2Q0TA

Crystal structure of a putative gamma-carboxymuconolactone decarboxylase subunit (bxe_b0980) from burkholderia xenovorans lb400 at 1.70 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
b'GMTQTTPQPDPSRLRDELVRLHGKASPEWDSLVRLDPRFVDAYLKFAGVPQRRNHLDDKTRAFIALAADACATQLYAPGVARHIERALSFGATREELIEVLELVSTIGIHTSNVGVPVLLEVLEEEGLRKGAPPLDERRQKLKAEFETNRGYWHPTWEGLLELDPDLFEAYVEFSSVPWRTGVLSPKIKEFMYCAFDASATHLYVPGLKLHIRNALRYGATAEELMELLEIVSVTGIHGAELGAPLLEAALKRSGAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative gamma-carboxymuconolactone decarboxylase subunit
publication title Crystal structure of putative gamma-carboxymuconolactone decarboxylase subunit (YP_554324.1) from Burkholderia xenovorans LB400 at 1.70 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Lyase
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2q0tA01
1KNCA 3BEYA 4G9QA 1GU9A 2CWQA 2PRRA 2Q0TA 1P8CA 1LW1A 3LVYA 5DIKA 3D7IA 1VKEA 2O4DA 2OYOA 5DIPA 3C1LA 1ME5A 2GMYA 2QEUA 2AF7A 2OUWA 2IJCA 2PFXA
chains in the Genus database with same CATH superfamily
1KNCA 3LK41 3BEYA 4G9QA 1GU9A 5AFUK 4AKRA 5ADXK 2CWQA 2PRRA 2Q0TA 3AA6A 2KZ7A 1P8CA 1LW1A 3LVYA 2ES9A 5DIKA 3AA0A 3LK2A 3D7IA 1VKEA 3LK3A 2O4DA 3AAEA 2OYOA 1IZNA 2JN8A 2KXPA 5DIPA 3AA1A 3C1LA 1ME5A 3AA7A 2GMYA 2QEUA 2AF7A 2OUWA 2IJCA 3AAAA 2PFXA
chains in the Genus database with same CATH topology
1KNCA 3LK41 3BEYA 4G9QA 1GU9A 5AFUK 4AKRA 5ADXK 2CWQA 2PRRA 2Q0TA 3AA6A 2KZ7A 1P8CA 1LW1A 3LVYA 2ES9A 5DIKA 3AA0A 3LK2A 3D7IA 1VKEA 3LK3A 2O4DA 3AAEA 2OYOA 1IZNA 2JN8A 2KXPA 5DIPA 3AA1A 3C1LA 1ME5A 3AA7A 2GMYA 2QEUA 2AF7A 2OUWA 2IJCA 3AAAA 2PFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNC A;  3BEY A;  4G9Q A;  1GU9 A;  2CWQ A;  2PRR A;  2Q0T A;  1P8C A;  1LW1 A;  3LVY A;  5DIK A;  3D7I A;  1VKE A;  2O4D A;  2OYO A;  5DIP A;  3C1L A;  1ME5 A;  2GMY A;  2QEU A;  2AF7 A;  2OUW A;  2IJC A;  2PFX A; 
#chains in the Genus database with same CATH topology
 1KNC A;  3LK4 1;  3BEY A;  4G9Q A;  1GU9 A;  5AFU K;  4AKR A;  5ADX K;  2CWQ A;  2PRR A;  2Q0T A;  3AA6 A;  2KZ7 A;  1P8C A;  1LW1 A;  3LVY A;  2ES9 A;  5DIK A;  3AA0 A;  3LK2 A;  3D7I A;  1VKE A;  3LK3 A;  2O4D A;  3AAE A;  2OYO A;  1IZN A;  2JN8 A;  2KXP A;  5DIP A;  3AA1 A;  3C1L A;  1ME5 A;  3AA7 A;  2GMY A;  2QEU A;  2AF7 A;  2OUW A;  2IJC A;  3AAA A;  2PFX A; 
#chains in the Genus database with same CATH homology
 1KNC A;  3LK4 1;  3BEY A;  4G9Q A;  1GU9 A;  5AFU K;  4AKR A;  5ADX K;  2CWQ A;  2PRR A;  2Q0T A;  3AA6 A;  2KZ7 A;  1P8C A;  1LW1 A;  3LVY A;  2ES9 A;  5DIK A;  3AA0 A;  3LK2 A;  3D7I A;  1VKE A;  3LK3 A;  2O4D A;  3AAE A;  2OYO A;  1IZN A;  2JN8 A;  2KXP A;  5DIP A;  3AA1 A;  3C1L A;  1ME5 A;  3AA7 A;  2GMY A;  2QEU A;  2AF7 A;  2OUW A;  2IJC A;  3AAA A;  2PFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...