2Q0OC

Crystal structure of an anti-activation complex in bacterial quorum sensing
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
EARYSVMTKSELEALAVSAIREHRRLLWADQAVYEEWLRASDDPSISGPVLQTLQDEYVARQKRSEAQQEELSDILDALGFVPDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional activator protein traR
publication title Structural basis for antiactivation in bacterial quorum sensing.
pubmed doi rcsb
source organism Rhizobium sp.
molecule tags Transcription
total genus 36
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 2q0oC00
4DYLA 1URFA 1RFYA 4IGGA 1UPGA 2HJDA 2Q0OC 4NKGB 1US6A 2RMKB 1CXZB 4NB5A
chains in the Genus database with same CATH superfamily
4P30A 4B3RB 2GSMB 3CRRA 2JEUA 4X65B 1K4DC 2ZCEA 4O2BA 2E5LB 4JTAB 3OUFA 1NT2B 3VQVA 1SQVH 4F6RB 2VQFO 2ZD9A 1BMFG 3FB8C 3B77A 1SQQH 3ZRXA 1GN4A 4LP8A 4HNAB 3QO7A 5F2VO 3RYCA 4JAVA 1YTFB 1AJNA 4DXWA 2Q67A 2H94A 2A3QA 2GTAA 2F66C 3L74H 1ZLZA 5DN6G 2Q7HA 2UU9O 4LH7A 4LFAB 2Q68A 3GB7C 1Q7YW 4J7ZA 2DQ3A 1I7FA 3LNMB 3RW0A 4UCUA 1QNMA 4JAAA 2EZPA 5CA1A 4I55B 1V9PA 5D5QA 3ASOC 2WLLA 1J5EB 2AHYA 4JZ2A 4UUJC 4LFBO 2HG5C 1VARA 4TV9B 1YI2V 1H38A 5IYZA 1BE3H 1N34B 1VQMV 4FZ0A 5IJ0A 2YIBA 1I94O 1V54C 3BCCH 1NH2D 1KU9A 1L0NH 3K08A 5IJ9A 3ML0A 3K5OA 2ETNA 1DK1A 4J9ZB 2BTOA 2Y69B 3SJAC 4W4KA 2F4VB 1GTOA 1AROP 3DGEA 3A0RA 4DV2O 1NI8A 2WLHA 3FD9A 4XBFA 3QG5A 2VQEO 4OX9B 1SZTA 1SS3A 4UB6Z 5LA6A 1IURA 3NR7A 1SQGA 5LGNA 4WFAV 4PJ0Z 5B1OA 3JYCA 2ILMA 1XMQB 5LHIA 4BAYA 2UXDB 1GN6A 2HHHB 1Q6UA 1EFRG 1LUVA 1X59A 4NYKA 2DMXA 4IHJB 2RJZA 2WLIB 4JI2O 3AK2A 1WLEA 4DK0A 3RFRA 5JH7B 4PA7A 1VQ7V 1HNZB 4NVPA 3CRCA 4BW9A 1FAFA 4YJ2A 3I5DA 1QHTA 2LW7A 1MZEA 2YC0A 3E89A 1G1XB 2MK3A 4R8CA 4JI0B 5J2TA 2IJIA 3APOA 3SPHA 4PDMA 3ZMTA 4ZIBA 2XT9A 1VQLV 3RYHB 3SGIA 1URFA 4LF9O 4JYCA 4QNHB 1YHQV 4FMTA 1VP7A 2K9PA 5EIBD 4J10A 4LF5B 4EFBA 4FM1A 3JALB 3FB5C 1WA8A 4DR7B 3P3PA 4F4LA 4O4LB 3RGBA 4B3TO 1S76D 4RUFA 4IGGA 2AHZA 1PNLA 3JASA 3I55V 4Z2WA 3TGUH 1FS0G 1L0LH 2JS3A 3UT5B 4B3MB 2X6BA 5H6RA 4ZBMA 1NZ6A 4LF7B 1NR1A 1VQ9V 5DECA 4WFGA 3ZS8C 5EZYA 5IY5C 1XOUA 4YY3B 3S3WA 2EIJB 3BAAA 1M1KW 3BA9A 4P9OA 4UCVA 2G38A 2DQ0A 4CBCA 1JQ0A 2DYSC 4DR6O 5LMUB 3VOUA 4E2LA 4RQFA 3ZMUA 4FVMA 1SQPH 4H33A 2BE3A 3CEIA 5EBMC 3RN4A 4QJFB 2EULA 2P22C 1R3JC 2ZNJA 2JGUA 4DW0A 3RYIA 3WU2Z 4GCZA 2XAJA 3JD3A 1O9GA 1V55C 1IVSA 2Y48A 4MVSA 3OAAG 1SRYA 1XUQA 5FPOA 4I50A 2LP7A 4PA6A 4MW8A 4GT1A 3CD6V 2PTMA 2UXCO 4ZI7A 5EIBC 1NU1H 3QNEA 1GRJA 5BMVA 1N8RW 4QE7A 3L73H 2D2CB 5K1XA 1IXMA 3W7XA 1ZX3A 2A0LA 3OTFA 2WLLB 4UB8Z 4C7UA 1HW7A 1P7BA 1AJPA 5IJ0B 4PA4A 2XAFA 4DV6O 2WLJA 1HP8A 4X1YA 3MD0A 5IJ9B 1HNWO 4GYCB 1PL0A 3GWOA 1NTMH 5BR8O 3ASOB 1UFIA 2B1IA 3QTCA 1SQBH 4DR4O 3FFQA 3K5NA 1JA8A 3AG4C 5LA6B 1SZXA 1N0NA 2OWOA 1LR1A 3MDSA 1ENVA 2VS0A 3UCSC 5KMGA 3WFVA 4K0KO 4PI2A 4DV1O 5CBGA 3DC6A 2Q73A 2IH1C 1YJNV 3JD0A 1AJQA 4LWSB 4JI8O 2HJFC 3K3WA 1AB3A 4J80A 2Q7EA 2PYJA 4MVZA 5CB4A 3APQA 1FFTB 4DW1A 1B06A 2CAZC 4J11A 3JAWA 4JI1O 2JRIA 4DK1A 1G6UA 5J2TB 1Q81W 1XBLA 3Q4HA 4MVOA 2R9IA 3OEEG 2B1GA 3T1YB 2QWRB 1GH6A 1NS1A 2FB5A 4DV0O 2HVKC 1VMGA 1ZTEA 3OMAB 3CCEV 3QVNA 1PPJH 4FFBA 3FB6C 4YHHO 1KC8W 3JAKA 1P84F 1WB7A 3O65A 3T1CA 1RSOA 4GUNA 2C2AA 4X88A 3HR0A 4JTCB 1WA8B 2IH3C 2EJ7A 4FJCC 1NVPD 4YJ3B 1TUEB 4J9YB 1I0HA 2DN9A 3T4ZA 2DYRC 1CXZB 3EHBB 3OD4A 2DE0X 3JASB 1YSCA 3CCMV 4GZRB 4LF8B 2GBOA 1W0JG 2YUAA 2CTWA 1FXHA 3ZN0A 1MG1A 4IYHA 3ZRSA 3FYIB 4U3FH 2PUSA 4DUYO 5KHKA 5EZYB 4IL6Z 1VQOV 2IBZH 1NH2B 3D36C 4DV4O 2ZINA 1PP9H 5B1NA 4FFKA 3R66A 1PD3A 3JCZA 2GUZA 4GLXA 4JI3O 1THZA 2NNUA 1R3KC 4Z1VA 1XREA 5IY5B 3BFRA 5GTHZ 3NXSA 3D36A 4CC6A 4PA9A 2PZSA 4I55A 1IBMO 2WAMA 3W7SA 1CP9A 1KECA 5GW7A 3RYIB 4GKKO 4TV9A 2DYSB 3OGCC 2YI9A 3JD2A 4H0LB 4JGSA 5D5PA 1VQ6V 4EEQA 5KUMA 1FXKC 4YIPA 3JAMN 3RVYA 3IC7A 4DV7O 5FL7G 4GX1A 1RM1C 2GTSA 1K3EA 2IU0A 4J7KA 4TSFG 4TUYB 2R9AA 1V55B 5E1AC 4ZI7B 4WF9V 4D7TA 4IT5A 1JPXA 2ODMA 3LUTB 1JJOA 3LSSA 1M4UA 4FZ1A 1BHBA 5IWAO 1K8AW 4NXMB 5LXTA 5C93A 2V7QG 4X89A 2WLIA 3CMEV 2IW5A 2Y4UA 2RMKB 3CYOA 2F95B 2EINC 4O4IA 5CA3A 3ASNC 3SPJA 1US6A 3CP1A 5LHHA 1JR9A 1JJ2U 3L72H 1F4NA 3J7AU 1HNXB 1R73A 2QSAA 4J41A 4LF4B 1DF5A 1EBOA 2ADQB 1YITV 4N23A 1IBLB 4X64B 5JQGA 4JI6O 3N2GA 5KMGB 1VQPV 4UFZA 3AG1C 3JALA 1Y74B 4P2ZA 5B1BC 4LFCO 2QM8A 2RCVA 4MVUA 3AG4B 1TAEA 1JMKC 4O4LA 3SPIA 3F5TA 3OMNB 3CCLV 3L70H 1SA0A 4OPAA 5CB4B 2W6IG 3JAWB 4CH4A 1K9MW 1AI6A 3LSUA 3UT5A 3CC7V 3RVZA 3Q4HB 2Y4TA 1KQSU 4UVCA 1N32B 2P67A 1FJGO 3ZBHA 4RWUA 2HKOA 1XNRB 4R7CA 5GONB 4FFBB 1BQZA 2QR4A 2H3OA 3ZX6A 4NKGB 1E1RG 1RSOB 3LNNA 5L3GA 3ETEA 1VQ4V 3CCQV 3T1HB 2OTLV 3E2EA 3CXCU 1AI4A 4DYLA 4X1KB 4FPPA 3OE7G 5JJEB 1Y4MA 4BIUA 5EBLC 4I0XA 4I4TA 1JFFA 3J81N 1NJIW 3HKBA 4K35A 2AZ0A 3KZIZ 3U0ZA 2OIGA 2P90A 4UCSA 5L3CA 2X6CA 5B5EZ 5HFMA 2DOSA 4CH6A 4NXNB 2DYRB 1SQFA 1YCIA 2ZR3A 2W0XA 5JJJB 2ATKC 2NLJC 3CRAA 4LR3A 4NTYA 1N33B 1RP3B 2YXLA 2Q5ZA 1E79G 4DR2B 3O9OA 1F4MA 1PL4A 2XUMA 2GUZB 2X6AA 3OT7A 4JYAB 1ROPA 4J42A 4ABMA 5B3SC 3K79A 4B08A 3ZHVA 3RYFA 2N74A 1PM9A 3OFNG 4DV6B 2D3OW 2UUAO 1NBMG 2E3CA 4BW5A 2OTJV 3OM3B 2KSDA 2QDOA 5L3BA 5LGTA 1Z5VA 3ABLC 2IU3A 4CH5A 1JCHA 4JF3A 2JK5C 4JI4O 1ZAUA 4JYYA 2BTQA 4D7SA 1AR5A 4D6TH 4QIWF 2EIKB 3H1KH 4DUZO 1JVMA 5L3EA 2Q69A 2FL4A 2ZXWC 5K1PA 2A06H 1UJWB 1KD1W 1QU7A 2FMLA 2E75B 1FXKB 4KP4A 2HLDG 1OCOC 1KYOF 1M5IA 4JI8B 4PD4F 3CC2V 4PA3A 3CWBH 5LXTB 1R6TA 2YSUB 4JI5O 1RM1B 4GKJB 4DR3B 2ITCC 4DV5B 3U11A 4LWSA 2ZKOA 4F6EA 4JI1B 2EX3A 4UV9A 4X66O 4AQYO 1NQTA 3K58A 3IAYA 1IBKB 4O4IB 1NVPB 4G27B 2A9HA 3A0HZ 4DV0B 4A5UB 4KHPB 1XHXA 4U3JB 1EM1A 3T4DA 1PNKA 3PJSK 2EINB 1DGSA 1NKDA 3ASNB 4L8JA 5JQGB 1JX9A 3CCUV 4KL1A 2M6YA 3N2GB 1KMIZ 1IDSA 2PI4A 1UPGA 4YJ3A 3ZHQA 1EN5A 2Z5UA 3SYCA 1SF9A 2ZM6O 3SYAA 3OGIB 3ZCCA 4DUYB 1SA0B 1QR9A 1Y6XA 3P32A 1GN3A 3AG1B 4B3SB 3H01A 2RQ6A 5B1BB 2UXBB 2UUBB 1XNQB 4PDRA 5LMNO 2CTQA 5J2UB 3CX5F 3TJTA 4CS3A 3AEIA 2A7WA 3JATB 1F7YA 1GAXA 3VQXA 1S3JA 5GTIZ 3ZHUA 1M90W 2PGGA 4HYOA 1BQ0A 3UO3A 5ITZB 1LUWA 1Q82W 2UUCB 1K5QA 4UVAA 5IYDO 3CRMA 3BA8A 3ZMVA 4UXNA 5KA5A 1YF2A 2OCCC 3OR7C 3FYEB 4I0XB 4I4TB 2WLMA 1JFFB 4NR1A 3N2KB 2ZE5A 4JV5O 4ASUG 3HKBB 1RPOA 4WFFA 5LP6C 5LL6Y 1QVGU 1XMOB 3EFFK 1QVFU 5DEDA 4I7ZB 4DR1O 4B3RO 1Y76B 4KUMA 3HKEA 3GVMA 4IYIA 5BZBA 3CJHA 1VF5B 5KAIZ 2IJHA 1Q5OA 2VWKA 3EVKA 2E5LO 4UV8A 1Y67A 4TUYA 4MVMA 3JSLA 1H8EG 4TWKA 1WPBA 3K0DA 4U7OA 4XDKA 3JD1A 1VIBA 3RYFB 3UKMA 2HVJC 1TA8A 1XILA 2MW2B 4JI7B 5C8YB 1SETA 1WAZA 3KCXA 5CBFA 1S5LZ 3CCJV 3ABMC 5B3SB 4Q20A 2Q0OC 2QA4V 3B09A 1Q90D 2FKXA 2Q6AA 5LHGA 3BEHA 3LSQA 4DRXB 1WNSA 3IFXA 2V4DA 2BTQB 4MTFA 2DJVA 3AK1A 4LBEC 3OTOB 5H2FZ 3W7WA 3L75H 1V54B 3ABLB 4JI6B 1VF6C 1J5EO 3H1LH 2QKAA 1VEWA 4LFCB 1N34O 1PKXA 2P5OA 3K59A 3E8BA 3W7TA 2LFSA 2ZXWB 1Y74A 1X4TA 1KKDA 2YXYA 1VF6A 5KX5A 2BOBC 2RN9A 1H2GA 1OCOB 2F4VO 1AILA 4UCOA 3DTUB 2QWNB 1D5AA 2CGOA 2XAGA 4I9WA 3E83A 1D5NA 5EK0A 1XMQO 5BXZA 1OCZC 1YDXA 2UXDO 3RBZA 2HHHO 1YIJV 1SESA 2GV9A 4LH6A 5GONA 5IYCO 1QLNA 3TETA 2QWPB 1FYJA 4RO2A 4QE9A 5CBHA 1IX9A 1HNZO 3GWKC 4OXSA 1GO3F 4BIZA 3JARA 4LNUA 4X1KA 2VQFB 4JI0O 5B1AC 1GKFA 2JEXA 2E76B 1NR7A 2WA4A 1I08A 2Q0AA 5EBWC 4AI8A 4JASA 3ABUA 2UU9B 4G28B 3L9DA 1H2LA 4DR7O 1P4RA 2LO1A 2Y0PA 3G4SV 2QTOA 4HAMA 3SPGA 2YEVA 1AI5A 1KKCA 2EZOA 3OMIB 5IE9A 3CCVV 3E22B 3K5MA 3CHXA 4LFBB 4TV8A 4XDLA 4B3MO 1S0VA 4LF7O 1I94B 3WG7C 1ZSPA 3G67A 2B9ZA 4LF6O 3U10A 1M57C 2ZIMA 5JVDA 3CE2A 4QPJA 4UCRA 2NN4A 4EB6B 4B7EA 1BS3A 2XAHA 3SPCA 2ZQMA 4DUZB 1YJWV 3K0GA 1HR0O 2CH7A 4DV2B 2L6LA 2LGQA 2VQEB 3B2EE 2OCCB 3HKEB 3B4SA 5LMUO 3CJHB 3X2QC 3TCUA 1Z2GA 3ZJZA 4ZKIA 5LP6B 3B40A 1KP3A 1DLBA 5H5NA 1XEQA 3K5LA 1FXKA 4ZOLA 1H8HG 4FLXA 2PYLA 2LJ2A 2AZ2A 4MTXA 1M9NA 1BSMA 2WSSG 4JI2B 5CMUA 2OT5A 4QGPA 3EXAA 1SQXH 3SYOA 1HWYA 1MOFA 1S5HC 5AG2A 3QF7A 1H2MA 2YI8A 1N36O 2DWDC 2JGDA 4LF9B 1S72V 2YICA 2CTPA 4U3JA 3ABMB 2R72A 4YXWG 5BY1A 1BT8A 3A8TA 4HZ3A 3ZHTA 3ZEDA 1O9HA 3K57A 5L3DA 3E35A 1PNMA 1KP2A 2YIDA 5H9CA 5FNVA 3T2MA 3C90A 2WA3A 2YIAA 4B3TB 4IIJA 2LQTA 3TK1A 1R6NA 3ETDA 5KX5B 1A32A 3BY6A 5JJNB 1N4CA 4OPHA 5A9GA 3G71V 1TUBB 2IM9A 4DR5O 2R70A 5LMNB 2YIBD 1XL6A 2OIEA 3A2FA 2QM7A 2QKSA 3E8HA 3IJ4A 2Q7GA 2RNBA 2BOCC 2GDSA 5J2UA 2QTSA 1K33A 1BZKA 1LNQA 4DR6B 3JATA 2YS8A 2V1DA 3H1JH 5EC2C 4K3AA 4QPKA 1DTOA 1QQCA 1WP7A 3UO2A 5CA0A 2W0FC 1TGOA 5KUKA 1AVMA 3JARB 1OCZB 2K1EA 2ADPA 4LNUB 1D2DA 4XDJA 3KCYA 1WB8A 4CZZA 4H44B 5ITZA 3LDEA 4JV5B 2ITDC 2XNDG 4FLWA 2Z0AA 4R50A 3SJQC 1ZL8A 1XI1A 1ORQC 4I9QA 3T1YO 1K92A 3I56V 5KA6A 4CS4A 1KBHA 3N2KA 4RAIA 5EC1C 2QEXV 5LBQA 1S5JA 2Z3YA 3AK3A 3SJCC 3IGAC 3ABKC 5KLVH 1W0KG 4FLYA 3K9SA 4JTDB 1H2KA 2QJ1A 5B1AB 2UXCB 1Y76A 1YZBA 5HFLA 3BPZA 1N0JA 4WFHA 4X20A 1W59A 4CH3A 1RPRA 2M7WA 3ZMZA 3WB1A 3SJBC 4DV3O 2YEVB 1EZVH 1Q43A 1FPOA 3BRCA 3ZRVA 4LF8O 4TV8B 3KKYA 5E79Z 4PDLA 5LYJA 1FKAO 3D3QA 4TQFA 1YEWA 5C8YA 1AP5A 1B04A 4W4LA 4FIPC 1HNWB 2FYUH 4MS2A 4FK5C 5JVDB 4LCUC 5BR8B 1XQ8A 2PF4E 4DR4B 4DRXA 2CH7B 1ZWIC 3K03A 1QR8A 5H6QA 1J95A 3WG7B 1M57B 2WLKA 3KG2A 3D8CA 4MW3A 4P9PA 4PV1B 2BSKA 4ZOLB 1F23A 4K0KB 2ZIOA 3CSXA 4B7KA 2F43G 3LDCA 4DV1B 2ZE7A 2E74B 1XL4A 5A2QN 2EILC 5LOVA 4KXRA 5DM6V 2BCCH 2WWWA 3E8FA 3X2QB 1FD9A 3ZMSA 2XASA 3OR6C 1TVKA 3C3SA 2P7TC 3VQYA 4E4EA 1P49A 4RUEA 3D3IA 4GX0A 1GM8A 3CS5A 4X62O 1R3IC 2ZR2A 2JGDB 4WFEA 3ZRWB 2QGNA 3HKCA 3M99B 1ZUQA 2JJ2G 4YHHB 3DC5A 5EYPA 5L3FA 1M56C 4KFMA 2XOKG 5IDJA 4NXMO 4X1IB 5B66Z 2W6JG 2OCHA 4J7JA 4JZGA 3FKSG 2NR5A 2EIMC 2ZE6A 1SERA 5FNVB 4I5SA 5KHHA 4FLZA 1H2SB 1GN2A 4MTGA 4IIJB 4UCTA 3VBBA 4O4HB 2AGAA 2HJDA 2X7RB 2QKCA 4AILC 1B6QA 1K5SA 1YVWA 1OZ0A 1WPXA 2ZE8A 1I5YA 1HNXO 2PI5A 4YIOA 4FLTA 5J9PC 4LF4O 1G8MA 1BL8A 2F23A 4ZHQA 2EJRA 3B8MA 4MSWC 2JS5A 1IBLO 4X64O 4DV4B 1YXBA 3J80N 3F7YC 2GHYA 1RFYA 3LDDA 3MHHC 3OEHG 2KB1A 3K04A 4JI3B 4L87A 2DW4A 1R6KA 1WN7A 2XTAA 5CA0B 1I5XA 4CS2A 1QCEA 1OV9A 1MABG 3BHPA 1IBMB 3F5WC 4PELA 3E22A 4LF6B 4GKKB 2LW1A 1Y66A 2UXNA 1ZL8B 3A0BZ 1HR0B 1N32O 3FAVA 3CRQA 4EFEA 1VF7A 4G2KA 4X9QA 1GK9A 1XNRO 2PY5A 2CE4A 1CPYA 4EB6A 1K97A 2VWJA 4DV7B 1WP8A 3H1IH 4MVQA 4O2BB 2ARHA 2OYQA 2P4KA 1E1QG 2HP8A 1VQKV 3K06A 5IT9N 1OCRC 3SR2C 1Z5WA 4X20B 4X65O 3T1HO 5TISZ 1IZ3A 3H1HH 5LP6A 1QBZA 5JCOC 5IWAB 3AG2C 1NTKH 4AHCA 3SYPA 3ABKB 2JJ1G 2YDEA 3RYCB 2KG7A 2JIZG 4WFBV 3ETQA 3M8AA 5LYJB 3UM7A 1L1FA 4TT3G 4O4JA 2Q9LA 1N36B 2UXXA 3STLC 4FM2A 5JCOA 4NXNO 1OCCC 1QLEC 1B3QA 2FTKA 4H37A 1N33O 1GMGA 4BR6A 3K9AA 4NTWA 4LFAO 5KAFZ 1P7GA 3E86A 4DR2O 1U97A 5CA1B 3WB2A 3R65A 3PN1A 4JYAO 3CMAV 2ZNIA 3HKDA 2IJKA 3ICXA 1YTFD 3ETGA 3CC4V 2XHBA 5IYZB 2BSKB 2CK3G 2P06A 1FXVA 1MSWD 4O2AA 1MNGA 2YXHA 4TQDA 3M7MX 2IJJA 5LOVB 1JOYA 1T5EA 2JVDA 1R1BA 1KUQA 1TVKB 3CCSV 1H2NA 3JD4A 2LGWA 4DR5B 3ZN1A 3F7VC 4RQEA 4WBNA 3G80A 3RWRD 2R9RB 3AG3C 2EILB 3BVOA 1TUBA 1G4YB 1FJGB 3HKCB 4OX9O 3B8NA 2ZT9B 5KHIA 1BCCH 5EYPB 2QWOB 4JYBA 2B5UA 4GX2A 1L8DA 2DWEC 3TXSA 1F51A 4GKJO 4DR3O 4YJ2B 4DV5O 2Q8VA 1COWG 2Y0IA 2KKWA 3L71H 3CCRV 3DXRA 1Q6IA 4HBNA 4PDVA 1M56B 1IBKO 4KHPO 4BWAA 4JAUA 1FFXA 2EIMB 3ABTA 1MZFA 1AP6A 1VQ8V 4K8ZA 1YJ9V 2QM4A 3MHSC 4ZHQB 4EKWA 3P3NA 3QO8A 2AXTZ 4LF5O 2QWQB 3N27A 4DV3B 5IYBO 1IXBA 1K7DA 4DO2A 3CB2A 3CPWU 2QE7G 5LGUA 2KQXA 1Q86W 4F6RA 2N05A 1VQ5V 2HEPA 1EZJA 3E8GA 2UUAB 4HNAA 4JPRA 4B3SO 3C3TA 2UXBO 2UUBO 1XNQO 3FAVB 4JI4B 1CEZA 1OJHA 5KHJA 4MT8A 4K8XA 3THOA 1MMMA 1GM7A 4YY3O 2F1MA 1NTZH 2CUGA 3DSQA 4NTXA 1MA1A 3G6BA 1S77D 2O57A 4X8AA 3WB0A 3ZHRA 3SYQA 2CGNA 2Y69C 2EIKC 2UUCO 3MAQA 3S3XA 4PHZA 4GX5A 3CXHF 1Q3EA 3AG7A 4LC1A 4JI5B 5CN0A 1K34A 2KG7B 2ZDIC 1OCRB 3FX7A 2F93B 1Q6HA 3SDLA 4NB5A 4I50B 4R6ZA 4TOIA 1XMOO 4O4JB 4X66B 4AQYB 4X62B 1AR4A 1HDJA 4MVRA 3AG2B 1AI7A 1GM9A 5BMVB 2ZDIA 2VRZA 3ZIAG 2L35A 5JWPA 2CTRA 3FB7C 3ZRWA 1XDCA 3STZC 2HFEC 3HKDB 4Q6GA 5KHGA 1OCCB 1U96A 4WCEV 1QLEB 4IHJA 2CDYA 3TXQA 1MSDA 4X1IA 4JI7O 5JH7A 3OW2U 4U7NA 1R3LC 4O2AB 4X1YB 4H13B 2LFRA 4OGQB 4UVBA 5FLXN 3UQ8A 1K4CC 2ZM6B 4O4HA 5FPRA 2P6JA 3RYHA 4CC5A 1EN4A 2H8PC 4WBNB 1VQNV 2EBOA 1AR1B 2HR3A 2Q4PA 1PV0A 3BABA 3OTOO 2A79B 2N04A 2WPDG 1KB9F 4Z1MG 2RDCA 3ZHSA 1K73W 3AG3B 3P30A 3RT3C 2AW9A 4ICGA 2X0LA 4FLVA 3OUSA 4FM0A 4PI0A 4MTOA 1DF4A 3JCUZ 1BGYH 3VQWA 3DXRB 1EN6A 2EIJC 1Q8IA 2JDIG 2WLNA 1WJZA 3HPLC 3QO5A 1BHAA 4BIOA 4N21A 1SKVA 4FLUA 3W7UA 3IC9A 1M93A 1W2BU 3G6EV 1FFXB 3JAKB 3JSNA 1SC5B 3HB3B 1XHZA 2P4VA 1OHHG 4DR1B 2XAQA 3H9VA
chains in the Genus database with same CATH topology
4DYLA 1URFA 1RFYA 4IGGA 1UPGA 2HJDA 2Q0OC 4NKGB 1US6A 2RMKB 1CXZB 4NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYL A;  1URF A;  1RFY A;  4IGG A;  1UPG A;  2HJD A;  2Q0O C;  4NKG B;  1US6 A;  2RMK B;  1CXZ B;  4NB5 A; 
#chains in the Genus database with same CATH topology
 4P30 A;  4B3R B;  2GSM B;  3CRR A;  2JEU A;  4X65 B;  1K4D C;  2ZCE A;  4O2B A;  2E5L B;  4JTA B;  3OUF A;  1NT2 B;  3VQV A;  1SQV H;  4F6R B;  2VQF O;  2ZD9 A;  1BMF G;  3FB8 C;  3B77 A;  1SQQ H;  3ZRX A;  1GN4 A;  4LP8 A;  4HNA B;  3QO7 A;  5F2V O;  3RYC A;  4JAV A;  1YTF B;  1AJN A;  4DXW A;  2Q67 A;  2H94 A;  2A3Q A;  2GTA A;  2F66 C;  3L74 H;  1ZLZ A;  5DN6 G;  2Q7H A;  2UU9 O;  4LH7 A;  4LFA B;  2Q68 A;  3GB7 C;  1Q7Y W;  4J7Z A;  2DQ3 A;  1I7F A;  3LNM B;  3RW0 A;  4UCU A;  1QNM A;  4JAA A;  2EZP A;  5CA1 A;  4I55 B;  1V9P A;  5D5Q A;  3ASO C;  2WLL A;  1J5E B;  2AHY A;  4JZ2 A;  4UUJ C;  4LFB O;  2HG5 C;  1VAR A;  4TV9 B;  1YI2 V;  1H38 A;  5IYZ A;  1BE3 H;  1N34 B;  1VQM V;  4FZ0 A;  5IJ0 A;  2YIB A;  1I94 O;  1V54 C;  3BCC H;  1NH2 D;  1KU9 A;  1L0N H;  3K08 A;  5IJ9 A;  3ML0 A;  3K5O A;  2ETN A;  1DK1 A;  4J9Z B;  2BTO A;  2Y69 B;  3SJA C;  4W4K A;  2F4V B;  1GTO A;  1ARO P;  3DGE A;  3A0R A;  4DV2 O;  1NI8 A;  2WLH A;  3FD9 A;  4XBF A;  3QG5 A;  2VQE O;  4OX9 B;  1SZT A;  1SS3 A;  4UB6 Z;  5LA6 A;  1IUR A;  3NR7 A;  1SQG A;  5LGN A;  4WFA V;  4PJ0 Z;  5B1O A;  3JYC A;  2ILM A;  1XMQ B;  5LHI A;  4BAY A;  2UXD B;  1GN6 A;  2HHH B;  1Q6U A;  1EFR G;  1LUV A;  1X59 A;  4NYK A;  2DMX A;  4IHJ B;  2RJZ A;  2WLI B;  4JI2 O;  3AK2 A;  1WLE A;  4DK0 A;  3RFR A;  5JH7 B;  4PA7 A;  1VQ7 V;  1HNZ B;  4NVP A;  3CRC A;  4BW9 A;  1FAF A;  4YJ2 A;  3I5D A;  1QHT A;  2LW7 A;  1MZE A;  2YC0 A;  3E89 A;  1G1X B;  2MK3 A;  4R8C A;  4JI0 B;  5J2T A;  2IJI A;  3APO A;  3SPH A;  4PDM A;  3ZMT A;  4ZIB A;  2XT9 A;  1VQL V;  3RYH B;  3SGI A;  1URF A;  4LF9 O;  4JYC A;  4QNH B;  1YHQ V;  4FMT A;  1VP7 A;  2K9P A;  5EIB D;  4J10 A;  4LF5 B;  4EFB A;  4FM1 A;  3JAL B;  3FB5 C;  1WA8 A;  4DR7 B;  3P3P A;  4F4L A;  4O4L B;  3RGB A;  4B3T O;  1S76 D;  4RUF A;  4IGG A;  2AHZ A;  1PNL A;  3JAS A;  3I55 V;  4Z2W A;  3TGU H;  1FS0 G;  1L0L H;  2JS3 A;  3UT5 B;  4B3M B;  2X6B A;  5H6R A;  4ZBM A;  1NZ6 A;  4LF7 B;  1NR1 A;  1VQ9 V;  5DEC A;  4WFG A;  3ZS8 C;  5EZY A;  5IY5 C;  1XOU A;  4YY3 B;  3S3W A;  2EIJ B;  3BAA A;  1M1K W;  3BA9 A;  4P9O A;  4UCV A;  2G38 A;  2DQ0 A;  4CBC A;  1JQ0 A;  2DYS C;  4DR6 O;  5LMU B;  3VOU A;  4E2L A;  4RQF A;  3ZMU A;  4FVM A;  1SQP H;  4H33 A;  2BE3 A;  3CEI A;  5EBM C;  3RN4 A;  4QJF B;  2EUL A;  2P22 C;  1R3J C;  2ZNJ A;  2JGU A;  4DW0 A;  3RYI A;  3WU2 Z;  4GCZ A;  2XAJ A;  3JD3 A;  1O9G A;  1V55 C;  1IVS A;  2Y48 A;  4MVS A;  3OAA G;  1SRY A;  1XUQ A;  5FPO A;  4I50 A;  2LP7 A;  4PA6 A;  4MW8 A;  4GT1 A;  3CD6 V;  2PTM A;  2UXC O;  4ZI7 A;  5EIB C;  1NU1 H;  3QNE A;  1GRJ A;  5BMV A;  1N8R W;  4QE7 A;  3L73 H;  2D2C B;  5K1X A;  1IXM A;  3W7X A;  1ZX3 A;  2A0L A;  3OTF A;  2WLL B;  4UB8 Z;  4C7U A;  1HW7 A;  1P7B A;  1AJP A;  5IJ0 B;  4PA4 A;  2XAF A;  4DV6 O;  2WLJ A;  1HP8 A;  4X1Y A;  3MD0 A;  5IJ9 B;  1HNW O;  4GYC B;  1PL0 A;  3GWO A;  1NTM H;  5BR8 O;  3ASO B;  1UFI A;  2B1I A;  3QTC A;  1SQB H;  4DR4 O;  3FFQ A;  3K5N A;  1JA8 A;  3AG4 C;  5LA6 B;  1SZX A;  1N0N A;  2OWO A;  1LR1 A;  3MDS A;  1ENV A;  2VS0 A;  3UCS C;  5KMG A;  3WFV A;  4K0K O;  4PI2 A;  4DV1 O;  5CBG A;  3DC6 A;  2Q73 A;  2IH1 C;  1YJN V;  3JD0 A;  1AJQ A;  4LWS B;  4JI8 O;  2HJF C;  3K3W A;  1AB3 A;  4J80 A;  2Q7E A;  2PYJ A;  4MVZ A;  5CB4 A;  3APQ A;  1FFT B;  4DW1 A;  1B06 A;  2CAZ C;  4J11 A;  3JAW A;  4JI1 O;  2JRI A;  4DK1 A;  1G6U A;  5J2T B;  1Q81 W;  1XBL A;  3Q4H A;  4MVO A;  2R9I A;  3OEE G;  2B1G A;  3T1Y B;  2QWR B;  1GH6 A;  1NS1 A;  2FB5 A;  4DV0 O;  2HVK C;  1VMG A;  1ZTE A;  3OMA B;  3CCE V;  3QVN A;  1PPJ H;  4FFB A;  3FB6 C;  4YHH O;  1KC8 W;  3JAK A;  1P84 F;  1WB7 A;  3O65 A;  3T1C A;  1RSO A;  4GUN A;  2C2A A;  4X88 A;  3HR0 A;  4JTC B;  1WA8 B;  2IH3 C;  2EJ7 A;  4FJC C;  1NVP D;  4YJ3 B;  1TUE B;  4J9Y B;  1I0H A;  2DN9 A;  3T4Z A;  2DYR C;  1CXZ B;  3EHB B;  3OD4 A;  2DE0 X;  3JAS B;  1YSC A;  3CCM V;  4GZR B;  4LF8 B;  2GBO A;  1W0J G;  2YUA A;  2CTW A;  1FXH A;  3ZN0 A;  1MG1 A;  4IYH A;  3ZRS A;  3FYI B;  4U3F H;  2PUS A;  4DUY O;  5KHK A;  5EZY B;  4IL6 Z;  1VQO V;  2IBZ H;  1NH2 B;  3D36 C;  4DV4 O;  2ZIN A;  1PP9 H;  5B1N A;  4FFK A;  3R66 A;  1PD3 A;  3JCZ A;  2GUZ A;  4GLX A;  4JI3 O;  1THZ A;  2NNU A;  1R3K C;  4Z1V A;  1XRE A;  5IY5 B;  3BFR A;  5GTH Z;  3NXS A;  3D36 A;  4CC6 A;  4PA9 A;  2PZS A;  4I55 A;  1IBM O;  2WAM A;  3W7S A;  1CP9 A;  1KEC A;  5GW7 A;  3RYI B;  4GKK O;  4TV9 A;  2DYS B;  3OGC C;  2YI9 A;  3JD2 A;  4H0L B;  4JGS A;  5D5P A;  1VQ6 V;  4EEQ A;  5KUM A;  1FXK C;  4YIP A;  3JAM N;  3RVY A;  3IC7 A;  4DV7 O;  5FL7 G;  4GX1 A;  1RM1 C;  2GTS A;  1K3E A;  2IU0 A;  4J7K A;  4TSF G;  4TUY B;  2R9A A;  1V55 B;  5E1A C;  4ZI7 B;  4WF9 V;  4D7T A;  4IT5 A;  1JPX A;  2ODM A;  3LUT B;  1JJO A;  3LSS A;  1M4U A;  4FZ1 A;  1BHB A;  5IWA O;  1K8A W;  4NXM B;  5LXT A;  5C93 A;  2V7Q G;  4X89 A;  2WLI A;  3CME V;  2IW5 A;  2Y4U A;  2RMK B;  3CYO A;  2F95 B;  2EIN C;  4O4I A;  5CA3 A;  3ASN C;  3SPJ A;  1US6 A;  3CP1 A;  5LHH A;  1JR9 A;  1JJ2 U;  3L72 H;  1F4N A;  3J7A U;  1HNX B;  1R73 A;  2QSA A;  4J41 A;  4LF4 B;  1DF5 A;  1EBO A;  2ADQ B;  1YIT V;  4N23 A;  1IBL B;  4X64 B;  5JQG A;  4JI6 O;  3N2G A;  5KMG B;  1VQP V;  4UFZ A;  3AG1 C;  3JAL A;  1Y74 B;  4P2Z A;  5B1B C;  4LFC O;  2QM8 A;  2RCV A;  4MVU A;  3AG4 B;  1TAE A;  1JMK C;  4O4L A;  3SPI A;  3F5T A;  3OMN B;  3CCL V;  3L70 H;  1SA0 A;  4OPA A;  5CB4 B;  2W6I G;  3JAW B;  4CH4 A;  1K9M W;  1AI6 A;  3LSU A;  3UT5 A;  3CC7 V;  3RVZ A;  3Q4H B;  2Y4T A;  1KQS U;  4UVC A;  1N32 B;  2P67 A;  1FJG O;  3ZBH A;  4RWU A;  2HKO A;  1XNR B;  4R7C A;  5GON B;  4FFB B;  1BQZ A;  2QR4 A;  2H3O A;  3ZX6 A;  4NKG B;  1E1R G;  1RSO B;  3LNN A;  5L3G A;  3ETE A;  1VQ4 V;  3CCQ V;  3T1H B;  2OTL V;  3E2E A;  3CXC U;  1AI4 A;  4DYL A;  4X1K B;  4FPP A;  3OE7 G;  5JJE B;  1Y4M A;  4BIU A;  5EBL C;  4I0X A;  4I4T A;  1JFF A;  3J81 N;  1NJI W;  3HKB A;  4K35 A;  2AZ0 A;  3KZI Z;  3U0Z A;  2OIG A;  2P90 A;  4UCS A;  5L3C A;  2X6C A;  5B5E Z;  5HFM A;  2DOS A;  4CH6 A;  4NXN B;  2DYR B;  1SQF A;  1YCI A;  2ZR3 A;  2W0X A;  5JJJ B;  2ATK C;  2NLJ C;  3CRA A;  4LR3 A;  4NTY A;  1N33 B;  1RP3 B;  2YXL A;  2Q5Z A;  1E79 G;  4DR2 B;  3O9O A;  1F4M A;  1PL4 A;  2XUM A;  2GUZ B;  2X6A A;  3OT7 A;  4JYA B;  1ROP A;  4J42 A;  4ABM A;  5B3S C;  3K79 A;  4B08 A;  3ZHV A;  3RYF A;  2N74 A;  1PM9 A;  3OFN G;  4DV6 B;  2D3O W;  2UUA O;  1NBM G;  2E3C A;  4BW5 A;  2OTJ V;  3OM3 B;  2KSD A;  2QDO A;  5L3B A;  5LGT A;  1Z5V A;  3ABL C;  2IU3 A;  4CH5 A;  1JCH A;  4JF3 A;  2JK5 C;  4JI4 O;  1ZAU A;  4JYY A;  2BTQ A;  4D7S A;  1AR5 A;  4D6T H;  4QIW F;  2EIK B;  3H1K H;  4DUZ O;  1JVM A;  5L3E A;  2Q69 A;  2FL4 A;  2ZXW C;  5K1P A;  2A06 H;  1UJW B;  1KD1 W;  1QU7 A;  2FML A;  2E75 B;  1FXK B;  4KP4 A;  2HLD G;  1OCO C;  1KYO F;  1M5I A;  4JI8 B;  4PD4 F;  3CC2 V;  4PA3 A;  3CWB H;  5LXT B;  1R6T A;  2YSU B;  4JI5 O;  1RM1 B;  4GKJ B;  4DR3 B;  2ITC C;  4DV5 B;  3U11 A;  4LWS A;  2ZKO A;  4F6E A;  4JI1 B;  2EX3 A;  4UV9 A;  4X66 O;  4AQY O;  1NQT A;  3K58 A;  3IAY A;  1IBK B;  4O4I B;  1NVP B;  4G27 B;  2A9H A;  3A0H Z;  4DV0 B;  4A5U B;  4KHP B;  1XHX A;  4U3J B;  1EM1 A;  3T4D A;  1PNK A;  3PJS K;  2EIN B;  1DGS A;  1NKD A;  3ASN B;  4L8J A;  5JQG B;  1JX9 A;  3CCU V;  4KL1 A;  2M6Y A;  3N2G B;  1KMI Z;  1IDS A;  2PI4 A;  1UPG A;  4YJ3 A;  3ZHQ A;  1EN5 A;  2Z5U A;  3SYC A;  1SF9 A;  2ZM6 O;  3SYA A;  3OGI B;  3ZCC A;  4DUY B;  1SA0 B;  1QR9 A;  1Y6X A;  3P32 A;  1GN3 A;  3AG1 B;  4B3S B;  3H01 A;  2RQ6 A;  5B1B B;  2UXB B;  2UUB B;  1XNQ B;  4PDR A;  5LMN O;  2CTQ A;  5J2U B;  3CX5 F;  3TJT A;  4CS3 A;  3AEI A;  2A7W A;  3JAT B;  1F7Y A;  1GAX A;  3VQX A;  1S3J A;  5GTI Z;  3ZHU A;  1M90 W;  2PGG A;  4HYO A;  1BQ0 A;  3UO3 A;  5ITZ B;  1LUW A;  1Q82 W;  2UUC B;  1K5Q A;  4UVA A;  5IYD O;  3CRM A;  3BA8 A;  3ZMV A;  4UXN A;  5KA5 A;  1YF2 A;  2OCC C;  3OR7 C;  3FYE B;  4I0X B;  4I4T B;  2WLM A;  1JFF B;  4NR1 A;  3N2K B;  2ZE5 A;  4JV5 O;  4ASU G;  3HKB B;  1RPO A;  4WFF A;  5LP6 C;  5LL6 Y;  1QVG U;  1XMO B;  3EFF K;  1QVF U;  5DED A;  4I7Z B;  4DR1 O;  4B3R O;  1Y76 B;  4KUM A;  3HKE A;  3GVM A;  4IYI A;  5BZB A;  3CJH A;  1VF5 B;  5KAI Z;  2IJH A;  1Q5O A;  2VWK A;  3EVK A;  2E5L O;  4UV8 A;  1Y67 A;  4TUY A;  4MVM A;  3JSL A;  1H8E G;  4TWK A;  1WPB A;  3K0D A;  4U7O A;  4XDK A;  3JD1 A;  1VIB A;  3RYF B;  3UKM A;  2HVJ C;  1TA8 A;  1XIL A;  2MW2 B;  4JI7 B;  5C8Y B;  1SET A;  1WAZ A;  3KCX A;  5CBF A;  1S5L Z;  3CCJ V;  3ABM C;  5B3S B;  4Q20 A;  2Q0O C;  2QA4 V;  3B09 A;  1Q90 D;  2FKX A;  2Q6A A;  5LHG A;  3BEH A;  3LSQ A;  4DRX B;  1WNS A;  3IFX A;  2V4D A;  2BTQ B;  4MTF A;  2DJV A;  3AK1 A;  4LBE C;  3OTO B;  5H2F Z;  3W7W A;  3L75 H;  1V54 B;  3ABL B;  4JI6 B;  1VF6 C;  1J5E O;  3H1L H;  2QKA A;  1VEW A;  4LFC B;  1N34 O;  1PKX A;  2P5O A;  3K59 A;  3E8B A;  3W7T A;  2LFS A;  2ZXW B;  1Y74 A;  1X4T A;  1KKD A;  2YXY A;  1VF6 A;  5KX5 A;  2BOB C;  2RN9 A;  1H2G A;  1OCO B;  2F4V O;  1AIL A;  4UCO A;  3DTU B;  2QWN B;  1D5A A;  2CGO A;  2XAG A;  4I9W A;  3E83 A;  1D5N A;  5EK0 A;  1XMQ O;  5BXZ A;  1OCZ C;  1YDX A;  2UXD O;  3RBZ A;  2HHH O;  1YIJ V;  1SES A;  2GV9 A;  4LH6 A;  5GON A;  5IYC O;  1QLN A;  3TET A;  2QWP B;  1FYJ A;  4RO2 A;  4QE9 A;  5CBH A;  1IX9 A;  1HNZ O;  3GWK C;  4OXS A;  1GO3 F;  4BIZ A;  3JAR A;  4LNU A;  4X1K A;  2VQF B;  4JI0 O;  5B1A C;  1GKF A;  2JEX A;  2E76 B;  1NR7 A;  2WA4 A;  1I08 A;  2Q0A A;  5EBW C;  4AI8 A;  4JAS A;  3ABU A;  2UU9 B;  4G28 B;  3L9D A;  1H2L A;  4DR7 O;  1P4R A;  2LO1 A;  2Y0P A;  3G4S V;  2QTO A;  4HAM A;  3SPG A;  2YEV A;  1AI5 A;  1KKC A;  2EZO A;  3OMI B;  5IE9 A;  3CCV V;  3E22 B;  3K5M A;  3CHX A;  4LFB B;  4TV8 A;  4XDL A;  4B3M O;  1S0V A;  4LF7 O;  1I94 B;  3WG7 C;  1ZSP A;  3G67 A;  2B9Z A;  4LF6 O;  3U10 A;  1M57 C;  2ZIM A;  5JVD A;  3CE2 A;  4QPJ A;  4UCR A;  2NN4 A;  4EB6 B;  4B7E A;  1BS3 A;  2XAH A;  3SPC A;  2ZQM A;  4DUZ B;  1YJW V;  3K0G A;  1HR0 O;  2CH7 A;  4DV2 B;  2L6L A;  2LGQ A;  2VQE B;  3B2E E;  2OCC B;  3HKE B;  3B4S A;  5LMU O;  3CJH B;  3X2Q C;  3TCU A;  1Z2G A;  3ZJZ A;  4ZKI A;  5LP6 B;  3B40 A;  1KP3 A;  1DLB A;  5H5N A;  1XEQ A;  3K5L A;  1FXK A;  4ZOL A;  1H8H G;  4FLX A;  2PYL A;  2LJ2 A;  2AZ2 A;  4MTX A;  1M9N A;  1BSM A;  2WSS G;  4JI2 B;  5CMU A;  2OT5 A;  4QGP A;  3EXA A;  1SQX H;  3SYO A;  1HWY A;  1MOF A;  1S5H C;  5AG2 A;  3QF7 A;  1H2M A;  2YI8 A;  1N36 O;  2DWD C;  2JGD A;  4LF9 B;  1S72 V;  2YIC A;  2CTP A;  4U3J A;  3ABM B;  2R72 A;  4YXW G;  5BY1 A;  1BT8 A;  3A8T A;  4HZ3 A;  3ZHT A;  3ZED A;  1O9H A;  3K57 A;  5L3D A;  3E35 A;  1PNM A;  1KP2 A;  2YID A;  5H9C A;  5FNV A;  3T2M A;  3C90 A;  2WA3 A;  2YIA A;  4B3T B;  4IIJ A;  2LQT A;  3TK1 A;  1R6N A;  3ETD A;  5KX5 B;  1A32 A;  3BY6 A;  5JJN B;  1N4C A;  4OPH A;  5A9G A;  3G71 V;  1TUB B;  2IM9 A;  4DR5 O;  2R70 A;  5LMN B;  2YIB D;  1XL6 A;  2OIE A;  3A2F A;  2QM7 A;  2QKS A;  3E8H A;  3IJ4 A;  2Q7G A;  2RNB A;  2BOC C;  2GDS A;  5J2U A;  2QTS A;  1K33 A;  1BZK A;  1LNQ A;  4DR6 B;  3JAT A;  2YS8 A;  2V1D A;  3H1J H;  5EC2 C;  4K3A A;  4QPK A;  1DTO A;  1QQC A;  1WP7 A;  3UO2 A;  5CA0 A;  2W0F C;  1TGO A;  5KUK A;  1AVM A;  3JAR B;  1OCZ B;  2K1E A;  2ADP A;  4LNU B;  1D2D A;  4XDJ A;  3KCY A;  1WB8 A;  4CZZ A;  4H44 B;  5ITZ A;  3LDE A;  4JV5 B;  2ITD C;  2XND G;  4FLW A;  2Z0A A;  4R50 A;  3SJQ C;  1ZL8 A;  1XI1 A;  1ORQ C;  4I9Q A;  3T1Y O;  1K92 A;  3I56 V;  5KA6 A;  4CS4 A;  1KBH A;  3N2K A;  4RAI A;  5EC1 C;  2QEX V;  5LBQ A;  1S5J A;  2Z3Y A;  3AK3 A;  3SJC C;  3IGA C;  3ABK C;  5KLV H;  1W0K G;  4FLY A;  3K9S A;  4JTD B;  1H2K A;  2QJ1 A;  5B1A B;  2UXC B;  1Y76 A;  1YZB A;  5HFL A;  3BPZ A;  1N0J A;  4WFH A;  4X20 A;  1W59 A;  4CH3 A;  1RPR A;  2M7W A;  3ZMZ A;  3WB1 A;  3SJB C;  4DV3 O;  2YEV B;  1EZV H;  1Q43 A;  1FPO A;  3BRC A;  3ZRV A;  4LF8 O;  4TV8 B;  3KKY A;  5E79 Z;  4PDL A;  5LYJ A;  1FKA O;  3D3Q A;  4TQF A;  1YEW A;  5C8Y A;  1AP5 A;  1B04 A;  4W4L A;  4FIP C;  1HNW B;  2FYU H;  4MS2 A;  4FK5 C;  5JVD B;  4LCU C;  5BR8 B;  1XQ8 A;  2PF4 E;  4DR4 B;  4DRX A;  2CH7 B;  1ZWI C;  3K03 A;  1QR8 A;  5H6Q A;  1J95 A;  3WG7 B;  1M57 B;  2WLK A;  3KG2 A;  3D8C A;  4MW3 A;  4P9P A;  4PV1 B;  2BSK A;  4ZOL B;  1F23 A;  4K0K B;  2ZIO A;  3CSX A;  4B7K A;  2F43 G;  3LDC A;  4DV1 B;  2ZE7 A;  2E74 B;  1XL4 A;  5A2Q N;  2EIL C;  5LOV A;  4KXR A;  5DM6 V;  2BCC H;  2WWW A;  3E8F A;  3X2Q B;  1FD9 A;  3ZMS A;  2XAS A;  3OR6 C;  1TVK A;  3C3S A;  2P7T C;  3VQY A;  4E4E A;  1P49 A;  4RUE A;  3D3I A;  4GX0 A;  1GM8 A;  3CS5 A;  4X62 O;  1R3I C;  2ZR2 A;  2JGD B;  4WFE A;  3ZRW B;  2QGN A;  3HKC A;  3M99 B;  1ZUQ A;  2JJ2 G;  4YHH B;  3DC5 A;  5EYP A;  5L3F A;  1M56 C;  4KFM A;  2XOK G;  5IDJ A;  4NXM O;  4X1I B;  5B66 Z;  2W6J G;  2OCH A;  4J7J A;  4JZG A;  3FKS G;  2NR5 A;  2EIM C;  2ZE6 A;  1SER A;  5FNV B;  4I5S A;  5KHH A;  4FLZ A;  1H2S B;  1GN2 A;  4MTG A;  4IIJ B;  4UCT A;  3VBB A;  4O4H B;  2AGA A;  2HJD A;  2X7R B;  2QKC A;  4AIL C;  1B6Q A;  1K5S A;  1YVW A;  1OZ0 A;  1WPX A;  2ZE8 A;  1I5Y A;  1HNX O;  2PI5 A;  4YIO A;  4FLT A;  5J9P C;  4LF4 O;  1G8M A;  1BL8 A;  2F23 A;  4ZHQ A;  2EJR A;  3B8M A;  4MSW C;  2JS5 A;  1IBL O;  4X64 O;  4DV4 B;  1YXB A;  3J80 N;  3F7Y C;  2GHY A;  1RFY A;  3LDD A;  3MHH C;  3OEH G;  2KB1 A;  3K04 A;  4JI3 B;  4L87 A;  2DW4 A;  1R6K A;  1WN7 A;  2XTA A;  5CA0 B;  1I5X A;  4CS2 A;  1QCE A;  1OV9 A;  1MAB G;  3BHP A;  1IBM B;  3F5W C;  4PEL A;  3E22 A;  4LF6 B;  4GKK B;  2LW1 A;  1Y66 A;  2UXN A;  1ZL8 B;  3A0B Z;  1HR0 B;  1N32 O;  3FAV A;  3CRQ A;  4EFE A;  1VF7 A;  4G2K A;  4X9Q A;  1GK9 A;  1XNR O;  2PY5 A;  2CE4 A;  1CPY A;  4EB6 A;  1K97 A;  2VWJ A;  4DV7 B;  1WP8 A;  3H1I H;  4MVQ A;  4O2B B;  2ARH A;  2OYQ A;  2P4K A;  1E1Q G;  2HP8 A;  1VQK V;  3K06 A;  5IT9 N;  1OCR C;  3SR2 C;  1Z5W A;  4X20 B;  4X65 O;  3T1H O;  5TIS Z;  1IZ3 A;  3H1H H;  5LP6 A;  1QBZ A;  5JCO C;  5IWA B;  3AG2 C;  1NTK H;  4AHC A;  3SYP A;  3ABK B;  2JJ1 G;  2YDE A;  3RYC B;  2KG7 A;  2JIZ G;  4WFB V;  3ETQ A;  3M8A A;  5LYJ B;  3UM7 A;  1L1F A;  4TT3 G;  4O4J A;  2Q9L A;  1N36 B;  2UXX A;  3STL C;  4FM2 A;  5JCO A;  4NXN O;  1OCC C;  1QLE C;  1B3Q A;  2FTK A;  4H37 A;  1N33 O;  1GMG A;  4BR6 A;  3K9A A;  4NTW A;  4LFA O;  5KAF Z;  1P7G A;  3E86 A;  4DR2 O;  1U97 A;  5CA1 B;  3WB2 A;  3R65 A;  3PN1 A;  4JYA O;  3CMA V;  2ZNI A;  3HKD A;  2IJK A;  3ICX A;  1YTF D;  3ETG A;  3CC4 V;  2XHB A;  5IYZ B;  2BSK B;  2CK3 G;  2P06 A;  1FXV A;  1MSW D;  4O2A A;  1MNG A;  2YXH A;  4TQD A;  3M7M X;  2IJJ A;  5LOV B;  1JOY A;  1T5E A;  2JVD A;  1R1B A;  1KUQ A;  1TVK B;  3CCS V;  1H2N A;  3JD4 A;  2LGW A;  4DR5 B;  3ZN1 A;  3F7V C;  4RQE A;  4WBN A;  3G80 A;  3RWR D;  2R9R B;  3AG3 C;  2EIL B;  3BVO A;  1TUB A;  1G4Y B;  1FJG B;  3HKC B;  4OX9 O;  3B8N A;  2ZT9 B;  5KHI A;  1BCC H;  5EYP B;  2QWO B;  4JYB A;  2B5U A;  4GX2 A;  1L8D A;  2DWE C;  3TXS A;  1F51 A;  4GKJ O;  4DR3 O;  4YJ2 B;  4DV5 O;  2Q8V A;  1COW G;  2Y0I A;  2KKW A;  3L71 H;  3CCR V;  3DXR A;  1Q6I A;  4HBN A;  4PDV A;  1M56 B;  1IBK O;  4KHP O;  4BWA A;  4JAU A;  1FFX A;  2EIM B;  3ABT A;  1MZF A;  1AP6 A;  1VQ8 V;  4K8Z A;  1YJ9 V;  2QM4 A;  3MHS C;  4ZHQ B;  4EKW A;  3P3N A;  3QO8 A;  2AXT Z;  4LF5 O;  2QWQ B;  3N27 A;  4DV3 B;  5IYB O;  1IXB A;  1K7D A;  4DO2 A;  3CB2 A;  3CPW U;  2QE7 G;  5LGU A;  2KQX A;  1Q86 W;  4F6R A;  2N05 A;  1VQ5 V;  2HEP A;  1EZJ A;  3E8G A;  2UUA B;  4HNA A;  4JPR A;  4B3S O;  3C3T A;  2UXB O;  2UUB O;  1XNQ O;  3FAV B;  4JI4 B;  1CEZ A;  1OJH A;  5KHJ A;  4MT8 A;  4K8X A;  3THO A;  1MMM A;  1GM7 A;  4YY3 O;  2F1M A;  1NTZ H;  2CUG A;  3DSQ A;  4NTX A;  1MA1 A;  3G6B A;  1S77 D;  2O57 A;  4X8A A;  3WB0 A;  3ZHR A;  3SYQ A;  2CGN A;  2Y69 C;  2EIK C;  2UUC O;  3MAQ A;  3S3X A;  4PHZ A;  4GX5 A;  3CXH F;  1Q3E A;  3AG7 A;  4LC1 A;  4JI5 B;  5CN0 A;  1K34 A;  2KG7 B;  2ZDI C;  1OCR B;  3FX7 A;  2F93 B;  1Q6H A;  3SDL A;  4NB5 A;  4I50 B;  4R6Z A;  4TOI A;  1XMO O;  4O4J B;  4X66 B;  4AQY B;  4X62 B;  1AR4 A;  1HDJ A;  4MVR A;  3AG2 B;  1AI7 A;  1GM9 A;  5BMV B;  2ZDI A;  2VRZ A;  3ZIA G;  2L35 A;  5JWP A;  2CTR A;  3FB7 C;  3ZRW A;  1XDC A;  3STZ C;  2HFE C;  3HKD B;  4Q6G A;  5KHG A;  1OCC B;  1U96 A;  4WCE V;  1QLE B;  4IHJ A;  2CDY A;  3TXQ A;  1MSD A;  4X1I A;  4JI7 O;  5JH7 A;  3OW2 U;  4U7N A;  1R3L C;  4O2A B;  4X1Y B;  4H13 B;  2LFR A;  4OGQ B;  4UVB A;  5FLX N;  3UQ8 A;  1K4C C;  2ZM6 B;  4O4H A;  5FPR A;  2P6J A;  3RYH A;  4CC5 A;  1EN4 A;  2H8P C;  4WBN B;  1VQN V;  2EBO A;  1AR1 B;  2HR3 A;  2Q4P A;  1PV0 A;  3BAB A;  3OTO O;  2A79 B;  2N04 A;  2WPD G;  1KB9 F;  4Z1M G;  2RDC A;  3ZHS A;  1K73 W;  3AG3 B;  3P30 A;  3RT3 C;  2AW9 A;  4ICG A;  2X0L A;  4FLV A;  3OUS A;  4FM0 A;  4PI0 A;  4MTO A;  1DF4 A;  3JCU Z;  1BGY H;  3VQW A;  3DXR B;  1EN6 A;  2EIJ C;  1Q8I A;  2JDI G;  2WLN A;  1WJZ A;  3HPL C;  3QO5 A;  1BHA A;  4BIO A;  4N21 A;  1SKV A;  4FLU A;  3W7U A;  3IC9 A;  1M93 A;  1W2B U;  3G6E V;  1FFX B;  3JAK B;  3JSN A;  1SC5 B;  3HB3 B;  1XHZ A;  2P4V A;  1OHH G;  4DR1 B;  2XAQ A;  3H9V A; 
#chains in the Genus database with same CATH homology
 4DYL A;  1URF A;  1RFY A;  4IGG A;  1UPG A;  2HJD A;  2Q0O C;  4NKG B;  1US6 A;  2RMK B;  1CXZ B;  4NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...