2Q0TA

Crystal structure of a putative gamma-carboxymuconolactone decarboxylase subunit (bxe_b0980) from burkholderia xenovorans lb400 at 1.70 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
GMTQTTPQPDPSRLRDELVRLHGKASPEWDSLVRLDPRFVDAYLKFAGVPQRRNHLDDKTRAFIALAADACATQLYAPGVARHIERALSFGATREELIEVLELVSTIGIHTSNVGVPVLLEVLEEEGLRKGAPPLDERRQKLKAEFETNRGYWHPTWEGLLELDPDLFEAYVEFSSVPWRTGVLSPKIKEFMYCAFDASATHLYVPGLKLHIRNALRYGATAEELMELLEIVSVTGIHGAELGAPLLEAALKRSGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative gamma-carboxymuconolactone decarboxylase subunit
publication title Crystal structure of putative gamma-carboxymuconolactone decarboxylase subunit (YP_554324.1) from Burkholderia xenovorans LB400 at 1.70 A resolution
rcsb
source organism Burkholderia xenovorans
molecule tags Lyase
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2q0tA01
2OUWA 5DIKA 2Q0TA 2AF7A 5DIPA 1KNCA 1P8CA 2O4DA 1GU9A 2GMYA 3LVYA 2OYOA 1ME5A 1VKEA 2IJCA 2PFXA 3C1LA 1LW1A 4G9QA 3BEYA 2PRRA 3D7IA 2QEUA 2CWQA
chains in the Genus database with same CATH superfamily
2OUWA 5ADXK 5DIKA 2Q0TA 2AF7A 5DIPA 5AFUK 1KNCA 1P8CA 2O4DA 1GU9A 2GMYA 3AA6A 3AAEA 4AKRA 3LVYA 2OYOA 1ME5A 1VKEA 3LK2A 2IJCA 2ES9A 3AA1A 3AAAA 2PFXA 3C1LA 1IZNA 1LW1A 2KZ7A 2JN8A 3LK41 3LK3A 2KXPA 4G9QA 3BEYA 3AA7A 3AA0A 2PRRA 3D7IA 2QEUA 2CWQA
chains in the Genus database with same CATH topology
2OUWA 5ADXK 5DIKA 2Q0TA 2AF7A 5DIPA 5AFUK 1KNCA 1P8CA 2O4DA 1GU9A 2GMYA 3AA6A 3AAEA 4AKRA 3LVYA 2OYOA 1ME5A 1VKEA 3LK2A 2IJCA 2ES9A 3AA1A 3AAAA 2PFXA 3C1LA 1IZNA 1LW1A 2KZ7A 2JN8A 3LK41 3LK3A 2KXPA 4G9QA 3BEYA 3AA7A 3AA0A 2PRRA 3D7IA 2QEUA 2CWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OUW A;  5DIK A;  2Q0T A;  2AF7 A;  5DIP A;  1KNC A;  1P8C A;  2O4D A;  1GU9 A;  2GMY A;  3LVY A;  2OYO A;  1ME5 A;  1VKE A;  2IJC A;  2PFX A;  3C1L A;  1LW1 A;  4G9Q A;  3BEY A;  2PRR A;  3D7I A;  2QEU A;  2CWQ A; 
#chains in the Genus database with same CATH topology
 2OUW A;  5ADX K;  5DIK A;  2Q0T A;  2AF7 A;  5DIP A;  5AFU K;  1KNC A;  1P8C A;  2O4D A;  1GU9 A;  2GMY A;  3AA6 A;  3AAE A;  4AKR A;  3LVY A;  2OYO A;  1ME5 A;  1VKE A;  3LK2 A;  2IJC A;  2ES9 A;  3AA1 A;  3AAA A;  2PFX A;  3C1L A;  1IZN A;  1LW1 A;  2KZ7 A;  2JN8 A;  3LK4 1;  3LK3 A;  2KXP A;  4G9Q A;  3BEY A;  3AA7 A;  3AA0 A;  2PRR A;  3D7I A;  2QEU A;  2CWQ A; 
#chains in the Genus database with same CATH homology
 2OUW A;  5ADX K;  5DIK A;  2Q0T A;  2AF7 A;  5DIP A;  5AFU K;  1KNC A;  1P8C A;  2O4D A;  1GU9 A;  2GMY A;  3AA6 A;  3AAE A;  4AKR A;  3LVY A;  2OYO A;  1ME5 A;  1VKE A;  3LK2 A;  2IJC A;  2ES9 A;  3AA1 A;  3AAA A;  2PFX A;  3C1L A;  1IZN A;  1LW1 A;  2KZ7 A;  2JN8 A;  3LK4 1;  3LK3 A;  2KXP A;  4G9Q A;  3BEY A;  3AA7 A;  3AA0 A;  2PRR A;  3D7I A;  2QEU A;  2CWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...