 2GR1A 2CFYA 3B6DA 1VRQB 4DNAA 4U8PA 1E1KA 4D03A 1JRXA 3L8KA 4X4JA 4BJZA 2WHDA 2CVJA 3UKPA 1PJ6A 3KLJA 1KSSA 2YLSA 1PBBA 3AEEA 3VRDB 1COYA 1PHHA 3AE2A 2XYOA 2JB1A 2WESA 4ADWA 5EB4A 3AE3A 3EF6A 2WP5A 1XDIA 1VG0A 1LJ1A 1PXAA 3BI2A 3ISHA 5KVIA 1PJ5A 4H2QA 1L9CA 1OJCA 2RGJA 1ZX9A 2YG3A 4U2LA 4B1BA 1GRBA 4EMIA 4UDQA 4H2PA 2VRMA 4Y4MA 4H4YA 2JK6A 3H8IA 3LXDA 1GRFA 1TYTA 1W4XA 2GB0A 3FPZA 2ZBWA 3M13A 4JY3A 1TDFA 4CNKA 1Q9IA 1QO8A 3WE0A 3KD9A 1NG4A 4FK1C 1LQTA 3AE8A 4REKA 2Q0LA 1E1LA 1PBDA 1PBCA 2YVGA 4MJWA 2BCPA 3NG7X 1CL0A 2GEWA 1X31B 5BVAA 3AD7B 2QA2A 1F8SA 2B7RA 3QSMA 1GV4A 4AOSA 4U8MA 4Z2TA 2B76A 2GMJA 3AD9B 4UDRA 4H2NA 4GDPA 1N4VA 1H86A 4A5LA 1SEZA 4YTMA 4U8LA 4B69A 3I6DA 4OPGA 3S5WA 1KDGA 1GRAA 3CNPA 4NTCA 2V6OA 3II4A 3VRBA 2YLTA 4J2WA 3EPTA 2X3NA 4I58A 4E0VA 2JBVA 3FIMB 2BK4A 3IHMA 3NTDA 1IUUA 3NLCA 5HYMA 1MXTA 4OPUA 3VQRA 3P4RA 5IQ1A 2PHHA 1EL9A 2WU5A 3UTHA 1D7LA 3C4NA 4BK2A 2XLSA 3UKKA 4B66A 2QAEA 2V3BA 1GREA 2WPCA 2B7SA 3IF9A 3GYJA 2VVLA 3NRNA 2RGOA 3UP4A 2WP6A 2WQYA 4USQA 3FBSA 1H81A 3NK2X 2VZ2A 1GTEA 4HA6A 1B4VA 5FS9A 3UOXA 4FX9A 2IVDA 2GV8A 1NG3A 2R0PA 3I3LA 4U2TA 5HY5A 3CNJA 4H4RA 2EQ9A 4CBQA 2FJDA 2BCGG 4IVOB 4A6NB 5TR3A 1TDNA 1Q1WA 2R0GA 1OJ9A 3CIRA 5U1OA 3QJ4A 4GUVA 5KRQA 1JU2A 4EM3A 1O94A 2YAUA 3QFAA 4BK1A 4K5RA 2OAMA 1NEKA 2B9YA 3NK0X 5BUKA 1F6MA 3V3OA 3K7TA 3FMWA 1H6VA 4A65A 3GYIA 2YLWA 5LV9A 4AOXA 1PBFA 4TM0A 2B9WA 3M0OA 1OJDA 2GQFA 2BS3A 4U2SA 3S61A 4DSHA 3UTGA 2ARDA 2H88A 2R4JA 4A9WA 2JAEA 2WOVA 1N1PA 3K7MX 2Y6RA 3BHKA 4BURA 2CULA 3BI5A 4H4PA 1ONFA 3NTAA 4Z26A 3GWDA 4BK3A 3NYFA 2YG4A 4A79A 1O95A 1LQUA 3DJGX 1YQ3A 2VRLA 3O0HA 4KPRA 4RG4A 3AEAA 2Y6QA 2NPXA 2R0CA 3NYEA 2GF3A 4H4XA 1P2HA 5EOWA 2WU2A 2F5ZA 1L9EA 4H4QA 3CGEA 3DMEA 3ICTA 3QSSA 2C76A 4YSHA 2WDVA 1VG9A 2XLPA 3AE1A 4Z24A 1IUWA 3CNTA 1B5QA 2QCUA 4YTPA 1D5TA 3V76A 2APGA 2WOWA 1BF3A 3B3RA 3K7QX 2Q6UA 2I0ZA 4ZCDA 1L0VA 5U63A 4O5UA 4B63A 1UKVG 2OLOA 2V3AA 2BYBA 1EL5A 2BABA 3AE4A 4CY8A 4H4VA 3QVPA 3GMCA 2E1MA 2V60A 4U8NA 1LV0A 1JNRA 1CBOA 3G5RA 3ALMA 4IA6A 2XFOA 1BGNA 4CNJA 1B37A 2FJEA 3HZLA 1H83A 3LOVA 2X8CA 1JEHA 4EMWA 5HXIA 3NYCA 2BS4A 3FG2P 1CC2A 1KF6A 4OPLA 4YSXA 2GAHB 3D1CA 1GESA 1K0IA 3SM8A 4K22A 4OPCA 1FEAA 4AP1A 4H4WA 3RP6A 1MO9A 2EQ8A 2VQ7A 2FJBA 4H4UA 1YY5A 3R9UA 3ALJA 1K0LA 3EAOA 4M52A 1S2QA 3CGDA 4AT2A 4YKFA 5EBKA 5JCLA 2C73A 2WPEA 3AEBA 5EB5A 5CQFA 3DK4A 1GOSA 4J56A 4XWRA 4TM1A 3UTFA 4EQRA 1H84A 1BZLA 4OVIA 3UOZA 4A6NA 2YM2A 2YLZA 4FDCB 3AE9A 2OALA 2XFUA 2A89A 2DKIA 3DJEA 4J34A 2J3NA 5HHFA 1RSGA 1IUTA 1H7WA 4YSZA 3IHGA 2XCGA 3AE7A 4GF7A 3AYLA 3C4AA 4ECHA 4YWOA 3SGLA 2BA9A 2BXSA 1IUVA 1M6IA 1GRHA 1QLBA 2ZZCA 4A7AA 4CRTA 1E1NA 3GD4A 1GTHA 4LU6A 3UKFA 1JRZA 3CNDA 3DA1A 3F8DA 3NGCX 3KPFA 3F8RA 5KOXA 1DOEA 5C3JA 3ABVA 3VR9A 1GRTA 3OZ2A 4Y4LA 3SQPA 3UP5A 1VQWA 3GD3A 3ICSA 3RP8A 1KSUA 4H2RA 3NHOX 1GEUA 4NTEA 4NEVA 3BI4A 3RNMA 4J57A 1EL8A 1ZMCA 2XLTA 1LTXR 3AEGA 5CKUA 2XVHA 4EIQA 4JNAA 2GMHA 1JOAA 3H8LA 1ZOVA 3PS9A 4TM4A 5FMHA 4X9MA 1GPEA 1REOA 3GRSA 1NAAA 4JQ9A 2IVEA 1CC6A 1XANA 3AECA 1PJ7A 3QVRA 3OC4A 1V59A 1Z6LA 3KU9A 2PYXA 1P2EA 3ADAB 2Q0KA 3KA7A 3UOYA 2C3CA 2C75A 2YWLA 2TMDA 2R4EA 5DBJA 1RYIA 4GRTA 4IA5A 4C3XA 3BHFA 3Q9TA 2RABA 4Y4NA 4EQXA 3AWIA 1TYPA 4UDPA 1IUSA 3SFEA 3UTEA 3D8XA 2GR0A 2HQMA 3GDPA 4C74A 2XVJA 4EIPA 4YXDA 3GWFA 1KNRA 1LPFA 1N4WA 2XLRA 3P4QA 5KXJA 3K30A 3REDA 1IJHA 2FBWA 4IV9A 5M0ZA 3T37A 1Q1RA 5JCMA 1CC4A 2GQWA 2XFQA 1E6EA 4JN9A 2W0HA 2Z5XA 4EQSA 1GALA 4BJYA 3CN8A 2GAGB 3DJJA 2OLNA 5FS7A 3AE5A 4AT0A 4OPIA 3UKLA 1PXCA 3CPJG 1E39A 4CY6A 3CPHG 3VR8A 3ZDNA 4IVMB 4JDRA 2YR5A 3G5SA 3NKSA 3Q6JA 4RSLA 1ZOYA 2X8GA 2BACA 5JCIA 2E5VA 3URHA 4ZN0A 2VQBA 2C7GA 1ZMDA 5GSNA 3SFDA 1TRBA 4K2XA 1FL2A 2TPRA 2V5ZA 1L9DA 2C65A 1DOCA 2C72A 4EMJA 1GERA 2C3DA 3AYIA 3GSIA 1AOGA 1IUXA 2C67A 5KVHA 3P4PA 4H4TA
chains in the Genus database with same CATH superfamily
1EL7A 1NENA 1RP0A 3T2KA 3DJDA 3RHAA 3V3NA 4XWZA 1DNCA 4YTNA 5L46A 5ER0A 4Z44A 4H50A 1YQZA 1KNPA 4APNA 3LZXA 1K0JA 3P1WA 3JSKA 2C70A 4Z43A 3QSEA 1S2YA 1NPXA 4LIIA 3BNMA 3GMBA 2XDOA 3KPKA 4H7UA 2YQUA 5JCKA 4OPDA 5KMSA 1S3EA 2DKHA 2BC0A 3AXBA 4C5OA 4I59A 2BXRA 2XLUA 3DK9A 2IIDA 1BGJA 3AB1A 3NNEA 3NN6X 2XFPA 4O5QA 3CMMA 1FECA 2X99A 4OCGA 2GH5A 2ACZA 5J7XA 3NT6A 4B68A 4J33A 2JKCA 1D4CA 1TDEA 2WDQA 2Q7VA 3NK1X 2XVFA 2A8XA 4P9SA 2VVMA 2YVFA 3CGBA 2WETA 3RP7A 3KVEA 1M64A 2R46A 2YR4A 1FEBA 4C77A 3G5QA 4EM4A 1JNZA 4U8JA 3IWAA 3UKQA 3M12A 4K5SA 1PN0A 2JB2A 4J31A 2YG6A 1QJDA 3AYJA 1D4DA 3SYIA 1K4QA 2BK5A 2Z5YA 1ZK7A 1JRYA 4YT0A 1KFYA 3ATQA 4B64A 4FK1A 1PXBA 3P4SA 2BK3A 5IPYA 2GR2A 2JB3A 1NHRA 2WPFA 4TLXA 2WEUA 1NDAA 4K8DA 1PDHA 4LA1A 2VVLG 2YG5A 2YR6A 3KKJA 4OPTA 4PABA 5FS8A 3DH9A 1DJNA 3NIXA 3IC9A 1NHQA 4GCMA 4U8KA 4UP3A 5J60A 2ZZBA 1E1MA 3AE6A 2UZZA 1YKJA 3AEFA 1ZY8A 4USRA 5M10A 1H82A 2YM1A 2WS3A 4EQWA 3NH3X 3ITJA 3UOVA 2AR8A 2R9ZA 2YG7A 1FOHA 2WDRA 5KWFA 4WCTA 3QFBA 2X50A 2RGHA 1PS9A 1NHSA 4K7ZA 2X8HA 1CJ2A 3SZWA 2XVEA 1DOBA 2AAQA 4GR1A 1DODA 4C3YA 2EQ7A 5BRTA 4AP3A 3HYXA 2QA1A 1GETA 2E4GA 4BV6A 1F8RA 4H4SA 3ATRA 1LVLA 2CDUA 3CNSA 1CJ3A 3P9UA 1DJQA 1ZKQA 3CTYA 5KNLA 4DGKA 3ALLA 4NEWA 4RG3A 1Y56A 1VDCA 2OA1A 2EQ6A 4ZCCA 4U8OA 5JCNA 1S3BA 3GDNA 4Z25A 1GSNA 1GNDA 4GDEA 4D04A 2WP9A 1FCDA 1TDKA 1YQ4A 1NHPA 3H4KA 4JNQA 4CCQA 1D4EA 1PBEA 2FJAA 4B67A 4A99A 4HB9A 2BC1A 2B9XA 2XVIA 1CHUA 2WBAA 4PAAA 4WX1A 4B65A 4N9XA 1F3PA 2A87A 3LB8A 1CJ4A 1B8SA 1DXLA 4XXGA 1XPQA 1GT8A 1ELIA 3ICRA 4DSGA 3LZWA 4J36A 2NVKX 1F8WA 1ZP0A 2GRTA 2XFNA 1GRGA 3CGCA 5IQ4A 2V61A 3NN0X 4NZHA 2C4CA 1TDOA 3AD8B 3EANA 1OJAA 2H89A 3AEDA 3CPIG 3LJPA 3COXA 2YVJA 3F8PA 2R45A 3L1RA 1GXFA 1BKWA 3PVCA 1CJCA 4ICYA 4U8IA 5KOWA 1Y0PA 3C96A 3GRTA 4TLZA 2O9ZA 4G9KA 4X9NA 5GRTA 2YLRA 3VRAA 1CF3A 3DGZA 2VOUA 5BULA 4YKGA 3UCLA 1BWCA 1MOKA 3LADA 3UKHA 4Z2UA 1Y56B 5KMPA 4TM3A 5U25A 4JY2A 1HYUA 2C64A 4H4ZA 4CCRA 3DK8A 2GVCA 2AQJA 1XHCA 3DGHA 1D7YA 4NTDA 3UKAA 3ZYXA 4YSYA 3BNUA 2GR3A 2ZZ0A 4Z2RA 5C2TA 2C66A 1N4UA 5FS6A 1OJTA 1H7XA 4KX6A 2WOIA 1EBDA 1O5WA 3E1TA 3PO7A 1ZDLA 2YLXA 1E7PA 2BS2A 2GR1A 2CFYA 3B6DA 1VRQB 4DNAA 4U8PA 4G73A 1E1KA 4D03A 1JRXA 3L8KA 4X4JA 4BJZA 2WHDA 2CVJA 3UKPA 1PJ6A 3KLJA 1KSSA 2YLSA 1PBBA 3AEEA 3VRDB 1COYA 1PHHA 3AE2A 2XYOA 2JB1A 2WESA 4ADWA 5EB4A 3AE3A 3EF6A 2WP5A 1XDIA 1VG0A 1LJ1A 1PXAA 3BI2A 3ISHA 5KVIA 1PJ5A 4H2QA 1L9CA 1OJCA 4NWZA 2RGJA 1ZX9A 2YG3A 4U2LA 4B1BA 1GRBA 4EMIA 4UDQA 4H2PA 2VRMA 4Y4MA 4H4YA 5KMQA 2JK6A 3H8IA 3LXDA 1GRFA 1TYTA 1W4XA 2GB0A 3HYVA 3FPZA 2ZBWA 3M13A 4JY3A 1TDFA 4CNKA 1Q9IA 1QO8A 3WE0A 3KD9A 1NG4A 4FK1C 4II2A 4GAVA 1LQTA 3AE8A 4REKA 2Q0LA 1E1LA 1PBDA 1PBCA 2YVGA 4MJWA 2BCPA 3NG7X 1CL0A 2GEWA 1X31B 5BVAA 3AD7B 2QA2A 1F8SA 2B7RA 3QSMA 1GV4A 4AOSA 4U8MA 4Z2TA 2B76A 2GMJA 3AD9B 4UDRA 4H2NA 4GDPA 1N4VA 1H86A 4A5LA 1SEZA 4YTMA 4U8LA 4B69A 3I6DA 4OPGA 3S5WA 1KDGA 1GRAA 3CNPA 4NTCA 2V6OA 3II4A 3VRBA 2YLTA 4J2WA 3EPTA 2X3NA 4I58A 4E0VA 3SXIA 2JBVA 3FIMB 2BK4A 3IHMA 3NTDA 1IUUA 3NLCA 5HYMA 1MXTA 4OPUA 3VQRA 3P4RA 5IQ1A 2PHHA 1EL9A 2WU5A 3GYXA 1D7LA 3C4NA 3T0KA 3UTHA 4BK2A 2XLSA 3UKKA 4B66A 2QAEA 2V3BA 1GREA 2WPCA 2B7SA 3IF9A 3GYJA 2VVLA 3NRNA 2RGOA 3UP4A 2WP6A 2WQYA 4USQA 3FBSA 1H81A 3NK2X 2VZ2A 1GTEA 4HA6A 1B4VA 5FS9A 3UOXA 4FX9A 2IVDA 2GV8A 1NG3A 2R0PA 3I3LA 4U2TA 5KMRA 5HY5A 3CNJA 4H4RA 2EQ9A 4CBQA 2FJDA 2BCGG 4IVOB 4A6NB 5TR3A 1TDNA 1Q1WA 2R0GA 1OJ9A 3SX6A 3CIRA 5U1OA 3QJ4A 4GUVA 5KRQA 1JU2A 4EM3A 1O94A 2YAUA 3QFAA 4BK1A 4K5RA 2OAMA 1NEKA 2B9YA 2BRYA 3NK0X 1F6MA 3V3OA 5BUKA 3K7TA 3FMWA 1H6VA 3SZ0A 4A65A 3GYIA 2YLWA 5LV9A 4AOXA 4G6GA 1PBFA 4TM0A 2B9WA 3M0OA 1OJDA 2GQFA 2BS3A 4U2SA 3S61A 4DSHA 3UTGA 2ARDA 2H88A 2R4JA 4A9WA 2JAEA 2WOVA 1N1PA 4G74A 3K7MX 2Y6RA 3BHKA 4BURA 2CULA 3BI5A 4H4PA 1ONFA 3NTAA 4Z26A 3GWDA 4BK3A 3NYFA 2YG4A 4A79A 1O95A 1LQUA 3T31A 3DJGX 1YQ3A 2VRLA 3O0HA 4KPRA 4RG4A 3AEAA 2Y6QA 2NPXA 2R0CA 3NYEA 2GF3A 4H4XA 1P2HA 5EOWA 2WU2A 2F5ZA 1L9EA 4H4QA 3CGEA 3DMEA 3ICTA 3QSSA 2C76A 4YSHA 2WDVA 1VG9A 2XLPA 3AE1A 4Z24A 1IUWA 3CNTA 1B5QA 2QCUA 4YTPA 1D5TA 3V76A 2APGA 2WOWA 1BF3A 3B3RA 3K7QX 2Q6UA 3SZFA 2I0ZA 4ZCDA 1L0VA 5U63A 4O5UA 4B63A 1UKVG 2OLOA 2V3AA 2BYBA 1EL5A 2BABA 3AE4A 4CY8A 4H4VA 3QVPA 3GMCA 2E1MA 2V60A 4U8NA 1LV0A 1JNRA 1CBOA 3G5RA 3ALMA 4IA6A 2XFOA 1BGNA 4CNJA 1B37A 2FJEA 3HZLA 1H83A 3LOVA 2X8CA 1JEHA 4EMWA 5HXIA 3NYCA 3SY4A 2BS4A 3FG2P 1CC2A 1KF6A 4OPLA 4YSXA 2GAHB 3D1CA 1GESA 4NNJA 1K0IA 3SM8A 4K22A 4OPCA 1FEAA 4AP1A 4H4WA 3RP6A 1MO9A 2EQ8A 2VQ7A 2FJBA 4H4UA 1YY5A 3R9UA 3ALJA 1K0LA 3EAOA 4M52A 1S2QA 3CGDA 4AT2A 4YKFA 5EBKA 5JCLA 2C73A 2WPEA 3AEBA 5EB5A 5CQFA 3DK4A 1GOSA 4J56A 4XWRA 4TM1A 3UTFA 4EQRA 1H84A 1BZLA 4OVIA 3UOZA 4A6NA 2YM2A 2YLZA 4FDCB 3AE9A 2OALA 3T2YA 2XFUA 2A89A 2DKIA 3DJEA 4J34A 2J3NA 5HHFA 1RSGA 1IUTA 1H7WA 4YSZA 3IHGA 2XCGA 3AE7A 4GF7A 3AYLA 3C4AA 4ECHA 4YWOA 3SGLA 2BA9A 2BXSA 1IUVA 1M6IA 1GRHA 1QLBA 2ZZCA 4A7AA 4CRTA 1E1NA 3GD4A 1GTHA 4LU6A 3UKFA 1JRZA 3CNDA 3DA1A 3F8DA 3NGCX 3KPFA 3F8RA 5KOXA 1DOEA 5C3JA 3ABVA 3VR9A 1GRTA 3T2ZA 3OZ2A 4Y4LA 3SQPA 3UP5A 1VQWA 3GD3A 3ICSA 4G6HA 3RP8A 1KSUA 4H2RA 3NHOX 1GEUA 4NTEA 4NEVA 3BI4A 3RNMA 4J57A 1EL8A 1ZMCA 2XLTA 1LTXR 3AEGA 5CKUA 2XVHA 4EIQA 4JNAA 2GMHA 1JOAA 3H8LA 1ZOVA 3PS9A 4TM4A 5FMHA 4X9MA 1GPEA 1REOA 3GRSA 1NAAA 4JQ9A 2IVEA 1CC6A 1XANA 3AECA 1PJ7A 3QVRA 3OC4A 1V59A 1Z6LA 3KU9A 2PYXA 1P2EA 3ADAB 2Q0KA 3KA7A 3UOYA 2C3CA 2C75A 2YWLA 2TMDA 2R4EA 5DBJA 2BRAA 1RYIA 4GRTA 4IA5A 4C3XA 3BHFA 3Q9TA 2RABA 4Y4NA 4EQXA 3AWIA 1TYPA 4UDPA 1IUSA 3SFEA 3UTEA 3D8XA 2GR0A 2HQMA 3GDPA 4C74A 2XVJA 4EIPA 4YXDA 3GWFA 1KNRA 1LPFA 1N4WA 2XLRA 3P4QA 5KXJA 3K30A 3REDA 1IJHA 2FBWA 4IV9A 5M0ZA 3T37A 1Q1RA 5JCMA 1CC4A 2GQWA 2XFQA 1E6EA 4JN9A 2W0HA 2Z5XA 4EQSA 3HYWA 1GALA 4BJYA 3SZCA 3CN8A 2GAGB 3DJJA 2OLNA 5FS7A 3AE5A 4AT0A 4OPIA 3UKLA 1PXCA 3CPJG 1E39A 4CY6A 3CPHG 3VR8A 3ZDNA 4IVMB 4JDRA 2YR5A 3G5SA 3NKSA 3Q6JA 4RSLA 1ZOYA 2X8GA 2BACA 5JCIA 2E5VA 3URHA 4ZN0A 2VQBA 2C7GA 1ZMDA 5GSNA 3SFDA 4GAPA 1TRBA 4K2XA 1FL2A 2TPRA 2V5ZA 1L9DA 2C65A 1DOCA 2C72A 4EMJA 1GERA 2C3DA 3AYIA 3GSIA 4II3A 3T14A 1AOGA 1IUXA 2C67A 5KVHA 3P4PA 4H4TA
chains in the Genus database with same CATH topology
1EL7A 1NENA 1RP0A 3T2KA 3DJDA 3RHAA 3V3NA 4XWZA 1DNCA 4YTNA 5L46A 5ER0A 4Z44A 4H50A 1YQZA 1KNPA 4APNA 3LZXA 1K0JA 3P1WA 3JSKA 2C70A 4Z43A 3QSEA 1S2YA 1NPXA 4LIIA 3BNMA 3GMBA 2XDOA 3KPKA 4H7UA 2YQUA 5JCKA 4OPDA 5KMSA 1S3EA 2DKHA 2BC0A 3AXBA 4C5OA 4I59A 2BXRA 2XLUA 3DK9A 2IIDA 1BGJA 3AB1A 3NNEA 3NN6X 2XFPA 4O5QA 3CMMA 1FECA 2X99A 4OCGA 2GH5A 2ACZA 5J7XA 3NT6A 4B68A 4J33A 2JKCA 1D4CA 1TDEA 2WDQA 2Q7VA 3NK1X 2XVFA 2A8XA 4P9SA 2VVMA 2YVFA 3CGBA 2WETA 3RP7A 3KVEA 1M64A 2R46A 2YR4A 1FEBA 4C77A 3G5QA 4EM4A 1JNZA 4U8JA 3IWAA 3UKQA 3M12A 4K5SA 1PN0A 2JB2A 4J31A 2YG6A 1QJDA 3AYJA 1D4DA 3SYIA 1K4QA 2BK5A 2Z5YA 1ZK7A 1JRYA 4YT0A 1KFYA 3ATQA 4B64A 4FK1A 1PXBA 3P4SA 2BK3A 5IPYA 2GR2A 2JB3A 1NHRA 2WPFA 4TLXA 2WEUA 1NDAA 4K8DA 1PDHA 4LA1A 2VVLG 2YG5A 2YR6A 3KKJA 4OPTA 4PABA 5FS8A 3DH9A 1DJNA 3NIXA 3IC9A 1NHQA 4GCMA 4U8KA 4UP3A 5J60A 2ZZBA 1E1MA 3AE6A 2UZZA 1YKJA 3AEFA 1ZY8A 4USRA 5M10A 1H82A 2YM1A 2WS3A 4EQWA 3NH3X 3ITJA 3UOVA 2AR8A 2R9ZA 2YG7A 1FOHA 2WDRA 5KWFA 4WCTA 3QFBA 2X50A 2RGHA 1PS9A 1NHSA 4K7ZA 2X8HA 1CJ2A 3SZWA 2XVEA 1DOBA 2AAQA 4GR1A 1DODA 4C3YA 2EQ7A 5BRTA 4AP3A 3HYXA 2QA1A 1GETA 2E4GA 4BV6A 1F8RA 4H4SA 3ATRA 1LVLA 2CDUA 3CNSA 1CJ3A 3P9UA 1DJQA 1ZKQA 3CTYA 5KNLA 4DGKA 3ALLA 4NEWA 4RG3A 1Y56A 1VDCA 2OA1A 2EQ6A 4ZCCA 4U8OA 5JCNA 1S3BA 3GDNA 4Z25A 1GSNA 1GNDA 4GDEA 4D04A 2WP9A 1FCDA 1TDKA 1YQ4A 1NHPA 3H4KA 4JNQA 4CCQA 1D4EA 1PBEA 2FJAA 4B67A 4A99A 4HB9A 2BC1A 2B9XA 2XVIA 1CHUA 2WBAA 4PAAA 4WX1A 4B65A 4N9XA 1F3PA 2A87A 3LB8A 1CJ4A 1B8SA 1DXLA 4XXGA 1XPQA 1GT8A 1ELIA 3ICRA 4DSGA 3LZWA 4J36A 2NVKX 1F8WA 1ZP0A 2GRTA 2XFNA 1GRGA 3CGCA 5IQ4A 2V61A 3NN0X 4NZHA 2C4CA 1TDOA 3AD8B 3EANA 1OJAA 2H89A 3AEDA 3CPIG 3LJPA 3COXA 2YVJA 3F8PA 2R45A 3L1RA 1GXFA 1BKWA 3PVCA 1CJCA 4ICYA 4U8IA 5KOWA 1Y0PA 3C96A 3GRTA 4TLZA 2O9ZA 4G9KA 4X9NA 5GRTA 2YLRA 3VRAA 1CF3A 3DGZA 2VOUA 5BULA 4YKGA 3UCLA 1BWCA 1MOKA 3LADA 3UKHA 4Z2UA 1Y56B 5KMPA 4TM3A 5U25A 4JY2A 1HYUA 2C64A 4H4ZA 4CCRA 3DK8A 2GVCA 2AQJA 1XHCA 3DGHA 1D7YA 4NTDA 3UKAA 3ZYXA 4YSYA 3BNUA 2GR3A 2ZZ0A 4Z2RA 5C2TA 2C66A 1N4UA 5FS6A 1OJTA 1H7XA 4KX6A 2WOIA 1EBDA 1O5WA 3E1TA 3PO7A 1ZDLA 2YLXA 1E7PA 2BS2A 2GR1A 2CFYA 3B6DA 1VRQB 4DNAA 4U8PA 4G73A 1E1KA 4D03A 1JRXA 3L8KA 4X4JA 4BJZA 2WHDA 2CVJA 3UKPA 1PJ6A 3KLJA 1KSSA 2YLSA 1PBBA 3AEEA 3VRDB 1COYA 1PHHA 3AE2A 2XYOA 2JB1A 2WESA 4ADWA 5EB4A 3AE3A 3EF6A 2WP5A 1XDIA 1VG0A 1LJ1A 1PXAA 3BI2A 3ISHA 5KVIA 1PJ5A 4H2QA 1L9CA 1OJCA 4NWZA 2RGJA 1ZX9A 2YG3A 4U2LA 4B1BA 1GRBA 4EMIA 4UDQA 4H2PA 2VRMA 4Y4MA 4H4YA 5KMQA 2JK6A 3H8IA 3LXDA 1GRFA 1TYTA 1W4XA 2GB0A 3HYVA 3FPZA 2ZBWA 3M13A 4JY3A 1TDFA 4CNKA 1Q9IA 1QO8A 3WE0A 3KD9A 1NG4A 4FK1C 4II2A 4GAVA 1LQTA 3AE8A 4REKA 2Q0LA 1E1LA 1PBDA 1PBCA 2YVGA 4MJWA 2BCPA 3NG7X 1CL0A 2GEWA 1X31B 5BVAA 3AD7B 2QA2A 1F8SA 2B7RA 3QSMA 1GV4A 4AOSA 4U8MA 4Z2TA 2B76A 2GMJA 3AD9B 4UDRA 4H2NA 4GDPA 1N4VA 1H86A 4A5LA 1SEZA 4YTMA 4U8LA 4B69A 3I6DA 4OPGA 3S5WA 1KDGA 1GRAA 3CNPA 4NTCA 2V6OA 3II4A 3VRBA 2YLTA 4J2WA 3EPTA 2X3NA 4I58A 4E0VA 3SXIA 2JBVA 3FIMB 2BK4A 3IHMA 3NTDA 1IUUA 3NLCA 5HYMA 1MXTA 4OPUA 3VQRA 3P4RA 5IQ1A 2PHHA 1EL9A 2WU5A 3GYXA 1D7LA 3C4NA 3T0KA 3UTHA 4BK2A 2XLSA 3UKKA 4B66A 2QAEA 2V3BA 1GREA 2WPCA 2B7SA 3IF9A 3GYJA 2VVLA 3NRNA 2RGOA 3UP4A 2WP6A 2WQYA 4USQA 3FBSA 1H81A 3NK2X 2VZ2A 1GTEA 4HA6A 1B4VA 5FS9A 3UOXA 4FX9A 2IVDA 2GV8A 1NG3A 2R0PA 3I3LA 4U2TA 5KMRA 5HY5A 3CNJA 4H4RA 2EQ9A 4CBQA 2FJDA 2BCGG 4IVOB 4A6NB 5TR3A 1TDNA 1Q1WA 2R0GA 1OJ9A 3SX6A 3CIRA 5U1OA 3QJ4A 4GUVA 5KRQA 1JU2A 4EM3A 1O94A 2YAUA 3QFAA 4BK1A 4K5RA 2OAMA 1NEKA 2B9YA 2BRYA 3NK0X 1F6MA 3V3OA 5BUKA 3K7TA 3FMWA 1H6VA 3SZ0A 4A65A 3GYIA 2YLWA 5LV9A 4AOXA 4G6GA 1PBFA 4TM0A 2B9WA 3M0OA 1OJDA 2GQFA 2BS3A 4U2SA 3S61A 4DSHA 3UTGA 2ARDA 2H88A 2R4JA 4A9WA 2JAEA 2WOVA 1N1PA 4G74A 3K7MX 2Y6RA 3BHKA 4BURA 2CULA 3BI5A 4H4PA 1ONFA 3NTAA 4Z26A 3GWDA 4BK3A 3NYFA 2YG4A 4A79A 1O95A 1LQUA 3T31A 3DJGX 1YQ3A 2VRLA 3O0HA 4KPRA 4RG4A 3AEAA 2Y6QA 2NPXA 2R0CA 3NYEA 2GF3A 4H4XA 1P2HA 5EOWA 2WU2A 2F5ZA 1L9EA 4H4QA 3CGEA 3DMEA 3ICTA 3QSSA 2C76A 4YSHA 2WDVA 1VG9A 2XLPA 3AE1A 4Z24A 1IUWA 3CNTA 1B5QA 2QCUA 4YTPA 1D5TA 3V76A 2APGA 2WOWA 1BF3A 3B3RA 3K7QX 2Q6UA 3SZFA 2I0ZA 4ZCDA 1L0VA 5U63A 4O5UA 4B63A 1UKVG 2OLOA 2V3AA 2BYBA 1EL5A 2BABA 3AE4A 4CY8A 4H4VA 3QVPA 3GMCA 2E1MA 2V60A 4U8NA 1LV0A 1JNRA 1CBOA 3G5RA 3ALMA 4IA6A 2XFOA 1BGNA 4CNJA 1B37A 2FJEA 3HZLA 1H83A 3LOVA 2X8CA 1JEHA 4EMWA 5HXIA 3NYCA 3SY4A 2BS4A 3FG2P 1CC2A 1KF6A 4OPLA 4YSXA 2GAHB 3D1CA 1GESA 4NNJA 1K0IA 3SM8A 4K22A 4OPCA 1FEAA 4AP1A 4H4WA 3RP6A 1MO9A 2EQ8A 2VQ7A 2FJBA 4H4UA 1YY5A 3R9UA 3ALJA 1K0LA 3EAOA 4M52A 1S2QA 3CGDA 4AT2A 4YKFA 5EBKA 5JCLA 2C73A 2WPEA 3AEBA 5EB5A 5CQFA 3DK4A 1GOSA 4J56A 4XWRA 4TM1A 3UTFA 4EQRA 1H84A 1BZLA 4OVIA 3UOZA 4A6NA 2YM2A 2YLZA 4FDCB 3AE9A 2OALA 3T2YA 2XFUA 2A89A 2DKIA 3DJEA 4J34A 2J3NA 5HHFA 1RSGA 1IUTA 1H7WA 4YSZA 3IHGA 2XCGA 3AE7A 4GF7A 3AYLA 3C4AA 4ECHA 4YWOA 3SGLA 2BA9A 2BXSA 1IUVA 1M6IA 1GRHA 1QLBA 2ZZCA 4A7AA 4CRTA 1E1NA 3GD4A 1GTHA 4LU6A 3UKFA 1JRZA 3CNDA 3DA1A 3F8DA 3NGCX 3KPFA 3F8RA 5KOXA 1DOEA 5C3JA 3ABVA 3VR9A 1GRTA 3T2ZA 3OZ2A 4Y4LA 3SQPA 3UP5A 1VQWA 3GD3A 3ICSA 4G6HA 3RP8A 1KSUA 4H2RA 3NHOX 1GEUA 4NTEA 4NEVA 3BI4A 3RNMA 4J57A 1EL8A 1ZMCA 2XLTA 1LTXR 3AEGA 5CKUA 2XVHA 4EIQA 4JNAA 2GMHA 1JOAA 3H8LA 1ZOVA 3PS9A 4TM4A 5FMHA 4X9MA 1GPEA 1REOA 3GRSA 1NAAA 4JQ9A 2IVEA 1CC6A 1XANA 3AECA 1PJ7A 3QVRA 3OC4A 1V59A 1Z6LA 3KU9A 2PYXA 1P2EA 3ADAB 2Q0KA 3KA7A 3UOYA 2C3CA 2C75A 2YWLA 2TMDA 2R4EA 5DBJA 2BRAA 1RYIA 4GRTA 4IA5A 4C3XA 3BHFA 3Q9TA 2RABA 4Y4NA 4EQXA 3AWIA 1TYPA 4UDPA 1IUSA 3SFEA 3UTEA 3D8XA 2GR0A 2HQMA 3GDPA 4C74A 2XVJA 4EIPA 4YXDA 3GWFA 1KNRA 1LPFA 1N4WA 2XLRA 3P4QA 5KXJA 3K30A 3REDA 1IJHA 2FBWA 4IV9A 5M0ZA 3T37A 1Q1RA 5JCMA 1CC4A 2GQWA 2XFQA 1E6EA 4JN9A 2W0HA 2Z5XA 4EQSA 3HYWA 1GALA 4BJYA 3SZCA 3CN8A 2GAGB 3DJJA 2OLNA 5FS7A 3AE5A 4AT0A 4OPIA 3UKLA 1PXCA 3CPJG 1E39A 4CY6A 3CPHG 3VR8A 3ZDNA 4IVMB 4JDRA 2YR5A 3G5SA 3NKSA 3Q6JA 4RSLA 1ZOYA 2X8GA 2BACA 5JCIA 2E5VA 3URHA 4ZN0A 2VQBA 2C7GA 1ZMDA 5GSNA 3SFDA 4GAPA 1TRBA 4K2XA 1FL2A 2TPRA 2V5ZA 1L9DA 2C65A 1DOCA 2C72A 4EMJA 1GERA 2C3DA 3AYIA 3GSIA 4II3A 3T14A 1AOGA 1IUXA 2C67A 5KVHA 3P4PA 4H4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL7 A;  1NEN A;  1RP0 A;  3DJD A;  3RHA A;  3V3N A;  4XWZ A;  1DNC A;  4YTN A;  5L46 A;  5ER0 A;  4Z44 A;  4H50 A;  1YQZ A;  1KNP A;  4APN A;  3LZX A;  1K0J A;  3P1W A;  3JSK A;  2C70 A;  4Z43 A;  3QSE A;  1S2Y A;  1NPX A;  4LII A;  3BNM A;  3GMB A;  2XDO A;  4H7U A;  2YQU A;  5JCK A;  4OPD A;  1S3E A;  2DKH A;  2BC0 A;  3AXB A;  4C5O A;  4I59 A;  2BXR A;  2XLU A;  3DK9 A;  2IID A;  1BGJ A;  3AB1 A;  3NNE A;  3NN6 X;  2XFP A;  4O5Q A;  1FEC A;  2X99 A;  4OCG A;  2GH5 A;  2ACZ A;  5J7X A;  3NT6 A;  4B68 A;  4J33 A;  2JKC A;  1D4C A;  1TDE A;  2WDQ A;  2Q7V A;  3NK1 X;  2XVF A;  2A8X A;  4P9S A;  2VVM A;  2YVF A;  3CGB A;  2WET A;  3RP7 A;  3KVE A;  1M64 A;  2R46 A;  2YR4 A;  1FEB A;  4C77 A;  3G5Q A;  4EM4 A;  1JNZ A;  4U8J A;  3IWA A;  3UKQ A;  3M12 A;  4K5S A;  1PN0 A;  2JB2 A;  4J31 A;  2YG6 A;  1QJD A;  3AYJ A;  1D4D A;  1K4Q A;  2BK5 A;  2Z5Y A;  1ZK7 A;  1JRY A;  4YT0 A;  1KFY A;  3ATQ A;  4B64 A;  4FK1 A;  1PXB A;  3P4S A;  2BK3 A;  5IPY A;  2GR2 A;  2JB3 A;  1NHR A;  2WPF A;  4TLX A;  2WEU A;  1NDA A;  4K8D A;  1PDH A;  4LA1 A;  2VVL G;  2YG5 A;  2YR6 A;  3KKJ A;  4OPT A;  4PAB A;  5FS8 A;  3DH9 A;  1DJN A;  3NIX A;  3IC9 A;  1NHQ A;  4GCM A;  4U8K A;  4UP3 A;  5J60 A;  2ZZB A;  1E1M A;  3AE6 A;  2UZZ A;  1YKJ A;  3AEF A;  1ZY8 A;  4USR A;  5M10 A;  1H82 A;  2YM1 A;  2WS3 A;  4EQW A;  3NH3 X;  3ITJ A;  3UOV A;  2AR8 A;  2R9Z A;  2YG7 A;  1FOH A;  2WDR A;  5KWF A;  4WCT A;  3QFB A;  2X50 A;  2RGH A;  1PS9 A;  1NHS A;  4K7Z A;  2X8H A;  1CJ2 A;  2XVE A;  1DOB A;  2AAQ A;  4GR1 A;  1DOD A;  4C3Y A;  2EQ7 A;  5BRT A;  4AP3 A;  2QA1 A;  1GET A;  2E4G A;  4BV6 A;  1F8R A;  4H4S A;  3ATR A;  1LVL A;  2CDU A;  3CNS A;  1CJ3 A;  3P9U A;  1DJQ A;  1ZKQ A;  3CTY A;  4DGK A;  3ALL A;  4NEW A;  4RG3 A;  1Y56 A;  1VDC A;  2OA1 A;  2EQ6 A;  4ZCC A;  4U8O A;  5JCN A;  1S3B A;  3GDN A;  4Z25 A;  1GSN A;  1GND A;  4GDE A;  4D04 A;  2WP9 A;  1FCD A;  1TDK A;  1YQ4 A;  1NHP A;  3H4K A;  4JNQ A;  4CCQ A;  1D4E A;  1PBE A;  2FJA A;  4B67 A;  4A99 A;  4HB9 A;  2BC1 A;  2B9X A;  2XVI A;  1CHU A;  2WBA A;  4PAA A;  4WX1 A;  4B65 A;  4N9X A;  1F3P A;  2A87 A;  3LB8 A;  1CJ4 A;  1B8S A;  1DXL A;  4XXG A;  1XPQ A;  1GT8 A;  1ELI A;  3ICR A;  4DSG A;  3LZW A;  4J36 A;  2NVK X;  1F8W A;  1ZP0 A;  2GRT A;  2XFN A;  1GRG A;  3CGC A;  5IQ4 A;  2V61 A;  3NN0 X;  4NZH A;  1TDO A;  3AD8 B;  3EAN A;  1OJA A;  2H89 A;  3AED A;  3CPI G;  3LJP A;  3COX A;  2YVJ A;  3F8P A;  2R45 A;  3L1R A;  1GXF A;  1BKW A;  3PVC A;  1CJC A;  4ICY A;  4U8I A;  5KOW A;  1Y0P A;  3C96 A;  3GRT A;  4TLZ A;  2O9Z A;  4X9N A;  5GRT A;  3VRA A;  2YLR A;  1CF3 A;  3DGZ A;  2VOU A;  5BUL A;  4YKG A;  3UCL A;  1BWC A;  1MOK A;  3LAD A;  3UKH A;  4Z2U A;  1Y56 B;  4TM3 A;  5U25 A;  4JY2 A;  1HYU A;  2C64 A;  4H4Z A;  4CCR A;  3DK8 A;  2GVC A;  2AQJ A;  1XHC A;  3DGH A;  1D7Y A;  4NTD A;  3UKA A;  3ZYX A;  4YSY A;  3BNU A;  2GR3 A;  2ZZ0 A;  4Z2R A;  5C2T A;  2C66 A;  1N4U A;  5FS6 A;  1OJT A;  1H7X A;  4KX6 A;  2WOI A;  1EBD A;  1O5W A;  3E1T A;  3PO7 A;  1ZDL A;  2YLX A;  1E7P A;  2BS2 A;  2GR1 A;  2CFY A;  3B6D A;  1VRQ B;  4DNA A;  4U8P A;  1E1K A;  4D03 A;  1JRX A;  3L8K A;  4X4J A;  4BJZ A;  2WHD A;  2CVJ A;  3UKP A;  1PJ6 A;  3KLJ A;  1KSS A;  2YLS A;  1PBB A;  3AEE A;  3VRD B;  1COY A;  1PHH A;  3AE2 A;  2XYO A;  2JB1 A;  2WES A;  4ADW A;  5EB4 A;  3AE3 A;  3EF6 A;  2WP5 A;  1XDI A;  1VG0 A;  1LJ1 A;  1PXA A;  3BI2 A;  3ISH A;  5KVI A;  1PJ5 A;  4H2Q A;  1L9C A;  1OJC A;  2RGJ A;  1ZX9 A;  2YG3 A;  4U2L A;  4B1B A;  1GRB A;  4EMI A;  4UDQ A;  4H2P A;  2VRM A;  4Y4M A;  4H4Y A;  2JK6 A;  3H8I A;  3LXD A;  1GRF A;  1TYT A;  1W4X A;  2GB0 A;  3FPZ A;  2ZBW A;  3M13 A;  4JY3 A;  1TDF A;  4CNK A;  1Q9I A;  1QO8 A;  3WE0 A;  3KD9 A;  1NG4 A;  4FK1 C;  1LQT A;  3AE8 A;  4REK A;  2Q0L A;  1E1L A;  1PBD A;  1PBC A;  2YVG A;  4MJW A;  2BCP A;  3NG7 X;  1CL0 A;  2GEW A;  1X31 B;  5BVA A;  3AD7 B;  2QA2 A;  1F8S A;  2B7R A;  3QSM A;  1GV4 A;  4AOS A;  4U8M A;  4Z2T A;  2B76 A;  2GMJ A;  3AD9 B;  4UDR A;  4H2N A;  4GDP A;  1N4V A;  1H86 A;  4A5L A;  1SEZ A;  4YTM A;  4U8L A;  4B69 A;  3I6D A;  4OPG A;  3S5W A;  1KDG A;  1GRA A;  3CNP A;  4NTC A;  2V6O A;  3II4 A;  3VRB A;  2YLT A;  4J2W A;  3EPT A;  2X3N A;  4I58 A;  4E0V A;  2JBV A;  3FIM B;  2BK4 A;  3IHM A;  3NTD A;  1IUU A;  3NLC A;  5HYM A;  1MXT A;  4OPU A;  3VQR A;  3P4R A;  5IQ1 A;  2PHH A;  1EL9 A;  2WU5 A;  3UTH A;  1D7L A;  3C4N A;  4BK2 A;  2XLS A;  3UKK A;  4B66 A;  2QAE A;  2V3B A;  1GRE A;  2WPC A;  2B7S A;  3IF9 A;  3GYJ A;  2VVL A;  3NRN A;  2RGO A;  3UP4 A;  2WP6 A;  2WQY A;  4USQ A;  3FBS A;  1H81 A;  3NK2 X;  2VZ2 A;  1GTE A;  4HA6 A;  1B4V A;  5FS9 A;  3UOX A;  4FX9 A;  2IVD A;  2GV8 A;  1NG3 A;  2R0P A;  3I3L A;  4U2T A;  5HY5 A;  3CNJ A;  4H4R A;  2EQ9 A;  4CBQ A;  2FJD A;  2BCG G;  4IVO B;  4A6N B;  5TR3 A;  1TDN A;  1Q1W A;  2R0G A;  1OJ9 A;  3CIR A;  5U1O A;  3QJ4 A;  4GUV A;  5KRQ A;  1JU2 A;  4EM3 A;  1O94 A;  2YAU A;  3QFA A;  4BK1 A;  4K5R A;  2OAM A;  1NEK A;  2B9Y A;  3NK0 X;  5BUK A;  1F6M A;  3V3O A;  3K7T A;  3FMW A;  1H6V A;  4A65 A;  3GYI A;  2YLW A;  5LV9 A;  4AOX A;  1PBF A;  4TM0 A;  2B9W A;  3M0O A;  1OJD A;  2GQF A;  2BS3 A;  4U2S A;  3S61 A;  4DSH A;  3UTG A;  2ARD A;  2H88 A;  2R4J A;  4A9W A;  2JAE A;  2WOV A;  1N1P A;  3K7M X;  2Y6R A;  3BHK A;  4BUR A;  2CUL A;  3BI5 A;  4H4P A;  1ONF A;  3NTA A;  4Z26 A;  3GWD A;  4BK3 A;  3NYF A;  2YG4 A;  4A79 A;  1O95 A;  1LQU A;  3DJG X;  1YQ3 A;  2VRL A;  3O0H A;  4KPR A;  4RG4 A;  3AEA A;  2Y6Q A;  2NPX A;  2R0C A;  3NYE A;  2GF3 A;  4H4X A;  1P2H A;  5EOW A;  2WU2 A;  2F5Z A;  1L9E A;  4H4Q A;  3CGE A;  3DME A;  3ICT A;  3QSS A;  2C76 A;  4YSH A;  2WDV A;  1VG9 A;  2XLP A;  3AE1 A;  4Z24 A;  1IUW A;  3CNT A;  1B5Q A;  2QCU A;  4YTP A;  1D5T A;  3V76 A;  2APG A;  2WOW A;  1BF3 A;  3B3R A;  3K7Q X;  2Q6U A;  2I0Z A;  4ZCD A;  1L0V A;  5U63 A;  4O5U A;  4B63 A;  1UKV G;  2OLO A;  2V3A A;  2BYB A;  1EL5 A;  2BAB A;  3AE4 A;  4CY8 A;  4H4V A;  3QVP A;  3GMC A;  2E1M A;  2V60 A;  4U8N A;  1LV0 A;  1JNR A;  1CBO A;  3G5R A;  3ALM A;  4IA6 A;  2XFO A;  1BGN A;  4CNJ A;  1B37 A;  2FJE A;  3HZL A;  1H83 A;  3LOV A;  2X8C A;  1JEH A;  4EMW A;  5HXI A;  3NYC A;  2BS4 A;  3FG2 P;  1CC2 A;  1KF6 A;  4OPL A;  4YSX A;  2GAH B;  3D1C A;  1GES A;  1K0I A;  3SM8 A;  4K22 A;  4OPC A;  1FEA A;  4AP1 A;  4H4W A;  3RP6 A;  1MO9 A;  2EQ8 A;  2VQ7 A;  2FJB A;  4H4U A;  1YY5 A;  3R9U A;  3ALJ A;  1K0L A;  3EAO A;  4M52 A;  1S2Q A;  3CGD A;  4AT2 A;  4YKF A;  5EBK A;  5JCL A;  2C73 A;  2WPE A;  3AEB A;  5EB5 A;  5CQF A;  3DK4 A;  1GOS A;  4J56 A;  4XWR A;  4TM1 A;  3UTF A;  4EQR A;  1H84 A;  1BZL A;  4OVI A;  3UOZ A;  4A6N A;  2YM2 A;  2YLZ A;  4FDC B;  3AE9 A;  2OAL A;  2XFU A;  2A89 A;  2DKI A;  3DJE A;  4J34 A;  2J3N A;  5HHF A;  1RSG A;  1IUT A;  1H7W A;  4YSZ A;  3IHG A;  2XCG A;  3AE7 A;  4GF7 A;  3AYL A;  3C4A A;  4ECH A;  4YWO A;  3SGL A;  2BA9 A;  2BXS A;  1IUV A;  1M6I A;  1GRH A;  1QLB A;  2ZZC A;  4A7A A;  4CRT A;  1E1N A;  3GD4 A;  1GTH A;  4LU6 A;  3UKF A;  1JRZ A;  3CND A;  3DA1 A;  3F8D A;  3NGC X;  3KPF A;  3F8R A;  5KOX A;  1DOE A;  5C3J A;  3ABV A;  3VR9 A;  1GRT A;  3OZ2 A;  4Y4L A;  3SQP A;  3UP5 A;  1VQW A;  3GD3 A;  3ICS A;  3RP8 A;  1KSU A;  4H2R A;  3NHO X;  1GEU A;  4NTE A;  4NEV A;  3BI4 A;  3RNM A;  4J57 A;  1EL8 A;  1ZMC A;  2XLT A;  1LTX R;  3AEG A;  5CKU A;  2XVH A;  4EIQ A;  4JNA A;  2GMH A;  1JOA A;  3H8L A;  1ZOV A;  3PS9 A;  4TM4 A;  5FMH A;  4X9M A;  1GPE A;  1REO A;  3GRS A;  1NAA A;  4JQ9 A;  2IVE A;  1CC6 A;  1XAN A;  3AEC A;  1PJ7 A;  3QVR A;  3OC4 A;  1V59 A;  1Z6L A;  3KU9 A;  2PYX A;  1P2E A;  3ADA B;  2Q0K A;  3KA7 A;  3UOY A;  2C3C A;  2C75 A;  2YWL A;  2TMD A;  2R4E A;  5DBJ A;  1RYI A;  4GRT A;  4IA5 A;  4C3X A;  3BHF A;  3Q9T A;  2RAB A;  4Y4N A;  4EQX A;  3AWI A;  1TYP A;  4UDP A;  1IUS A;  3SFE A;  3UTE A;  3D8X A;  2GR0 A;  2HQM A;  3GDP A;  4C74 A;  2XVJ A;  4EIP A;  4YXD A;  3GWF A;  1KNR A;  1LPF A;  1N4W A;  2XLR A;  3P4Q A;  5KXJ A;  3K30 A;  3RED A;  1IJH A;  2FBW A;  4IV9 A;  5M0Z A;  3T37 A;  1Q1R A;  5JCM A;  1CC4 A;  2GQW A;  2XFQ A;  1E6E A;  4JN9 A;  2W0H A;  2Z5X A;  4EQS A;  1GAL A;  4BJY A;  3CN8 A;  2GAG B;  3DJJ A;  2OLN A;  5FS7 A;  3AE5 A;  4AT0 A;  4OPI A;  3UKL A;  1PXC A;  3CPJ G;  1E39 A;  4CY6 A;  3CPH G;  3VR8 A;  3ZDN A;  4IVM B;  4JDR A;  2YR5 A;  3G5S A;  3NKS A;  3Q6J A;  4RSL A;  1ZOY A;  2X8G A;  2BAC A;  5JCI A;  2E5V A;  3URH A;  4ZN0 A;  2VQB A;  2C7G A;  1ZMD A;  5GSN A;  3SFD A;  1TRB A;  4K2X A;  1FL2 A;  2TPR A;  2V5Z A;  1L9D A;  2C65 A;  1DOC A;  2C72 A;  4EMJ A;  1GER A;  2C3D A;  3AYI A;  3GSI A;  1AOG A;  1IUX A;  2C67 A;  5KVH A;  3P4P A;  4H4T A; 
#chains in the Genus database with same CATH topology
 1EL7 A;  1NEN A;  1RP0 A;  3T2K A;  3DJD A;  3RHA A;  3V3N A;  4XWZ A;  1DNC A;  4YTN A;  5L46 A;  5ER0 A;  4Z44 A;  4H50 A;  1YQZ A;  1KNP A;  4APN A;  3LZX A;  1K0J A;  3P1W A;  3JSK A;  2C70 A;  4Z43 A;  3QSE A;  1S2Y A;  1NPX A;  4LII A;  3BNM A;  3GMB A;  2XDO A;  3KPK A;  4H7U A;  2YQU A;  5JCK A;  4OPD A;  5KMS A;  1S3E A;  2DKH A;  2BC0 A;  3AXB A;  4C5O A;  4I59 A;  2BXR A;  2XLU A;  3DK9 A;  2IID A;  1BGJ A;  3AB1 A;  3NNE A;  3NN6 X;  2XFP A;  4O5Q A;  3CMM A;  1FEC A;  2X99 A;  4OCG A;  2GH5 A;  2ACZ A;  5J7X A;  3NT6 A;  4B68 A;  4J33 A;  2JKC A;  1D4C A;  1TDE A;  2WDQ A;  2Q7V A;  3NK1 X;  2XVF A;  2A8X A;  4P9S A;  2VVM A;  2YVF A;  3CGB A;  2WET A;  3RP7 A;  3KVE A;  1M64 A;  2R46 A;  2YR4 A;  1FEB A;  4C77 A;  3G5Q A;  4EM4 A;  1JNZ A;  4U8J A;  3IWA A;  3UKQ A;  3M12 A;  4K5S A;  1PN0 A;  2JB2 A;  4J31 A;  2YG6 A;  1QJD A;  3AYJ A;  1D4D A;  3SYI A;  1K4Q A;  2BK5 A;  2Z5Y A;  1ZK7 A;  1JRY A;  4YT0 A;  1KFY A;  3ATQ A;  4B64 A;  4FK1 A;  1PXB A;  3P4S A;  2BK3 A;  5IPY A;  2GR2 A;  2JB3 A;  1NHR A;  2WPF A;  4TLX A;  2WEU A;  1NDA A;  4K8D A;  1PDH A;  4LA1 A;  2VVL G;  2YG5 A;  2YR6 A;  3KKJ A;  4OPT A;  4PAB A;  5FS8 A;  3DH9 A;  1DJN A;  3NIX A;  3IC9 A;  1NHQ A;  4GCM A;  4U8K A;  4UP3 A;  5J60 A;  2ZZB A;  1E1M A;  3AE6 A;  2UZZ A;  1YKJ A;  3AEF A;  1ZY8 A;  4USR A;  5M10 A;  1H82 A;  2YM1 A;  2WS3 A;  4EQW A;  3NH3 X;  3ITJ A;  3UOV A;  2AR8 A;  2R9Z A;  2YG7 A;  1FOH A;  2WDR A;  5KWF A;  4WCT A;  3QFB A;  2X50 A;  2RGH A;  1PS9 A;  1NHS A;  4K7Z A;  2X8H A;  1CJ2 A;  3SZW A;  2XVE A;  1DOB A;  2AAQ A;  4GR1 A;  1DOD A;  4C3Y A;  2EQ7 A;  5BRT A;  4AP3 A;  3HYX A;  2QA1 A;  1GET A;  2E4G A;  4BV6 A;  1F8R A;  4H4S A;  3ATR A;  1LVL A;  2CDU A;  3CNS A;  1CJ3 A;  3P9U A;  1DJQ A;  1ZKQ A;  3CTY A;  5KNL A;  4DGK A;  3ALL A;  4NEW A;  4RG3 A;  1Y56 A;  1VDC A;  2OA1 A;  2EQ6 A;  4ZCC A;  4U8O A;  5JCN A;  1S3B A;  3GDN A;  4Z25 A;  1GSN A;  1GND A;  4GDE A;  4D04 A;  2WP9 A;  1FCD A;  1TDK A;  1YQ4 A;  1NHP A;  3H4K A;  4JNQ A;  4CCQ A;  1D4E A;  1PBE A;  2FJA A;  4B67 A;  4A99 A;  4HB9 A;  2BC1 A;  2B9X A;  2XVI A;  1CHU A;  2WBA A;  4PAA A;  4WX1 A;  4B65 A;  4N9X A;  1F3P A;  2A87 A;  3LB8 A;  1CJ4 A;  1B8S A;  1DXL A;  4XXG A;  1XPQ A;  1GT8 A;  1ELI A;  3ICR A;  4DSG A;  3LZW A;  4J36 A;  2NVK X;  1F8W A;  1ZP0 A;  2GRT A;  2XFN A;  1GRG A;  3CGC A;  5IQ4 A;  2V61 A;  3NN0 X;  4NZH A;  2C4C A;  1TDO A;  3AD8 B;  3EAN A;  1OJA A;  2H89 A;  3AED A;  3CPI G;  3LJP A;  3COX A;  2YVJ A;  3F8P A;  2R45 A;  3L1R A;  1GXF A;  1BKW A;  3PVC A;  1CJC A;  4ICY A;  4U8I A;  5KOW A;  1Y0P A;  3C96 A;  3GRT A;  4TLZ A;  2O9Z A;  4G9K A;  4X9N A;  5GRT A;  2YLR A;  3VRA A;  1CF3 A;  3DGZ A;  2VOU A;  5BUL A;  4YKG A;  3UCL A;  1BWC A;  1MOK A;  3LAD A;  3UKH A;  4Z2U A;  1Y56 B;  5KMP A;  4TM3 A;  5U25 A;  4JY2 A;  1HYU A;  2C64 A;  4H4Z A;  4CCR A;  3DK8 A;  2GVC A;  2AQJ A;  1XHC A;  3DGH A;  1D7Y A;  4NTD A;  3UKA A;  3ZYX A;  4YSY A;  3BNU A;  2GR3 A;  2ZZ0 A;  4Z2R A;  5C2T A;  2C66 A;  1N4U A;  5FS6 A;  1OJT A;  1H7X A;  4KX6 A;  2WOI A;  1EBD A;  1O5W A;  3E1T A;  3PO7 A;  1ZDL A;  2YLX A;  1E7P A;  2BS2 A;  2GR1 A;  2CFY A;  3B6D A;  1VRQ B;  4DNA A;  4U8P A;  4G73 A;  1E1K A;  4D03 A;  1JRX A;  3L8K A;  4X4J A;  4BJZ A;  2WHD A;  2CVJ A;  3UKP A;  1PJ6 A;  3KLJ A;  1KSS A;  2YLS A;  1PBB A;  3AEE A;  3VRD B;  1COY A;  1PHH A;  3AE2 A;  2XYO A;  2JB1 A;  2WES A;  4ADW A;  5EB4 A;  3AE3 A;  3EF6 A;  2WP5 A;  1XDI A;  1VG0 A;  1LJ1 A;  1PXA A;  3BI2 A;  3ISH A;  5KVI A;  1PJ5 A;  4H2Q A;  1L9C A;  1OJC A;  4NWZ A;  2RGJ A;  1ZX9 A;  2YG3 A;  4U2L A;  4B1B A;  1GRB A;  4EMI A;  4UDQ A;  4H2P A;  2VRM A;  4Y4M A;  4H4Y A;  5KMQ A;  2JK6 A;  3H8I A;  3LXD A;  1GRF A;  1TYT A;  1W4X A;  2GB0 A;  3HYV A;  3FPZ A;  2ZBW A;  3M13 A;  4JY3 A;  1TDF A;  4CNK A;  1Q9I A;  1QO8 A;  3WE0 A;  3KD9 A;  1NG4 A;  4FK1 C;  4II2 A;  4GAV A;  1LQT A;  3AE8 A;  4REK A;  2Q0L A;  1E1L A;  1PBD A;  1PBC A;  2YVG A;  4MJW A;  2BCP A;  3NG7 X;  1CL0 A;  2GEW A;  1X31 B;  5BVA A;  3AD7 B;  2QA2 A;  1F8S A;  2B7R A;  3QSM A;  1GV4 A;  4AOS A;  4U8M A;  4Z2T A;  2B76 A;  2GMJ A;  3AD9 B;  4UDR A;  4H2N A;  4GDP A;  1N4V A;  1H86 A;  4A5L A;  1SEZ A;  4YTM A;  4U8L A;  4B69 A;  3I6D A;  4OPG A;  3S5W A;  1KDG A;  1GRA A;  3CNP A;  4NTC A;  2V6O A;  3II4 A;  3VRB A;  2YLT A;  4J2W A;  3EPT A;  2X3N A;  4I58 A;  4E0V A;  3SXI A;  2JBV A;  3FIM B;  2BK4 A;  3IHM A;  3NTD A;  1IUU A;  3NLC A;  5HYM A;  1MXT A;  4OPU A;  3VQR A;  3P4R A;  5IQ1 A;  2PHH A;  1EL9 A;  2WU5 A;  3GYX A;  1D7L A;  3C4N A;  3T0K A;  3UTH A;  4BK2 A;  2XLS A;  3UKK A;  4B66 A;  2QAE A;  2V3B A;  1GRE A;  2WPC A;  2B7S A;  3IF9 A;  3GYJ A;  2VVL A;  3NRN A;  2RGO A;  3UP4 A;  2WP6 A;  2WQY A;  4USQ A;  3FBS A;  1H81 A;  3NK2 X;  2VZ2 A;  1GTE A;  4HA6 A;  1B4V A;  5FS9 A;  3UOX A;  4FX9 A;  2IVD A;  2GV8 A;  1NG3 A;  2R0P A;  3I3L A;  4U2T A;  5KMR A;  5HY5 A;  3CNJ A;  4H4R A;  2EQ9 A;  4CBQ A;  2FJD A;  2BCG G;  4IVO B;  4A6N B;  5TR3 A;  1TDN A;  1Q1W A;  2R0G A;  1OJ9 A;  3SX6 A;  3CIR A;  5U1O A;  3QJ4 A;  4GUV A;  5KRQ A;  1JU2 A;  4EM3 A;  1O94 A;  2YAU A;  3QFA A;  4BK1 A;  4K5R A;  2OAM A;  1NEK A;  2B9Y A;  2BRY A;  3NK0 X;  1F6M A;  3V3O A;  5BUK A;  3K7T A;  3FMW A;  1H6V A;  3SZ0 A;  4A65 A;  3GYI A;  2YLW A;  5LV9 A;  4AOX A;  4G6G A;  1PBF A;  4TM0 A;  2B9W A;  3M0O A;  1OJD A;  2GQF A;  2BS3 A;  4U2S A;  3S61 A;  4DSH A;  3UTG A;  2ARD A;  2H88 A;  2R4J A;  4A9W A;  2JAE A;  2WOV A;  1N1P A;  4G74 A;  3K7M X;  2Y6R A;  3BHK A;  4BUR A;  2CUL A;  3BI5 A;  4H4P A;  1ONF A;  3NTA A;  4Z26 A;  3GWD A;  4BK3 A;  3NYF A;  2YG4 A;  4A79 A;  1O95 A;  1LQU A;  3T31 A;  3DJG X;  1YQ3 A;  2VRL A;  3O0H A;  4KPR A;  4RG4 A;  3AEA A;  2Y6Q A;  2NPX A;  2R0C A;  3NYE A;  2GF3 A;  4H4X A;  1P2H A;  5EOW A;  2WU2 A;  2F5Z A;  1L9E A;  4H4Q A;  3CGE A;  3DME A;  3ICT A;  3QSS A;  2C76 A;  4YSH A;  2WDV A;  1VG9 A;  2XLP A;  3AE1 A;  4Z24 A;  1IUW A;  3CNT A;  1B5Q A;  2QCU A;  4YTP A;  1D5T A;  3V76 A;  2APG A;  2WOW A;  1BF3 A;  3B3R A;  3K7Q X;  2Q6U A;  3SZF A;  2I0Z A;  4ZCD A;  1L0V A;  5U63 A;  4O5U A;  4B63 A;  1UKV G;  2OLO A;  2V3A A;  2BYB A;  1EL5 A;  2BAB A;  3AE4 A;  4CY8 A;  4H4V A;  3QVP A;  3GMC A;  2E1M A;  2V60 A;  4U8N A;  1LV0 A;  1JNR A;  1CBO A;  3G5R A;  3ALM A;  4IA6 A;  2XFO A;  1BGN A;  4CNJ A;  1B37 A;  2FJE A;  3HZL A;  1H83 A;  3LOV A;  2X8C A;  1JEH A;  4EMW A;  5HXI A;  3NYC A;  3SY4 A;  2BS4 A;  3FG2 P;  1CC2 A;  1KF6 A;  4OPL A;  4YSX A;  2GAH B;  3D1C A;  1GES A;  4NNJ A;  1K0I A;  3SM8 A;  4K22 A;  4OPC A;  1FEA A;  4AP1 A;  4H4W A;  3RP6 A;  1MO9 A;  2EQ8 A;  2VQ7 A;  2FJB A;  4H4U A;  1YY5 A;  3R9U A;  3ALJ A;  1K0L A;  3EAO A;  4M52 A;  1S2Q A;  3CGD A;  4AT2 A;  4YKF A;  5EBK A;  5JCL A;  2C73 A;  2WPE A;  3AEB A;  5EB5 A;  5CQF A;  3DK4 A;  1GOS A;  4J56 A;  4XWR A;  4TM1 A;  3UTF A;  4EQR A;  1H84 A;  1BZL A;  4OVI A;  3UOZ A;  4A6N A;  2YM2 A;  2YLZ A;  4FDC B;  3AE9 A;  2OAL A;  3T2Y A;  2XFU A;  2A89 A;  2DKI A;  3DJE A;  4J34 A;  2J3N A;  5HHF A;  1RSG A;  1IUT A;  1H7W A;  4YSZ A;  3IHG A;  2XCG A;  3AE7 A;  4GF7 A;  3AYL A;  3C4A A;  4ECH A;  4YWO A;  3SGL A;  2BA9 A;  2BXS A;  1IUV A;  1M6I A;  1GRH A;  1QLB A;  2ZZC A;  4A7A A;  4CRT A;  1E1N A;  3GD4 A;  1GTH A;  4LU6 A;  3UKF A;  1JRZ A;  3CND A;  3DA1 A;  3F8D A;  3NGC X;  3KPF A;  3F8R A;  5KOX A;  1DOE A;  5C3J A;  3ABV A;  3VR9 A;  1GRT A;  3T2Z A;  3OZ2 A;  4Y4L A;  3SQP A;  3UP5 A;  1VQW A;  3GD3 A;  3ICS A;  4G6H A;  3RP8 A;  1KSU A;  4H2R A;  3NHO X;  1GEU A;  4NTE A;  4NEV A;  3BI4 A;  3RNM A;  4J57 A;  1EL8 A;  1ZMC A;  2XLT A;  1LTX R;  3AEG A;  5CKU A;  2XVH A;  4EIQ A;  4JNA A;  2GMH A;  1JOA A;  3H8L A;  1ZOV A;  3PS9 A;  4TM4 A;  5FMH A;  4X9M A;  1GPE A;  1REO A;  3GRS A;  1NAA A;  4JQ9 A;  2IVE A;  1CC6 A;  1XAN A;  3AEC A;  1PJ7 A;  3QVR A;  3OC4 A;  1V59 A;  1Z6L A;  3KU9 A;  2PYX A;  1P2E A;  3ADA B;  2Q0K A;  3KA7 A;  3UOY A;  2C3C A;  2C75 A;  2YWL A;  2TMD A;  2R4E A;  5DBJ A;  2BRA A;  1RYI A;  4GRT A;  4IA5 A;  4C3X A;  3BHF A;  3Q9T A;  2RAB A;  4Y4N A;  4EQX A;  3AWI A;  1TYP A;  4UDP A;  1IUS A;  3SFE A;  3UTE A;  3D8X A;  2GR0 A;  2HQM A;  3GDP A;  4C74 A;  2XVJ A;  4EIP A;  4YXD A;  3GWF A;  1KNR A;  1LPF A;  1N4W A;  2XLR A;  3P4Q A;  5KXJ A;  3K30 A;  3RED A;  1IJH A;  2FBW A;  4IV9 A;  5M0Z A;  3T37 A;  1Q1R A;  5JCM A;  1CC4 A;  2GQW A;  2XFQ A;  1E6E A;  4JN9 A;  2W0H A;  2Z5X A;  4EQS A;  3HYW A;  1GAL A;  4BJY A;  3SZC A;  3CN8 A;  2GAG B;  3DJJ A;  2OLN A;  5FS7 A;  3AE5 A;  4AT0 A;  4OPI A;  3UKL A;  1PXC A;  3CPJ G;  1E39 A;  4CY6 A;  3CPH G;  3VR8 A;  3ZDN A;  4IVM B;  4JDR A;  2YR5 A;  3G5S A;  3NKS A;  3Q6J A;  4RSL A;  1ZOY A;  2X8G A;  2BAC A;  5JCI A;  2E5V A;  3URH A;  4ZN0 A;  2VQB A;  2C7G A;  1ZMD A;  5GSN A;  3SFD A;  4GAP A;  1TRB A;  4K2X A;  1FL2 A;  2TPR A;  2V5Z A;  1L9D A;  2C65 A;  1DOC A;  2C72 A;  4EMJ A;  1GER A;  2C3D A;  3AYI A;  3GSI A;  4II3 A;  3T14 A;  1AOG A;  1IUX A;  2C67 A;  5KVH A;  3P4P A;  4H4T A; 
#chains in the Genus database with same CATH homology
 1EL7 A;  1NEN A;  1RP0 A;  3T2K A;  3DJD A;  3RHA A;  3V3N A;  4XWZ A;  1DNC A;  4YTN A;  5L46 A;  5ER0 A;  4Z44 A;  4H50 A;  1YQZ A;  1KNP A;  4APN A;  3LZX A;  1K0J A;  3P1W A;  3JSK A;  2C70 A;  4Z43 A;  3QSE A;  1S2Y A;  1NPX A;  4LII A;  3BNM A;  3GMB A;  2XDO A;  3KPK A;  4H7U A;  2YQU A;  5JCK A;  4OPD A;  5KMS A;  1S3E A;  2DKH A;  2BC0 A;  3AXB A;  4C5O A;  4I59 A;  2BXR A;  2XLU A;  3DK9 A;  2IID A;  1BGJ A;  3AB1 A;  3NNE A;  3NN6 X;  2XFP A;  4O5Q A;  3CMM A;  1FEC A;  2X99 A;  4OCG A;  2GH5 A;  2ACZ A;  5J7X A;  3NT6 A;  4B68 A;  4J33 A;  2JKC A;  1D4C A;  1TDE A;  2WDQ A;  2Q7V A;  3NK1 X;  2XVF A;  2A8X A;  4P9S A;  2VVM A;  2YVF A;  3CGB A;  2WET A;  3RP7 A;  3KVE A;  1M64 A;  2R46 A;  2YR4 A;  1FEB A;  4C77 A;  3G5Q A;  4EM4 A;  1JNZ A;  4U8J A;  3IWA A;  3UKQ A;  3M12 A;  4K5S A;  1PN0 A;  2JB2 A;  4J31 A;  2YG6 A;  1QJD A;  3AYJ A;  1D4D A;  3SYI A;  1K4Q A;  2BK5 A;  2Z5Y A;  1ZK7 A;  1JRY A;  4YT0 A;  1KFY A;  3ATQ A;  4B64 A;  4FK1 A;  1PXB A;  3P4S A;  2BK3 A;  5IPY A;  2GR2 A;  2JB3 A;  1NHR A;  2WPF A;  4TLX A;  2WEU A;  1NDA A;  4K8D A;  1PDH A;  4LA1 A;  2VVL G;  2YG5 A;  2YR6 A;  3KKJ A;  4OPT A;  4PAB A;  5FS8 A;  3DH9 A;  1DJN A;  3NIX A;  3IC9 A;  1NHQ A;  4GCM A;  4U8K A;  4UP3 A;  5J60 A;  2ZZB A;  1E1M A;  3AE6 A;  2UZZ A;  1YKJ A;  3AEF A;  1ZY8 A;  4USR A;  5M10 A;  1H82 A;  2YM1 A;  2WS3 A;  4EQW A;  3NH3 X;  3ITJ A;  3UOV A;  2AR8 A;  2R9Z A;  2YG7 A;  1FOH A;  2WDR A;  5KWF A;  4WCT A;  3QFB A;  2X50 A;  2RGH A;  1PS9 A;  1NHS A;  4K7Z A;  2X8H A;  1CJ2 A;  3SZW A;  2XVE A;  1DOB A;  2AAQ A;  4GR1 A;  1DOD A;  4C3Y A;  2EQ7 A;  5BRT A;  4AP3 A;  3HYX A;  2QA1 A;  1GET A;  2E4G A;  4BV6 A;  1F8R A;  4H4S A;  3ATR A;  1LVL A;  2CDU A;  3CNS A;  1CJ3 A;  3P9U A;  1DJQ A;  1ZKQ A;  3CTY A;  5KNL A;  4DGK A;  3ALL A;  4NEW A;  4RG3 A;  1Y56 A;  1VDC A;  2OA1 A;  2EQ6 A;  4ZCC A;  4U8O A;  5JCN A;  1S3B A;  3GDN A;  4Z25 A;  1GSN A;  1GND A;  4GDE A;  4D04 A;  2WP9 A;  1FCD A;  1TDK A;  1YQ4 A;  1NHP A;  3H4K A;  4JNQ A;  4CCQ A;  1D4E A;  1PBE A;  2FJA A;  4B67 A;  4A99 A;  4HB9 A;  2BC1 A;  2B9X A;  2XVI A;  1CHU A;  2WBA A;  4PAA A;  4WX1 A;  4B65 A;  4N9X A;  1F3P A;  2A87 A;  3LB8 A;  1CJ4 A;  1B8S A;  1DXL A;  4XXG A;  1XPQ A;  1GT8 A;  1ELI A;  3ICR A;  4DSG A;  3LZW A;  4J36 A;  2NVK X;  1F8W A;  1ZP0 A;  2GRT A;  2XFN A;  1GRG A;  3CGC A;  5IQ4 A;  2V61 A;  3NN0 X;  4NZH A;  2C4C A;  1TDO A;  3AD8 B;  3EAN A;  1OJA A;  2H89 A;  3AED A;  3CPI G;  3LJP A;  3COX A;  2YVJ A;  3F8P A;  2R45 A;  3L1R A;  1GXF A;  1BKW A;  3PVC A;  1CJC A;  4ICY A;  4U8I A;  5KOW A;  1Y0P A;  3C96 A;  3GRT A;  4TLZ A;  2O9Z A;  4G9K A;  4X9N A;  5GRT A;  2YLR A;  3VRA A;  1CF3 A;  3DGZ A;  2VOU A;  5BUL A;  4YKG A;  3UCL A;  1BWC A;  1MOK A;  3LAD A;  3UKH A;  4Z2U A;  1Y56 B;  5KMP A;  4TM3 A;  5U25 A;  4JY2 A;  1HYU A;  2C64 A;  4H4Z A;  4CCR A;  3DK8 A;  2GVC A;  2AQJ A;  1XHC A;  3DGH A;  1D7Y A;  4NTD A;  3UKA A;  3ZYX A;  4YSY A;  3BNU A;  2GR3 A;  2ZZ0 A;  4Z2R A;  5C2T A;  2C66 A;  1N4U A;  5FS6 A;  1OJT A;  1H7X A;  4KX6 A;  2WOI A;  1EBD A;  1O5W A;  3E1T A;  3PO7 A;  1ZDL A;  2YLX A;  1E7P A;  2BS2 A;  2GR1 A;  2CFY A;  3B6D A;  1VRQ B;  4DNA A;  4U8P A;  4G73 A;  1E1K A;  4D03 A;  1JRX A;  3L8K A;  4X4J A;  4BJZ A;  2WHD A;  2CVJ A;  3UKP A;  1PJ6 A;  3KLJ A;  1KSS A;  2YLS A;  1PBB A;  3AEE A;  3VRD B;  1COY A;  1PHH A;  3AE2 A;  2XYO A;  2JB1 A;  2WES A;  4ADW A;  5EB4 A;  3AE3 A;  3EF6 A;  2WP5 A;  1XDI A;  1VG0 A;  1LJ1 A;  1PXA A;  3BI2 A;  3ISH A;  5KVI A;  1PJ5 A;  4H2Q A;  1L9C A;  1OJC A;  4NWZ A;  2RGJ A;  1ZX9 A;  2YG3 A;  4U2L A;  4B1B A;  1GRB A;  4EMI A;  4UDQ A;  4H2P A;  2VRM A;  4Y4M A;  4H4Y A;  5KMQ A;  2JK6 A;  3H8I A;  3LXD A;  1GRF A;  1TYT A;  1W4X A;  2GB0 A;  3HYV A;  3FPZ A;  2ZBW A;  3M13 A;  4JY3 A;  1TDF A;  4CNK A;  1Q9I A;  1QO8 A;  3WE0 A;  3KD9 A;  1NG4 A;  4FK1 C;  4II2 A;  4GAV A;  1LQT A;  3AE8 A;  4REK A;  2Q0L A;  1E1L A;  1PBD A;  1PBC A;  2YVG A;  4MJW A;  2BCP A;  3NG7 X;  1CL0 A;  2GEW A;  1X31 B;  5BVA A;  3AD7 B;  2QA2 A;  1F8S A;  2B7R A;  3QSM A;  1GV4 A;  4AOS A;  4U8M A;  4Z2T A;  2B76 A;  2GMJ A;  3AD9 B;  4UDR A;  4H2N A;  4GDP A;  1N4V A;  1H86 A;  4A5L A;  1SEZ A;  4YTM A;  4U8L A;  4B69 A;  3I6D A;  4OPG A;  3S5W A;  1KDG A;  1GRA A;  3CNP A;  4NTC A;  2V6O A;  3II4 A;  3VRB A;  2YLT A;  4J2W A;  3EPT A;  2X3N A;  4I58 A;  4E0V A;  3SXI A;  2JBV A;  3FIM B;  2BK4 A;  3IHM A;  3NTD A;  1IUU A;  3NLC A;  5HYM A;  1MXT A;  4OPU A;  3VQR A;  3P4R A;  5IQ1 A;  2PHH A;  1EL9 A;  2WU5 A;  3GYX A;  1D7L A;  3C4N A;  3T0K A;  3UTH A;  4BK2 A;  2XLS A;  3UKK A;  4B66 A;  2QAE A;  2V3B A;  1GRE A;  2WPC A;  2B7S A;  3IF9 A;  3GYJ A;  2VVL A;  3NRN A;  2RGO A;  3UP4 A;  2WP6 A;  2WQY A;  4USQ A;  3FBS A;  1H81 A;  3NK2 X;  2VZ2 A;  1GTE A;  4HA6 A;  1B4V A;  5FS9 A;  3UOX A;  4FX9 A;  2IVD A;  2GV8 A;  1NG3 A;  2R0P A;  3I3L A;  4U2T A;  5KMR A;  5HY5 A;  3CNJ A;  4H4R A;  2EQ9 A;  4CBQ A;  2FJD A;  2BCG G;  4IVO B;  4A6N B;  5TR3 A;  1TDN A;  1Q1W A;  2R0G A;  1OJ9 A;  3SX6 A;  3CIR A;  5U1O A;  3QJ4 A;  4GUV A;  5KRQ A;  1JU2 A;  4EM3 A;  1O94 A;  2YAU A;  3QFA A;  4BK1 A;  4K5R A;  2OAM A;  1NEK A;  2B9Y A;  2BRY A;  3NK0 X;  1F6M A;  3V3O A;  5BUK A;  3K7T A;  3FMW A;  1H6V A;  3SZ0 A;  4A65 A;  3GYI A;  2YLW A;  5LV9 A;  4AOX A;  4G6G A;  1PBF A;  4TM0 A;  2B9W A;  3M0O A;  1OJD A;  2GQF A;  2BS3 A;  4U2S A;  3S61 A;  4DSH A;  3UTG A;  2ARD A;  2H88 A;  2R4J A;  4A9W A;  2JAE A;  2WOV A;  1N1P A;  4G74 A;  3K7M X;  2Y6R A;  3BHK A;  4BUR A;  2CUL A;  3BI5 A;  4H4P A;  1ONF A;  3NTA A;  4Z26 A;  3GWD A;  4BK3 A;  3NYF A;  2YG4 A;  4A79 A;  1O95 A;  1LQU A;  3T31 A;  3DJG X;  1YQ3 A;  2VRL A;  3O0H A;  4KPR A;  4RG4 A;  3AEA A;  2Y6Q A;  2NPX A;  2R0C A;  3NYE A;  2GF3 A;  4H4X A;  1P2H A;  5EOW A;  2WU2 A;  2F5Z A;  1L9E A;  4H4Q A;  3CGE A;  3DME A;  3ICT A;  3QSS A;  2C76 A;  4YSH A;  2WDV A;  1VG9 A;  2XLP A;  3AE1 A;  4Z24 A;  1IUW A;  3CNT A;  1B5Q A;  2QCU A;  4YTP A;  1D5T A;  3V76 A;  2APG A;  2WOW A;  1BF3 A;  3B3R A;  3K7Q X;  2Q6U A;  3SZF A;  2I0Z A;  4ZCD A;  1L0V A;  5U63 A;  4O5U A;  4B63 A;  1UKV G;  2OLO A;  2V3A A;  2BYB A;  1EL5 A;  2BAB A;  3AE4 A;  4CY8 A;  4H4V A;  3QVP A;  3GMC A;  2E1M A;  2V60 A;  4U8N A;  1LV0 A;  1JNR A;  1CBO A;  3G5R A;  3ALM A;  4IA6 A;  2XFO A;  1BGN A;  4CNJ A;  1B37 A;  2FJE A;  3HZL A;  1H83 A;  3LOV A;  2X8C A;  1JEH A;  4EMW A;  5HXI A;  3NYC A;  3SY4 A;  2BS4 A;  3FG2 P;  1CC2 A;  1KF6 A;  4OPL A;  4YSX A;  2GAH B;  3D1C A;  1GES A;  4NNJ A;  1K0I A;  3SM8 A;  4K22 A;  4OPC A;  1FEA A;  4AP1 A;  4H4W A;  3RP6 A;  1MO9 A;  2EQ8 A;  2VQ7 A;  2FJB A;  4H4U A;  1YY5 A;  3R9U A;  3ALJ A;  1K0L A;  3EAO A;  4M52 A;  1S2Q A;  3CGD A;  4AT2 A;  4YKF A;  5EBK A;  5JCL A;  2C73 A;  2WPE A;  3AEB A;  5EB5 A;  5CQF A;  3DK4 A;  1GOS A;  4J56 A;  4XWR A;  4TM1 A;  3UTF A;  4EQR A;  1H84 A;  1BZL A;  4OVI A;  3UOZ A;  4A6N A;  2YM2 A;  2YLZ A;  4FDC B;  3AE9 A;  2OAL A;  3T2Y A;  2XFU A;  2A89 A;  2DKI A;  3DJE A;  4J34 A;  2J3N A;  5HHF A;  1RSG A;  1IUT A;  1H7W A;  4YSZ A;  3IHG A;  2XCG A;  3AE7 A;  4GF7 A;  3AYL A;  3C4A A;  4ECH A;  4YWO A;  3SGL A;  2BA9 A;  2BXS A;  1IUV A;  1M6I A;  1GRH A;  1QLB A;  2ZZC A;  4A7A A;  4CRT A;  1E1N A;  3GD4 A;  1GTH A;  4LU6 A;  3UKF A;  1JRZ A;  3CND A;  3DA1 A;  3F8D A;  3NGC X;  3KPF A;  3F8R A;  5KOX A;  1DOE A;  5C3J A;  3ABV A;  3VR9 A;  1GRT A;  3T2Z A;  3OZ2 A;  4Y4L A;  3SQP A;  3UP5 A;  1VQW A;  3GD3 A;  3ICS A;  4G6H A;  3RP8 A;  1KSU A;  4H2R A;  3NHO X;  1GEU A;  4NTE A;  4NEV A;  3BI4 A;  3RNM A;  4J57 A;  1EL8 A;  1ZMC A;  2XLT A;  1LTX R;  3AEG A;  5CKU A;  2XVH A;  4EIQ A;  4JNA A;  2GMH A;  1JOA A;  3H8L A;  1ZOV A;  3PS9 A;  4TM4 A;  5FMH A;  4X9M A;  1GPE A;  1REO A;  3GRS A;  1NAA A;  4JQ9 A;  2IVE A;  1CC6 A;  1XAN A;  3AEC A;  1PJ7 A;  3QVR A;  3OC4 A;  1V59 A;  1Z6L A;  3KU9 A;  2PYX A;  1P2E A;  3ADA B;  2Q0K A;  3KA7 A;  3UOY A;  2C3C A;  2C75 A;  2YWL A;  2TMD A;  2R4E A;  5DBJ A;  2BRA A;  1RYI A;  4GRT A;  4IA5 A;  4C3X A;  3BHF A;  3Q9T A;  2RAB A;  4Y4N A;  4EQX A;  3AWI A;  1TYP A;  4UDP A;  1IUS A;  3SFE A;  3UTE A;  3D8X A;  2GR0 A;  2HQM A;  3GDP A;  4C74 A;  2XVJ A;  4EIP A;  4YXD A;  3GWF A;  1KNR A;  1LPF A;  1N4W A;  2XLR A;  3P4Q A;  5KXJ A;  3K30 A;  3RED A;  1IJH A;  2FBW A;  4IV9 A;  5M0Z A;  3T37 A;  1Q1R A;  5JCM A;  1CC4 A;  2GQW A;  2XFQ A;  1E6E A;  4JN9 A;  2W0H A;  2Z5X A;  4EQS A;  3HYW A;  1GAL A;  4BJY A;  3SZC A;  3CN8 A;  2GAG B;  3DJJ A;  2OLN A;  5FS7 A;  3AE5 A;  4AT0 A;  4OPI A;  3UKL A;  1PXC A;  3CPJ G;  1E39 A;  4CY6 A;  3CPH G;  3VR8 A;  3ZDN A;  4IVM B;  4JDR A;  2YR5 A;  3G5S A;  3NKS A;  3Q6J A;  4RSL A;  1ZOY A;  2X8G A;  2BAC A;  5JCI A;  2E5V A;  3URH A;  4ZN0 A;  2VQB A;  2C7G A;  1ZMD A;  5GSN A;  3SFD A;  4GAP A;  1TRB A;  4K2X A;  1FL2 A;  2TPR A;  2V5Z A;  1L9D A;  2C65 A;  1DOC A;  2C72 A;  4EMJ A;  1GER A;  2C3D A;  3AYI A;  3GSI A;  4II3 A;  3T14 A;  1AOG A;  1IUX A;  2C67 A;  5KVH A;  3P4P A;  4H4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...