2Q0OC

Crystal structure of an anti-activation complex in bacterial quorum sensing
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
EARYSVMTKSELEALAVSAIREHRRLLWADQAVYEEWLRASDDPSISGPVLQTLQDEYVARQKRSEAQQEELSDILDALGFVPDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional activator protein traR
publication title Structural basis for antiactivation in bacterial quorum sensing.
pubmed doi rcsb
source organism Rhizobium sp.
molecule tags Transcription
total genus 36
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 2q0oC00
1URFA 2HJDA 1CXZB 2Q0OC 4DYLA 4IGGA 1RFYA 4NB5A 1US6A 2RMKB 1UPGA 4NKGB
chains in the Genus database with same CATH superfamily
2UXDO 5KA5A 2ZE5A 2DYRC 3FB5C 2HR3A 4GKKO 2E3CA 4RQFA 2EIJC 2HVJC 1RM1B 2KB1A 4LF8B 3N2GB 5L3DA 3JARB 4UV8A 3ZN0A 4XBFA 4DV4O 1MZEA 3APOA 1N4CA 4CC6A 3D36C 4WBNA 4JI5O 5E79Z 4F6RB 3ETQA 1HP8A 4X64O 1AJNA 3H9VA 1K97A 3JAKA 4MSWC 3UQ8A 2LJ2A 1R6KA 4LF4O 4DV3B 1Z5WA 3VQVA 5JJJB 2UUCB 3VOUA 5KAIZ 2VQFB 3FX7A 3S3WA 1Y76A 1KC8W 3SYCA 5L3EA 2WLMA 3WFVA 4R7CA 3OTFA 1FYJA 1K73W 4UB6Z 4H0LB 2P22C 4YJ2A 1WN7A 4LF7B 1WAZA 1AJPA 3WB0A 1RM1C 1BHBA 4LF6B 1SQPH 3A0HZ 3T1HB 1XI1A 3L72H 1I5YA 2HFEC 1XUQA 4O4LA 1O9HA 1RPRA 3JALB 4WFHA 3S3XA 2OWOA 2UU9O 1AP5A 2EIKC 2EX3A 2WWWA 4IHJB 2Q7HA 1N33B 1EZJA 3CXCU 4DR4B 4UCTA 4CH5A 2ETNA 5F2VO 3ZMTA 5ITZA 4O4JB 1QU7A 5BXZA 4GZRB 4ZKIA 1ZUQA 5H2FZ 1G8MA 3OUFA 2CTWA 4D7TA 1EN4A 3D3QA 1IXMA 5TISZ 1F51A 4TOIA 1VQPV 5KUKA 3TGUH 4X66B 2NLJC 3JD1A 3B40A 1U96A 4N21A 4GKJO 2ZDIC 2Q8VA 2R9IA 1G6UA 1U97A 2GTSA 1M57B 5BR8O 3OMIB 1PL4A 1ZL8A 2QM7A 4ZOLB 2PGGA 2QGNA 3ZJZA 4KHPB 1Q7YW 5BY1A 2WLLA 4DV1B 1BQZA 2X0LA 3CCQV 3OT7A 2QDOA 3LSUA 1P84F 3W7UA 4H44B 1M9NA 1XREA 2PY5A 2LW7A 1NT2B 3OTOO 4EB6A 2EJ7A 1D2DA 4DW1A 3CXHF 4B08A 4MTXA 3TK1A 4FIPC 2AW9A 3JSNA 4HBNA 3THOA 1ZX3A 4WBNB 1YVWA 1M93A 1Y67A 1QVGU 2AHZA 1DGSA 2OTLV 3CCRV 1EFRG 3BEHA 3CRMA 4LF6O 3JAKB 2FL4A 1VQNV 1CXZB 2OCCC 2BOBC 3OGCC 3QO8A 1R3IC 3BRCA 4PHZA 3APQA 1Y76B 2IU0A 1AI7A 2QKCA 4NXNO 3OUSA 2JJ2G 1SKVA 1S0VA 4DRXA 2B1IA 1N33O 1SZTA 1Y6XA 2JDIG 1K33A 3LSQA 4FJCC 3BFRA 3BY6A 3AG4B 4YJ2B 4TWKA 3H1LH 5HFLA 2XAHA 4X1KA 1AR4A 3FB6C 1YF2A 1K4DC 2BCCH 1W0JG 4O4LB 1AP6A 2CTQA 1N32O 1JJOA 1SRYA 4NB5A 2F4VO 2A06H 3ICXA 5LP6A 3ABLC 5LXTA 3K5MA 3N27A 4JAAA 3VQXA 1LUWA 4BIUA 3OR7C 3CC7V 5ITZB 2XNDG 2YIAA 5JCOA 4AQYB 1SC5B 3AG1B 3DXRA 2HJDA 4R6ZA 3ASOC 5EYPA 3SR2C 2ZE7A 3GWOA 3B8NA 4PI2A 4GX1A 3MHSC 1CEZA 1V54B 5B1AC 2JRIA 1FD9A 2UXNA 4U7OA 1FXVA 5IWAO 3WB1A 1G4YB 1FAFA 4UCSA 3LNNA 4WFBV 3SJAC 1H2KA 4CC5A 1XQ8A 2HHHO 1MSDA 2L35A 2X7RB 4MW8A 3HB3B 2AHYA 3HKEA 5KMGA 1VF6A 2GHYA 3F5TA 1AJQA 1YZBA 1ZL8B 3AK3A 1SQFA 2F23A 1WB8A 3OMNB 4FFKA 3SJCC 3P30A 2YI8A 4JAUA 3JAWA 3SPHA 2WLLB 1SQVH 4X1IA 3AG1C 1NTMH 3QVNA 1VQ8V 1K5SA 4EB6B 2K9PA 1AI5A 1N34B 4UB8Z 4B3SB 2LO1A 1ZLZA 2PTMA 2XTAA 3CE2A 4DV0O 3KKYA 1AROP 1HNWB 2Q68A 1IBLB 1S5LZ 4FVMA 4LFBB 5JWPA 2DN9A 2QR4A 2KKWA 1I08A 1J5EB 3K04A 2H94A 2ZIMA 1Q5OA 5IDJA 4DR6B 3NR7A 1WLEA 3A8TA 3K5LA 2V1DA 4DRXB 2LFSA 3DSQA 4O4HA 3FB8C 3ZRVA 3LDDA 1N36B 2P90A 4PDVA 4YHHO 2Q9LA 3C3TA 3M8AA 1NVPD 5J2UA 1QNMA 4X1KB 2QKSA 4NYKA 2K1EA 3CEIA 2Y69B 5EBMC 4QGPA 4W4LA 1VQ4V 1TVKA 4J7ZA 3ZMSA 1SQBH 1Q43A 1IX9A 4J9ZB 3EVKA 5GTHZ 2UUBB 4DO2A 4YIOA 1M5IA 3D36A 5KHGA 5LP6B 1QVFU 2FYUH 1HWYA 5LXTB 3CSXA 1XBLA 5FLXN 3JASA 1AR1B 4OX9O 4LCUC 1SERA 2VWKA 3DXRB 1LR1A 5EYPB 1AVMA 1GO3F 2L6LA 2EINC 3ZEDA 2F43G 4FZ1A 5K1XA 1B6QA 2AXTZ 2EILB 4C7UA 2LW1A 4NR1A 3RYCA 3JYCA 2N74A 4U3FH 3AG3C 4YJ3A 4FM2A 2Y69C 4O4IA 5B5EZ 5L3FA 5C93A 1JJ2U 2CGNA 2E5LB 4JAVA 3HKEB 5KMGB 3CCSV 3JD2A 4JI4O 3T1YB 2QWQB 3K3WA 1XL6A 4PD4F 4YY3B 1M90W 3F7VC 5LP6C 4B3RB 4JYCA 1XNQB 1Q81W 1ZAUA 1OCCC 2JEUA 3JAWB 4NXMB 3U11A 3L74H 4X1IB 1TUEB 1YSCA 2HLDG 3CP1A 1QQCA 2EJRA 5JJEB 2WLIA 5D5PA 1XDCA 4LF5O 4JTDB 2ATKC 2Z3YA 3PN1A 2Y4TA 4TQDA 3O9OA 1G1XB 3RBZA 2EILC 2YICA 1KD1W 4B3TO 3UO2A 1OJHA 1L0NH 4JI1B 3W7WA 2LFRA 4BIOA 2A7WA 2Q0AA 4LBEC 2ZDIA 1WA8A 2DQ0A 3O65A 2P06A 1LNQA 4LH7A 4PDRA 2FTKA 4O4HB 2CDYA 5EC1C 2XAJA 2DYSB 3CWBH 3OEHG 2DYRB 4LNUA 3JD3A 4DR1B 2ZQMA 5J2UB 3FFQA 1KKDA 1JOYA 2EIJB 4QIWF 4CH6A 3SPCA 4GUNA 4FLWA 2YEVA 1TVKB 3ABTA 4GX2A 2UXCO 1XOUA 3J80N 3TCUA 4OGQB 4RO2A 3R65A 1N0JA 1Y74A 3HPLC 3JASB 4UCOA 3ABMB 3QF7A 4B7EA 2YC0A 3K5OA 2W0XA 3FYEB 4DW0A 4FLTA 2JJ1G 1HW7A 1E1QG 1JQ0A 3T1YO 4J11A 4O2AA 2LP7A 4JV5B 4FPPA 1K34A 4RAIA 4DR2B 2YIBA 1O9GA 1QLEC 3JCZA 5JVDA 3RYCB 4YJ3B 3CC4V 2QWOB 1W2BU 5KHHA 2KSDA 4O4IB 2YIBD 3HKBA 4PA6A 1MSWD 2F1MA 1P49A 1PM9A 1AI6A 1XNRB 4MVMA 4X20B 1YITV 4J42A 2PI4A 5B1BC 1TA8A 3STLC 1NI8A 3GB7C 2EIKB 1SA0A 4YXWG 3ABMC 4NVPA 1KYOF 1FFXA 1UJWB 4LFCB 3KG2A 2WLIB 4PJ0Z 4LR3A 2WLHA 1HNXO 1M1KW 2UXBO 1GM7A 2ODMA 3M99B 1FJGO 3OD4A 1VMGA 1VQ9V 5D5QA 4DV7B 1WJZA 1I7FA 5H9CA 3G80A 1COWG 2QEXV 4PV1B 1W59A 2EZPA 2AZ2A 3LUTB 3JSLA 3ASNB 1SQGA 3ZBHA 2JGDA 1B3QA 4ZI7A 2EIMB 3G71V 5JH7A 1WA8B 5LGNA 4PELA 4BIZA 1VARA 1Y4MA 1SQXH 4DR7B 5GONA 3RYIA 2EZOA 3J81N 2YXLA 2BTOA 1K7DA 5A2QN 2IH1C 3ZHSA 1H2MA 1Z5VA 5HFMA 3T4ZA 1HDJA 4LNUB 1IVSA 3P3NA 2BOCC 3RYHA 5EK0A 3ABKC 4UCUA 1XEQA 2DOSA 2YEVB 3K59A 1OHHG 2NNUA 2QE7G 4P2ZA 1YHQV 1YJNV 1XMQB 1OZ0A 1N0NA 1FXHA 1HNZB 3ASNC 4GCZA 5CA1A 2CE4A 5IE9A 1R3KC 1Y74B 3L70H 2EIMC 4LF8O 1MMMA 1E1RG 4F4LA 3B4SA 2OCCB 5H6RA 5J9PC 4LF9B 3CX5F 3IJ4A 1N8RW 1XL4A 3TJTA 3AK2A 1IBKB 1XNRO 4O2AB 2JGUA 2IJHA 4JI8B 2AZ0A 1BSMA 1MZFA 1GN6A 3W7XA 3K5NA 1XHXA 3ETEA 2ZNJA 2YS8A 3CCLV 3LSSA 3G6BA 3ETDA 1OCOC 5JVDB 5IJ0A 4DXWA 4DV3O 3IC9A 2XAGA 2Q0OC 2UUCO 4E2LA 4I7ZB 2E75B 3HKCA 3CD6V 2VQFO 3VQYA 3HKBB 2DQ3A 3UM7A 1US6A 1S77D 4JI2B 1H2GA 4JYBA 1H38A 2P5OA 5LYJA 2ZCEA 2ZINA 1SA0B 4LF7O 3ABLB 2WPDG 4UVCA 3T1HO 1YI2V 1Q6HA 1FFXB 4UVAA 1WPXA 1KP2A 5H5NA 2Q6AA 3B2EE 3ASOB 4I0XA 2CGOA 1KU9A 1GRJA 2H8PC 5IT9N 4DR7O 2JIZG 2CUGA 5LOVA 5B1AB 2GSMB 1GM8A 3IGAC 4H33A 4DV5B 4DR4O 1JR9A 4Q6GA 4QPJA 2XASA 3BCCH 3DC6A 4KP4A 2HJFC 3CPWU 1VQ6V 3JD0A 3W7SA 2JGDB 3BVOA 4DV2B 4ZI7B 5A9GA 3JD4A 4DK0A 5JH7B 5B66Z 1KP3A 1GN2A 2HEPA 1F7YA 2JK5C 3AEIA 1VQ5V 5GONB 3RYIB 3H1JH 3OR6C 1XMQO 1IDSA 2O57A 5KHJA 3ABUA 1HNZO 1I5XA 1FKAO 1WP8A 1MNGA 2DE0X 4I9WA 4JGSA 5CA0A 4P30A 1BS3A 1EM1A 2ARHA 4X66O 3ZN1A 2GV9A 2BSKA 3HR0A 3D8CA 4AILC 3WG7B 2XHBA 1R1BA 1BZKA 4R50A 3RYHB 4N23A 1VQ7V 3FAVA 2Q73A 1L8DA 2VS0A 1QR8A 4KHPO 1NS1A 1KECA 4NTXA 3CHXA 1YDXA 3RN4A 4MT8A 4CZZA 4UVBA 4DV1O 5CA1B 5EZYA 5B1NA 2YXYA 4MVOA 3CCMV 3WU2Z 4ICGA 2IJJA 3GVMA 1M56B 3JCUZ 5CA3A 3C3SA 1TGOA 1DTOA 2BTQA 4K35A 3X2QC 3C90A 5BMVA 1AILA 4J9YB 4Q20A 5IYCO 5IJ0B 3WG7C 1NZ6A 4IT5A 2ITDC 3HKCB 1HR0B 4WCEV 2JVDA 4NKGB 1P4RA 1K5QA 1RPOA 4CBCA 2UUAB 1KMIZ 3T2MA 4Z1VA 5LYJB 4EKWA 3A2FA 4JASA 1K4CC 1BHAA 5LL6Y 2YI9A 1R6TA 3E22A 2PYJA 2QTSA 1L1FA 2QWRB 4IYHA 1M56C 3RGBA 1ROPA 4I0XB 1FS0G 1GM9A 5LMNB 4JZGA 4Z2WA 2EINB 3B09A 3H1KH 5LOVB 1GMGA 4JPRA 4OXSA 1MOFA 1VF5B 1I94B 3E89A 4JI3B 4FZ0A 1S72V 4XDKA 3LDEA 2W6IG 1YXBA 4I50A 3OEEG 3FYIB 4X65B 5K1PA 3CC2V 4AQYO 4KUMA 4D6TH 3AG3B 2OTJV 1K9MW 3KCYA 1BQ0A 1Q6UA 2XUMA 3QG5A 4QJFB 1Y66A 5LHIA 4I4TA 2V4DA 4K0KB 1D5NA 3ZHUA 3TXSA 1X59A 4K8ZA 4OPHA 5DM6V 4PA4A 5J2TA 1DK1A 2KQXA 4MVQA 2P4KA 5CA0B 4RWUA 1OCCB 2QTOA 4K8XA 2ZIOA 1PV0A 1ZSPA 3OFNG 2BSKB 4JI6B 2ZXWC 1JCHA 1IZ3A 4NTYA 4MVUA 1JVMA 1F23A 3FAVB 2QM4A 3L9DA 2M7WA 3U0ZA 2KG7A 4FFBA 3K03A 1V9PA 1QR9A 2Q4PA 3QTCA 5LA6A 2H3OA 1BCCH 3FD9A 3QNEA 1WP7A 3TXQA 4FMTA 5EZYB 4HNAA 1IBMB 4HYOA 1QHTA 3E86A 3AG7A 1KKCA 1R3LC 5FNVA 4LFAB 2R72A 3B8MA 4I5SA 1H2SB 1N34O 1TUBA 2QJ1A 5DN6G 4X20A 4B3SO 5BZBA 1SETA 4MTOA 3BAAA 1PNKA 3K9AA 3G6EV 1HNWO 2BTQB 1IBLO 3LNMB 5BMVB 4LFBO 3T1CA 1P7GA 4JI0B 2A9HA 2F93B 4DV6B 1J5EO 2ILMA 1GN4A 4DR6O 5E1AC 2MK3A 1NJIW 4FLVA 1L0LH 1KQSU 2UXDB 3L75H 1K3EA 4JZ2A 2QWPB 4J7KA 3CMEV 1AR5A 4CS3A 4GKKB 1K92A 4J10A 1N36O 2ZT9B 4J80A 1A32A 1BMFG 2ZM6B 4X65O 1NR1A 3E22B 4X9QA 4H13B 3ZHQA 3G67A 5FPRA 1RSOA 2YUAA 4DV4B 4CH4A 1Q82W 1EN6A 1AI4A 2JS3A 4K0KO 4HZ3A 4JI5B 3K08A 4TSFG 4X64B 1VQKV 2UUBO 3H1IH 1NVPB 5JQGA 1VIBA 4LF4B 4BW9A 4I50B 5IYDO 2IJIA 4DUZB 1SQQH 1VP7A 1P7BA 1QLEB 4JI6O 5DECA 2Z0AA 1CPYA 3UCSC 4G2KA 2XT9A 3PJSK 3T4DA 2EULA 4I4TB 1WPBA 2GBOA 3I55V 3CJHA 4L8JA 4UFZA 4TT3G 4FM1A 4IL6Z 4RQEA 5B1BB 5KLVH 3I5DA 2DMXA 5J2TB 2Q67A 2OCHA 3K0GA 1YJWV 4UCVA 1EBOA 3R66A 4DUYB 3UKMA 1IBMO 4RUEA 1JA8A 3OW2U 5KX5A 2E5LO 5KHIA 3M7MX 4GYCB 2Y4UA 1V55B 3RWRD 2B1GA 3STZC 4YY3O 2Y0IA 2KG7B 3K58A 4FFBB 4B3RO 1BGYH 1XNQO 4X1YA 5KHKA 1NKDA 4I55A 3U10A 5LA6B 4NXMO 1QCEA 4QNHB 5L3BA 3OGIB 4HNAB 3KCXA 2VRZA 3DC5A 1PKXA 5FNVB 2ZE6A 5DEDA 4O2BA 3CRRA 1H2NA 1TUBB 1OV9A 4PA9A 4AHCA 2MW2B 3I56V 2ZM6O 3CCJV 3A0RA 4GKJB 4JI1O 2FMLA 5LMUB 2B9ZA 5BR8B 4FLXA 2P6JA 3L71H 4MVSA 2RJZA 3OE7G 1V55C 2PF4E 4JTCB 2IU3A 4ZBMA 3ABKB 2ZR2A 3ZX6A 1F4NA 5AG2A 4LC1A 3ZHTA 1IURA 2Q7EA 4W4KA 5L3CA 3CB2A 4TV9A 2A3QA 5CMUA 4DUZO 3SPGA 4DR1O 3AK1A 3OTOB 3BHPA 4DK1A 5EBLC 4WFFA 3P32A 3DTUB 4X62B 1Q8IA 1RSOB 5CBFA 5IYZA 1GN3A 3JAMN 3CRAA 1MA1A 3E8FA 4CS2A 4BR6A 1EN5A 1Q3EA 4DR3B 5JQGB 1PPJH 2ZD9A 3CRQA 2RQ6A 4EFEA 4DUYO 3IC7A 1CP9A 2F66C 3SYPA 1OCOB 2ZKOA 4RUFA 3J7AU 3RVZA 3E2EA 4NXNB 4ABMA 2WAMA 1PP9H 3Q4HB 3CCEV 3BA9A 1K8AW 5CN0A 4JV5O 1RFYA 3EHBB 4PA3A 1NU1H 2ITCC 3ZIAG 3CJHB 4UUJC 1YTFD 4JYYA 4FK5C 2NN4A 4DR2O 4NTWA 4BWAA 2EBOA 1NR7A 5L3GA 1ORQC 2CK3G 1M4UA 2HP8A 2JEXA 5EIBD 5FL7G 5EBWC 3UT5A 5CB4A 4X89A 1N32B 3OMAB 5KX5B 2Q5ZA 2F4VB 3OAAG 1NH2D 3ZCCA 3MDSA 2N04A 4J7JA 5LGUA 3L73H 2PUSA 5JJNB 2PZSA 1THZA 4X1YB 4I9QA 4I55B 2RNBA 1ZWIC 2WA4A 1BL8A 3IFXA 3N2KA 1JPXA 2F95B 1JMKC 1WNSA 5LMUO 2IBZH 4LFCO 4XDLA 1WB7A 1PNMA 4A5UB 2ZE8A 4O2BB 3SJQC 5IWAB 2Y0PA 2QSAA 3SJBC 1BT8A 4DV7O 2DWDC 1FFTB 4IIJA 3EXAA 1FXKA 2DJVA 2DW4A 2HHHB 5CBGA 4DR5B 1DF5A 2IH3C 4BW5A 3K0DA 5B3SB 2XAQA 5C8YA 1NBMG 4X62O 4IGGA 1D5AA 3RYFA 2RMKB 1YCIA 2G38A 1Q6IA 1ZTEA 2WLKA 1PL0A 4DR3O 4TV9B 1Z2GA 1GKFA 4GT1A 1M57C 1SF9A 4PI0A 2PI5A 2HKOA 2BE3A 3WB2A 1YEWA 4JYAB 3RW0A 2CAZC 4ASUG 4MS2A 3ZRXA 5IYZB 3D3IA 4J41A 4DV0B 5IY5B 2XAFA 2Y48A 4DYLA 4FLUA 1JFFA 2OIGA 2YDEA 4PDMA 2WLNA 1NTKH 5IYBO 3CRCA 4WF9V 2Z5UA 2D2CB 3X2QB 2RN9A 2P4VA 1NQTA 4AI8A 5B3SC 1OCZB 4E4EA 2JS5A 4LF9O 4LWSA 1EZVH 5EC2C 1F4MA 2CTPA 1YTFB 2CH7A 1IXBA 5GTIZ 3ZMZA 1IBKO 3MAQA 3SYQA 5LGTA 4K3AA 4JI8O 2R9RB 1GAXA 2LGQA 4JTAB 4EFBA 4BAYA 4YHHB 2V7QG 3K9SA 2YXHA 1ENVA 4TV8A 4FLZA 2YIDA 1SESA 1S5HC 4PA7A 2LGWA 1NH2B 3UT5B 5CB4B 1H8EG 3OM3B 3JATA 3QO7A 4TQFA 4YIPA 2D3OW 3BA8A 5KUMA 3GWKC 4U3JA 5IY5C 1TAEA 4ZHQA 3A0BZ 3RT3C 1XILA 3AG4C 1B06A 4JI2O 2VQEB 4U7NA 1UFIA 3SGIA 3CS5A 2HG5C 5KAFZ 1VF7A 2W0FC 4OX9B 2ZR3A 2AGAA 4FM0A 3E8GA 4DR5O 3N2KB 4CS4A 1OCZC 2GDSA 1SS3A 2YSUB 4MTFA 3ZS8C 5IJ9A 2A79B 1BE3H 1AB3A 1J95A 1T5EA 4F6EA 2OIEA 4WFEA 1E79G 5EIBC 4IYIA 4DV5O 4H37A 4MVZA 4IIJB 1YJ9V 4LH6A 1FXKB 5GW7A 1OCRB 4QPKA 2FB5A 3LDCA 1QBZA 4DV2O 4JYAO 1V54C 4JI4B 5C8YB 3B77A 2ZXWB 4G27B 3E8BA 3RYFB 1UPGA 5LBQA 1VQLV 1XMOB 1GH6A 2C2AA 2VWJA 4TUYA 4OPAA 1GK9A 4LF5B 2X6CA 4WFAV 2Q7GA 2WSSG 3VBBA 4X8AA 2IW5A 4Z1MG 2E76B 4UV9A 2GUZA 2NR5A 1KB9F 3BABA 1URFA 3BPZA 4B3TB 1FXKC 3K06A 3ZRWA 1OCRC 2ADQB 4P9PA 1JFFB 3SYAA 4D7SA 5LHHA 1Q86W 1S3JA 3MD0A 2A0LA 1W0KG 4P9OA 3FKSG 2XOKG 3KZIZ 5H6QA 3W7TA 3H01A 3SYOA 4LWSB 3HKDA 1I0HA 2CH7B 3ETGA 4MVRA 2VQEO 4L87A 4LP8A 3K79A 3CMAV 3ZMUA 2IJKA 4GLXA 3CCVV 2OYQA 2R70A 1RP3B 4TV8B 4EEQA 1FPOA 1DF4A 4CH3A 3VQWA 1R73A 4JF3A 1VQOV 3E8HA 3ZHVA 1HR0O 2HVKC 1S76D 3JATB 1PNLA 2UUAO 2UXCB 4U3JB 4ZHQB 4B3MB 2UXXA 2IM9A 5B1OA 5FPOA 3G4SV 3K57A 1QLNA 2OT5A 4JI7B 2LQTA 3H1HH 3N2GA 5LHGA 3TETA 3JARA 1SZXA 4X88A 5IJ9B 4QE9A 5CBHA 1R3JC 3ZMVA 2FKXA 2W6JG 1B04A 4F6RA 5LMNO 4XDJA 3UO3A 2P67A 1I94O 1XMOO 3DGEA 4KXRA 5JCOC 4JI3O 2WA3A 1VQMV 4G28B 1NTZH 1S5JA 3CYOA 2R9AA 3FB7C 1LUVA 2GTAA 3ZHRA 1KBHA 3E83A 1Q90D 4ZIBA 1MABG 3SPJA 4R8CA 3NXSA 4UXNA 2ADPA 4GX0A 3SPIA 2X6AA 1X4TA 3ZRSA 1DLBA 2B5UA 4PDLA 1GTOA 4TUYB 2M6YA 3RVYA 1VF6C 2QM8A 3SDLA 3JALA 3MHHC 1HNXB 4B7KA 2UXBB 1FJGB 2PYLA 4IHJA 2E74B 2GUZB 4KFMA 3AG2B 3Q4HA 5KA6A 1PD3A 2RDCA 3ZRWB 4MTGA 2P7TC 4GX5A 1H8HG 2WLJA 4O4JA 3RFRA 1JX9A 1R6NA 3EFFK 3CCUV 2CTRA 2UU9B 4UCRA 4WFGA 4LFAO 1VEWA 3F5WC 3HKDB 2Q69A 1KUQA 4B3MO 2RCVA 3F7YC 2QKAA 1MG1A 3IAYA 1H2LA 3E35A 4FLYA 3ML0A 4KL1A 4JI7O 2DWEC 3QO5A 3P3PA 1XHZA 4JI0O 4QE7A 2QWNB 4HAMA 2N05A 4MW3A 4DV6O 2ZNIA 3AG2C 4ZOLA 2QA4V 1YIJV 2DYSC 2X6BA
chains in the Genus database with same CATH topology
1URFA 2HJDA 1CXZB 2Q0OC 4DYLA 4IGGA 1RFYA 4NB5A 1US6A 2RMKB 1UPGA 4NKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URF A;  2HJD A;  1CXZ B;  2Q0O C;  4DYL A;  4IGG A;  1RFY A;  4NB5 A;  1US6 A;  2RMK B;  1UPG A;  4NKG B; 
#chains in the Genus database with same CATH topology
 2UXD O;  5KA5 A;  2ZE5 A;  2DYR C;  3FB5 C;  2HR3 A;  4GKK O;  2E3C A;  4RQF A;  2EIJ C;  2HVJ C;  1RM1 B;  2KB1 A;  4LF8 B;  3N2G B;  5L3D A;  3JAR B;  4UV8 A;  3ZN0 A;  4XBF A;  4DV4 O;  1MZE A;  3APO A;  1N4C A;  4CC6 A;  3D36 C;  4WBN A;  4JI5 O;  5E79 Z;  4F6R B;  3ETQ A;  1HP8 A;  4X64 O;  1AJN A;  3H9V A;  1K97 A;  3JAK A;  4MSW C;  3UQ8 A;  2LJ2 A;  1R6K A;  4LF4 O;  4DV3 B;  1Z5W A;  3VQV A;  5JJJ B;  2UUC B;  3VOU A;  5KAI Z;  2VQF B;  3FX7 A;  3S3W A;  1Y76 A;  1KC8 W;  3SYC A;  5L3E A;  2WLM A;  3WFV A;  4R7C A;  3OTF A;  1FYJ A;  1K73 W;  4UB6 Z;  4H0L B;  2P22 C;  4YJ2 A;  1WN7 A;  4LF7 B;  1WAZ A;  1AJP A;  3WB0 A;  1RM1 C;  1BHB A;  4LF6 B;  1SQP H;  3A0H Z;  3T1H B;  1XI1 A;  3L72 H;  1I5Y A;  2HFE C;  1XUQ A;  4O4L A;  1O9H A;  1RPR A;  3JAL B;  4WFH A;  3S3X A;  2OWO A;  2UU9 O;  1AP5 A;  2EIK C;  2EX3 A;  2WWW A;  4IHJ B;  2Q7H A;  1N33 B;  1EZJ A;  3CXC U;  4DR4 B;  4UCT A;  4CH5 A;  2ETN A;  5F2V O;  3ZMT A;  5ITZ A;  4O4J B;  1QU7 A;  5BXZ A;  4GZR B;  4ZKI A;  1ZUQ A;  5H2F Z;  1G8M A;  3OUF A;  2CTW A;  4D7T A;  1EN4 A;  3D3Q A;  1IXM A;  5TIS Z;  1F51 A;  4TOI A;  1VQP V;  5KUK A;  3TGU H;  4X66 B;  2NLJ C;  3JD1 A;  3B40 A;  1U96 A;  4N21 A;  4GKJ O;  2ZDI C;  2Q8V A;  2R9I A;  1G6U A;  1U97 A;  2GTS A;  1M57 B;  5BR8 O;  3OMI B;  1PL4 A;  1ZL8 A;  2QM7 A;  4ZOL B;  2PGG A;  2QGN A;  3ZJZ A;  4KHP B;  1Q7Y W;  5BY1 A;  2WLL A;  4DV1 B;  1BQZ A;  2X0L A;  3CCQ V;  3OT7 A;  2QDO A;  3LSU A;  1P84 F;  3W7U A;  4H44 B;  1M9N A;  1XRE A;  2PY5 A;  2LW7 A;  1NT2 B;  3OTO O;  4EB6 A;  2EJ7 A;  1D2D A;  4DW1 A;  3CXH F;  4B08 A;  4MTX A;  3TK1 A;  4FIP C;  2AW9 A;  3JSN A;  4HBN A;  3THO A;  1ZX3 A;  4WBN B;  1YVW A;  1M93 A;  1Y67 A;  1QVG U;  2AHZ A;  1DGS A;  2OTL V;  3CCR V;  1EFR G;  3BEH A;  3CRM A;  4LF6 O;  3JAK B;  2FL4 A;  1VQN V;  1CXZ B;  2OCC C;  2BOB C;  3OGC C;  3QO8 A;  1R3I C;  3BRC A;  4PHZ A;  3APQ A;  1Y76 B;  2IU0 A;  1AI7 A;  2QKC A;  4NXN O;  3OUS A;  2JJ2 G;  1SKV A;  1S0V A;  4DRX A;  2B1I A;  1N33 O;  1SZT A;  1Y6X A;  2JDI G;  1K33 A;  3LSQ A;  4FJC C;  3BFR A;  3BY6 A;  3AG4 B;  4YJ2 B;  4TWK A;  3H1L H;  5HFL A;  2XAH A;  4X1K A;  1AR4 A;  3FB6 C;  1YF2 A;  1K4D C;  2BCC H;  1W0J G;  4O4L B;  1AP6 A;  2CTQ A;  1N32 O;  1JJO A;  1SRY A;  4NB5 A;  2F4V O;  2A06 H;  3ICX A;  5LP6 A;  3ABL C;  5LXT A;  3K5M A;  3N27 A;  4JAA A;  3VQX A;  1LUW A;  4BIU A;  3OR7 C;  3CC7 V;  5ITZ B;  2XND G;  2YIA A;  5JCO A;  4AQY B;  1SC5 B;  3AG1 B;  3DXR A;  2HJD A;  4R6Z A;  3ASO C;  5EYP A;  3SR2 C;  2ZE7 A;  3GWO A;  3B8N A;  4PI2 A;  4GX1 A;  3MHS C;  1CEZ A;  1V54 B;  5B1A C;  2JRI A;  1FD9 A;  2UXN A;  4U7O A;  1FXV A;  5IWA O;  3WB1 A;  1G4Y B;  1FAF A;  4UCS A;  3LNN A;  4WFB V;  3SJA C;  1H2K A;  4CC5 A;  1XQ8 A;  2HHH O;  1MSD A;  2L35 A;  2X7R B;  4MW8 A;  3HB3 B;  2AHY A;  3HKE A;  5KMG A;  1VF6 A;  2GHY A;  3F5T A;  1AJQ A;  1YZB A;  1ZL8 B;  3AK3 A;  1SQF A;  2F23 A;  1WB8 A;  3OMN B;  4FFK A;  3SJC C;  3P30 A;  2YI8 A;  4JAU A;  3JAW A;  3SPH A;  2WLL B;  1SQV H;  4X1I A;  3AG1 C;  1NTM H;  3QVN A;  1VQ8 V;  1K5S A;  4EB6 B;  2K9P A;  1AI5 A;  1N34 B;  4UB8 Z;  4B3S B;  2LO1 A;  1ZLZ A;  2PTM A;  2XTA A;  3CE2 A;  4DV0 O;  3KKY A;  1ARO P;  1HNW B;  2Q68 A;  1IBL B;  1S5L Z;  4FVM A;  4LFB B;  5JWP A;  2DN9 A;  2QR4 A;  2KKW A;  1I08 A;  1J5E B;  3K04 A;  2H94 A;  2ZIM A;  1Q5O A;  5IDJ A;  4DR6 B;  3NR7 A;  1WLE A;  3A8T A;  3K5L A;  2V1D A;  4DRX B;  2LFS A;  3DSQ A;  4O4H A;  3FB8 C;  3ZRV A;  3LDD A;  1N36 B;  2P90 A;  4PDV A;  4YHH O;  2Q9L A;  3C3T A;  3M8A A;  1NVP D;  5J2U A;  1QNM A;  4X1K B;  2QKS A;  4NYK A;  2K1E A;  3CEI A;  2Y69 B;  5EBM C;  4QGP A;  4W4L A;  1VQ4 V;  1TVK A;  4J7Z A;  3ZMS A;  1SQB H;  1Q43 A;  1IX9 A;  4J9Z B;  3EVK A;  5GTH Z;  2UUB B;  4DO2 A;  4YIO A;  1M5I A;  3D36 A;  5KHG A;  5LP6 B;  1QVF U;  2FYU H;  1HWY A;  5LXT B;  3CSX A;  1XBL A;  5FLX N;  3JAS A;  1AR1 B;  4OX9 O;  4LCU C;  1SER A;  2VWK A;  3DXR B;  1LR1 A;  5EYP B;  1AVM A;  1GO3 F;  2L6L A;  2EIN C;  3ZED A;  2F43 G;  4FZ1 A;  5K1X A;  1B6Q A;  2AXT Z;  2EIL B;  4C7U A;  2LW1 A;  4NR1 A;  3RYC A;  3JYC A;  2N74 A;  4U3F H;  3AG3 C;  4YJ3 A;  4FM2 A;  2Y69 C;  4O4I A;  5B5E Z;  5L3F A;  5C93 A;  1JJ2 U;  2CGN A;  2E5L B;  4JAV A;  3HKE B;  5KMG B;  3CCS V;  3JD2 A;  4JI4 O;  3T1Y B;  2QWQ B;  3K3W A;  1XL6 A;  4PD4 F;  4YY3 B;  1M90 W;  3F7V C;  5LP6 C;  4B3R B;  4JYC A;  1XNQ B;  1Q81 W;  1ZAU A;  1OCC C;  2JEU A;  3JAW B;  4NXM B;  3U11 A;  3L74 H;  4X1I B;  1TUE B;  1YSC A;  2HLD G;  3CP1 A;  1QQC A;  2EJR A;  5JJE B;  2WLI A;  5D5P A;  1XDC A;  4LF5 O;  4JTD B;  2ATK C;  2Z3Y A;  3PN1 A;  2Y4T A;  4TQD A;  3O9O A;  1G1X B;  3RBZ A;  2EIL C;  2YIC A;  1KD1 W;  4B3T O;  3UO2 A;  1OJH A;  1L0N H;  4JI1 B;  3W7W A;  2LFR A;  4BIO A;  2A7W A;  2Q0A A;  4LBE C;  2ZDI A;  1WA8 A;  2DQ0 A;  3O65 A;  2P06 A;  1LNQ A;  4LH7 A;  4PDR A;  2FTK A;  4O4H B;  2CDY A;  5EC1 C;  2XAJ A;  2DYS B;  3CWB H;  3OEH G;  2DYR B;  4LNU A;  3JD3 A;  4DR1 B;  2ZQM A;  5J2U B;  3FFQ A;  1KKD A;  1JOY A;  2EIJ B;  4QIW F;  4CH6 A;  3SPC A;  4GUN A;  4FLW A;  2YEV A;  1TVK B;  3ABT A;  4GX2 A;  2UXC O;  1XOU A;  3J80 N;  3TCU A;  4OGQ B;  4RO2 A;  3R65 A;  1N0J A;  1Y74 A;  3HPL C;  3JAS B;  4UCO A;  3ABM B;  3QF7 A;  4B7E A;  2YC0 A;  3K5O A;  2W0X A;  3FYE B;  4DW0 A;  4FLT A;  2JJ1 G;  1HW7 A;  1E1Q G;  1JQ0 A;  3T1Y O;  4J11 A;  4O2A A;  2LP7 A;  4JV5 B;  4FPP A;  1K34 A;  4RAI A;  4DR2 B;  2YIB A;  1O9G A;  1QLE C;  3JCZ A;  5JVD A;  3RYC B;  4YJ3 B;  3CC4 V;  2QWO B;  1W2B U;  5KHH A;  2KSD A;  4O4I B;  2YIB D;  3HKB A;  4PA6 A;  1MSW D;  2F1M A;  1P49 A;  1PM9 A;  1AI6 A;  1XNR B;  4MVM A;  4X20 B;  1YIT V;  4J42 A;  2PI4 A;  5B1B C;  1TA8 A;  3STL C;  1NI8 A;  3GB7 C;  2EIK B;  1SA0 A;  4YXW G;  3ABM C;  4NVP A;  1KYO F;  1FFX A;  1UJW B;  4LFC B;  3KG2 A;  2WLI B;  4PJ0 Z;  4LR3 A;  2WLH A;  1HNX O;  1M1K W;  2UXB O;  1GM7 A;  2ODM A;  3M99 B;  1FJG O;  3OD4 A;  1VMG A;  1VQ9 V;  5D5Q A;  4DV7 B;  1WJZ A;  1I7F A;  5H9C A;  3G80 A;  1COW G;  2QEX V;  4PV1 B;  1W59 A;  2EZP A;  2AZ2 A;  3LUT B;  3JSL A;  3ASN B;  1SQG A;  3ZBH A;  2JGD A;  1B3Q A;  4ZI7 A;  2EIM B;  3G71 V;  5JH7 A;  1WA8 B;  5LGN A;  4PEL A;  4BIZ A;  1VAR A;  1Y4M A;  1SQX H;  4DR7 B;  5GON A;  3RYI A;  2EZO A;  3J81 N;  2YXL A;  2BTO A;  1K7D A;  5A2Q N;  2IH1 C;  3ZHS A;  1H2M A;  1Z5V A;  5HFM A;  3T4Z A;  1HDJ A;  4LNU B;  1IVS A;  3P3N A;  2BOC C;  3RYH A;  5EK0 A;  3ABK C;  4UCU A;  1XEQ A;  2DOS A;  2YEV B;  3K59 A;  1OHH G;  2NNU A;  2QE7 G;  4P2Z A;  1YHQ V;  1YJN V;  1XMQ B;  1OZ0 A;  1N0N A;  1FXH A;  1HNZ B;  3ASN C;  4GCZ A;  5CA1 A;  2CE4 A;  5IE9 A;  1R3K C;  1Y74 B;  3L70 H;  2EIM C;  4LF8 O;  1MMM A;  1E1R G;  4F4L A;  3B4S A;  2OCC B;  5H6R A;  5J9P C;  4LF9 B;  3CX5 F;  3IJ4 A;  1N8R W;  1XL4 A;  3TJT A;  3AK2 A;  1IBK B;  1XNR O;  4O2A B;  2JGU A;  2IJH A;  4JI8 B;  2AZ0 A;  1BSM A;  1MZF A;  1GN6 A;  3W7X A;  3K5N A;  1XHX A;  3ETE A;  2ZNJ A;  2YS8 A;  3CCL V;  3LSS A;  3G6B A;  3ETD A;  1OCO C;  5JVD B;  5IJ0 A;  4DXW A;  4DV3 O;  3IC9 A;  2XAG A;  2Q0O C;  2UUC O;  4E2L A;  4I7Z B;  2E75 B;  3HKC A;  3CD6 V;  2VQF O;  3VQY A;  3HKB B;  2DQ3 A;  3UM7 A;  1US6 A;  1S77 D;  4JI2 B;  1H2G A;  4JYB A;  1H38 A;  2P5O A;  5LYJ A;  2ZCE A;  2ZIN A;  1SA0 B;  4LF7 O;  3ABL B;  2WPD G;  4UVC A;  3T1H O;  1YI2 V;  1Q6H A;  1FFX B;  4UVA A;  1WPX A;  1KP2 A;  5H5N A;  2Q6A A;  3B2E E;  3ASO B;  4I0X A;  2CGO A;  1KU9 A;  1GRJ A;  2H8P C;  5IT9 N;  4DR7 O;  2JIZ G;  2CUG A;  5LOV A;  5B1A B;  2GSM B;  1GM8 A;  3IGA C;  4H33 A;  4DV5 B;  4DR4 O;  1JR9 A;  4Q6G A;  4QPJ A;  2XAS A;  3BCC H;  3DC6 A;  4KP4 A;  2HJF C;  3CPW U;  1VQ6 V;  3JD0 A;  3W7S A;  2JGD B;  3BVO A;  4DV2 B;  4ZI7 B;  5A9G A;  3JD4 A;  4DK0 A;  5JH7 B;  5B66 Z;  1KP3 A;  1GN2 A;  2HEP A;  1F7Y A;  2JK5 C;  3AEI A;  1VQ5 V;  5GON B;  3RYI B;  3H1J H;  3OR6 C;  1XMQ O;  1IDS A;  2O57 A;  5KHJ A;  3ABU A;  1HNZ O;  1I5X A;  1FKA O;  1WP8 A;  1MNG A;  2DE0 X;  4I9W A;  4JGS A;  5CA0 A;  4P30 A;  1BS3 A;  1EM1 A;  2ARH A;  4X66 O;  3ZN1 A;  2GV9 A;  2BSK A;  3HR0 A;  3D8C A;  4AIL C;  3WG7 B;  2XHB A;  1R1B A;  1BZK A;  4R50 A;  3RYH B;  4N23 A;  1VQ7 V;  3FAV A;  2Q73 A;  1L8D A;  2VS0 A;  1QR8 A;  4KHP O;  1NS1 A;  1KEC A;  4NTX A;  3CHX A;  1YDX A;  3RN4 A;  4MT8 A;  4CZZ A;  4UVB A;  4DV1 O;  5CA1 B;  5EZY A;  5B1N A;  2YXY A;  4MVO A;  3CCM V;  3WU2 Z;  4ICG A;  2IJJ A;  3GVM A;  1M56 B;  3JCU Z;  5CA3 A;  3C3S A;  1TGO A;  1DTO A;  2BTQ A;  4K35 A;  3X2Q C;  3C90 A;  5BMV A;  1AIL A;  4J9Y B;  4Q20 A;  5IYC O;  5IJ0 B;  3WG7 C;  1NZ6 A;  4IT5 A;  2ITD C;  3HKC B;  1HR0 B;  4WCE V;  2JVD A;  4NKG B;  1P4R A;  1K5Q A;  1RPO A;  4CBC A;  2UUA B;  1KMI Z;  3T2M A;  4Z1V A;  5LYJ B;  4EKW A;  3A2F A;  4JAS A;  1K4C C;  1BHA A;  5LL6 Y;  2YI9 A;  1R6T A;  3E22 A;  2PYJ A;  2QTS A;  1L1F A;  2QWR B;  4IYH A;  1M56 C;  3RGB A;  1ROP A;  4I0X B;  1FS0 G;  1GM9 A;  5LMN B;  4JZG A;  4Z2W A;  2EIN B;  3B09 A;  3H1K H;  5LOV B;  1GMG A;  4JPR A;  4OXS A;  1MOF A;  1VF5 B;  1I94 B;  3E89 A;  4JI3 B;  4FZ0 A;  1S72 V;  4XDK A;  3LDE A;  2W6I G;  1YXB A;  4I50 A;  3OEE G;  3FYI B;  4X65 B;  5K1P A;  3CC2 V;  4AQY O;  4KUM A;  4D6T H;  3AG3 B;  2OTJ V;  1K9M W;  3KCY A;  1BQ0 A;  1Q6U A;  2XUM A;  3QG5 A;  4QJF B;  1Y66 A;  5LHI A;  4I4T A;  2V4D A;  4K0K B;  1D5N A;  3ZHU A;  3TXS A;  1X59 A;  4K8Z A;  4OPH A;  5DM6 V;  4PA4 A;  5J2T A;  1DK1 A;  2KQX A;  4MVQ A;  2P4K A;  5CA0 B;  4RWU A;  1OCC B;  2QTO A;  4K8X A;  2ZIO A;  1PV0 A;  1ZSP A;  3OFN G;  2BSK B;  4JI6 B;  2ZXW C;  1JCH A;  1IZ3 A;  4NTY A;  4MVU A;  1JVM A;  1F23 A;  3FAV B;  2QM4 A;  3L9D A;  2M7W A;  3U0Z A;  2KG7 A;  4FFB A;  3K03 A;  1V9P A;  1QR9 A;  2Q4P A;  3QTC A;  5LA6 A;  2H3O A;  1BCC H;  3FD9 A;  3QNE A;  1WP7 A;  3TXQ A;  4FMT A;  5EZY B;  4HNA A;  1IBM B;  4HYO A;  1QHT A;  3E86 A;  3AG7 A;  1KKC A;  1R3L C;  5FNV A;  4LFA B;  2R72 A;  3B8M A;  4I5S A;  1H2S B;  1N34 O;  1TUB A;  2QJ1 A;  5DN6 G;  4X20 A;  4B3S O;  5BZB A;  1SET A;  4MTO A;  3BAA A;  1PNK A;  3K9A A;  3G6E V;  1HNW O;  2BTQ B;  1IBL O;  3LNM B;  5BMV B;  4LFB O;  3T1C A;  1P7G A;  4JI0 B;  2A9H A;  2F93 B;  4DV6 B;  1J5E O;  2ILM A;  1GN4 A;  4DR6 O;  5E1A C;  2MK3 A;  1NJI W;  4FLV A;  1L0L H;  1KQS U;  2UXD B;  3L75 H;  1K3E A;  4JZ2 A;  2QWP B;  4J7K A;  3CME V;  1AR5 A;  4CS3 A;  4GKK B;  1K92 A;  4J10 A;  1N36 O;  2ZT9 B;  4J80 A;  1A32 A;  1BMF G;  2ZM6 B;  4X65 O;  1NR1 A;  3E22 B;  4X9Q A;  4H13 B;  3ZHQ A;  3G67 A;  5FPR A;  1RSO A;  2YUA A;  4DV4 B;  4CH4 A;  1Q82 W;  1EN6 A;  1AI4 A;  2JS3 A;  4K0K O;  4HZ3 A;  4JI5 B;  3K08 A;  4TSF G;  4X64 B;  1VQK V;  2UUB O;  3H1I H;  1NVP B;  5JQG A;  1VIB A;  4LF4 B;  4BW9 A;  4I50 B;  5IYD O;  2IJI A;  4DUZ B;  1SQQ H;  1VP7 A;  1P7B A;  1QLE B;  4JI6 O;  5DEC A;  2Z0A A;  1CPY A;  3UCS C;  4G2K A;  2XT9 A;  3PJS K;  3T4D A;  2EUL A;  4I4T B;  1WPB A;  2GBO A;  3I55 V;  3CJH A;  4L8J A;  4UFZ A;  4TT3 G;  4FM1 A;  4IL6 Z;  4RQE A;  5B1B B;  5KLV H;  3I5D A;  2DMX A;  5J2T B;  2Q67 A;  2OCH A;  3K0G A;  1YJW V;  4UCV A;  1EBO A;  3R66 A;  4DUY B;  3UKM A;  1IBM O;  4RUE A;  1JA8 A;  3OW2 U;  5KX5 A;  2E5L O;  5KHI A;  3M7M X;  4GYC B;  2Y4U A;  1V55 B;  3RWR D;  2B1G A;  3STZ C;  4YY3 O;  2Y0I A;  2KG7 B;  3K58 A;  4FFB B;  4B3R O;  1BGY H;  1XNQ O;  4X1Y A;  5KHK A;  1NKD A;  4I55 A;  3U10 A;  5LA6 B;  4NXM O;  1QCE A;  4QNH B;  5L3B A;  3OGI B;  4HNA B;  3KCX A;  2VRZ A;  3DC5 A;  1PKX A;  5FNV B;  2ZE6 A;  5DED A;  4O2B A;  3CRR A;  1H2N A;  1TUB B;  1OV9 A;  4PA9 A;  4AHC A;  2MW2 B;  3I56 V;  2ZM6 O;  3CCJ V;  3A0R A;  4GKJ B;  4JI1 O;  2FML A;  5LMU B;  2B9Z A;  5BR8 B;  4FLX A;  2P6J A;  3L71 H;  4MVS A;  2RJZ A;  3OE7 G;  1V55 C;  2PF4 E;  4JTC B;  2IU3 A;  4ZBM A;  3ABK B;  2ZR2 A;  3ZX6 A;  1F4N A;  5AG2 A;  4LC1 A;  3ZHT A;  1IUR A;  2Q7E A;  4W4K A;  5L3C A;  3CB2 A;  4TV9 A;  2A3Q A;  5CMU A;  4DUZ O;  3SPG A;  4DR1 O;  3AK1 A;  3OTO B;  3BHP A;  4DK1 A;  5EBL C;  4WFF A;  3P32 A;  3DTU B;  4X62 B;  1Q8I A;  1RSO B;  5CBF A;  5IYZ A;  1GN3 A;  3JAM N;  3CRA A;  1MA1 A;  3E8F A;  4CS2 A;  4BR6 A;  1EN5 A;  1Q3E A;  4DR3 B;  5JQG B;  1PPJ H;  2ZD9 A;  3CRQ A;  2RQ6 A;  4EFE A;  4DUY O;  3IC7 A;  1CP9 A;  2F66 C;  3SYP A;  1OCO B;  2ZKO A;  4RUF A;  3J7A U;  3RVZ A;  3E2E A;  4NXN B;  4ABM A;  2WAM A;  1PP9 H;  3Q4H B;  3CCE V;  3BA9 A;  1K8A W;  5CN0 A;  4JV5 O;  1RFY A;  3EHB B;  4PA3 A;  1NU1 H;  2ITC C;  3ZIA G;  3CJH B;  4UUJ C;  1YTF D;  4JYY A;  4FK5 C;  2NN4 A;  4DR2 O;  4NTW A;  4BWA A;  2EBO A;  1NR7 A;  5L3G A;  1ORQ C;  2CK3 G;  1M4U A;  2HP8 A;  2JEX A;  5EIB D;  5FL7 G;  5EBW C;  3UT5 A;  5CB4 A;  4X89 A;  1N32 B;  3OMA B;  5KX5 B;  2Q5Z A;  2F4V B;  3OAA G;  1NH2 D;  3ZCC A;  3MDS A;  2N04 A;  4J7J A;  5LGU A;  3L73 H;  2PUS A;  5JJN B;  2PZS A;  1THZ A;  4X1Y B;  4I9Q A;  4I55 B;  2RNB A;  1ZWI C;  2WA4 A;  1BL8 A;  3IFX A;  3N2K A;  1JPX A;  2F95 B;  1JMK C;  1WNS A;  5LMU O;  2IBZ H;  4LFC O;  4XDL A;  1WB7 A;  1PNM A;  4A5U B;  2ZE8 A;  4O2B B;  3SJQ C;  5IWA B;  2Y0P A;  2QSA A;  3SJB C;  1BT8 A;  4DV7 O;  2DWD C;  1FFT B;  4IIJ A;  3EXA A;  1FXK A;  2DJV A;  2DW4 A;  2HHH B;  5CBG A;  4DR5 B;  1DF5 A;  2IH3 C;  4BW5 A;  3K0D A;  5B3S B;  2XAQ A;  5C8Y A;  1NBM G;  4X62 O;  4IGG A;  1D5A A;  3RYF A;  2RMK B;  1YCI A;  2G38 A;  1Q6I A;  1ZTE A;  2WLK A;  1PL0 A;  4DR3 O;  4TV9 B;  1Z2G A;  1GKF A;  4GT1 A;  1M57 C;  1SF9 A;  4PI0 A;  2PI5 A;  2HKO A;  2BE3 A;  3WB2 A;  1YEW A;  4JYA B;  3RW0 A;  2CAZ C;  4ASU G;  4MS2 A;  3ZRX A;  5IYZ B;  3D3I A;  4J41 A;  4DV0 B;  5IY5 B;  2XAF A;  2Y48 A;  4DYL A;  4FLU A;  1JFF A;  2OIG A;  2YDE A;  4PDM A;  2WLN A;  1NTK H;  5IYB O;  3CRC A;  4WF9 V;  2Z5U A;  2D2C B;  3X2Q B;  2RN9 A;  2P4V A;  1NQT A;  4AI8 A;  5B3S C;  1OCZ B;  4E4E A;  2JS5 A;  4LF9 O;  4LWS A;  1EZV H;  5EC2 C;  1F4M A;  2CTP A;  1YTF B;  2CH7 A;  1IXB A;  5GTI Z;  3ZMZ A;  1IBK O;  3MAQ A;  3SYQ A;  5LGT A;  4K3A A;  4JI8 O;  2R9R B;  1GAX A;  2LGQ A;  4JTA B;  4EFB A;  4BAY A;  4YHH B;  2V7Q G;  3K9S A;  2YXH A;  1ENV A;  4TV8 A;  4FLZ A;  2YID A;  1SES A;  1S5H C;  4PA7 A;  2LGW A;  1NH2 B;  3UT5 B;  5CB4 B;  1H8E G;  3OM3 B;  3JAT A;  3QO7 A;  4TQF A;  4YIP A;  2D3O W;  3BA8 A;  5KUM A;  3GWK C;  4U3J A;  5IY5 C;  1TAE A;  4ZHQ A;  3A0B Z;  3RT3 C;  1XIL A;  3AG4 C;  1B06 A;  4JI2 O;  2VQE B;  4U7N A;  1UFI A;  3SGI A;  3CS5 A;  2HG5 C;  5KAF Z;  1VF7 A;  2W0F C;  4OX9 B;  2ZR3 A;  2AGA A;  4FM0 A;  3E8G A;  4DR5 O;  3N2K B;  4CS4 A;  1OCZ C;  2GDS A;  1SS3 A;  2YSU B;  4MTF A;  3ZS8 C;  5IJ9 A;  2A79 B;  1BE3 H;  1AB3 A;  1J95 A;  1T5E A;  4F6E A;  2OIE A;  4WFE A;  1E79 G;  5EIB C;  4IYI A;  4DV5 O;  4H37 A;  4MVZ A;  4IIJ B;  1YJ9 V;  4LH6 A;  1FXK B;  5GW7 A;  1OCR B;  4QPK A;  2FB5 A;  3LDC A;  1QBZ A;  4DV2 O;  4JYA O;  1V54 C;  4JI4 B;  5C8Y B;  3B77 A;  2ZXW B;  4G27 B;  3E8B A;  3RYF B;  1UPG A;  5LBQ A;  1VQL V;  1XMO B;  1GH6 A;  2C2A A;  2VWJ A;  4TUY A;  4OPA A;  1GK9 A;  4LF5 B;  2X6C A;  4WFA V;  2Q7G A;  2WSS G;  3VBB A;  4X8A A;  2IW5 A;  4Z1M G;  2E76 B;  4UV9 A;  2GUZ A;  2NR5 A;  1KB9 F;  3BAB A;  1URF A;  3BPZ A;  4B3T B;  1FXK C;  3K06 A;  3ZRW A;  1OCR C;  2ADQ B;  4P9P A;  1JFF B;  3SYA A;  4D7S A;  5LHH A;  1Q86 W;  1S3J A;  3MD0 A;  2A0L A;  1W0K G;  4P9O A;  3FKS G;  2XOK G;  3KZI Z;  5H6Q A;  3W7T A;  3H01 A;  3SYO A;  4LWS B;  3HKD A;  1I0H A;  2CH7 B;  3ETG A;  4MVR A;  2VQE O;  4L87 A;  4LP8 A;  3K79 A;  3CMA V;  3ZMU A;  2IJK A;  4GLX A;  3CCV V;  2OYQ A;  2R70 A;  1RP3 B;  4TV8 B;  4EEQ A;  1FPO A;  1DF4 A;  4CH3 A;  3VQW A;  1R73 A;  4JF3 A;  1VQO V;  3E8H A;  3ZHV A;  1HR0 O;  2HVK C;  1S76 D;  3JAT B;  1PNL A;  2UUA O;  2UXC B;  4U3J B;  4ZHQ B;  4B3M B;  2UXX A;  2IM9 A;  5B1O A;  5FPO A;  3G4S V;  3K57 A;  1QLN A;  2OT5 A;  4JI7 B;  2LQT A;  3H1H H;  3N2G A;  5LHG A;  3TET A;  3JAR A;  1SZX A;  4X88 A;  5IJ9 B;  4QE9 A;  5CBH A;  1R3J C;  3ZMV A;  2FKX A;  2W6J G;  1B04 A;  4F6R A;  5LMN O;  4XDJ A;  3UO3 A;  2P67 A;  1I94 O;  1XMO O;  3DGE A;  4KXR A;  5JCO C;  4JI3 O;  2WA3 A;  1VQM V;  4G28 B;  1NTZ H;  1S5J A;  3CYO A;  2R9A A;  3FB7 C;  1LUV A;  2GTA A;  3ZHR A;  1KBH A;  3E83 A;  1Q90 D;  4ZIB A;  1MAB G;  3SPJ A;  4R8C A;  3NXS A;  4UXN A;  2ADP A;  4GX0 A;  3SPI A;  2X6A A;  1X4T A;  3ZRS A;  1DLB A;  2B5U A;  4PDL A;  1GTO A;  4TUY B;  2M6Y A;  3RVY A;  1VF6 C;  2QM8 A;  3SDL A;  3JAL A;  3MHH C;  1HNX B;  4B7K A;  2UXB B;  1FJG B;  2PYL A;  4IHJ A;  2E74 B;  2GUZ B;  4KFM A;  3AG2 B;  3Q4H A;  5KA6 A;  1PD3 A;  2RDC A;  3ZRW B;  4MTG A;  2P7T C;  4GX5 A;  1H8H G;  2WLJ A;  4O4J A;  3RFR A;  1JX9 A;  1R6N A;  3EFF K;  3CCU V;  2CTR A;  2UU9 B;  4UCR A;  4WFG A;  4LFA O;  1VEW A;  3F5W C;  3HKD B;  2Q69 A;  1KUQ A;  4B3M O;  2RCV A;  3F7Y C;  2QKA A;  1MG1 A;  3IAY A;  1H2L A;  3E35 A;  4FLY A;  3ML0 A;  4KL1 A;  4JI7 O;  2DWE C;  3QO5 A;  3P3P A;  1XHZ A;  4JI0 O;  4QE7 A;  2QWN B;  4HAM A;  2N05 A;  4MW3 A;  4DV6 O;  2ZNI A;  3AG2 C;  4ZOL A;  2QA4 V;  1YIJ V;  2DYS C;  2X6B A; 
#chains in the Genus database with same CATH homology
 1URF A;  2HJD A;  1CXZ B;  2Q0O C;  4DYL A;  4IGG A;  1RFY A;  4NB5 A;  1US6 A;  2RMK B;  1UPG A;  4NKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...