2Q0LA

Helicobacter pylori thioredoxin reductase reduced by sodium dithionite in complex with nadp+
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of oxidized and reduced thioredoxin reductase from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 93
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0lA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q0lA02
2AAQA 2Z5YA 4Z2UA 1FL2A 2GV8A 4J56A 3P4QA 4H4SA 1JNRA 1YY5A 4C3XA 1ZY8A 3CPHG 3RP8A 4Y4MA 5FMHA 3FMWA 1GRFA 4BJZA 1E1KA 2C3DA 4H4RA 2YAUA 1AOGA 3CPIG 3EANA 3P4SA 1XANA 3GDNA 3V76A 5JCMA 4H4YA 4BJYA 2QAEA 2V5ZA 2ZZ0A 3JSKA 2WPCA 1F8SA 3ALMA 2X8CA 1DODA 3SFDA 4DGKA 4CY8A 5KWFA 4YXDA 3AE8A 2R0PA 2XVFA 2YVGA 2JBVA 2VVLA 2EQ9A 2FJEA 3UP4A 5IQ1A 2B9WA 3KVEA 2Q6UA 3NHOX 4YWOA 4AP3A 1CC2A 1BF3A 1KSSA 2GB0A 4FK1C 4U8PA 3S61A 2Q0KA 2O9ZA 1KNRA 4JY3A 3SM8A 2XLTA 4B64A 1W4XA 5J60A 1IUUA 1D7LA 2XFPA 4C74A 4MJWA 2PYXA 4YSZA 4J31A 3C96A 4H2RA 1E1NA 1N4UA 5HHFA 4A7AA 1GV4A 3RNMA 1DNCA 2V3BA 1PXBA 2WS3A 2VRLA 2WPFA 3ADAB 1O94A 3GD3A 3DA1A 3LB8A 5U63A 2C66A 3AEBA 2C3CA 1PJ7A 3AE7A 4J57A 3AXBA 4EQRA 2BS3A 1K4QA 3RP6A 3FBSA 3UOVA 2GF3A 3GWDA 4AT2A 2WDRA 2A8XA 1OJCA 4CNKA 4WCTA 1IUXA 2BK5A 5TR3A 1ZMCA 3CN8A 3DGZA 4X4JA 4YSYA 5KOWA 4JDRA 3NIXA 2B9XA 1LQTA 5ER0A 1Q1WA 3VR9A 3SFEA 4U8OA 1S3BA 3CNSA 1PJ6A 3HZLA 3UKKA 4OPCA 2XFNA 5KRQA 2R0GA 1UKVG 4JNQA 4U8NA 4A65A 1D5TA 1GESA 1CC6A 3L1RA 2VZ2A 1NG4A 4U8LA 3VQRA 1M6IA 3SQPA 3UP5A 1B4VA 3M0OA 3CGDA 2VOUA 3H8IA 4K5RA 4D04A 4Z25A 2V61A 1B37A 3AE1A 4A79A 4AOSA 2GMJA 3AE2A 3EAOA 2GR0A 4GUVA 3NTDA 1ZK7A 4NTCA 1GEUA 1P2HA 3ZYXA 4EM3A 3UTFA 5HYMA 2OLNA 4FK1A 4TM0A 2BXSA 2BK4A 1GERA 2R9ZA 4BV6A 4C77A 4APNA 1VG0A 3GYJA 1TYTA 5C3JA 2XVEA 3GSIA 4H4TA 4YSHA 1QLBA 3FPZA 3AE5A 3SGLA 3GDPA 1O5WA 2XDOA 4BK2A 4K5SA 4D03A 2V6OA 1S3EA 4EMIA 4USRA 3VR8A 3F8RA 4A9WA 5M10A 1N4WA 1COYA 3UTHA 3GMBA 2TMDA 2RABA 1TDKA 2GAGB 1PN0A 3NN6X 1H7WA 2A89A 4I59A 4YKGA 4YT0A 4WX1A 3RHAA 4LU6A 4XWZA 3UKPA 4U8KA 1D7YA 1L9CA 4O5UA 4H2QA 4XXGA 4B67A 4JNAA 3CGBA 1GTHA 4GDPA 3AYIA 3QSMA 4PABA 3ABVA 4YSXA 4A6NB 5GRTA 2ZZBA 4JY2A 2TPRA 2GRTA 4BK3A 4REKA 1H6VA 3NYCA 1TYPA 2XFUA 1F8WA 3UKFA 1H84A 4LA1A 4EMJA 2WQYA 2F5ZA 2R4JA 5CKUA 1Y0PA 3BHFA 2YLXA 3KLJA 2EQ6A 2WETA 3ISHA 4K7ZA 4BK1A 1GREA 4B1BA 4H4WA 3K7TA 1BWCA 1LTXR 1JRXA 3UKAA 1EL5A 2BCGG 1NAAA 3C4AA 2JB1A 4XWRA 4YTNA 5C2TA 2X8GA 1DOBA 2OAMA 4U2TA 4B66A 4U8IA 1GRBA 1BKWA 2QA1A 3ICRA 3Q9TA 4UDPA 3M13A 2QCUA 2WOVA 2FBWA 2YQUA 4OPIA 1FOHA 1N1PA 1NHRA 2B7RA 3GMCA 2JKCA 4NZHA 5EB5A 4EQSA 3AYLA 2A87A 1JU2A 2E4GA 2WEUA 3F8DA 3ALJA 1F6MA 2BK3A 1SEZA 4Z2RA 2YR5A 3ICSA 1S2QA 2RGHA 3AE6A 3PVCA 4Z24A 1PBBA 5CQFA 2C64A 1Q1RA 2VQ7A 3I3LA 2ZZCA 1NHQA 4CCRA 2R46A 3GRTA 4EIPA 1Q9IA 1KSUA 1BZLA 3M12A 4H4XA 4OVIA 2C67A 1BGNA 1TDFA 2X50A 4TLXA 1H83A 5JCKA 3B3RA 2RGOA 1V59A 2WP9A 1IJHA 2AQJA 2BS4A 4NEWA 4CBQA 3LZWA 4H4PA 4NTEA 3R9UA 4ADWA 2YLRA 2NVKX 2XVJA 2YVJA 5JCNA 1Z6LA 2VRMA 2XCGA 4HA6A 4ZCCA 2CULA 3BNUA 1K0LA 4B69A 2X8HA 3Q6JA 3II4A 3KU9A 3ATRA 4H50A 2GR1A 5L46A 2GQFA 2E1MA 1MOKA 4PAAA 1GETA 1YQ3A 1FEBA 4X9MA 2YG6A 4FDCB 5FS7A 1ONFA 1GT8A 2Z5XA 1MO9A 1E7PA 2IVEA 4TM4A 5FS8A 3LOVA 4RG4A 3NGCX 5JCIA 1GTEA 2E5VA 2I0ZA 3BI2A 1K0JA 1JOAA 3DJGX 3IC9A 1KNPA 4OPTA 4NTDA 3UOXA 3VRBA 2BCPA 2GH5A 2XLSA 2Q0LA 3IHGA 3AEGA 1IUSA 5KVIA 4J33A 3AB1A 1KDGA 4X9NA 4J2WA 1EL7A 1JEHA 2XVIA 1L9EA 2XFQA 4DNAA 1Y56A 3IF9A 4H4QA 1GNDA 1XPQA 2FJDA 3QFAA 4H7UA 1NHSA 4J36A 4USQA 4Z44A 3DGHA 3DK4A 3T37A 4EM4A 3BHKA 1DJNA 2BC1A 2XLPA 1NG3A 2WPEA 1H86A 4B63A 1XDIA 4YTPA 1JNZA 1H81A 5BULA 2BYBA 4EQWA 1OJDA 2HQMA 1CHUA 3NYEA 4TM3A 3UOZA 1NHPA 4H4VA 3UKLA 2YLZA 3ALLA 4Z43A 4P9SA 5IQ4A 1QJDA 5EBKA 1B8SA 2ARDA 3DMEA 1ZMDA 1IUWA 2C7GA 1VQWA 3COXA 1ZX9A 2CVJA 3G5SA 3LJPA 3NKSA 3AECA 2IVDA 4Y4LA 1BGJA 5GSNA 2BACA 3VRAA 3AEFA 3NYFA 5KVHA 2YG5A 2CFYA 2R4EA 1VRQB 4Z2TA 2VVLG 1IUTA 2GR2A 1GXFA 2XLRA 3CNPA 3EPTA 1F8RA 1NEKA 4C5OA 4ICYA 3KA7A 3KPFA 1NENA 4A99A 1HYUA 2WBAA 4UDRA 2YR4A 3DJDA 4K2XA 5U1OA 3I6DA 4H4ZA 1KFYA 4OPGA 3DK8A 3BI5A 3CTYA 3FIMB 3S5WA 5BVAA 1FEAA 2Y6RA 1OJAA 1EL8A 1MXTA 2RGJA 3K7MX 2ACZA 1FCDA 5KOXA 2R45A 3LADA 1LJ1A 3QJ4A 2YG4A 2EQ7A 2H88A 2UZZA 4HB9A 2APGA 3URHA 1FECA 1PXCA 1DOEA 2WDQA 2FJAA 3KKJA 3UTGA 2OA1A 2WESA 4JQ9A 2YG7A 2BABA 3CNJA 1QO8A 4GDEA 4OCGA 3L8KA 2GMHA 3D8XA 5EOWA 2WP5A 1H82A 1B5QA 2J3NA 3BI4A 1GSNA 2YVFA 5BUKA 1S2YA 3NN0X 1GPEA 2B76A 3CGEA 2XFOA 2XYOA 1PBFA 2WOWA 1DOCA 3LXDA 2IIDA 5JCLA 3ZDNA 1LQUA 1X31B 1PS9A 3QVRA 2YLWA 3GWFA 3AE9A 3LZXA 5IPYA 4LIIA 4M52A 4UDQA 4RSLA 3AD7B 2NPXA 3UCLA 4AOXA 3NG7X 1CJ2A 2V3AA 3PS9A 3ITJA 3NT6A 1P2EA 1CL0A 1D4CA 3V3NA 2Q7VA 4GF7A 3REDA 1JRYA 1PBDA 2YG3A 3ICTA 1E1LA 2JK6A 1VG9A 3CIRA 4H2NA 4IVOB 3VRDB 2R0CA 2W0HA 3IWAA 2QA2A 2JAEA 3P4RA 4TLZA 4Y4NA 2JB2A 3CPJG 4U2SA 2VQBA 1ZP0A 2YLSA 3OC4A 3QVPA 3GYIA 3QSEA 4OPUA 5FS6A 3PO7A 5HXIA 3DJEA 1YQ4A 2YM1A 3P4PA 1RP0A 4A5LA 5KXJA 2Y6QA 1TDNA 1RSGA 1ZKQA 1O95A 4O5QA 2C65A 1GRGA 2C76A 2BXRA 5J7XA 2GEWA 1YKJA 4U2LA 3CGCA 3AEAA 3K30A 4ZN0A 4Z26A 1CJ3A 1H7XA 2DKHA 1RYIA 2VVMA 2XVHA 1CF3A 3NH3X 4A6NA 2CDUA 4CY6A 1PBCA 1DXLA 1JRZA 4YTMA 1GRAA 3AWIA 2C70A 2C73A 2C72A 3AYJA 1DJQA 4C3YA 2C75A 2DKIA 3QSSA 1ZOYA 2GAHB 2XLUA 2YWLA 4H4UA 2YR6A 1PHHA 2WOIA 4BURA 4EQXA 1REOA 4U8MA 3V3OA 2WU5A 1CJCA 1NPXA 4AP1A 3P1WA 4H2PA 3NK2X 3D1CA 4UP3A 3CNTA 5HY5A 4ECHA 1GALA 1D4DA 4N9XA 4GCMA 3O0HA 2WU2A 3BNMA 4GR1A 1TDOA 1TRBA 3B6DA 3G5QA 2ZBWA 5BRTA 4GRTA 1E1MA 1TDEA 4CNJA 1OJ9A 1CJ4A 2YM2A 2EQ8A 5FS9A 2B7SA 4K8DA 3E1TA 4OPLA 3CNDA 3F8PA 3AD9B 3RP7A 1VDCA 1NDAA 1N4VA 4CCQA 3QFBA 4RG3A 3OZ2A 3KD9A 1PXAA 4B68A 3G5RA 1EBDA 3NNEA 1KF6A 1PBEA 2WHDA 2GQWA 2FJBA 1LVLA 2PHHA 4AT0A 3DK9A 3NTAA 1EL9A 1OJTA 3DJJA 4DSHA 1CBOA 1PDHA 2BS2A 3AEEA 3NK0X 2OLOA 1E39A 4I58A 4ZCDA 4TM1A 1GOSA 4KPRA 1D4EA 5LV9A 3UTEA 2YLTA 5U25A 3H8LA 3NK1X 4FX9A 4J34A 2WDVA 5EB4A 1YQZA 3H4KA 4KX6A 3DH9A 1XHCA 2BA9A 3GRSA 4K22A 1LV0A 1Y56B 1ZOVA 2X3NA 3P9UA 2GVCA 1K0IA 3NRNA 4EIQA 4IV9A 4DSGA 1PJ5A 2B9YA 2X99A 4IVMB 3C4NA 4NEVA 2H89A 4U8JA 3AE3A 2OALA 3IHMA 1GRHA 1ELIA 4CRTA 3UKHA 1ZDLA 2GR3A 3ATQA 2JB3A 1F3PA 1CC4A 1L9DA 3EF6A 3K7QX 4EMWA 1M64A 1IUVA 1E6EA 2BC0A 2WP6A 4IA6A 4YKFA 3UOYA 3UKQA 1L0VA 1LPFA 4OPDA 3AD8B 3NLCA 2V60A 4IA5A 1GRTA 5DBJA 4B65A 3GD4A 4JN9A 3AE4A 5M0ZA 3AEDA 4E0VA 3FG2P 2AR8A 3WE0A
chains in the Genus database with same CATH superfamily
2AAQA 2Z5YA 4Z2UA 1FL2A 2GV8A 4J56A 4II2A 3P4QA 4H4SA 1JNRA 1YY5A 4C3XA 1ZY8A 3CPHG 3RP8A 4Y4MA 5FMHA 3FMWA 1GRFA 4BJZA 1E1KA 2C3DA 4H4RA 2YAUA 1AOGA 3CPIG 3EANA 3P4SA 3HYXA 1XANA 3GDNA 3V76A 5JCMA 4H4YA 4BJYA 2QAEA 2V5ZA 2ZZ0A 3JSKA 2WPCA 5KMQA 1F8SA 3ALMA 2X8CA 1DODA 3SFDA 4DGKA 4CY8A 5KWFA 4YXDA 3AE8A 5KNLA 2R0PA 2XVFA 2YVGA 2JBVA 2VVLA 2EQ9A 2FJEA 3UP4A 5IQ1A 2B9WA 3KVEA 2Q6UA 3NHOX 4YWOA 4AP3A 1CC2A 1BF3A 1KSSA 2GB0A 4FK1C 4U8PA 3S61A 2Q0KA 2O9ZA 1KNRA 4JY3A 3SM8A 2XLTA 4B64A 1W4XA 5J60A 1IUUA 1D7LA 4G6GA 2XFPA 4C74A 4MJWA 2PYXA 4YSZA 4J31A 3C96A 4H2RA 1E1NA 1N4UA 5HHFA 4A7AA 1GV4A 3RNMA 1DNCA 2V3BA 1PXBA 2WS3A 2VRLA 2WPFA 3ADAB 1O94A 3GD3A 3DA1A 3LB8A 5U63A 2C66A 3AEBA 2C3CA 1PJ7A 3AE7A 3T0KA 4J57A 4NWZA 3AXBA 3T2YA 4EQRA 2BS3A 1K4QA 3RP6A 3FBSA 2BRAA 2GF3A 3UOVA 3GWDA 4AT2A 2WDRA 2A8XA 1OJCA 4CNKA 4WCTA 1IUXA 2BK5A 5TR3A 1ZMCA 3CN8A 3DGZA 4X4JA 4YSYA 5KOWA 4JDRA 3NIXA 2B9XA 1LQTA 5ER0A 1Q1WA 3VR9A 3SFEA 4U8OA 1S3BA 3CNSA 1PJ6A 3HZLA 3UKKA 4OPCA 2XFNA 5KRQA 2R0GA 1UKVG 4JNQA 4U8NA 4A65A 1D5TA 1GESA 1CC6A 3L1RA 2VZ2A 1NG4A 4U8LA 3VQRA 1M6IA 3SQPA 3UP5A 1B4VA 3M0OA 3CGDA 2VOUA 3H8IA 4K5RA 4D04A 4Z25A 2V61A 1B37A 3AE1A 4A79A 4AOSA 2GMJA 3AE2A 3EAOA 2GR0A 4GUVA 3NTDA 1ZK7A 4NTCA 1GEUA 1P2HA 3ZYXA 4EM3A 3UTFA 5HYMA 2OLNA 4FK1A 4TM0A 2BXSA 2BK4A 1GERA 2R9ZA 4BV6A 4C77A 4APNA 1VG0A 3GYJA 1TYTA 5C3JA 2XVEA 3GSIA 4H4TA 4YSHA 1QLBA 3FPZA 4G6HA 3AE5A 3SGLA 3GDPA 1O5WA 2XDOA 4BK2A 4K5SA 4D03A 2V6OA 1S3EA 4EMIA 4USRA 3VR8A 3F8RA 4A9WA 5M10A 1N4WA 1COYA 3UTHA 3GMBA 2TMDA 2RABA 2BRYA 1TDKA 2GAGB 1PN0A 3NN6X 1H7WA 2A89A 4I59A 4YKGA 4YT0A 4WX1A 3RHAA 4LU6A 4XWZA 3UKPA 4U8KA 1D7YA 1L9CA 4O5UA 4H2QA 4XXGA 4B67A 4JNAA 3CGBA 1GTHA 4GDPA 3AYIA 3QSMA 4PABA 3ABVA 4YSXA 4A6NB 5GRTA 2ZZBA 4JY2A 2TPRA 2GRTA 4BK3A 4REKA 1H6VA 3NYCA 1TYPA 2XFUA 1F8WA 3UKFA 1H84A 4LA1A 4EMJA 2WQYA 2F5ZA 2R4JA 5CKUA 1Y0PA 3BHFA 2YLXA 3HYVA 2EQ6A 2WETA 3ISHA 3KLJA 4K7ZA 4BK1A 1GREA 4B1BA 4H4WA 3K7TA 1BWCA 1LTXR 1JRXA 3UKAA 1EL5A 2BCGG 1NAAA 3C4AA 2JB1A 4XWRA 4YTNA 5C2TA 2X8GA 1DOBA 2OAMA 4U2TA 4B66A 4U8IA 3T2ZA 1GRBA 1BKWA 2QA1A 3ICRA 3Q9TA 4UDPA 3M13A 2QCUA 2WOVA 2FBWA 2YQUA 4OPIA 1FOHA 1N1PA 1NHRA 2B7RA 3GMCA 2JKCA 3GYXA 4NZHA 5EB5A 3AYLA 3T2KA 4EQSA 2A87A 1JU2A 2E4GA 2WEUA 3F8DA 3ALJA 1F6MA 2BK3A 1SEZA 4Z2RA 2YR5A 3ICSA 1S2QA 2RGHA 3AE6A 3PVCA 4GAVA 1PBBA 4Z24A 5CQFA 2C64A 1Q1RA 2VQ7A 3I3LA 2ZZCA 1NHQA 4CCRA 2R46A 3GRTA 4EIPA 1Q9IA 1KSUA 1BZLA 3M12A 4H4XA 4OVIA 2C67A 1BGNA 1TDFA 2X50A 4TLXA 1H83A 5JCKA 4II3A 3B3RA 2RGOA 1V59A 2WP9A 1IJHA 2AQJA 2BS4A 4NEWA 4CBQA 3LZWA 4H4PA 4NTEA 3R9UA 4ADWA 3SZFA 2YLRA 2NVKX 2XVJA 2YVJA 5JCNA 1Z6LA 2VRMA 2XCGA 4HA6A 4ZCCA 2CULA 3BNUA 1K0LA 4B69A 2X8HA 3Q6JA 3II4A 3KU9A 3ATRA 4H50A 2GR1A 5L46A 2GQFA 2E1MA 1MOKA 4PAAA 3T14A 1GETA 1YQ3A 1FEBA 4X9MA 2YG6A 2C4CA 4FDCB 5FS7A 1ONFA 1GT8A 2Z5XA 1MO9A 1E7PA 2IVEA 4TM4A 5FS8A 3LOVA 4RG4A 3NGCX 5JCIA 1GTEA 2E5VA 2I0ZA 3BI2A 1K0JA 1JOAA 3DJGX 3IC9A 1KNPA 4OPTA 4NTDA 3UOXA 3VRBA 5KMRA 2BCPA 2GH5A 2XLSA 2Q0LA 3IHGA 3AEGA 1IUSA 5KVIA 4J33A 3AB1A 1KDGA 4X9NA 4J2WA 1EL7A 1JEHA 2XVIA 1L9EA 2XFQA 4NNJA 4DNAA 1Y56A 3IF9A 4H4QA 1GNDA 1XPQA 2FJDA 3QFAA 4H7UA 1NHSA 4J36A 4USQA 4Z44A 3DGHA 3DK4A 3T37A 4EM4A 3BHKA 1DJNA 2BC1A 2XLPA 1NG3A 2WPEA 1H86A 4B63A 1XDIA 4YTPA 1JNZA 1H81A 5BULA 2BYBA 4EQWA 1OJDA 2HQMA 1CHUA 3NYEA 4TM3A 3UOZA 1NHPA 4H4VA 3UKLA 2YLZA 3ALLA 4Z43A 4P9SA 5IQ4A 1QJDA 5EBKA 1B8SA 2ARDA 3DMEA 1ZMDA 1IUWA 2C7GA 1VQWA 3COXA 1ZX9A 2CVJA 3G5SA 3LJPA 3NKSA 3AECA 2IVDA 4Y4LA 3SXIA 1BGJA 5GSNA 2BACA 3VRAA 3AEFA 3NYFA 5KVHA 2YG5A 2CFYA 2R4EA 1VRQB 4Z2TA 2VVLG 1IUTA 2GR2A 1GXFA 2XLRA 3CNPA 3EPTA 1F8RA 1NEKA 4C5OA 4ICYA 3KA7A 3KPFA 1NENA 4A99A 1HYUA 2WBAA 4UDRA 2YR4A 3DJDA 4K2XA 5U1OA 3I6DA 4H4ZA 1KFYA 4OPGA 3DK8A 3BI5A 3CTYA 3FIMB 3S5WA 5BVAA 1FEAA 2Y6RA 1OJAA 1EL8A 1MXTA 2RGJA 3K7MX 2ACZA 1FCDA 5KOXA 2R45A 3LADA 1LJ1A 3QJ4A 2YG4A 2EQ7A 2H88A 2UZZA 4HB9A 2APGA 3URHA 1FECA 1PXCA 1DOEA 2WDQA 2FJAA 3SZ0A 3KKJA 3UTGA 2OA1A 2WESA 4JQ9A 2YG7A 2BABA 3CNJA 1QO8A 4GDEA 4OCGA 3L8KA 2GMHA 3D8XA 5EOWA 2WP5A 1H82A 1B5QA 2J3NA 3BI4A 1GSNA 2YVFA 5BUKA 1S2YA 3NN0X 1GPEA 2B76A 3CGEA 2XFOA 2XYOA 1PBFA 2WOWA 1DOCA 3LXDA 2IIDA 5JCLA 3ZDNA 1LQUA 1X31B 3SZWA 1PS9A 3QVRA 2YLWA 3GWFA 3AE9A 3LZXA 5IPYA 4LIIA 4M52A 4G73A 4UDQA 4RSLA 3AD7B 2NPXA 3UCLA 4AOXA 3NG7X 1CJ2A 2V3AA 3PS9A 3ITJA 3NT6A 1P2EA 1CL0A 1D4CA 3V3NA 2Q7VA 4GF7A 3REDA 1JRYA 1PBDA 2YG3A 3ICTA 1E1LA 2JK6A 1VG9A 3CIRA 4H2NA 4IVOB 3VRDB 2R0CA 2W0HA 3IWAA 2QA2A 2JAEA 3P4RA 4TLZA 4Y4NA 2JB2A 4G9KA 3CPJG 4U2SA 2VQBA 1ZP0A 2YLSA 3OC4A 3HYWA 3GYIA 3QSEA 3QVPA 4OPUA 5FS6A 3PO7A 5HXIA 3DJEA 1YQ4A 2YM1A 3P4PA 1RP0A 4A5LA 5KXJA 2Y6QA 1TDNA 1RSGA 1ZKQA 1O95A 4O5QA 2C65A 1GRGA 2C76A 2BXRA 5J7XA 2GEWA 1YKJA 4U2LA 3CGCA 3AEAA 3K30A 4G74A 4ZN0A 4Z26A 3T31A 3SZCA 1CJ3A 1H7XA 2DKHA 1RYIA 2VVMA 2XVHA 1CF3A 3NH3X 4A6NA 2CDUA 4CY6A 1PBCA 1DXLA 1JRZA 4YTMA 1GRAA 3AWIA 2C70A 2C73A 2C72A 3AYJA 1DJQA 4C3YA 2C75A 2DKIA 3QSSA 1ZOYA 2GAHB 2XLUA 2YWLA 4H4UA 2YR6A 1PHHA 2WOIA 4BURA 3CMMA 4EQXA 1REOA 4U8MA 3V3OA 2WU5A 1CJCA 1NPXA 4AP1A 3P1WA 4H2PA 3NK2X 3D1CA 4UP3A 3CNTA 5HY5A 4ECHA 1GALA 1D4DA 4N9XA 4GCMA 3O0HA 2WU2A 3BNMA 4GR1A 1TDOA 3KPKA 1TRBA 3B6DA 3G5QA 2ZBWA 5BRTA 4GRTA 1E1MA 1TDEA 4CNJA 1OJ9A 1CJ4A 2YM2A 2EQ8A 5FS9A 2B7SA 4K8DA 3E1TA 4OPLA 3CNDA 3F8PA 3AD9B 3RP7A 1VDCA 1NDAA 1N4VA 4CCQA 3QFBA 4RG3A 3OZ2A 3KD9A 1PXAA 4B68A 3G5RA 1EBDA 3NNEA 1KF6A 1PBEA 2WHDA 2GQWA 2FJBA 1LVLA 2PHHA 4AT0A 3DK9A 3NTAA 1EL9A 1OJTA 3DJJA 4DSHA 3SY4A 1CBOA 1PDHA 2BS2A 3AEEA 3NK0X 2OLOA 1E39A 4I58A 4ZCDA 4TM1A 1GOSA 4GAPA 4KPRA 1D4EA 5LV9A 3UTEA 2YLTA 5U25A 3H8LA 3NK1X 4FX9A 4J34A 2WDVA 5EB4A 1YQZA 3H4KA 4KX6A 3DH9A 1XHCA 2BA9A 3GRSA 4K22A 1LV0A 1Y56B 1ZOVA 2X3NA 3P9UA 2GVCA 1K0IA 3NRNA 4EIQA 4IV9A 4DSGA 1PJ5A 2B9YA 2X99A 4IVMB 3C4NA 3SX6A 4NEVA 2H89A 4U8JA 3AE3A 2OALA 3IHMA 1GRHA 1ELIA 4CRTA 3UKHA 1ZDLA 2GR3A 3ATQA 2JB3A 3SYIA 5KMPA 5KMSA 1F3PA 1CC4A 1L9DA 3EF6A 3K7QX 4EMWA 1M64A 1IUVA 1E6EA 2BC0A 2WP6A 4IA6A 4YKFA 3UOYA 3UKQA 1L0VA 1LPFA 4OPDA 3AD8B 3NLCA 2V60A 4IA5A 1GRTA 5DBJA 4B65A 3GD4A 4JN9A 3AE4A 5M0ZA 3AEDA 4E0VA 3FG2P 2AR8A 3WE0A
chains in the Genus database with same CATH topology
2AAQA 2Z5YA 4Z2UA 1FL2A 2GV8A 4J56A 4II2A 3P4QA 4H4SA 1JNRA 1YY5A 4C3XA 1ZY8A 3CPHG 3RP8A 4Y4MA 5FMHA 3FMWA 1GRFA 4BJZA 1E1KA 2C3DA 4H4RA 2YAUA 1AOGA 3CPIG 3EANA 3P4SA 3HYXA 1XANA 3GDNA 3V76A 5JCMA 4H4YA 4BJYA 2QAEA 2V5ZA 2ZZ0A 3JSKA 2WPCA 5KMQA 1F8SA 3ALMA 2X8CA 1DODA 3SFDA 4DGKA 4CY8A 5KWFA 4YXDA 3AE8A 5KNLA 2R0PA 2XVFA 2YVGA 2JBVA 2VVLA 2EQ9A 2FJEA 3UP4A 5IQ1A 2B9WA 3KVEA 2Q6UA 3NHOX 4YWOA 4AP3A 1CC2A 1BF3A 1KSSA 2GB0A 4FK1C 4U8PA 3S61A 2Q0KA 2O9ZA 1KNRA 4JY3A 3SM8A 2XLTA 4B64A 1W4XA 5J60A 1IUUA 1D7LA 4G6GA 2XFPA 4C74A 4MJWA 2PYXA 4YSZA 4J31A 3C96A 4H2RA 1E1NA 1N4UA 5HHFA 4A7AA 1GV4A 3RNMA 1DNCA 2V3BA 1PXBA 2WS3A 2VRLA 2WPFA 3ADAB 1O94A 3GD3A 3DA1A 3LB8A 5U63A 2C66A 3AEBA 2C3CA 1PJ7A 3AE7A 3T0KA 4J57A 4NWZA 3AXBA 3T2YA 4EQRA 2BS3A 1K4QA 3RP6A 3FBSA 2BRAA 2GF3A 3UOVA 3GWDA 4AT2A 2WDRA 2A8XA 1OJCA 4CNKA 4WCTA 1IUXA 2BK5A 5TR3A 1ZMCA 3CN8A 3DGZA 4X4JA 4YSYA 5KOWA 4JDRA 3NIXA 2B9XA 1LQTA 5ER0A 1Q1WA 3VR9A 3SFEA 4U8OA 1S3BA 3CNSA 1PJ6A 3HZLA 3UKKA 4OPCA 2XFNA 5KRQA 2R0GA 1UKVG 4JNQA 4U8NA 4A65A 1D5TA 1GESA 1CC6A 3L1RA 2VZ2A 1NG4A 4U8LA 3VQRA 1M6IA 3SQPA 3UP5A 1B4VA 3M0OA 3CGDA 2VOUA 3H8IA 4K5RA 4D04A 4Z25A 2V61A 1B37A 3AE1A 4A79A 4AOSA 2GMJA 3AE2A 3EAOA 2GR0A 4GUVA 3NTDA 1ZK7A 4NTCA 1GEUA 1P2HA 3ZYXA 4EM3A 3UTFA 5HYMA 2OLNA 4FK1A 4TM0A 2BXSA 2BK4A 1GERA 2R9ZA 4BV6A 4C77A 4APNA 1VG0A 3GYJA 1TYTA 5C3JA 2XVEA 3GSIA 4H4TA 4YSHA 1QLBA 3FPZA 4G6HA 3AE5A 3SGLA 3GDPA 1O5WA 2XDOA 4BK2A 4K5SA 4D03A 2V6OA 1S3EA 4EMIA 4USRA 3VR8A 3F8RA 4A9WA 5M10A 1N4WA 1COYA 3UTHA 3GMBA 2TMDA 2RABA 2BRYA 1TDKA 2GAGB 1PN0A 3NN6X 1H7WA 2A89A 4I59A 4YKGA 4YT0A 4WX1A 3RHAA 4LU6A 4XWZA 3UKPA 4U8KA 1D7YA 1L9CA 4O5UA 4H2QA 4XXGA 4B67A 4JNAA 3CGBA 1GTHA 4GDPA 3AYIA 3QSMA 4PABA 3ABVA 4YSXA 4A6NB 5GRTA 2ZZBA 4JY2A 2TPRA 2GRTA 4BK3A 4REKA 1H6VA 3NYCA 1TYPA 2XFUA 1F8WA 3UKFA 1H84A 4LA1A 4EMJA 2WQYA 2F5ZA 2R4JA 5CKUA 1Y0PA 3BHFA 2YLXA 3HYVA 2EQ6A 2WETA 3ISHA 3KLJA 4K7ZA 4BK1A 1GREA 4B1BA 4H4WA 3K7TA 1BWCA 1LTXR 1JRXA 3UKAA 1EL5A 2BCGG 1NAAA 3C4AA 2JB1A 4XWRA 4YTNA 5C2TA 2X8GA 1DOBA 2OAMA 4U2TA 4B66A 4U8IA 3T2ZA 1GRBA 1BKWA 2QA1A 3ICRA 3Q9TA 4UDPA 3M13A 2QCUA 2WOVA 2FBWA 2YQUA 4OPIA 1FOHA 1N1PA 1NHRA 2B7RA 3GMCA 2JKCA 3GYXA 4NZHA 5EB5A 3AYLA 3T2KA 4EQSA 2A87A 1JU2A 2E4GA 2WEUA 3F8DA 3ALJA 1F6MA 2BK3A 1SEZA 4Z2RA 2YR5A 3ICSA 1S2QA 2RGHA 3AE6A 3PVCA 4GAVA 1PBBA 4Z24A 5CQFA 2C64A 1Q1RA 2VQ7A 3I3LA 2ZZCA 1NHQA 4CCRA 2R46A 3GRTA 4EIPA 1Q9IA 1KSUA 1BZLA 3M12A 4H4XA 4OVIA 2C67A 1BGNA 1TDFA 2X50A 4TLXA 1H83A 5JCKA 4II3A 3B3RA 2RGOA 1V59A 2WP9A 1IJHA 2AQJA 2BS4A 4NEWA 4CBQA 3LZWA 4H4PA 4NTEA 3R9UA 4ADWA 3SZFA 2YLRA 2NVKX 2XVJA 2YVJA 5JCNA 1Z6LA 2VRMA 2XCGA 4HA6A 4ZCCA 2CULA 3BNUA 1K0LA 4B69A 2X8HA 3Q6JA 3II4A 3KU9A 3ATRA 4H50A 2GR1A 5L46A 2GQFA 2E1MA 1MOKA 4PAAA 3T14A 1GETA 1YQ3A 1FEBA 4X9MA 2YG6A 2C4CA 4FDCB 5FS7A 1ONFA 1GT8A 2Z5XA 1MO9A 1E7PA 2IVEA 4TM4A 5FS8A 3LOVA 4RG4A 3NGCX 5JCIA 1GTEA 2E5VA 2I0ZA 3BI2A 1K0JA 1JOAA 3DJGX 3IC9A 1KNPA 4OPTA 4NTDA 3UOXA 3VRBA 5KMRA 2BCPA 2GH5A 2XLSA 2Q0LA 3IHGA 3AEGA 1IUSA 5KVIA 4J33A 3AB1A 1KDGA 4X9NA 4J2WA 1EL7A 1JEHA 2XVIA 1L9EA 2XFQA 4NNJA 4DNAA 1Y56A 3IF9A 4H4QA 1GNDA 1XPQA 2FJDA 3QFAA 4H7UA 1NHSA 4J36A 4USQA 4Z44A 3DGHA 3DK4A 3T37A 4EM4A 3BHKA 1DJNA 2BC1A 2XLPA 1NG3A 2WPEA 1H86A 4B63A 1XDIA 4YTPA 1JNZA 1H81A 5BULA 2BYBA 4EQWA 1OJDA 2HQMA 1CHUA 3NYEA 4TM3A 3UOZA 1NHPA 4H4VA 3UKLA 2YLZA 3ALLA 4Z43A 4P9SA 5IQ4A 1QJDA 5EBKA 1B8SA 2ARDA 3DMEA 1ZMDA 1IUWA 2C7GA 1VQWA 3COXA 1ZX9A 2CVJA 3G5SA 3LJPA 3NKSA 3AECA 2IVDA 4Y4LA 3SXIA 1BGJA 5GSNA 2BACA 3VRAA 3AEFA 3NYFA 5KVHA 2YG5A 2CFYA 2R4EA 1VRQB 4Z2TA 2VVLG 1IUTA 2GR2A 1GXFA 2XLRA 3CNPA 3EPTA 1F8RA 1NEKA 4C5OA 4ICYA 3KA7A 3KPFA 1NENA 4A99A 1HYUA 2WBAA 4UDRA 2YR4A 3DJDA 4K2XA 5U1OA 3I6DA 4H4ZA 1KFYA 4OPGA 3DK8A 3BI5A 3CTYA 3FIMB 3S5WA 5BVAA 1FEAA 2Y6RA 1OJAA 1EL8A 1MXTA 2RGJA 3K7MX 2ACZA 1FCDA 5KOXA 2R45A 3LADA 1LJ1A 3QJ4A 2YG4A 2EQ7A 2H88A 2UZZA 4HB9A 2APGA 3URHA 1FECA 1PXCA 1DOEA 2WDQA 2FJAA 3SZ0A 3KKJA 3UTGA 2OA1A 2WESA 4JQ9A 2YG7A 2BABA 3CNJA 1QO8A 4GDEA 4OCGA 3L8KA 2GMHA 3D8XA 5EOWA 2WP5A 1H82A 1B5QA 2J3NA 3BI4A 1GSNA 2YVFA 5BUKA 1S2YA 3NN0X 1GPEA 2B76A 3CGEA 2XFOA 2XYOA 1PBFA 2WOWA 1DOCA 3LXDA 2IIDA 5JCLA 3ZDNA 1LQUA 1X31B 3SZWA 1PS9A 3QVRA 2YLWA 3GWFA 3AE9A 3LZXA 5IPYA 4LIIA 4M52A 4G73A 4UDQA 4RSLA 3AD7B 2NPXA 3UCLA 4AOXA 3NG7X 1CJ2A 2V3AA 3PS9A 3ITJA 3NT6A 1P2EA 1CL0A 1D4CA 3V3NA 2Q7VA 4GF7A 3REDA 1JRYA 1PBDA 2YG3A 3ICTA 1E1LA 2JK6A 1VG9A 3CIRA 4H2NA 4IVOB 3VRDB 2R0CA 2W0HA 3IWAA 2QA2A 2JAEA 3P4RA 4TLZA 4Y4NA 2JB2A 4G9KA 3CPJG 4U2SA 2VQBA 1ZP0A 2YLSA 3OC4A 3HYWA 3GYIA 3QSEA 3QVPA 4OPUA 5FS6A 3PO7A 5HXIA 3DJEA 1YQ4A 2YM1A 3P4PA 1RP0A 4A5LA 5KXJA 2Y6QA 1TDNA 1RSGA 1ZKQA 1O95A 4O5QA 2C65A 1GRGA 2C76A 2BXRA 5J7XA 2GEWA 1YKJA 4U2LA 3CGCA 3AEAA 3K30A 4G74A 4ZN0A 4Z26A 3T31A 3SZCA 1CJ3A 1H7XA 2DKHA 1RYIA 2VVMA 2XVHA 1CF3A 3NH3X 4A6NA 2CDUA 4CY6A 1PBCA 1DXLA 1JRZA 4YTMA 1GRAA 3AWIA 2C70A 2C73A 2C72A 3AYJA 1DJQA 4C3YA 2C75A 2DKIA 3QSSA 1ZOYA 2GAHB 2XLUA 2YWLA 4H4UA 2YR6A 1PHHA 2WOIA 4BURA 3CMMA 4EQXA 1REOA 4U8MA 3V3OA 2WU5A 1CJCA 1NPXA 4AP1A 3P1WA 4H2PA 3NK2X 3D1CA 4UP3A 3CNTA 5HY5A 4ECHA 1GALA 1D4DA 4N9XA 4GCMA 3O0HA 2WU2A 3BNMA 4GR1A 1TDOA 3KPKA 1TRBA 3B6DA 3G5QA 2ZBWA 5BRTA 4GRTA 1E1MA 1TDEA 4CNJA 1OJ9A 1CJ4A 2YM2A 2EQ8A 5FS9A 2B7SA 4K8DA 3E1TA 4OPLA 3CNDA 3F8PA 3AD9B 3RP7A 1VDCA 1NDAA 1N4VA 4CCQA 3QFBA 4RG3A 3OZ2A 3KD9A 1PXAA 4B68A 3G5RA 1EBDA 3NNEA 1KF6A 1PBEA 2WHDA 2GQWA 2FJBA 1LVLA 2PHHA 4AT0A 3DK9A 3NTAA 1EL9A 1OJTA 3DJJA 4DSHA 3SY4A 1CBOA 1PDHA 2BS2A 3AEEA 3NK0X 2OLOA 1E39A 4I58A 4ZCDA 4TM1A 1GOSA 4GAPA 4KPRA 1D4EA 5LV9A 3UTEA 2YLTA 5U25A 3H8LA 3NK1X 4FX9A 4J34A 2WDVA 5EB4A 1YQZA 3H4KA 4KX6A 3DH9A 1XHCA 2BA9A 3GRSA 4K22A 1LV0A 1Y56B 1ZOVA 2X3NA 3P9UA 2GVCA 1K0IA 3NRNA 4EIQA 4IV9A 4DSGA 1PJ5A 2B9YA 2X99A 4IVMB 3C4NA 3SX6A 4NEVA 2H89A 4U8JA 3AE3A 2OALA 3IHMA 1GRHA 1ELIA 4CRTA 3UKHA 1ZDLA 2GR3A 3ATQA 2JB3A 3SYIA 5KMPA 5KMSA 1F3PA 1CC4A 1L9DA 3EF6A 3K7QX 4EMWA 1M64A 1IUVA 1E6EA 2BC0A 2WP6A 4IA6A 4YKFA 3UOYA 3UKQA 1L0VA 1LPFA 4OPDA 3AD8B 3NLCA 2V60A 4IA5A 1GRTA 5DBJA 4B65A 3GD4A 4JN9A 3AE4A 5M0ZA 3AEDA 4E0VA 3FG2P 2AR8A 3WE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAQ A;  2Z5Y A;  4Z2U A;  1FL2 A;  2GV8 A;  4J56 A;  3P4Q A;  4H4S A;  1JNR A;  1YY5 A;  4C3X A;  1ZY8 A;  3CPH G;  3RP8 A;  4Y4M A;  5FMH A;  3FMW A;  1GRF A;  4BJZ A;  1E1K A;  2C3D A;  4H4R A;  2YAU A;  1AOG A;  3CPI G;  3EAN A;  3P4S A;  1XAN A;  3GDN A;  3V76 A;  5JCM A;  4H4Y A;  4BJY A;  2QAE A;  2V5Z A;  2ZZ0 A;  3JSK A;  2WPC A;  1F8S A;  3ALM A;  2X8C A;  1DOD A;  3SFD A;  4DGK A;  4CY8 A;  5KWF A;  4YXD A;  3AE8 A;  2R0P A;  2XVF A;  2YVG A;  2JBV A;  2VVL A;  2EQ9 A;  2FJE A;  3UP4 A;  5IQ1 A;  2B9W A;  3KVE A;  2Q6U A;  3NHO X;  4YWO A;  4AP3 A;  1CC2 A;  1BF3 A;  1KSS A;  2GB0 A;  4FK1 C;  4U8P A;  3S61 A;  2Q0K A;  2O9Z A;  1KNR A;  4JY3 A;  3SM8 A;  2XLT A;  4B64 A;  1W4X A;  5J60 A;  1IUU A;  1D7L A;  2XFP A;  4C74 A;  4MJW A;  2PYX A;  4YSZ A;  4J31 A;  3C96 A;  4H2R A;  1E1N A;  1N4U A;  5HHF A;  4A7A A;  1GV4 A;  3RNM A;  1DNC A;  2V3B A;  1PXB A;  2WS3 A;  2VRL A;  2WPF A;  3ADA B;  1O94 A;  3GD3 A;  3DA1 A;  3LB8 A;  5U63 A;  2C66 A;  3AEB A;  2C3C A;  1PJ7 A;  3AE7 A;  4J57 A;  3AXB A;  4EQR A;  2BS3 A;  1K4Q A;  3RP6 A;  3FBS A;  3UOV A;  2GF3 A;  3GWD A;  4AT2 A;  2WDR A;  2A8X A;  1OJC A;  4CNK A;  4WCT A;  1IUX A;  2BK5 A;  5TR3 A;  1ZMC A;  3CN8 A;  3DGZ A;  4X4J A;  4YSY A;  5KOW A;  4JDR A;  3NIX A;  2B9X A;  1LQT A;  5ER0 A;  1Q1W A;  3VR9 A;  3SFE A;  4U8O A;  1S3B A;  3CNS A;  1PJ6 A;  3HZL A;  3UKK A;  4OPC A;  2XFN A;  5KRQ A;  2R0G A;  1UKV G;  4JNQ A;  4U8N A;  4A65 A;  1D5T A;  1GES A;  1CC6 A;  3L1R A;  2VZ2 A;  1NG4 A;  4U8L A;  3VQR A;  1M6I A;  3SQP A;  3UP5 A;  1B4V A;  3M0O A;  3CGD A;  2VOU A;  3H8I A;  4K5R A;  4D04 A;  4Z25 A;  2V61 A;  1B37 A;  3AE1 A;  4A79 A;  4AOS A;  2GMJ A;  3AE2 A;  3EAO A;  2GR0 A;  4GUV A;  3NTD A;  1ZK7 A;  4NTC A;  1GEU A;  1P2H A;  3ZYX A;  4EM3 A;  3UTF A;  5HYM A;  2OLN A;  4FK1 A;  4TM0 A;  2BXS A;  2BK4 A;  1GER A;  2R9Z A;  4BV6 A;  4C77 A;  4APN A;  1VG0 A;  3GYJ A;  1TYT A;  5C3J A;  2XVE A;  3GSI A;  4H4T A;  4YSH A;  1QLB A;  3FPZ A;  3AE5 A;  3SGL A;  3GDP A;  1O5W A;  2XDO A;  4BK2 A;  4K5S A;  4D03 A;  2V6O A;  1S3E A;  4EMI A;  4USR A;  3VR8 A;  3F8R A;  4A9W A;  5M10 A;  1N4W A;  1COY A;  3UTH A;  3GMB A;  2TMD A;  2RAB A;  1TDK A;  2GAG B;  1PN0 A;  3NN6 X;  1H7W A;  2A89 A;  4I59 A;  4YKG A;  4YT0 A;  4WX1 A;  3RHA A;  4LU6 A;  4XWZ A;  3UKP A;  4U8K A;  1D7Y A;  1L9C A;  4O5U A;  4H2Q A;  4XXG A;  4B67 A;  4JNA A;  3CGB A;  1GTH A;  4GDP A;  3AYI A;  3QSM A;  4PAB A;  3ABV A;  4YSX A;  4A6N B;  5GRT A;  2ZZB A;  4JY2 A;  2TPR A;  2GRT A;  4BK3 A;  4REK A;  1H6V A;  3NYC A;  1TYP A;  2XFU A;  1F8W A;  3UKF A;  1H84 A;  4LA1 A;  4EMJ A;  2WQY A;  2F5Z A;  2R4J A;  5CKU A;  1Y0P A;  3BHF A;  2YLX A;  3KLJ A;  2EQ6 A;  2WET A;  3ISH A;  4K7Z A;  4BK1 A;  1GRE A;  4B1B A;  4H4W A;  3K7T A;  1BWC A;  1LTX R;  1JRX A;  3UKA A;  1EL5 A;  2BCG G;  1NAA A;  3C4A A;  2JB1 A;  4XWR A;  4YTN A;  5C2T A;  2X8G A;  1DOB A;  2OAM A;  4U2T A;  4B66 A;  4U8I A;  1GRB A;  1BKW A;  2QA1 A;  3ICR A;  3Q9T A;  4UDP A;  3M13 A;  2QCU A;  2WOV A;  2FBW A;  2YQU A;  4OPI A;  1FOH A;  1N1P A;  1NHR A;  2B7R A;  3GMC A;  2JKC A;  4NZH A;  5EB5 A;  4EQS A;  3AYL A;  2A87 A;  1JU2 A;  2E4G A;  2WEU A;  3F8D A;  3ALJ A;  1F6M A;  2BK3 A;  1SEZ A;  4Z2R A;  2YR5 A;  3ICS A;  1S2Q A;  2RGH A;  3AE6 A;  3PVC A;  4Z24 A;  1PBB A;  5CQF A;  2C64 A;  1Q1R A;  2VQ7 A;  3I3L A;  2ZZC A;  1NHQ A;  4CCR A;  2R46 A;  3GRT A;  4EIP A;  1Q9I A;  1KSU A;  1BZL A;  3M12 A;  4H4X A;  4OVI A;  2C67 A;  1BGN A;  1TDF A;  2X50 A;  4TLX A;  1H83 A;  5JCK A;  3B3R A;  2RGO A;  1V59 A;  2WP9 A;  1IJH A;  2AQJ A;  2BS4 A;  4NEW A;  4CBQ A;  3LZW A;  4H4P A;  4NTE A;  3R9U A;  4ADW A;  2YLR A;  2NVK X;  2XVJ A;  2YVJ A;  5JCN A;  1Z6L A;  2VRM A;  2XCG A;  4HA6 A;  4ZCC A;  2CUL A;  3BNU A;  1K0L A;  4B69 A;  2X8H A;  3Q6J A;  3II4 A;  3KU9 A;  3ATR A;  4H50 A;  2GR1 A;  5L46 A;  2GQF A;  2E1M A;  1MOK A;  4PAA A;  1GET A;  1YQ3 A;  1FEB A;  4X9M A;  2YG6 A;  4FDC B;  5FS7 A;  1ONF A;  1GT8 A;  2Z5X A;  1MO9 A;  1E7P A;  2IVE A;  4TM4 A;  5FS8 A;  3LOV A;  4RG4 A;  3NGC X;  5JCI A;  1GTE A;  2E5V A;  2I0Z A;  3BI2 A;  1K0J A;  1JOA A;  3DJG X;  3IC9 A;  1KNP A;  4OPT A;  4NTD A;  3UOX A;  3VRB A;  2BCP A;  2GH5 A;  2XLS A;  2Q0L A;  3IHG A;  3AEG A;  1IUS A;  5KVI A;  4J33 A;  3AB1 A;  1KDG A;  4X9N A;  4J2W A;  1EL7 A;  1JEH A;  2XVI A;  1L9E A;  2XFQ A;  4DNA A;  1Y56 A;  3IF9 A;  4H4Q A;  1GND A;  1XPQ A;  2FJD A;  3QFA A;  4H7U A;  1NHS A;  4J36 A;  4USQ A;  4Z44 A;  3DGH A;  3DK4 A;  3T37 A;  4EM4 A;  3BHK A;  1DJN A;  2BC1 A;  2XLP A;  1NG3 A;  2WPE A;  1H86 A;  4B63 A;  1XDI A;  4YTP A;  1JNZ A;  1H81 A;  5BUL A;  2BYB A;  4EQW A;  1OJD A;  2HQM A;  1CHU A;  3NYE A;  4TM3 A;  3UOZ A;  1NHP A;  4H4V A;  3UKL A;  2YLZ A;  3ALL A;  4Z43 A;  4P9S A;  5IQ4 A;  1QJD A;  5EBK A;  1B8S A;  2ARD A;  3DME A;  1ZMD A;  1IUW A;  2C7G A;  1VQW A;  3COX A;  1ZX9 A;  2CVJ A;  3G5S A;  3LJP A;  3NKS A;  3AEC A;  2IVD A;  4Y4L A;  1BGJ A;  5GSN A;  2BAC A;  3VRA A;  3AEF A;  3NYF A;  5KVH A;  2YG5 A;  2CFY A;  2R4E A;  1VRQ B;  4Z2T A;  2VVL G;  1IUT A;  2GR2 A;  1GXF A;  2XLR A;  3CNP A;  3EPT A;  1F8R A;  1NEK A;  4C5O A;  4ICY A;  3KA7 A;  3KPF A;  1NEN A;  4A99 A;  1HYU A;  2WBA A;  4UDR A;  2YR4 A;  3DJD A;  4K2X A;  5U1O A;  3I6D A;  4H4Z A;  1KFY A;  4OPG A;  3DK8 A;  3BI5 A;  3CTY A;  3FIM B;  3S5W A;  5BVA A;  1FEA A;  2Y6R A;  1OJA A;  1EL8 A;  1MXT A;  2RGJ A;  3K7M X;  2ACZ A;  1FCD A;  5KOX A;  2R45 A;  3LAD A;  1LJ1 A;  3QJ4 A;  2YG4 A;  2EQ7 A;  2H88 A;  2UZZ A;  4HB9 A;  2APG A;  3URH A;  1FEC A;  1PXC A;  1DOE A;  2WDQ A;  2FJA A;  3KKJ A;  3UTG A;  2OA1 A;  2WES A;  4JQ9 A;  2YG7 A;  2BAB A;  3CNJ A;  1QO8 A;  4GDE A;  4OCG A;  3L8K A;  2GMH A;  3D8X A;  5EOW A;  2WP5 A;  1H82 A;  1B5Q A;  2J3N A;  3BI4 A;  1GSN A;  2YVF A;  5BUK A;  1S2Y A;  3NN0 X;  1GPE A;  2B76 A;  3CGE A;  2XFO A;  2XYO A;  1PBF A;  2WOW A;  1DOC A;  3LXD A;  2IID A;  5JCL A;  3ZDN A;  1LQU A;  1X31 B;  1PS9 A;  3QVR A;  2YLW A;  3GWF A;  3AE9 A;  3LZX A;  5IPY A;  4LII A;  4M52 A;  4UDQ A;  4RSL A;  3AD7 B;  2NPX A;  3UCL A;  4AOX A;  3NG7 X;  1CJ2 A;  2V3A A;  3PS9 A;  3ITJ A;  3NT6 A;  1P2E A;  1CL0 A;  1D4C A;  3V3N A;  2Q7V A;  4GF7 A;  3RED A;  1JRY A;  1PBD A;  2YG3 A;  3ICT A;  1E1L A;  2JK6 A;  1VG9 A;  3CIR A;  4H2N A;  4IVO B;  3VRD B;  2R0C A;  2W0H A;  3IWA A;  2QA2 A;  2JAE A;  3P4R A;  4TLZ A;  4Y4N A;  2JB2 A;  3CPJ G;  4U2S A;  2VQB A;  1ZP0 A;  2YLS A;  3OC4 A;  3QVP A;  3GYI A;  3QSE A;  4OPU A;  5FS6 A;  3PO7 A;  5HXI A;  3DJE A;  1YQ4 A;  2YM1 A;  3P4P A;  1RP0 A;  4A5L A;  5KXJ A;  2Y6Q A;  1TDN A;  1RSG A;  1ZKQ A;  1O95 A;  4O5Q A;  2C65 A;  1GRG A;  2C76 A;  2BXR A;  5J7X A;  2GEW A;  1YKJ A;  4U2L A;  3CGC A;  3AEA A;  3K30 A;  4ZN0 A;  4Z26 A;  1CJ3 A;  1H7X A;  2DKH A;  1RYI A;  2VVM A;  2XVH A;  1CF3 A;  3NH3 X;  4A6N A;  2CDU A;  4CY6 A;  1PBC A;  1DXL A;  1JRZ A;  4YTM A;  1GRA A;  3AWI A;  2C70 A;  2C73 A;  2C72 A;  3AYJ A;  1DJQ A;  4C3Y A;  2C75 A;  2DKI A;  3QSS A;  1ZOY A;  2GAH B;  2XLU A;  2YWL A;  4H4U A;  2YR6 A;  1PHH A;  2WOI A;  4BUR A;  4EQX A;  1REO A;  4U8M A;  3V3O A;  2WU5 A;  1CJC A;  1NPX A;  4AP1 A;  3P1W A;  4H2P A;  3NK2 X;  3D1C A;  4UP3 A;  3CNT A;  5HY5 A;  4ECH A;  1GAL A;  1D4D A;  4N9X A;  4GCM A;  3O0H A;  2WU2 A;  3BNM A;  4GR1 A;  1TDO A;  1TRB A;  3B6D A;  3G5Q A;  2ZBW A;  5BRT A;  4GRT A;  1E1M A;  1TDE A;  4CNJ A;  1OJ9 A;  1CJ4 A;  2YM2 A;  2EQ8 A;  5FS9 A;  2B7S A;  4K8D A;  3E1T A;  4OPL A;  3CND A;  3F8P A;  3AD9 B;  3RP7 A;  1VDC A;  1NDA A;  1N4V A;  4CCQ A;  3QFB A;  4RG3 A;  3OZ2 A;  3KD9 A;  1PXA A;  4B68 A;  3G5R A;  1EBD A;  3NNE A;  1KF6 A;  1PBE A;  2WHD A;  2GQW A;  2FJB A;  1LVL A;  2PHH A;  4AT0 A;  3DK9 A;  3NTA A;  1EL9 A;  1OJT A;  3DJJ A;  4DSH A;  1CBO A;  1PDH A;  2BS2 A;  3AEE A;  3NK0 X;  2OLO A;  1E39 A;  4I58 A;  4ZCD A;  4TM1 A;  1GOS A;  4KPR A;  1D4E A;  5LV9 A;  3UTE A;  2YLT A;  5U25 A;  3H8L A;  3NK1 X;  4FX9 A;  4J34 A;  2WDV A;  5EB4 A;  1YQZ A;  3H4K A;  4KX6 A;  3DH9 A;  1XHC A;  2BA9 A;  3GRS A;  4K22 A;  1LV0 A;  1Y56 B;  1ZOV A;  2X3N A;  3P9U A;  2GVC A;  1K0I A;  3NRN A;  4EIQ A;  4IV9 A;  4DSG A;  1PJ5 A;  2B9Y A;  2X99 A;  4IVM B;  3C4N A;  4NEV A;  2H89 A;  4U8J A;  3AE3 A;  2OAL A;  3IHM A;  1GRH A;  1ELI A;  4CRT A;  3UKH A;  1ZDL A;  2GR3 A;  3ATQ A;  2JB3 A;  1F3P A;  1CC4 A;  1L9D A;  3EF6 A;  3K7Q X;  4EMW A;  1M64 A;  1IUV A;  1E6E A;  2BC0 A;  2WP6 A;  4IA6 A;  4YKF A;  3UOY A;  3UKQ A;  1L0V A;  1LPF A;  4OPD A;  3AD8 B;  3NLC A;  2V60 A;  4IA5 A;  1GRT A;  5DBJ A;  4B65 A;  3GD4 A;  4JN9 A;  3AE4 A;  5M0Z A;  3AED A;  4E0V A;  3FG2 P;  2AR8 A;  3WE0 A; 
#chains in the Genus database with same CATH topology
 2AAQ A;  2Z5Y A;  4Z2U A;  1FL2 A;  2GV8 A;  4J56 A;  4II2 A;  3P4Q A;  4H4S A;  1JNR A;  1YY5 A;  4C3X A;  1ZY8 A;  3CPH G;  3RP8 A;  4Y4M A;  5FMH A;  3FMW A;  1GRF A;  4BJZ A;  1E1K A;  2C3D A;  4H4R A;  2YAU A;  1AOG A;  3CPI G;  3EAN A;  3P4S A;  3HYX A;  1XAN A;  3GDN A;  3V76 A;  5JCM A;  4H4Y A;  4BJY A;  2QAE A;  2V5Z A;  2ZZ0 A;  3JSK A;  2WPC A;  5KMQ A;  1F8S A;  3ALM A;  2X8C A;  1DOD A;  3SFD A;  4DGK A;  4CY8 A;  5KWF A;  4YXD A;  3AE8 A;  5KNL A;  2R0P A;  2XVF A;  2YVG A;  2JBV A;  2VVL A;  2EQ9 A;  2FJE A;  3UP4 A;  5IQ1 A;  2B9W A;  3KVE A;  2Q6U A;  3NHO X;  4YWO A;  4AP3 A;  1CC2 A;  1BF3 A;  1KSS A;  2GB0 A;  4FK1 C;  4U8P A;  3S61 A;  2Q0K A;  2O9Z A;  1KNR A;  4JY3 A;  3SM8 A;  2XLT A;  4B64 A;  1W4X A;  5J60 A;  1IUU A;  1D7L A;  4G6G A;  2XFP A;  4C74 A;  4MJW A;  2PYX A;  4YSZ A;  4J31 A;  3C96 A;  4H2R A;  1E1N A;  1N4U A;  5HHF A;  4A7A A;  1GV4 A;  3RNM A;  1DNC A;  2V3B A;  1PXB A;  2WS3 A;  2VRL A;  2WPF A;  3ADA B;  1O94 A;  3GD3 A;  3DA1 A;  3LB8 A;  5U63 A;  2C66 A;  3AEB A;  2C3C A;  1PJ7 A;  3AE7 A;  3T0K A;  4J57 A;  4NWZ A;  3AXB A;  3T2Y A;  4EQR A;  2BS3 A;  1K4Q A;  3RP6 A;  3FBS A;  2BRA A;  2GF3 A;  3UOV A;  3GWD A;  4AT2 A;  2WDR A;  2A8X A;  1OJC A;  4CNK A;  4WCT A;  1IUX A;  2BK5 A;  5TR3 A;  1ZMC A;  3CN8 A;  3DGZ A;  4X4J A;  4YSY A;  5KOW A;  4JDR A;  3NIX A;  2B9X A;  1LQT A;  5ER0 A;  1Q1W A;  3VR9 A;  3SFE A;  4U8O A;  1S3B A;  3CNS A;  1PJ6 A;  3HZL A;  3UKK A;  4OPC A;  2XFN A;  5KRQ A;  2R0G A;  1UKV G;  4JNQ A;  4U8N A;  4A65 A;  1D5T A;  1GES A;  1CC6 A;  3L1R A;  2VZ2 A;  1NG4 A;  4U8L A;  3VQR A;  1M6I A;  3SQP A;  3UP5 A;  1B4V A;  3M0O A;  3CGD A;  2VOU A;  3H8I A;  4K5R A;  4D04 A;  4Z25 A;  2V61 A;  1B37 A;  3AE1 A;  4A79 A;  4AOS A;  2GMJ A;  3AE2 A;  3EAO A;  2GR0 A;  4GUV A;  3NTD A;  1ZK7 A;  4NTC A;  1GEU A;  1P2H A;  3ZYX A;  4EM3 A;  3UTF A;  5HYM A;  2OLN A;  4FK1 A;  4TM0 A;  2BXS A;  2BK4 A;  1GER A;  2R9Z A;  4BV6 A;  4C77 A;  4APN A;  1VG0 A;  3GYJ A;  1TYT A;  5C3J A;  2XVE A;  3GSI A;  4H4T A;  4YSH A;  1QLB A;  3FPZ A;  4G6H A;  3AE5 A;  3SGL A;  3GDP A;  1O5W A;  2XDO A;  4BK2 A;  4K5S A;  4D03 A;  2V6O A;  1S3E A;  4EMI A;  4USR A;  3VR8 A;  3F8R A;  4A9W A;  5M10 A;  1N4W A;  1COY A;  3UTH A;  3GMB A;  2TMD A;  2RAB A;  2BRY A;  1TDK A;  2GAG B;  1PN0 A;  3NN6 X;  1H7W A;  2A89 A;  4I59 A;  4YKG A;  4YT0 A;  4WX1 A;  3RHA A;  4LU6 A;  4XWZ A;  3UKP A;  4U8K A;  1D7Y A;  1L9C A;  4O5U A;  4H2Q A;  4XXG A;  4B67 A;  4JNA A;  3CGB A;  1GTH A;  4GDP A;  3AYI A;  3QSM A;  4PAB A;  3ABV A;  4YSX A;  4A6N B;  5GRT A;  2ZZB A;  4JY2 A;  2TPR A;  2GRT A;  4BK3 A;  4REK A;  1H6V A;  3NYC A;  1TYP A;  2XFU A;  1F8W A;  3UKF A;  1H84 A;  4LA1 A;  4EMJ A;  2WQY A;  2F5Z A;  2R4J A;  5CKU A;  1Y0P A;  3BHF A;  2YLX A;  3HYV A;  2EQ6 A;  2WET A;  3ISH A;  3KLJ A;  4K7Z A;  4BK1 A;  1GRE A;  4B1B A;  4H4W A;  3K7T A;  1BWC A;  1LTX R;  1JRX A;  3UKA A;  1EL5 A;  2BCG G;  1NAA A;  3C4A A;  2JB1 A;  4XWR A;  4YTN A;  5C2T A;  2X8G A;  1DOB A;  2OAM A;  4U2T A;  4B66 A;  4U8I A;  3T2Z A;  1GRB A;  1BKW A;  2QA1 A;  3ICR A;  3Q9T A;  4UDP A;  3M13 A;  2QCU A;  2WOV A;  2FBW A;  2YQU A;  4OPI A;  1FOH A;  1N1P A;  1NHR A;  2B7R A;  3GMC A;  2JKC A;  3GYX A;  4NZH A;  5EB5 A;  3AYL A;  3T2K A;  4EQS A;  2A87 A;  1JU2 A;  2E4G A;  2WEU A;  3F8D A;  3ALJ A;  1F6M A;  2BK3 A;  1SEZ A;  4Z2R A;  2YR5 A;  3ICS A;  1S2Q A;  2RGH A;  3AE6 A;  3PVC A;  4GAV A;  1PBB A;  4Z24 A;  5CQF A;  2C64 A;  1Q1R A;  2VQ7 A;  3I3L A;  2ZZC A;  1NHQ A;  4CCR A;  2R46 A;  3GRT A;  4EIP A;  1Q9I A;  1KSU A;  1BZL A;  3M12 A;  4H4X A;  4OVI A;  2C67 A;  1BGN A;  1TDF A;  2X50 A;  4TLX A;  1H83 A;  5JCK A;  4II3 A;  3B3R A;  2RGO A;  1V59 A;  2WP9 A;  1IJH A;  2AQJ A;  2BS4 A;  4NEW A;  4CBQ A;  3LZW A;  4H4P A;  4NTE A;  3R9U A;  4ADW A;  3SZF A;  2YLR A;  2NVK X;  2XVJ A;  2YVJ A;  5JCN A;  1Z6L A;  2VRM A;  2XCG A;  4HA6 A;  4ZCC A;  2CUL A;  3BNU A;  1K0L A;  4B69 A;  2X8H A;  3Q6J A;  3II4 A;  3KU9 A;  3ATR A;  4H50 A;  2GR1 A;  5L46 A;  2GQF A;  2E1M A;  1MOK A;  4PAA A;  3T14 A;  1GET A;  1YQ3 A;  1FEB A;  4X9M A;  2YG6 A;  2C4C A;  4FDC B;  5FS7 A;  1ONF A;  1GT8 A;  2Z5X A;  1MO9 A;  1E7P A;  2IVE A;  4TM4 A;  5FS8 A;  3LOV A;  4RG4 A;  3NGC X;  5JCI A;  1GTE A;  2E5V A;  2I0Z A;  3BI2 A;  1K0J A;  1JOA A;  3DJG X;  3IC9 A;  1KNP A;  4OPT A;  4NTD A;  3UOX A;  3VRB A;  5KMR A;  2BCP A;  2GH5 A;  2XLS A;  2Q0L A;  3IHG A;  3AEG A;  1IUS A;  5KVI A;  4J33 A;  3AB1 A;  1KDG A;  4X9N A;  4J2W A;  1EL7 A;  1JEH A;  2XVI A;  1L9E A;  2XFQ A;  4NNJ A;  4DNA A;  1Y56 A;  3IF9 A;  4H4Q A;  1GND A;  1XPQ A;  2FJD A;  3QFA A;  4H7U A;  1NHS A;  4J36 A;  4USQ A;  4Z44 A;  3DGH A;  3DK4 A;  3T37 A;  4EM4 A;  3BHK A;  1DJN A;  2BC1 A;  2XLP A;  1NG3 A;  2WPE A;  1H86 A;  4B63 A;  1XDI A;  4YTP A;  1JNZ A;  1H81 A;  5BUL A;  2BYB A;  4EQW A;  1OJD A;  2HQM A;  1CHU A;  3NYE A;  4TM3 A;  3UOZ A;  1NHP A;  4H4V A;  3UKL A;  2YLZ A;  3ALL A;  4Z43 A;  4P9S A;  5IQ4 A;  1QJD A;  5EBK A;  1B8S A;  2ARD A;  3DME A;  1ZMD A;  1IUW A;  2C7G A;  1VQW A;  3COX A;  1ZX9 A;  2CVJ A;  3G5S A;  3LJP A;  3NKS A;  3AEC A;  2IVD A;  4Y4L A;  3SXI A;  1BGJ A;  5GSN A;  2BAC A;  3VRA A;  3AEF A;  3NYF A;  5KVH A;  2YG5 A;  2CFY A;  2R4E A;  1VRQ B;  4Z2T A;  2VVL G;  1IUT A;  2GR2 A;  1GXF A;  2XLR A;  3CNP A;  3EPT A;  1F8R A;  1NEK A;  4C5O A;  4ICY A;  3KA7 A;  3KPF A;  1NEN A;  4A99 A;  1HYU A;  2WBA A;  4UDR A;  2YR4 A;  3DJD A;  4K2X A;  5U1O A;  3I6D A;  4H4Z A;  1KFY A;  4OPG A;  3DK8 A;  3BI5 A;  3CTY A;  3FIM B;  3S5W A;  5BVA A;  1FEA A;  2Y6R A;  1OJA A;  1EL8 A;  1MXT A;  2RGJ A;  3K7M X;  2ACZ A;  1FCD A;  5KOX A;  2R45 A;  3LAD A;  1LJ1 A;  3QJ4 A;  2YG4 A;  2EQ7 A;  2H88 A;  2UZZ A;  4HB9 A;  2APG A;  3URH A;  1FEC A;  1PXC A;  1DOE A;  2WDQ A;  2FJA A;  3SZ0 A;  3KKJ A;  3UTG A;  2OA1 A;  2WES A;  4JQ9 A;  2YG7 A;  2BAB A;  3CNJ A;  1QO8 A;  4GDE A;  4OCG A;  3L8K A;  2GMH A;  3D8X A;  5EOW A;  2WP5 A;  1H82 A;  1B5Q A;  2J3N A;  3BI4 A;  1GSN A;  2YVF A;  5BUK A;  1S2Y A;  3NN0 X;  1GPE A;  2B76 A;  3CGE A;  2XFO A;  2XYO A;  1PBF A;  2WOW A;  1DOC A;  3LXD A;  2IID A;  5JCL A;  3ZDN A;  1LQU A;  1X31 B;  3SZW A;  1PS9 A;  3QVR A;  2YLW A;  3GWF A;  3AE9 A;  3LZX A;  5IPY A;  4LII A;  4M52 A;  4G73 A;  4UDQ A;  4RSL A;  3AD7 B;  2NPX A;  3UCL A;  4AOX A;  3NG7 X;  1CJ2 A;  2V3A A;  3PS9 A;  3ITJ A;  3NT6 A;  1P2E A;  1CL0 A;  1D4C A;  3V3N A;  2Q7V A;  4GF7 A;  3RED A;  1JRY A;  1PBD A;  2YG3 A;  3ICT A;  1E1L A;  2JK6 A;  1VG9 A;  3CIR A;  4H2N A;  4IVO B;  3VRD B;  2R0C A;  2W0H A;  3IWA A;  2QA2 A;  2JAE A;  3P4R A;  4TLZ A;  4Y4N A;  2JB2 A;  4G9K A;  3CPJ G;  4U2S A;  2VQB A;  1ZP0 A;  2YLS A;  3OC4 A;  3HYW A;  3GYI A;  3QSE A;  3QVP A;  4OPU A;  5FS6 A;  3PO7 A;  5HXI A;  3DJE A;  1YQ4 A;  2YM1 A;  3P4P A;  1RP0 A;  4A5L A;  5KXJ A;  2Y6Q A;  1TDN A;  1RSG A;  1ZKQ A;  1O95 A;  4O5Q A;  2C65 A;  1GRG A;  2C76 A;  2BXR A;  5J7X A;  2GEW A;  1YKJ A;  4U2L A;  3CGC A;  3AEA A;  3K30 A;  4G74 A;  4ZN0 A;  4Z26 A;  3T31 A;  3SZC A;  1CJ3 A;  1H7X A;  2DKH A;  1RYI A;  2VVM A;  2XVH A;  1CF3 A;  3NH3 X;  4A6N A;  2CDU A;  4CY6 A;  1PBC A;  1DXL A;  1JRZ A;  4YTM A;  1GRA A;  3AWI A;  2C70 A;  2C73 A;  2C72 A;  3AYJ A;  1DJQ A;  4C3Y A;  2C75 A;  2DKI A;  3QSS A;  1ZOY A;  2GAH B;  2XLU A;  2YWL A;  4H4U A;  2YR6 A;  1PHH A;  2WOI A;  4BUR A;  3CMM A;  4EQX A;  1REO A;  4U8M A;  3V3O A;  2WU5 A;  1CJC A;  1NPX A;  4AP1 A;  3P1W A;  4H2P A;  3NK2 X;  3D1C A;  4UP3 A;  3CNT A;  5HY5 A;  4ECH A;  1GAL A;  1D4D A;  4N9X A;  4GCM A;  3O0H A;  2WU2 A;  3BNM A;  4GR1 A;  1TDO A;  3KPK A;  1TRB A;  3B6D A;  3G5Q A;  2ZBW A;  5BRT A;  4GRT A;  1E1M A;  1TDE A;  4CNJ A;  1OJ9 A;  1CJ4 A;  2YM2 A;  2EQ8 A;  5FS9 A;  2B7S A;  4K8D A;  3E1T A;  4OPL A;  3CND A;  3F8P A;  3AD9 B;  3RP7 A;  1VDC A;  1NDA A;  1N4V A;  4CCQ A;  3QFB A;  4RG3 A;  3OZ2 A;  3KD9 A;  1PXA A;  4B68 A;  3G5R A;  1EBD A;  3NNE A;  1KF6 A;  1PBE A;  2WHD A;  2GQW A;  2FJB A;  1LVL A;  2PHH A;  4AT0 A;  3DK9 A;  3NTA A;  1EL9 A;  1OJT A;  3DJJ A;  4DSH A;  3SY4 A;  1CBO A;  1PDH A;  2BS2 A;  3AEE A;  3NK0 X;  2OLO A;  1E39 A;  4I58 A;  4ZCD A;  4TM1 A;  1GOS A;  4GAP A;  4KPR A;  1D4E A;  5LV9 A;  3UTE A;  2YLT A;  5U25 A;  3H8L A;  3NK1 X;  4FX9 A;  4J34 A;  2WDV A;  5EB4 A;  1YQZ A;  3H4K A;  4KX6 A;  3DH9 A;  1XHC A;  2BA9 A;  3GRS A;  4K22 A;  1LV0 A;  1Y56 B;  1ZOV A;  2X3N A;  3P9U A;  2GVC A;  1K0I A;  3NRN A;  4EIQ A;  4IV9 A;  4DSG A;  1PJ5 A;  2B9Y A;  2X99 A;  4IVM B;  3C4N A;  3SX6 A;  4NEV A;  2H89 A;  4U8J A;  3AE3 A;  2OAL A;  3IHM A;  1GRH A;  1ELI A;  4CRT A;  3UKH A;  1ZDL A;  2GR3 A;  3ATQ A;  2JB3 A;  3SYI A;  5KMP A;  5KMS A;  1F3P A;  1CC4 A;  1L9D A;  3EF6 A;  3K7Q X;  4EMW A;  1M64 A;  1IUV A;  1E6E A;  2BC0 A;  2WP6 A;  4IA6 A;  4YKF A;  3UOY A;  3UKQ A;  1L0V A;  1LPF A;  4OPD A;  3AD8 B;  3NLC A;  2V60 A;  4IA5 A;  1GRT A;  5DBJ A;  4B65 A;  3GD4 A;  4JN9 A;  3AE4 A;  5M0Z A;  3AED A;  4E0V A;  3FG2 P;  2AR8 A;  3WE0 A; 
#chains in the Genus database with same CATH homology
 2AAQ A;  2Z5Y A;  4Z2U A;  1FL2 A;  2GV8 A;  4J56 A;  4II2 A;  3P4Q A;  4H4S A;  1JNR A;  1YY5 A;  4C3X A;  1ZY8 A;  3CPH G;  3RP8 A;  4Y4M A;  5FMH A;  3FMW A;  1GRF A;  4BJZ A;  1E1K A;  2C3D A;  4H4R A;  2YAU A;  1AOG A;  3CPI G;  3EAN A;  3P4S A;  3HYX A;  1XAN A;  3GDN A;  3V76 A;  5JCM A;  4H4Y A;  4BJY A;  2QAE A;  2V5Z A;  2ZZ0 A;  3JSK A;  2WPC A;  5KMQ A;  1F8S A;  3ALM A;  2X8C A;  1DOD A;  3SFD A;  4DGK A;  4CY8 A;  5KWF A;  4YXD A;  3AE8 A;  5KNL A;  2R0P A;  2XVF A;  2YVG A;  2JBV A;  2VVL A;  2EQ9 A;  2FJE A;  3UP4 A;  5IQ1 A;  2B9W A;  3KVE A;  2Q6U A;  3NHO X;  4YWO A;  4AP3 A;  1CC2 A;  1BF3 A;  1KSS A;  2GB0 A;  4FK1 C;  4U8P A;  3S61 A;  2Q0K A;  2O9Z A;  1KNR A;  4JY3 A;  3SM8 A;  2XLT A;  4B64 A;  1W4X A;  5J60 A;  1IUU A;  1D7L A;  4G6G A;  2XFP A;  4C74 A;  4MJW A;  2PYX A;  4YSZ A;  4J31 A;  3C96 A;  4H2R A;  1E1N A;  1N4U A;  5HHF A;  4A7A A;  1GV4 A;  3RNM A;  1DNC A;  2V3B A;  1PXB A;  2WS3 A;  2VRL A;  2WPF A;  3ADA B;  1O94 A;  3GD3 A;  3DA1 A;  3LB8 A;  5U63 A;  2C66 A;  3AEB A;  2C3C A;  1PJ7 A;  3AE7 A;  3T0K A;  4J57 A;  4NWZ A;  3AXB A;  3T2Y A;  4EQR A;  2BS3 A;  1K4Q A;  3RP6 A;  3FBS A;  2BRA A;  2GF3 A;  3UOV A;  3GWD A;  4AT2 A;  2WDR A;  2A8X A;  1OJC A;  4CNK A;  4WCT A;  1IUX A;  2BK5 A;  5TR3 A;  1ZMC A;  3CN8 A;  3DGZ A;  4X4J A;  4YSY A;  5KOW A;  4JDR A;  3NIX A;  2B9X A;  1LQT A;  5ER0 A;  1Q1W A;  3VR9 A;  3SFE A;  4U8O A;  1S3B A;  3CNS A;  1PJ6 A;  3HZL A;  3UKK A;  4OPC A;  2XFN A;  5KRQ A;  2R0G A;  1UKV G;  4JNQ A;  4U8N A;  4A65 A;  1D5T A;  1GES A;  1CC6 A;  3L1R A;  2VZ2 A;  1NG4 A;  4U8L A;  3VQR A;  1M6I A;  3SQP A;  3UP5 A;  1B4V A;  3M0O A;  3CGD A;  2VOU A;  3H8I A;  4K5R A;  4D04 A;  4Z25 A;  2V61 A;  1B37 A;  3AE1 A;  4A79 A;  4AOS A;  2GMJ A;  3AE2 A;  3EAO A;  2GR0 A;  4GUV A;  3NTD A;  1ZK7 A;  4NTC A;  1GEU A;  1P2H A;  3ZYX A;  4EM3 A;  3UTF A;  5HYM A;  2OLN A;  4FK1 A;  4TM0 A;  2BXS A;  2BK4 A;  1GER A;  2R9Z A;  4BV6 A;  4C77 A;  4APN A;  1VG0 A;  3GYJ A;  1TYT A;  5C3J A;  2XVE A;  3GSI A;  4H4T A;  4YSH A;  1QLB A;  3FPZ A;  4G6H A;  3AE5 A;  3SGL A;  3GDP A;  1O5W A;  2XDO A;  4BK2 A;  4K5S A;  4D03 A;  2V6O A;  1S3E A;  4EMI A;  4USR A;  3VR8 A;  3F8R A;  4A9W A;  5M10 A;  1N4W A;  1COY A;  3UTH A;  3GMB A;  2TMD A;  2RAB A;  2BRY A;  1TDK A;  2GAG B;  1PN0 A;  3NN6 X;  1H7W A;  2A89 A;  4I59 A;  4YKG A;  4YT0 A;  4WX1 A;  3RHA A;  4LU6 A;  4XWZ A;  3UKP A;  4U8K A;  1D7Y A;  1L9C A;  4O5U A;  4H2Q A;  4XXG A;  4B67 A;  4JNA A;  3CGB A;  1GTH A;  4GDP A;  3AYI A;  3QSM A;  4PAB A;  3ABV A;  4YSX A;  4A6N B;  5GRT A;  2ZZB A;  4JY2 A;  2TPR A;  2GRT A;  4BK3 A;  4REK A;  1H6V A;  3NYC A;  1TYP A;  2XFU A;  1F8W A;  3UKF A;  1H84 A;  4LA1 A;  4EMJ A;  2WQY A;  2F5Z A;  2R4J A;  5CKU A;  1Y0P A;  3BHF A;  2YLX A;  3HYV A;  2EQ6 A;  2WET A;  3ISH A;  3KLJ A;  4K7Z A;  4BK1 A;  1GRE A;  4B1B A;  4H4W A;  3K7T A;  1BWC A;  1LTX R;  1JRX A;  3UKA A;  1EL5 A;  2BCG G;  1NAA A;  3C4A A;  2JB1 A;  4XWR A;  4YTN A;  5C2T A;  2X8G A;  1DOB A;  2OAM A;  4U2T A;  4B66 A;  4U8I A;  3T2Z A;  1GRB A;  1BKW A;  2QA1 A;  3ICR A;  3Q9T A;  4UDP A;  3M13 A;  2QCU A;  2WOV A;  2FBW A;  2YQU A;  4OPI A;  1FOH A;  1N1P A;  1NHR A;  2B7R A;  3GMC A;  2JKC A;  3GYX A;  4NZH A;  5EB5 A;  3AYL A;  3T2K A;  4EQS A;  2A87 A;  1JU2 A;  2E4G A;  2WEU A;  3F8D A;  3ALJ A;  1F6M A;  2BK3 A;  1SEZ A;  4Z2R A;  2YR5 A;  3ICS A;  1S2Q A;  2RGH A;  3AE6 A;  3PVC A;  4GAV A;  1PBB A;  4Z24 A;  5CQF A;  2C64 A;  1Q1R A;  2VQ7 A;  3I3L A;  2ZZC A;  1NHQ A;  4CCR A;  2R46 A;  3GRT A;  4EIP A;  1Q9I A;  1KSU A;  1BZL A;  3M12 A;  4H4X A;  4OVI A;  2C67 A;  1BGN A;  1TDF A;  2X50 A;  4TLX A;  1H83 A;  5JCK A;  4II3 A;  3B3R A;  2RGO A;  1V59 A;  2WP9 A;  1IJH A;  2AQJ A;  2BS4 A;  4NEW A;  4CBQ A;  3LZW A;  4H4P A;  4NTE A;  3R9U A;  4ADW A;  3SZF A;  2YLR A;  2NVK X;  2XVJ A;  2YVJ A;  5JCN A;  1Z6L A;  2VRM A;  2XCG A;  4HA6 A;  4ZCC A;  2CUL A;  3BNU A;  1K0L A;  4B69 A;  2X8H A;  3Q6J A;  3II4 A;  3KU9 A;  3ATR A;  4H50 A;  2GR1 A;  5L46 A;  2GQF A;  2E1M A;  1MOK A;  4PAA A;  3T14 A;  1GET A;  1YQ3 A;  1FEB A;  4X9M A;  2YG6 A;  2C4C A;  4FDC B;  5FS7 A;  1ONF A;  1GT8 A;  2Z5X A;  1MO9 A;  1E7P A;  2IVE A;  4TM4 A;  5FS8 A;  3LOV A;  4RG4 A;  3NGC X;  5JCI A;  1GTE A;  2E5V A;  2I0Z A;  3BI2 A;  1K0J A;  1JOA A;  3DJG X;  3IC9 A;  1KNP A;  4OPT A;  4NTD A;  3UOX A;  3VRB A;  5KMR A;  2BCP A;  2GH5 A;  2XLS A;  2Q0L A;  3IHG A;  3AEG A;  1IUS A;  5KVI A;  4J33 A;  3AB1 A;  1KDG A;  4X9N A;  4J2W A;  1EL7 A;  1JEH A;  2XVI A;  1L9E A;  2XFQ A;  4NNJ A;  4DNA A;  1Y56 A;  3IF9 A;  4H4Q A;  1GND A;  1XPQ A;  2FJD A;  3QFA A;  4H7U A;  1NHS A;  4J36 A;  4USQ A;  4Z44 A;  3DGH A;  3DK4 A;  3T37 A;  4EM4 A;  3BHK A;  1DJN A;  2BC1 A;  2XLP A;  1NG3 A;  2WPE A;  1H86 A;  4B63 A;  1XDI A;  4YTP A;  1JNZ A;  1H81 A;  5BUL A;  2BYB A;  4EQW A;  1OJD A;  2HQM A;  1CHU A;  3NYE A;  4TM3 A;  3UOZ A;  1NHP A;  4H4V A;  3UKL A;  2YLZ A;  3ALL A;  4Z43 A;  4P9S A;  5IQ4 A;  1QJD A;  5EBK A;  1B8S A;  2ARD A;  3DME A;  1ZMD A;  1IUW A;  2C7G A;  1VQW A;  3COX A;  1ZX9 A;  2CVJ A;  3G5S A;  3LJP A;  3NKS A;  3AEC A;  2IVD A;  4Y4L A;  3SXI A;  1BGJ A;  5GSN A;  2BAC A;  3VRA A;  3AEF A;  3NYF A;  5KVH A;  2YG5 A;  2CFY A;  2R4E A;  1VRQ B;  4Z2T A;  2VVL G;  1IUT A;  2GR2 A;  1GXF A;  2XLR A;  3CNP A;  3EPT A;  1F8R A;  1NEK A;  4C5O A;  4ICY A;  3KA7 A;  3KPF A;  1NEN A;  4A99 A;  1HYU A;  2WBA A;  4UDR A;  2YR4 A;  3DJD A;  4K2X A;  5U1O A;  3I6D A;  4H4Z A;  1KFY A;  4OPG A;  3DK8 A;  3BI5 A;  3CTY A;  3FIM B;  3S5W A;  5BVA A;  1FEA A;  2Y6R A;  1OJA A;  1EL8 A;  1MXT A;  2RGJ A;  3K7M X;  2ACZ A;  1FCD A;  5KOX A;  2R45 A;  3LAD A;  1LJ1 A;  3QJ4 A;  2YG4 A;  2EQ7 A;  2H88 A;  2UZZ A;  4HB9 A;  2APG A;  3URH A;  1FEC A;  1PXC A;  1DOE A;  2WDQ A;  2FJA A;  3SZ0 A;  3KKJ A;  3UTG A;  2OA1 A;  2WES A;  4JQ9 A;  2YG7 A;  2BAB A;  3CNJ A;  1QO8 A;  4GDE A;  4OCG A;  3L8K A;  2GMH A;  3D8X A;  5EOW A;  2WP5 A;  1H82 A;  1B5Q A;  2J3N A;  3BI4 A;  1GSN A;  2YVF A;  5BUK A;  1S2Y A;  3NN0 X;  1GPE A;  2B76 A;  3CGE A;  2XFO A;  2XYO A;  1PBF A;  2WOW A;  1DOC A;  3LXD A;  2IID A;  5JCL A;  3ZDN A;  1LQU A;  1X31 B;  3SZW A;  1PS9 A;  3QVR A;  2YLW A;  3GWF A;  3AE9 A;  3LZX A;  5IPY A;  4LII A;  4M52 A;  4G73 A;  4UDQ A;  4RSL A;  3AD7 B;  2NPX A;  3UCL A;  4AOX A;  3NG7 X;  1CJ2 A;  2V3A A;  3PS9 A;  3ITJ A;  3NT6 A;  1P2E A;  1CL0 A;  1D4C A;  3V3N A;  2Q7V A;  4GF7 A;  3RED A;  1JRY A;  1PBD A;  2YG3 A;  3ICT A;  1E1L A;  2JK6 A;  1VG9 A;  3CIR A;  4H2N A;  4IVO B;  3VRD B;  2R0C A;  2W0H A;  3IWA A;  2QA2 A;  2JAE A;  3P4R A;  4TLZ A;  4Y4N A;  2JB2 A;  4G9K A;  3CPJ G;  4U2S A;  2VQB A;  1ZP0 A;  2YLS A;  3OC4 A;  3HYW A;  3GYI A;  3QSE A;  3QVP A;  4OPU A;  5FS6 A;  3PO7 A;  5HXI A;  3DJE A;  1YQ4 A;  2YM1 A;  3P4P A;  1RP0 A;  4A5L A;  5KXJ A;  2Y6Q A;  1TDN A;  1RSG A;  1ZKQ A;  1O95 A;  4O5Q A;  2C65 A;  1GRG A;  2C76 A;  2BXR A;  5J7X A;  2GEW A;  1YKJ A;  4U2L A;  3CGC A;  3AEA A;  3K30 A;  4G74 A;  4ZN0 A;  4Z26 A;  3T31 A;  3SZC A;  1CJ3 A;  1H7X A;  2DKH A;  1RYI A;  2VVM A;  2XVH A;  1CF3 A;  3NH3 X;  4A6N A;  2CDU A;  4CY6 A;  1PBC A;  1DXL A;  1JRZ A;  4YTM A;  1GRA A;  3AWI A;  2C70 A;  2C73 A;  2C72 A;  3AYJ A;  1DJQ A;  4C3Y A;  2C75 A;  2DKI A;  3QSS A;  1ZOY A;  2GAH B;  2XLU A;  2YWL A;  4H4U A;  2YR6 A;  1PHH A;  2WOI A;  4BUR A;  3CMM A;  4EQX A;  1REO A;  4U8M A;  3V3O A;  2WU5 A;  1CJC A;  1NPX A;  4AP1 A;  3P1W A;  4H2P A;  3NK2 X;  3D1C A;  4UP3 A;  3CNT A;  5HY5 A;  4ECH A;  1GAL A;  1D4D A;  4N9X A;  4GCM A;  3O0H A;  2WU2 A;  3BNM A;  4GR1 A;  1TDO A;  3KPK A;  1TRB A;  3B6D A;  3G5Q A;  2ZBW A;  5BRT A;  4GRT A;  1E1M A;  1TDE A;  4CNJ A;  1OJ9 A;  1CJ4 A;  2YM2 A;  2EQ8 A;  5FS9 A;  2B7S A;  4K8D A;  3E1T A;  4OPL A;  3CND A;  3F8P A;  3AD9 B;  3RP7 A;  1VDC A;  1NDA A;  1N4V A;  4CCQ A;  3QFB A;  4RG3 A;  3OZ2 A;  3KD9 A;  1PXA A;  4B68 A;  3G5R A;  1EBD A;  3NNE A;  1KF6 A;  1PBE A;  2WHD A;  2GQW A;  2FJB A;  1LVL A;  2PHH A;  4AT0 A;  3DK9 A;  3NTA A;  1EL9 A;  1OJT A;  3DJJ A;  4DSH A;  3SY4 A;  1CBO A;  1PDH A;  2BS2 A;  3AEE A;  3NK0 X;  2OLO A;  1E39 A;  4I58 A;  4ZCD A;  4TM1 A;  1GOS A;  4GAP A;  4KPR A;  1D4E A;  5LV9 A;  3UTE A;  2YLT A;  5U25 A;  3H8L A;  3NK1 X;  4FX9 A;  4J34 A;  2WDV A;  5EB4 A;  1YQZ A;  3H4K A;  4KX6 A;  3DH9 A;  1XHC A;  2BA9 A;  3GRS A;  4K22 A;  1LV0 A;  1Y56 B;  1ZOV A;  2X3N A;  3P9U A;  2GVC A;  1K0I A;  3NRN A;  4EIQ A;  4IV9 A;  4DSG A;  1PJ5 A;  2B9Y A;  2X99 A;  4IVM B;  3C4N A;  3SX6 A;  4NEV A;  2H89 A;  4U8J A;  3AE3 A;  2OAL A;  3IHM A;  1GRH A;  1ELI A;  4CRT A;  3UKH A;  1ZDL A;  2GR3 A;  3ATQ A;  2JB3 A;  3SYI A;  5KMP A;  5KMS A;  1F3P A;  1CC4 A;  1L9D A;  3EF6 A;  3K7Q X;  4EMW A;  1M64 A;  1IUV A;  1E6E A;  2BC0 A;  2WP6 A;  4IA6 A;  4YKF A;  3UOY A;  3UKQ A;  1L0V A;  1LPF A;  4OPD A;  3AD8 B;  3NLC A;  2V60 A;  4IA5 A;  1GRT A;  5DBJ A;  4B65 A;  3GD4 A;  4JN9 A;  3AE4 A;  5M0Z A;  3AED A;  4E0V A;  3FG2 P;  2AR8 A;  3WE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...