2Q0XA

Alpha/beta hydrolase fold protein of unknown function
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
294
structure length
294
Chain Sequence
SRPEPVQGHLFTYYKDPYCKIPVFMMNMDARRCVLWVGGQTESLLSFDYFTNLAEELQGDWAFVQVEVPSGKIGSGPQDHAHDAEDVDDLIGILLRDHCMNEVALFATSTGTQLVFELLENSAHKSSITRVILHGVVCDPENPLFTPEGCAARKEHVEKLMAEGRGEDSLAMLKHYDIPITPARLAGGGFPTLQEAVWNPCIRKEFDVLRRSVGVIKVPLLLMLAHNVQYKPSDEEVGTVLEGVRDHTGCNRVTVSYFNDTCDELRRVLKAAESEHVAAILQFLADEDEFRTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure of a Trypanosoma brucei alpha/beta-hydrolase fold protein with unknown function.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Structural genomics, unknown function
total genus 102
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08538 DUF1749 Protein of unknown function (DUF1749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q0xA01
2CUTA 2VAXA 2XMZA 3VKFA 4L9AA 3TGLA 3FVRA 1CR6A 4ARAA 4UHDA 4FTWA 4J03A 3TEJA 4BYMA 3AINA 5ALXA 4B0PA 4OB6A 3NOXA 3ZWQA 1VZ3A 1UK9A 4Y2SA 5JADA 1U65A 3A70A 2GBCA 5D7BA 1Q0ZA 5LYYA 2PSDA 3VXKA 1LBSA 4Y7DA 1AQLA 5ALYA 2D5LA 4DLNA 1HBJA 4Y2JA 5F4ZA 2XQKA 3FBWA 2O2HA 3G0GA 1DX4A 2OAGA 3C70A 3QVMA 3HACA 3WK7A 4KRXA 4CCYB 3G7NA 4KE7A 4PV7A 5CT9A 5KREA 3FCXA 1UXOA 3LIIA 3F98A 5CH8A 2WM2A 4G4IA 5EGNA 3ED1A 3F8SA 2OCGA 3WIOA 1BE0A 4G4JA 4KAJA 3ZLVA 3B3QA 3IVMA 2OG1A 2H1IA 4EZIA 4XX1A 5J3JA 2DCMA 5BWBA 5AOCA 5CH5A 3B12A 3DYVA 4L0CA 1OILA 1ZGBA 1K6EA 3STWA 2XUKA 1IUOA 4TGLA 1ZI8A 3L1HA 3ILSA 3WK4A 3HABA 2HL6A 3I1IA 2XQJA 5H3HA 1ODSA 1A8QA 3W04A 4KRYA 4OU4A 1UFOA 1YASA 4XIIA 2WIFA 2Z8ZA 2WQZA 3FOBA 1XQVA 4HTAA 3R3YA 1OXMA 2J3DA 1WOMA 5AOAA 1EA5A 3IB3A 1ORVA 2JEYA 2PPLA 3HZOA 2G63A 2EDCA 3EIOA 2IITA 4QDZA 5A6VA 4JYPA 1Z68A 4BB0A 3C6YA 5CXXA 4YK7A 5IVHA 2HA7A 3V1MA 3I1YA 2QKYA 5JAHA 5JAUA 3QPCA 3KWJA 2ZJ6A 1SCIA 2HA0A 5AK5A 3VJMA 4KE6A 1E89A 3IURA 4DIUA 3PF9A 4FMPA 1JMKC 5AHXA 4J0CA 4C88A 3ZPXA 2QMQA 3C8HA 2C5GA 2HIHA 2HA5A 3AZPA 1MX5A 3C8DA 3W2TA 1EVQA 2R11A 4BZWA 1XRQA 4X92A 1J2EA 5A71A 4AN0A 2AJCA 2WU4A 4OB7A 1F8UA 3R3VA 4IHAA 5DNUA 4Y2TA 3BIXA 4RPCA 1VKHA 3STYA 4EY8A 1SCQA 1EK2A 5BV7A 1S8OA 4RGYA 3H1BA 1VXOA 5CH3A 2XE4A 1CQZA 4J0HA 5LZ2A 5CT4A 1UK8A 1ZJ5A 3G02A 2JBWA 5ISMA 1ZOIA 2HU7A 3N0TA 4DTCA 4LHEA 3WWEA 4N8EA 4W1SA 5FUMA 3W9BA 2W22A 1QE3A 4XJVA 3DD5A 2HRRA 3V48A 5CW2A 1HPLA 3G0IA 2PM8A 4BVJA 1TIBA 4Y2RA 2AJDA 3IUNA 2D0DA 4MWSA 4Q3OA 5BWCA 2XMQA 2X8BA 3SC2A 1ZD5A 5A7GA 3AIOA 1M33A 5T4FA 1BEZA 5DYYA 5HKAA 1QOZA 2QXUA 1HKHA 3RM3A 1BEEA 2W6CX 3KSRA 4FOLA 1ZI9A 5FP0A 4BRSA 3I2JA 5CURA 5T4HA 2DHEA 2VATA 2XUAA 3M82A 1CIJA 3VVMA 4YASA 1R1DA 2OLEA 4Y9SA 1RP1A 1E5TA 1WCYA 3HEAA 4PSCA 1LLFA 2YYSA 4QDOA 1A8SA 2OCIA 3L1JA 3NUZA 1L7RA 2C58A 4M0EA 1BCSA 4D9JA 3ANSA 1RWQA 5ALNA 1ZGCA 2ZVDA 3WL8A 4J0GA 4K5QA 3A6ZA 1IMJA 3WA7A 3ZLTA 5EI5A 4LKOA 3STXA 4GECA 3O4IA 4B0OA 2XUJA 5ALZA 1Q84A 1BS9A 1GPLA 2FJ0A 1FFDA 4QNNA 5FKJA 5DYTA 5JZ9A 4EUSA 1G5FA 4ARBA 4NVRA 2VTVA 1W52X 1HL7A 1U4NA 2H7YA 3DS8A 4C4XA 2O7RA 1GQRA 5D3ZA 4KAAA 4MYSA 4H77A 3BJMA 1WHSA 4QWMA 4I4CA 3I28A 4J0IA 4J7AA 5ALGA 1B41A 5AM2A 1PFQA 4WFKA 4BZZA 5AK3A 1U8EA 1LPPA 2H7CA 4X00A 1N8SA 2XI4A 4NMWA 1EDEA 5HZGA 2XUOA 4G4GA 1TKRA 4WY5A 3SX4A 5JZBA 3R40A 5ALVA 4H7JA 4DYHA 5DLPA 1MX1A 4C4YA 2GBIA 3QPDA 4QA9A 5AKHA 5AOBA 2G5TA 4QE3A 1Y7IA 5FOQA 4CCYA 4WDQA 4AN1A 3W9UA 1EDDA 2OGZA 4L72A 5D6OA 4EY4A 2WUGA 2AJLI 3MGAA 4HZGA 3AUKA 5AKIA 4UBJA 1HQDA 2WFLB 4HRYA 2QVBA 3FLBA 3ZI7A 4I3FA 4KEAA 4GWLA 2PSEA 3H2GA 4H7HA 4J0KA 4MQLA 3P2MA 1A7UA 1GGVA 4WJLA 3DNMA 1LPMA 3BF8A 3C87A 2Y1KA 1WB6A 3G0CA 4CG1A 3N2ZB 5AP9A 1KEZA 5BOVA 2VJBA 4X85A 1W6RA 4DSAA 3R3XA 5HKBA 3LP5A 4H0CA 2Y2UA 3LCRA 1FFEA 3HJUA 3O4JA 1WM1A 2C0QA 4AQDA 2WJ6A 5AKJA 5K3BA 4DGQA 1TCAA 4B7ZA 2IIVA 3C5WP 2V97A 4KE9A 3C6BA 2HRQA 2VJAA 4BAZA 4MXDA 1ORWA 4BE9A 2O7VA 2ZJ7A 3D2BA 2B4KA 5ALJA 2Y2VA 3OPMA 3KWFA 3BE8A 5HF8A 1XRMA 4B84A 3CCCA 3DL4A 5ALUA 1P0PA 1XLUA 1SFRA 1H2WA 4UBOA 4UBIA 1UKAA 1JU3A 1JJBA 1H2ZA 4H7FA 4CIBA 1CPYA 2DSNA 3HSSA 1TAHA 2H9YA 2QTBA 4G8BA 5K3AA 3KOOA 3M3DA 1HLGA 4OUKX 3O9VA 3STVA 3HXKA 2ZYSA 4HXEB 1F6WA 4OD0A 3DLTA 3F67A 5IKXA 1DWOA 2GZRA 3WZMA 6YASA 4RE5A 2XB6A 2QRUA 1R50A 2RHTA 5AKLA 5AM3A 4LYEA 1MAHA 2VT7A 4W63A 1QJ4A 4V2IA 1UWCA 2XUQA 5LKAA 2BFNA 4C89A 4C4ZA 3RK4A 1EVEA 1BRTA 3BIWA 4LXHA 2ZJFA 1CUHA 1QIEA 4A23A 3OC0A 4U2DA 1O6FA 3C6XA 4BC1A 1ZD3A 4FLEA 4BDTA 4DNFA 2AJ8A 4F21A 4EA6A 4B81A 4Z49A 1GXSA 3AFIA 3K6KA 3HRHA 3D2CA 3I2GA 1DU4A 2Q0XA 4MYDA 4W9RA 1GKLA 3OTQA 1W1IA 2IX9A 5A7FA 2HU8A 4HRXA 2JGJA 1LGYA 2HFJA 3WL7A 1CUJA 3F96A 5YASA 4AMYA 4A5SA 4K6KA 1UOOA 4I19A 3ICVA 5AI4A 4GHWA 4KYVA 3KXPA 5JAPA 4ZGBA 5ALPA 4Y2VA 2PSJA 5K3EA 1FJ2A 3FAKA 1XZDA 2GYVA 4C01A 2B9VA 5E4YA 3IUJA 5K3CA 1B6GA 2QUBA 3WKBA 4C87A 1DTEA 3CN9A 2LIPA 2P8SA 4F5ZA 5IVIA 1AUOA 1QIGA 5FDFA 2QR5A 3E4DA 3WWPA 4BAGA 4EY5A 4JH0A 4P08A 5C8XA 4PSDA 1UOPA 1G4HA 2PSFA 1XZAA 1G66A 2G5PA 2VT6A 3BJRA 2XUPA 1NU8A 2YXPX 3K2IA 3MVEA 4XWGA 3HLKA 3QH4A 4G9EA 1CUYA 4LIPD 5HCUA 3EF3A 5ALOA 2K2QB 3T52A 1DWPA 1SOMA 4FLFA 5AIAA 1VJ5A 4QDXA 4MEAA 2FUKA 3WK6A 4N8SA 3JWEA 1QFSA 4H7EA 3Q0TA 1KU0A 3V1LA 1K4YA 4UUQA 2PBLA 4O08A 1MPXA 3I2KA 1XLVA 4BE4A 1IVYA 1H2YA 1O6GA 4Y2XA 3ZV7A 3I2FA 2QJWA 4K6GA 1C4XA 1EDBA 4X95A 1CUWA 1VZ2A 5EIAA 3GELA 3D7RA 1CUFA 4G5XA 4W1PA 1YS2X 4HVTA 1CRLA 4OSEA 3STTA 4AZ0A 2XUHA 2YASA 1DINA 4X6YA 1CUZA 1YAHA 3DYIA 4UFPA 5DJ5A 5AKXA 3H19A 5HF5A 5D3KA 1C7IA 3PUHA 4IO0A 1QIMA 1THGA 5K3FB 2XQFA 1YA8A 4YX9A 4GW3A 3HI4A 1LPBB 1EH5A 3NGMA 3IDAA 3OURA 2PVSA 2Z3ZA 4G8DA 1ZJ4A 4F0JA 5C8VA 3WJ2A 5JD5A 2BUAA 4HXFB 5EFZA 1QIIA 3H17A 3K9BA 3GUUA 5IVDA 1CUBA 1JT2A 3SWWA 3ESDA 2ORYA 5CTAA 3R0VA 4BATA 1UT6A 1IZ8A 3DOHA 3IULA 4Q82A 1GQSA 4G1FA 5EHQA 4PO3X 3H18A 1K5PA 2BUCA 2XLBA 4MQMA 1ZICA 1MTZA 3VDXA 3C45A 1QIJA 1VA5A 2QZPA 2GYWA 3WL6A 4Q34A 5JARA 1TRHA 1W75A 2HA3A 5EHZA 3FSGA 3FYUC 5AKKA 1WB4A 1BCRA 3AJAA 3FLEA 1XLWA 3WIBA 4E14A 2CZQA 4L3WA 3IUMA 2WFLA 2OGTA 3LLCA 2JGMA 5CT8A 2J4FA 4PW0A 1AMNA 4JEIA 4DMFA 4AB1A 4AMZA 4HS9A 1QO9A 2X5XA 2WIDA 1ACLA 3A2NA 3VJLA 4MJ3A 2XLCA 5E4JA 2RIPA 2ZYHA 2QUAA 5DWDA 1UOQA 4NS4A 1JU4A 5LP1A 1QGED 3GFFA 4FFWA 2WIJA 2JGFA 2HA2A 1EXWA 1H2XA 3RKSA 2J4CA 2DHDA 3NWOA 3IA2A 5ALKA 1DX6A 5AKGA 3E1GA 1XZGA 3C5VA 2HDWA 3QM1A 2BKLA 4LYDA 3VVLA 3R41A 2OCLA 3FSGD 4QWWA 4IH4A 5T4BA 3SK0A 1XZIA 2VJCA 2WJ3A 3G9TA 4X6XA 1DQYA 2CB9A 2V98A 5AICA 3WMRA 1JFRA 4H7IA 1MU0A 2ACEA 1E8MA 1DT3A 3S2ZA 5IH7A 4CI9A 5E2IA 3DDUA 1QTIA 3EQ9A 3A2MA 1XZLA 5HQ3B 1TK3A 2JGEA 3FYTA 1QFMA 4U2BA 1UKCA 4S0XA 5DYWA 4K2AA 4BRZA 3W06A 4N8DA 4U2CA 4G8CA 2Y6UA 2OQIA 5ALHA 2PL5A 4Y2PA 1W4LA 5AM1A 1CUCA 3W05A 2XDWA 2HHAA 1TCBA 4EBBA 2XMCA 4N5HX 5FRDA 3BF7A 5JAOA 2RONA 4FDMA 4FBLA 3RARA 1IZ7A 5CBKA 3WA6A 1EX9A 1R4ZA 3AIKA 1CUUA 1E66A 3UUFA 1XROA 1Q0RA 1F0NA 1YAJA 3AIMA 1XZJA 4OYLA 5JATA 3WK5A 4HAIA 4ZI5A 4B80A 1QO7A 1EB8A 1QONA 4U2GA 1Q83A 4X71A 1SCKA 5AKZA 2C0PA 4FNMA 3OOSA 1XZCA 1I6WA 4H35A 1A8UA 2OCKA 2BGRA 3ZLUA 4BTVA 1YB6A 1WPXA 1A88A 1VA4A 2JGIA 5HFNA 3I6ZA 5HFAA 2V96A 4PNZA 4K6HA 1YA4A 1T4MA 2PUHA 1Y37A 4BC0A 4JYMA 2XT0A 2B61A 4H18A 2XUDA 1XQXA 2CEKA 5I9IA 2I3ZA 4X7BA 4F60A 3OG9A 4EY6A 1NU6A 4Q1VA 1LBTA 3WWOA 4BBZA 2QOEA 4WY8A 4X97A 2C7BA 4BVLA 5LLSA 5CT6A 4B9AA 4CG2A 3X3HA 2Y6VA 3QMMA 1MAAA 3H2IA 1R9NA 3WWDA 4RE6A 1VXRA 4DSZA 4P9NA 1J1IA 4AO8A 4YPVA 1DT5A 5JANA 1YSCA 3WWCA 4CCWA 5AIBA 2XQGA 4B85A 3IBTA 4CIAA 1UK7A 2E3JA 5ESRA 5CT5A 1XZBA 4GLBA 5ALIA 4TPKA 4ETWA 3D5EA 4KE8A 1CUDA 4FBMA 1AKNA 5CRIA 4P92A 1BN6A 3BDVA 5E4TA 3TRDA 2VAVA 1QZ3A 1EHYA 3QMVA 4AXBA 2Z5GA 4ITVA 4BP9A 1XRLA 1X2BA 2OPHA 5ALSA 2XMBA 2NW6A 4DNPA 4OYYA 2ECFA 3EQ7A 3FYUB 3E0XA 3WKDA 1AX9A 1N5RA 3G9UA 4Y2YA 1XQYA 4J0DA 1MNAA 4FHZA 2DHCA 1EINA 1ZIXA 3OM8A 1N5MA 4KR0A 1BROA 5FPPA 1D07A 3H2HA 4UHCA 5HK9A 2HFKA 4DNQA 3U1TA 4JUIA 3G9ZA 3AZOA 4UHFA 3E3AA 4KAFA 1P0MA 4H7DA 4ZRDA 5LZ8A 5AH0A 4GBGA 2HU5A 3EBLA 3G0BA 5SYMA 2WTMA 2WHRA 2RHWA 4FWBA 2PSHA 5SYNA 1EK1A 4B82A 3KDAA 3TJMA 1USWA 3C6ZA 1IUNA 3DKKA 5ALMA 4RNCA 2O2IA 5LKRA 3C43A 1E8DA 2GBFA 3L1IA 4FNGA 1CUXA 1CUGA 4UBNA 4H7KA 4DM7A 1CV2A 2FX5A 2UZ0A 2H7XA 4C6HA 2WKWA 3VJKA 2WFZA 4X94A 3UUEA 2X76A 4B9EA 1CFJA 1GPKA 1ETHA 3FLAA 4AO7A 1MT3A 4IQ4A 3D4LA 5JASA 3HYSA 2AXEA 2ZYRA 1MJ5A 2J3QA 5LZ5A 1TCCA 3FVTA 5C81A 2QS9A 4X3CA 1AURA 3MUOA 2HA6A 1CUIA 3S8YA 1JI3A 1KU6A 2WUEA 2JGKA 1CVLA 4IH9A 3F97A 2WHQA 3F9CA 3CXUA 4UHBA 2VSQA 3WI7A 5C7YA 1AZWA 1L7AA 5ALTA 5DTJA 2HADA 4AO6A 3CCBA 4BAUA 3QYJA 1ODTC 1RYYA 1C7JA 3AILA 1YR2A 2XUGA 1Y7HA 1CEXA 5LZ4A 1ZIYA 2HM7A 5A62A 4WFIA 2FJPA 3PICA 4GDMA 1QIDA 1ISPA 3DKRA 1LPNA 3KD2A 4UFNA 1R9MA 2Z3WA 3H2JA 3PI6A 5EIEA 2QT9A 2WG1A 1DWQA 1P0IA 1YCDA 4GEGA 1EI9A 5I8PA 2PKYX 4FFVA 2WHPB 2I3DA 3B5EA 3M83A 2BAGA 1WB5A 3D3NA 5HQ3A 2R8BA 1YS1X 1N1MA 4ZREA 4W1QA 1K63A 3IIIA 2VQ6A 2XQIA 1IUPA 4QZVA 1FFBA 3PE6A 1XKTA 3O9MA 3ICWA 4KACA 3O4HA 3JYHA 5FPQA 4UFOA 4X90A 1P0QA 2EDAA 2CMFA 4X93A 5LIPA 4E11A 2JEZA 4Q3KA 4JNCA 4HXGA 3DL7A 4FKBA 2XMDA 1EB9A 5K5EA 1MO2A 2VA9A 3MUNA 1QLWA 3WKCA 5ALRA 3PDCA 1W76A 3G8YA 3WJ1A 3JW8A 2BCEA 5KBYA 1J07A 2DR0A 1SC9A 3DOIA 2JGLA 1U2EA 4B83A 1CUEA 1MNQA 2ZSIA 5HF9A 1QIHA 2RI6A 2OXEA 2I78A 3WKAA 1XZHA 4U2EA 4QDUA 4BP8A 3WYNA 1TQHA 4NZZA 2PUJA 1ZD2P 1DQZA 4BCCA 2G4LA 2OQVA 5AI5A 4WDRA 4E15A 3ESBA 2WJ4A 3LIPA 2WILA 5EHNA 1ZD4A 3WKEA 4QLOA 2QM0A 4EHBA 4QDTA 2CBGA 2WG0A 2WIKA 2I03A 2WFMA 2WUDA 1MN6A 1ODCA 3QZUA 7YASA 2WLSA 1JKMA 3H0CA 2C4HA 1XZEA 1G42A 5LZ7A 1H23A 3WLAA 3I6MA 1R88A 5AI9A 2B20A 3DCNA 4UPDA 5A2GA 3ANTA 2PU5A 5AJHA 1PV1A 3A2LA 4AX4A 3WK8A 2GYUA 1MX9A 4BCDA 3DEAA 2RAUA 4UHHA 2BUBA 4Q05A 4X91A 4AZ3A 5AI6A 4WCVA 1AC5A 5ALWA 5AM4A 2DQYA 4FLMA 2AJBA 2QXTA 3V1KA 4QEKA 4J0JA 5JD4A 1E3QA 4OCZA 4PQEA 3WQHA 1BU8A 5FXMA 5CXUA 1NX9A 4MEBA 4DMKA 2C5FA 5K3DA 4DMHA 4OPMA 1AGYA 5FLKA 1XQWA 2WG2A 1LZKA 4CG3A 3UMJA 1QTRA 3PFCA 3GZJA 2YH2A 2WU3A 3PFBA 1FFAA 3I6YA 3U0VA 4MWTA 2DQZA 4GXNA 3FNBA 2WSLA 3BDIA 4U2FA 1THTA 5A7HA 5DTIA 4UBLA 1PJAA 1FSSA 1XFDA 4W1RA 3FYUA 5JZSA 2CJPA 1X70A 3GA7A 2VF2A 3YASA 5T4EA 3VISA 2HA4A 3FWHA 4PF1A 1XZKA 1JJFA 3EQ8A 5DNWA 1LNSA 1JJIA 2OAEA 2DFPA 5JD6A 3LS2A 3GBSA 3D0KA 4PSUA 3I2IA 1QIKA 3QBJA 4ROTA 3O95A 4INZA 5CMLA 1LPOA 1GPNA 3BXPA 2GBGA 5DNVA 1GKKA 1OCEA 1L7QA 1J06A 3DJYA 2EEPA 4XVCA 1XZMA 3BL8A 3ESAA 3WZLA 5AI0A 4A16A 4UBKA 1UK6A 1LZLA 5LZ9A 1E8NA 4G9GA 3GROA 1VE7A 1WHTA 1XRPA 1K8QA 5IVKA 4EY7A 1LPAB 1GZ7A 2WTNA 4BDSA 5AO9A 4LXGA 4M0MA 1T2NA 5AI8A 5AKYA 3O0DA 4Q3LA 5AM5A 5AM0A 4Y2QA 3H04A 1FFCA 3PF8A 4P93A 4DNOA 1X2EA 1VOTA 5HK8A 1LPSA 2ACKA 3HC7A 1YB7A 5AKEA 5C8ZA 3O4GA 2XMSA 1CUAA 4M0FA 4ZWNA 3V9AA 3QPAA 4Y2UA 3IUQA 3T4UA 4IH1A 3WYDA 1CLEA 1F0PA 4J3JA 5ALLA 5HF6A 4EB0A 3WL5A 1XZFA 1BN7A 1R3DA 1H22A 3R3UA 5AK4A 2ZSHA 1GT6A 2PX6A 4KJXA 4B6GA 3V1NA 3STUA 2ZYIA 5ALFA 3I2HA 2OGSA 3FCYA 2XUFA 4LXIA 2PU7A 5KWIA 3D59A 2Z8XA 2WUFA 4UHEA 4CFSA 3WK9A 4OU5A 2XMRA 1JMYA 2O2GA 5JALA 2V9ZA 2BGNA 5JYCA 3AZQA 2CKMA 3ESCA 5EHXA 5KWJA 1CUVA 1ZI6A 1XRNA 4E46A 4TVKA 4UBMA 1HDEA 3R3WA 5ALDA 1XKLA 2WIGA 3CN7A 2BJHA 2XUIA 4DMCA 3PUIA 2JF0A 1WPRA 3R3ZA 5AK6A 4WFJA 4ZXFA 4BVKA 5FV4A 5JIBA 4GI1A 4N5IX 1CQWA 2ROQA 3BWXA 4BTLA 5ALEA 3RLIA 3H2KA 3G9XA 2RGUA 2QJRA 2WHPA 4ZV7A 1ACJA 2GZSA 5I7UA 1VLQA 3QITA 1VE6A 4OB8A 3H1AA 3DQZA 4ZV9A 2ES4A 1XRRA 3D2AA 3QMWA 2ONCA 1QIFA 2VEOA 5K3FA 5EIHA 2JIDA 4BCBA 2VJDA 2XMGA 3M81A 1UZAA 3Q8WA 3G0DA 1CUSA 5ALQA 1UKBA 4QLAA 4X6UA
chains in the Genus database with same CATH superfamily
3AF1A 1M2WA 2CUTA 4PG7A 4HAZA 4E22A 2XMZA 3TQOA 3WVNA 3G49A 2GM9A 3UGJA 3A32A 3LQRA 5TMEA 2QI9C 1PJCA 2H1WA 1ITZA 1HOXA 3DE5X 4C3ZA 1GG8A 2FF7A 3E0QA 1JIQA 1BWSA 4XXHA 2ZR7A 5HSGA 5CTJA 1JQBA 2CY0A 5TJHA 3FPAA 4LCBA 5I7FA 2IEYA 3BIOA 4F2HA 5KSWB 4OHYA 5JJLA 3F71A 4FTWA 2W48A 4RKFA 1MORA 5TQ2B 1F3LA 1V7QA 1VLZA 2FRDC 4REOA 3K0AB 2RKBA 4FFNA 4N0PA 1WUTA 5KHLB 2C77A 3W2EA 2Q6OA 1YJBA 4OB6A 4WECA 3NOXA 4I4NA 1R9JA 5CU7A 3ZWQA 4CTMA 1VZ3A 2ID8A 4HRAA 1O94C 3A1WA 1HFEL 1L4FA 2H06A 2WUWE 3KOWA 3K9CA 1GUBA 3BSWA 1QGYA 3LO5A 3EMKA 4PZZA 4OQMA 3T5GA 5DFAA 1XRSB 1PLJA 1H69A 4PG4A 3H05A 5COBA 3ESXA 5F3DA 1YFLA 3E3NA 1S3IA 2IQ5A 3IV6A 1T5TA 5DTQA 3GUVA 4N3NA 5KTKA 1Z5PA 4Y7DA 2GRUA 3FFTA 2MWMA 1W1WA 1YWGO 2D5LA 2CUNA 3N58A 1X1CA 5HBGA 2EP8A 1A7AA 1E2MA 3JVUA 1QVVA 3FKSA 1ZLYA 2ERYA 3NUGA 2GEDA 4WGGA 4C1BA 4I7EA 1INLA 2H18A 3U3RA 3W3AD 2VXCA 3IA7A 5P8WA 3JAKA 2IYPA 3DBRB 4ZAZA 5DGCA 5IWCA 3WJ7A 5A4KA 2BF4A 4RKYA 3S2EA 4B6RA 4HB3A 3RC1A 2CNNA 3G7NA 3VNBA 4HTFB 3KDSE 3CVVA 1SBTA 3N75A 2H0RA 3ENKA 4FFMA 3T7RA 4E5KA 4KE7A 1DG9A 1FUUA 2DQ4A 1DRJA 1JHXA 1GO2A 2HCBA 4PV7A 3NYIA 5KDOA 5KREA 1AHIA 5IWAB 5DTRA 2VQDA 1OH8A 3LIIA 3CO0S 1Z6AA 1EM8A 1RWOA 2H29A 3U31A 3EPKA 3SEQA 2DMRA 1CSEE 1XHFA 4NDAA 4NV1A 1T4CA 1MMFB 3H8WA 5JDCC 4QM7A 2PANA 4HPWA 3B9QA 1KI1A 2JVIA 4MK4A 5HILA 5TIIA 2JHCA 1SC6A 1V37A 1LQTA 3HY4A 1KIFA 3B70A 3HFSA 5EGNA 4I9NA 5JNSA 2YFYA 1H5NA 1XKXA 3EE6A 2OCGA 2RGGA 5LFAA 1L5ZA 3C7TA 4L8WB 3THSA 3WIOA 4ZYWA 2Z1DA 1UP7A 2PFSA 4JJFA 4YECA 1NOIA 4DXAA 1P7PA 4EGSA 4ESOA 2WWWA 2DFTA 5DN6D 1PD1A 1TB4A 4F3CA 4LOAA 2HJGA 3WZ2A 4OV6B 5KQLA 1WW2A 4TZKA 3U9LA 1FL9A 1Q5PA 1QH8B 2HU2A 4Q3EA 3H3XA 3HB4X 1VIAA 1AD2A 3LP8A 4IGFA 4K9KA 5CH5A 2OYCA 3B12A 1DRUA 1ELOA 3IQZA 2EYUA 3QUCA 1E3IA 4Z0NA 3IAFA 2H4FA 4QU8A 3QVWA 1OFUA 4S0ZA 3EHDA 2RGRA 4XM0A 1ZG3A 4YUZA 4JY7A 3L40A 3HKEA 3OT1B 4RFLA 2SCUA 3ETNA 3IDOA 2XOXA 3SE0A 2BEWB 1ZI8A 3FNIA 2WMYA 3LUPA 1IZ9A 4KVGA 3HMKA 4GYJA 1GARA 4TS3A 4BLVA 2I4TA 3Q3GE 4DBLE 2GDJA 3STHA 1TF7A 2WJYA 4BLQA 1IJFA 2AEFA 2B1QA 3WK4A 1LBQA 1XVAA 1TEHA 1T5SA 2Q5CA 1AKYA 2NXEA 2YQZA 2XQJA 2XWJI 1PQUA 1Y48E 2YV1A 3GFQA 3I1IA 3LHIA 3OO1A 3K15A 5H3HA 2W58A 2YXNA 1IATA 1V5FA 1QHHB 2C78A 2WIAA 3AG6A 3ME5A 3ETGA 4XDGA 1N7GA 3EXEB 2V7GA 3OZ7A 4RLHA 3ANNA 4G0PA 4ZQCB 3LK6A 3FTNA 2EBHX 5HWSA 1N2IA 2IZ6A 4TLAA 3TW4A 2H85A 4F72A 1C1YA 2WIFA 4FK8A 4YLGA 2FEAA 3C4VA 3M3PA 2XV1A 2Z8ZA 3RUDA 4B1FA 2QX7A 2VUIB 3PQ3A 3S0JA 3QOWA 4Q19A 1WU8A 4OKSA 1ESZA 1BGWA 1K3TA 3AI3A 1EFDN 3WLFA 3KOXA 1XQVA 4YJ2A 3WRYC 1GPMA 4OQZA 5K99A 4JQCA 4LV8B 3VR5A 4LJ9A 4OXKA 5EUMA 2FWBA 2J3DA 2HXGA 2HXYA 2NVWA 3DVQX 4KQIA 2B1JA 1RLMA 4EJMA 3UV3A 2HPAA 3VPHA 1KPGA 3IB3A 2C2HA 1EFKA 2JEYA 2XGMA 3MD0A 2G04A 4RO0A 5WRFA 1WS6A 2G63A 2R6AA 1A9QA 4L27A 1IHYA 5DASA 4DR7B 2O2CA 3BWBA 4DEYA 1Q91A 2VPZA 1MH9A 3BFPA 1TM5E 1TA9A 1ZUNB 2AEMA 5L3SA 3TAUA 1AKQA 1NVWQ 4HGRA 1DOAA 4IXWA 4DMRA 1T26A 3QP9A 4P33A 5EQDA 1U28A 1BOOA 1LQ2A 3CX6A 3NVAA 5IVHA 1WCWA 4HWSA 4LZLA 2IXDA 3IOEA 4MR9B 5L3ZA 1G5TA 4DBVO 2X0NA 3GAZA 4PTYA 4B3RB 1D8AA 1MVLA 3QXJA 2QKYA 3TR6A 4CMHA 3OU2A 5JAUA 5CHEA 3AEKB 4TVBA 1OIXA 3WO1A 1CY2A 4HPJB 2HSDA 1NMYA 5EYPA 5K3OA 1OXSC 3GLFB 4XWTA 2E4VA 3GQBB 1SCIA 1JHUA 3AETA 1GV1A 1AE1A 1U7OA 2OK7A 3HCPA 1ZX1A 4YJDA 3S7ZA 4UULA 3I3OA 2HA0A 5AK5A 2RGAA 3CO5A 1F06A 3GJRA 4KR6A 3F5FA 3UGKA 4UNIA 3PF9A 1AGPA 2AF4C 1R6TA 2YFQA 1BWPA 2W2NA 4FZ3A 1FLNA 1YZNA 2PZBA 3ZR4B 4D43A 3U44B 5KQRA 1UDWA 4BY9E 1XCMA 4FHGA 4IQFA 4C88A 3UJHA 4FOPA 1Q95A 4K81B 2H5LA 4Y6GB 2VHEA 3MMXA 1E79A 2HA5A 1CIPA 3FPLA 1P9LA 3U26A 5PNTA 2BM0A 3WV5A 3PUJA 3GRCA 3W2TA 4Y7CA 3L7NA 4ZA2A 4MVWA 4DWJA 5CAEA 3VR5H 5HTKA 1DIOB 2VDOB 5JXIA 4NXMB 1P7WA 1TKAA 2B0CA 5FL7D 1GZ5A 1ULZA 4TS4A 2AJCA 3HBAA 3Q72A 4TUYF 4U8GA 4OB7A 5DRTA 5G0TA 1RM3A 1PUXA 4YUYA 4LX8A 2JK0A 4RD4A 1DTWB 3EXHB 5A5DA 2MJLA 3H9UA 3KUKA 3LLSA 1V5WA 1W2WB 4X41A 4AW9A 1VKHA 1W0CA 3D54D 3STYA 1PR2A 3TM4A 1U1IA 2WJHA 2H5IA 3OJCA 4TKVA 4PAGA 3HH8A 3K8QA 2BEKA 1TUBA 3K31A 1UXKA 4UEKA 2QYOA 1TA4A 2ANCA 2XNKA 3SI7A 4NJEA 1U98A 3GGSA 3LKZA 3ZZ0A 4AZTA 1O95D 2G71A 3IBCA 4CCSA 2VSYA 2ONZA 3CCFA 1IG0A 3Q85A 4X54A 5CD9A 3OIGA 2YW2A 3V4PB 3VKUA 1FXUA 3I4LA 1QC5A 2L2QA 1WMAA 1B0PA 1UFQA 1KWKA 2FMHA 1WQ3A 4W8OA 5DW3A 3AONB 4OJKA 2PJRA 2NVBA 4M36A 5AHWA 2VRBA 2PBFA 1VI5A 4MVJP 3U80A 3Q0IA 2A1UA 4ACBA 5EHIA 3OZXA 3OO0A 3P0FA 4Y1FA 1KE1A 3T1TA 1JI0A 5F9HA 2HF7A 2LDXA 2Y1WA 3HFJA 3SQOA 3SSMA 3SYLA 2R00A 2WE7A 5TGTA 2W37A 1QGUA 1DE0A 1KYWA 2O2DA 3KR9A 3HUEA 1SPXA 3VSAA 3CMCO 1NW6A 1O87A 1K06A 1ZRSA 3PQFA 5JT1A 4L4ZA 3EGDA 1ZITA 3P9KA 2ZRQA 2W6JA 4ER3A 4W1SA 5EJ8A 1E2BA 3O1HB 4Q24A 1PAUA 1E1CB 4JP8A 4NY1A 1QE3A 3AG5A 4XJVA 3H99A 5AVUA 3P94A 2FZGA 3G89A 3IUYA 3B1FA 1NJ5A 4TMFA 4J90A 4L78A 1TCUA 4JS0A 3G0IA 1A0OA 2XGJA 2O8CB 4OI2A 4A8JC 3U3ZA 1OFHA 4L16A 4AJNA 4BVJA 5BR7A 5HVNA 1VKNA 4AKIA 2IEDA 2D0DA 1SJ9A 1F51E 1OLUA 4HWRA 4NJOA 4Q3OA 4BYGA 1ILWA 2XTJA 3OQBA 5BWCA 1WD5A 1FPMA 5ECDA 3RS5A 2HLPA 2PMCA 4EFLA 3GB9A 1JBKA 1HMYA 2X2OA 1JEOA 2UYQA 4B3JA 5FI3A 3RSGA 2CXNA 2AX3A 2QZSA 5T5QA 2Q5LA 3OY7A 4FGWA 4TLEA 3WNZA 1JFFB 4E5UA 1TCVA 2VRWA 2CL7X 3DMYA 4BNWA 1AS2A 1M6WA 2XGOA 3UT5B 3IEVA 2EHJA 4LMAA 2CHFA 2II6A 2CC2A 3EXFA 2P91A 4NU6A 4V1CI 2CVHA 2GNPA 3WIEA 3W8DA 1SVUA 3KSRA 2DF8A 2YZNA 5GOZA 3LXUX 3RODA 4TV9A 3ED5A 5JNTA 4O63O 1U8FO 3TG2A 3P2OA 1ZI9A 1ZL0A 4CIWA 9LDTA 3O21A 4NG5A 3F6CA 3GHHA 3J7TA 3R6GA 1LBIA 2VATA 3CNEA 2DQKA 4HAVA 4OLAA 4WVFA 1CIJA 1U5BB 3QQPA 4EVQA 2XE7A 1VB5A 4R1QA 4RF5A 4QQFA 1EVYA 1XQ6A 3E7WA 2GF9A 2A14A 1NVDA 4FWIB 1N5LA 1T0IA 2Z9CA 1WCYA 4D45A 3HEAA 4LYFA 4GKJB 5EZYB 3CMMA 1QR6A 1G21E 4EATA 3ND6A 1RXWA 2OCIA 2F6RA 3ZD6A 2R8XA 3NUZA 4NECA 1X7ZA 1D0SA 1ZMRA 4RH3A 3P4YA 4TWBA 4P81A 4M0EA 5D85A 4UUAA 3C14C 1PEKE 3GA5A 2ZE6A 3DWEX 1ISIA 3VU8A 2YYZA 1O5OA 3ONNA 4NX2A 1GHTA 1EGHA 4UM9D 3EYAA 3GIDA 4HBZA 2DKFA 3T54A 1YACA 3MWEA 2R7KA 5ALNA 4ZHQA 2ZVDA 3C3MA 4EHFA 1DBWA 3SKXA 2I33A 4MGZR 3UMRA 3EIHA 3UG6A 1GNSA 3NRBA 3SKYA 4V39A 4L2IB 4BFXA 1FCJA 3BL6A 4GMDA 1CTQA 1KO8A 1SOUA 5AMXA 2OZVA 3OKCA 3TIFA 4D4JA 4BGDA 1O0BA 1Y6FA 2VZ0A 4P83A 4UPEA 1Z08A 1N7HA 1VFNA 3CM0A 1C9KA 1WLYA 4WADA 5HZKA 4WAUA 5EI5A 4O5OA 4LKOA 5EUQB 3STXA 3GH1A 4DDKA 2CFCA 4OGKA 4G1UC 3FG9A 2XR1A 1KI7A 2XUJA 1Q84A 2B9EA 1P18A 2WOJA 5LB2A 5KNDH 3MCWA 3RRMA 1NLYA 3NNSA 2WB4A 2XWSA 4QUIA 3DULA 4CIDA 4UTRA 2F4VB 2FJ0A 2QGNA 3G23A 1J21A 4FYIA 3KYCA 5CYFA 5BYKA 1ISFA 4QNNA 1TMKA 5DYTA 2XYQA 4PANA 3IV9A 1XPUA 5IJZA 4G0YA 5T41A 3W3ZB 1HDRA 1UXJA 2UVPA 1F48A 4AWAA 2Q2WA 4CT5A 4II2A 1G5FA 4ARBA 4PGFA 2Y76A 1XAHA 4XQGA 1LH0A 1XQ9A 2C94A 1D1QA 3JCZA 4JU9A 4C0JA 3U62A 4BOYA 4DUGD 3QBTA 3GNSA 5JWRA 1UUFA 2H7YA 5KC8A 1O97C 1GQRA 1H2BA 3PXGA 5BSGA 2P2ZA 4K7JA 4J7UA 5D3ZA 4YCBA 1N9GA 2DY0A 3VPXA 5DVZA 4NPCA 3K71B 2QUKA 1JE0A 4IDNA 4KO1S 2W2LD 4ZZ1A 1NG9A 1U9IA 5IDXA 1FA9A 4K9SA 1G5RA 3JVEA 4G1MB 3L0BA 4QWMA 3TE7A 4J0IA 1BJKA 1TQDA 2X77A 5ALGA 5E9QA 2XDQB 3A6EA 5FADA 5H8WA 3FNGA 1P4SA 5AM2A 1PGQA 3UAGA 3VQTA 2BMEA 2YJ4A 3DMHA 5TGDA 1S1MA 1U0SY 4UDNA 1CS4C 2FUEA 5AK3A 3IDZA 2BZSA 5DBIA 1CQPA 2RHRA 4ALJA 4EW1A 1GZ3A 4XD2A 3KOUA 2ISCA 3SHTA 1C7EA 3MJSA 4AJJA 4N48A 1MG5A 2OCPA 4L22A 5HRAA 2YUTA 3VSDA 3JVVA 2DVMA 3MEQA 4XR4A 5LC1A 3TUJC 3X0DA 3FY4A 3EFOB 3R40A 1N7IA 1V1JA 4NMXB 1HYHA 4RLFA 2FZWA 2R6DA 4CU2A 2E4UA 4DYHA 5AD1A 3GC6A 3MMPA 1G3MA 4MA0A 1OQAA 3T5TA 1B42A 1D1SA 1OLSB 1Z6ZA 3DOJA 1GFIA 2DFLA 2A78A 5AKHA 4QE3A 3NJ4A 3C48A 3S5UA 5C1IA 5K6AC 3IE1A 4H0NA 1Q0TA 3M6AA 2ZB8A 1ZHOA 1RI4A 2A5LA 2PWYA 1ZJZA 1SCAA 3OVMA 2QWXA 2FN3A 2R84A 2WUGA 3NTUA 1BCRB 4E33A 5KNCA 2EBUA 4HDMB 4WXHA 4P3XA 4R41A 2C4VA 4WXRA 5DYGA 4MUBA 1C7FA 3FH0A 5FI0B 4Q9LA 3DEYX 1ZWLA 1T3TA 5EP1A 5FR1A 2WVGA 1GUAA 4HRYA 4BP1A 3L0IB 3ON5A 4UD6A 1VI2A 3DAOA 3AJRA 1Z38A 4EEKA 9MHTA 1AUVA 3LT1A 4MKZA 4B35A 2ZBGA 3VZCA 3TLYA 4IIXA 4KEAA 5LQAA 2HLDD 1FP4A 1RP7A 2PSEA 3H2GA 4J0KA 1XDSA 5F64A 1XXLA 1ZP6A 3IKLA 4FMDB 3GHYA 3R7LA 5B7GA 1GLNA 1ZVVA 4F84A 3TXXA 3LECA 3WGVA 1RRMA 1LPMA 3DNMA 3PNBA 4F4IA 3EZLA 4LFAB 2FSUA 1W9HA 3G0CA 4HDKA 3GRFA 3E27A 2WJAA 1N6RA 4KDRA 4JB3A 2SKEA 1TJNA 2VDUE 3N8KA 1RYFA 1KEZA 1PJZA 3D2LA 4RK1A 4XUGB 4TT3D 3WWZA 3AEUB 2G83A 1P7ZA 5ILGA 5BOVA 4PICA 2LDBA 2WOOA 3FHOA 1W6RA 4MB0A 4BMYA 4DSAA 5IYZA 5LYJB 4GS5A 3T1HB 4FGSA 1NXQA 4LW8A 1PGOA 2R8OA 1XMJA 3LP5A 3NDRA 4DSNA 5HKBA 4IJ6A 4W5RA 4KBGA 3O4JA 1JEYB 2CL5A 2C0QA 1JIKA 3CF4G 4HB0A 4QUJA 1NHGA 1XTQA 1R6DA 3DZBA 4IXNA 5KUTA 1JR6A 4FFDA 5AKJA 1TYZA 3U3DA 4YRGA 4DMGA 1NN1A 3DBVO 5KTSA 2IIVA 4KITB 1I4LD 3P8ZA 3KQYA 4RTRA 4KE9A 3K0EA 4XQCA 5KNLA 2NUBA 2HRQA 4C29A 1XZQA 4URUR 3CIFA 4FCVA 2HKIA 4MXDA 1T6XA 5IH3A 4I5IA 3FTFA 1O0CA 4Q4JB 1QKIA 1J49A 3D3KA 2Q7DA 2WD9A 1SU6A 1QQAA 1OKKD 4BE9A 2MR6A 3D6VA 3N7TA 4NV3A 3VTFA 5CA1A 2B4KA 7MDHA 3KZNA 2XMPA 2DYKA 3HB1A 1KNQA 3L18A 1CJCA 2ZSAA 1XRMA 3ANYB 3RYCB 3SSOA 4YMUA 3GEHA 5GJBA 1F4PA 4ISCA 5ALUA 1FS4A 1P0PA 1VBKA 2X8WA 3KFVA 1KK2A 1ATIA 1EIWA 3DL0A 5HM8A 1Y63A 5IJWA 5FPYA 1B93A 4N3AA 4ZT5A 2QN7A 1H2WA 2XSZA 1FOEB 1H93A 1Z6QA 2CJWB 1UKAA 3EZFA 3H8JA 2CNKA 2EG5A 1WMEA 4D4GA 1CFZA 3SJCA 1ZK4A 3FPHA 5JDIC 3R23A 4C4AA 3QFSA 3EZ7A 3BX1A 4KL8S 2X0JA 3AVYA 1CPYA 4K8RB 4FHEA 3LW7A 5CA1F 1P44A 4TSRA 5IAGA 1TAHA 4FR0A 1H6CA 2AWNA 4JQYA 4MWCA 5D7NA 5A5VA 2QQFA 4RVCA 5K3AA 1BHQ1 4DMUB 4BV8A 1S9DA 4EZEA 2BYTA 1KI6B 3C16C 4JEMA 1R0KA 4RMNA 4Q03A 4OUKX 1JILA 1Y1QA 4R3UC 4YTEA 4IHJA 4KWTA 3HXKA 3VI4B 4D99A 1FUKA 1UDAA 3FYDA 4P7GA 3U3MA 3L6UA 3NC4A 5GGXA 3T12A 3CUSA 3E8SA 4FD3A 4B43A 4ESEA 4HGZA 1H3EA 1JHZA 1DFGA 1U8CB 2HO4A 3P5BA 4M9XA 3TZ6A 2GAFA 1W29A 4TTQA 3WWYA 4G26A 4UVEA 1E2FA 1WKVA 2IXBA 1NI3A 2JZOA 4KDFA 3NAZA 4N1AA 3JWGA 4K40A 2C5BA 2HMWA 4OL0A 4WLFA 4ZT7A 1J2TA 1WNTA 5JVDB 3I45A 3TBKA 3WZMA 1TW3A 2VJMB 3VHXA 3ZK9A 1R5BA 2HHLA 3PGLA 4JR1A 1QG6A 2XB6A 4S1PA 4LEIA 5D5HA 1K0UA 1V39A 3PC8C 4F8JA 5JRZA 1RRFA 5DYIA 2VBFA 1FX0A 2C3PA 2VT7A 1BW9B 3C3XA 1QSGA 4RZUA 1OXXK 2QG4A 5E9WA 5A9SB 1QJ4A 3FX2A 4QELA 4M1WA 5LBUA 5IANA 3QPBA 4D3SA 3R5FA 1IBRA 4IHJF 3RK4A 3T3PB 1V1RB 2XTZA 5AWFC 2YZKA 5CCDA 4A8JB 2ZPAA 3RC3A 3OMXA 3FRIA 2GARA 3KQUA 3BJEA 4A6PA 4CUZA 3IVCA 1PJ2A 5DGDA 5K0TA 1QIEA 3FTDA 4BASA 4GC9A 2VHVA 1PNOA 4Y6SA 1O6FA 3DG9A 3I4CA 3OZEA 5H3CA 3TBHA 4KGDA 3IBGA 3WLMA 2Q4EA 5DLEA 1D04A 4MDHA 1UFKA 4EA6A 5A5EA 5J4YA 4A5OA 1PR6A 2KBEA 4B81A 2O9JA 2K7FA 3JRNA 4EUEA 4Z49A 5H80A 1TEXA 3ZJVA 2D5CA 5EMLA 1GXSA 1Q7BA 2AQIA 3B1ZA 3HVJA 2GN2A 4JWKA 3GRVA 4RVSA 4G3XA 3O31A 5HGJA 3R0JA 1L5SA 2ZTVA 4MV3A 4PYKA 4AUEA 5KHOC 4URHA 2B37A 3NFYA 2HRDA 1LD3A 1EFHA 1Z6TA 3DEZA 3MT0A 1G21A 3UYKA 4QTYA 1GKLA 1ODJA 2YZ2A 4EENA 2NUAA 1Q0SA 3IR7A 4IGEA 4IUDS 4JDPA 4DCGA 3O1LA 1W1IA 3QLUC 4YJFB 2IX9A 5A7FA 1DJNA 4G37A 1AY0A 2JGJA 4IFIA 2BZGA 1LGYA 3USCS 3RYHB 3WL7A 2HBQA 1WHTB 3PFGA 4L02A 4MAFA 2DR2A 3LWDA 4K6KA 1ST3A 5JOQA 3HJCA 5J2UF 1I0ZA 1LF0A 4B6EA 8LDHA 2JBHA 1N2GA 2ODWA 4GHWA 3QE2A 2YVAA 1ZS9A 2W2PA 4D9MA 4F4HA 2QRZA 3EIWA 4J29A 1QNLA 2BEUA 2EL9A 4DY6A 2C82A 3EPRA 3ZE1B 3MFQA 5K3EA 1QF6A 4DWOA 3G1WA 3UO8B 5M7EA 4NQZA 3QENA 4F3TA 3MQ2A 4I2NA 2Y1FA 4HOYA 1UIMA 3KZKA 2B9VA 3ZWBA 3CSUA 2Q27A 1Q16A 3QGMA 1L5VA 3AYZB 3KPUA 4ESHA 4Y6LA 4GM1A 3UWDA 3B6MA 1VIYA 1D6MA 2MU1A 5K3CA 2QUBA 3EAGA 3EAFA 3WKBA 3GZ4A 4KQFA 4OGFA 4DQDA 4I3HA 1OD6A 2PMBA 3I83A 4OJMX 1UC9A 4LGCA 1JFSA 2HMSA 2PH7A 1FNMA 4HVAA 2XAAA 3PQ8A 4L57A 4XOUA 3SJUA 4M0KA 4J6FA 4F9FA 1UJCA 2FP4A 1PU2A 2VUUA 4UMFA 2QNIA 5FDFA 3WWPA 2GVNA 5L3QB 4HVCA 3ILVA 3RUPA 4JH0A 2FPSA 5C8XA 4TX1A 5NULA 5HKOA 2WAYA 5IVPA 5DOZA 5KJ1A 2BWJA 2P9TA 1XLTC 4MHOA 1A2QA 4NFHA 1XZAA 2LV8A 3B5IA 1PLKA 2MSKA 4KR9A 1MC5A 1V25A 4NDZA 2JARA 4UDYX 5SICE 1BVRA 1BKYA 1D1PA 3V5NA 4X3OA 3HN7A 3PFNA 2D1YA 2P1ZA 2H8KA 2P9ZA 4DPMA 1Y6GA 2X1LA 4EPYA 1KMMA 4R6WA 1YRHA 4U6SA 1SBZA 4X62B 4EM6A 2G88A 4XWGA 2LD4A 1KY3A 1V43A 2VHXA 4OHVA 2R7NA 3MT7A 2GCPA 4FYHA 1TFRA 1D9XA 2HRZA 4FHDA 3OC6A 3QH4A 1JVNA 4G9EA 1JA1A 1YRWA 4UASA 5IRCD 5I8WA 5CPFA 1F20A 1ISHA 4HLNA 3SCZA 4EFKA 1Z25A 1AV7A 5HE8A 1RC1A 1Z39A 5HCUA 3ZS8A 2K2QB 4EG5A 3TDNA 5DM4A 1FTQA 1DWPA 5AT1A 4LC9A 2O8DA 3DMRA 4JI0B 4M9CA 4N3CA 1QX4A 1TK2A 1K5DA 2O3UA 4JGGA 4LC1A 4BBAA 4FCTA 2NWQA 4EW2A 3VA7A 1VPWA 3LCMA 4ZOLA 1MO6A 1RC8A 2RHBA 2FUKA 4MEAA 4PLCA 1O96B 4R8KA 2QZJA 3TRKA 1QCYA 5A2QA 1QFSA 2JCSA 2Q3BA 1GVHA 3LL7A 1R8QA 4H7EA 1I14A 5F4BA 4AXXA 3Q0TA 1T1RA 4JLMA 5DWVA 1OX4A 2AQKA 3DEFA 4K9NA 3V1LA 4BXOB 1BE6A 1G8AA 1SXQA 4HNHA 1VTKA 3WB0A 1CJUC 5MDHA 3DAPA 4FNAA 4MSUA 2GXSA 3VFDA 2SKCA 4F6RB 1UOEA 2GPTA 4Q4HA 2KLHA 2W7TA 2WWVD 4QGBA 5F5NA 1HLPA 3MWLA 4FZJA 2VHCA 2IXAA 1HE2A 1ZD1A 2Z4RA 1RM0A 1ZGJA 2O1EA 2Z58A 4GT1A 4JL6A 3ZV7A 5LQMA 1A2BA 2DFNA 5JFGA 1PZGA 2R6R1 5KVVA 2FGJA 4ZOLF 5ES3A 1VZ2A 4MYTA 3V2UA 1I1NA 1LBEA 5ADVA 3J81k 3D7RA 4V0OA 1DBIA 1PNTA 4S24A 2NU7B 1CUFA 3D3WA 1G8PA 4PR3A 1Z4MA 5TSDA 2BGUA 1V2HE 1MQ9A 2GTHA 4ND8A 1Z6XA 1RLJA 5JHGB 3T1YB 3O9ZA 5JCJA 4XWYA 1NY5A 4UTNA 2A57A 4B47A 4GOXA 3PUVA 4P32A 4YRBA 3ZCSA 3TD6A 3RREA 2OFOA 2Q8PA 2JFVA 4LOHA 4P4LA 4EA7A 1U3UA 1AGXA 2EFYA 2YASA 4IDGA 5DN9A 5ED0A 5ARCA 3ZV6A 3B8HA 4J1TA 3RR2A 4FFRA 2AXNA 3H9EO 3JQEA 1CS0A 4NNOA 5E95A 5EINA 5HTOA 1FJXA 1J1UA 1Z7EA 2OV2A 3DYIA 4CEJB 1T1SA 1B8PA 4LZJA 2BISA 5AKXA 3GLGB 1KK3A 2C57A 5LMNB 4AZVA 2D7JA 4D7AA 3DFZA 4E5SA 5C37A 1F2DA 3AEQB 1EWQA 4E09A 5D3MA 3QX7A 5P21A 6Q21A 2FEXA 3PUHA 1BH6A 1N3BA 2ZJOA 4IO0A 2GHRA 1NDQA 1BAPA 1THGA 4RY0A 5K3FB 4A3SA 3HA7A 1C4OA 3K5WA 5ESWA 5JRDS 5K7SA 2BGGA 1OU0A 4NQRA 2IL1A 3H97A 3IAHA 5TRTA 1MP0A 5LUAA 1OFVA 1IN5A 2YNMC 4BGIA 2PVSA 2Z3ZA 2NV2B 1WV0A 4QGGA 4BV2A 3CRQA 3VR3A 2OHFA 1HT2E 1QOPB 3IBSA 4G5OA 4F0JA 2O2ZA 1PW7A 1O94D 1XTIA 3VPCA 3WJ2A 4AJLA 4AKHA 1RPTA 3AESB 5JD5A 4BKMA 3RVLA 4EX7A 4Z9XA 3VU0A 1FSFA 1QHSA 1IOLA 1D3AA 2A84A 3CB4A 4WOCA 5EFZA 3TOSA 4LRTB 2Y0DA 3DBLB 2JJ2A 3D6MA 3SQNA 4C5BA 1GTG1 1YU9A 3OZRA 3CKYA 1PS0A 3I01M 3RBXA 5IVDA 4OYHA 1SU8A 1C3VA 1JT2A 2HNKA 3EXIB 4HDRB 4EI2A 1RAFA 1WMSA 4OO3A 1YHNA 1JLLB 3ZVMA 4BQPA 1AIPA 3RVDA 2GEVA 3SVZA 3R0VA 3R4VA 1ZKMA 2F59A 2XEDA 2V5UA 4PLWA 4EECA 4BATA 1UT6A 1VLLA 1R9GA 5BRJA 5KCMA 3SAJA 4P3OA 1QHIA 1Q92A 2GGSA 4ZJZA 2XYVA 5DCUA 3ABZA 1G20B 3F47A 3MOGA 2IU3A 3NBMA 1LCIA 1CDDA 3B1JA 4PO3X 1C8KA 2YWJA 4YDRA 3D1LA 3MJVA 3RANA 5JTTA 2ZBRA 3H18A 1A9XA 1QGOA 1RMYA 2J85A 3BG5A 3OMLA 5J2UA 3ZJUA 1ZMOA 2W6QA 3KT3A 4MQMA 5CGZA 2E5LB 3DHEA 1S6YA 2JHPA 3UOAB 4TRMA 3C45A 5B3LA 3UTDA 1BA2A 2GZHA 1F1BA 1V8OA 4KXVA 4OFWA 4YRLA 4YP6A 3WL6A 4WLEA 3ZOZA 3HDGA 3X2SA 4QLBA 5E3IA 4O4JA 1NMZA 1EUDB 2O2SA 5BSRA 4QC2A 1KHTA 3DDNA 4KWIA 3AJAA 3WIBA 3WMGA 5G2OA 2JGRA 3OQPA 4GPTA 4V38A 221PA 5MN4A 4O4IB 2ZZMA 3ZVKA 3LDUA 3LTNC 3IKJA 3NKLA 4NTZA 2OGTA 3O2JA 4GZ5A 4G0UA 1RRVA 3ITNA 5HKLA 3K0FB 4LWOA 1YR1A 1L5YA 3FYCA 4Q9DA 1QQ5A 4LHYA 2JGMA 3ENNA 3GFGA 3I9NA 5TPWB 4BKPA 4CF5A 4JFAA 3G7SA 4FI3F 1ESEA 3R9XB 1Z2PX 4R6XA 1JQEA 2G9NA 1L7NA 2ZB4A 1EDZA 1WXIA 2HMAA 3EGIA 3H11A 3GR6A 3KR0A 4FMCB 4HLQB 3M2TA 3U56A 1QO9A 3COJA 4KLZA 2QRHA 1DIBA 4GBJA 2X5XA 4GZ6A 2DH5A 4PQRA 1JHPA 4YNBA 5FO1A 4L73A 3VI3B 4D9FA 3OOHA 4RHYA 2P4QA 1V11B 4WZBB 3TLZA 1S02A 3A2NA 3ZYCA 5KU1A 5KTRA 3BS4A 5HMMA 2XLCA 5JS2A 1ZJ6A 3AVVA 2ZXFA 1CY1A 4GPIB 3OIVA 1P62B 5H83A 1R8JA 1PQPA 5DGXA 4KOAA 5DWDA 4HDQB 2OLJA 4WJKB 3JD1A 2I4MA 2FU5C 2FZVA 1RBYA 2RGBA 2OV8A 2D0OB 3JYQA 1UOQA 2GEUA 4IOMA 4MTLA 3ABQB 4B4KA 1JU4A 2V6IA 1GRCA 1NM5C 4EGFA 1JQAA 4Z1MD 2P79A 2WSSD 5DIFA 2WPNA 4FFWA 4KHZA 2G09A 2WIJA 3KC2A 3AGPA 1SHTX 3SGLA 1A95A 5HXAA 4EVRA 4NMHA 4BFLA 1Q20A 3EIFA 3KTOA 3VC1A 5A0TA 1EXWA 3EGWA 2IOFK 3CGWA 4NMLA 3SNHA 4ECAA 2QM7A 3KPYA 4F1WA 3RKSA 2J4CA 1LJUA 2EFHB 3B6JA 3LUFA 1PQWA 2VP2A 3LYUA 3NWOA 1YIAA 2OO7A 2IPMA 4UQOA 1YR6A 6CHYA 3PJEA 3EVTA 3P0EA 3I72A 2BFEA 4FUQA 4F04A 4LJ8A 1XZGA 1ZHHA 2QLFA 3C5VA 5K0EA 3IPXA 3PLRA 2HDWA 4HSGA 2BKLA 4LYDA 5IDWA 4BX9A 4QWWA 2ZI5A 2I7CA 3EGEA 1CR1A 3PQEA 1G5QA 4DDMA 4F56A 3S2IA 1P7CA 4KWHA 3G9TA 4EHIA 4X6XA 2A9QA 2CB9A 3TQIA 1XD9A 4JHXA 1TU0A 4LJKA 2J9YB 3NP7A 2V98A 4GGOA 4IOLA 2NYUA 3TZBA 5ELXA 2W8BA 4Q5IA 1D4OA 2ACEA 2R8RA 4QKQA 3I5YA 1AMUA 4CI9A 4UE3S 4RWEA 1I1HA 1WF3A 2IXEA 5F35A 1HXHA 3BH6A 1Z9BA 4MV7A 4PGAA 2J3MA 2P2CA 2Q1YA 5TMDA 2JFQA 1ABFA 2A3NA 3RTCA 3SR4A 3NBFA 4URWR 1NXXA 2QGFA 3A2MA 3ASZA 3F2VA 5HQ3B 3U3JA 3BSSA 4Z6KA 2IUTA 1E69A 4C5CA 1QFMA 5KYUB 1UKCA 4K0RA 1ACMA 2M9MA 1C0KA 1E2QA 3MWFA 1JYEA 3OLYA 4LV5B 4WKNA 1KC1A 2V4ZA 3OUZA 2H00A 4PBSA 3RAPR 3W06A 3GMSA 1P2UA 5KNDD 4TTSA 1SEPA 3IIKA 1E0DA 2FW6A 4GRDA 1T1IA 5BMOA 3N5CA 4ZK6A 2C2ZA 3QF7A 3T1OA 3IR6A 2X0KA 5ANRB 2Y6UA 4LUCA 2I2WA 1DSSG 4ZQHA 5THKA 3QF4B 1GADO 2OFWA 2QF7A 1WXDA 1CJMA 3AB8A 2G9ZA 5TQJA 4ZO7A 3DHYA 3H5TA 1T2FA 2AH5A 4M55A 4EG0A 3ESZA 4C03A 2G8NA 2VJYA 1W85B 4J43A 2AUMA 1NOJA 4M54A 1CUCA 5AM1A 3GUCA 4FCCA 4XVUA 3PENA 5EJ9A 2Q6KA 4IDAA 3IT2A 3K20A 2D0PB 2Y4NA 1F8YA 3GDFA 1Z8HA 1T6BY 2N3ZA 3AVPA 4XGKA 1XU7A 5E8RA 1CRZA 1KJ9A 4RVNA 5LMCA 1VCMA 3LX5A 3B48A 2WJPA 4KI0A 2J45A 1DG3A 5TQ2A 1Z5ZA 5CD1A 1VCOA 3RO7A 1NC1A 1VJ0A 2GJKA 3E9ZA 3RVOA 4CEHB 5JAOA 2RONA 5HHTA 4FDMA 2R44A 5IABA 3WGZA 5KQSA 1IZ7A 1EAYA 4OL9A 1W581 4P35A 3MBKA 4KLAA 3ZZ1A 3GZTB 4KBYA 5KAMA 4AZSA 1CQIB 2NO9A 1UMKA 4RDHA 1WUHS 3AIKA 4CIVA 4CKBA 4FGUA 1CUUA 4OJYA 3KUUA 3X1WA 4HFJA 4ZFNA 3HR4A 5EC8A 2W2TA 1JDNA 1M0SA 2D1RA 2VT2A 3CF0A 3DFFA 5E38A 1Y4DE 4F2WA 1O5TA 1YAJA 4YAJA 3OMWA 3ADDA 1XZJA 4C6RA 2P4HX 5JATA 1LWOA 4O1IA 3WK5A 3TL3A 3ZBQA 3O47A 4PHHA 4QNMA 1HI9A 1KJ8A 1M1YB 2X13A 2I71A 2IP1A 3EF1A 2IJGX 2FLVA 4QQNA 4TMTA 4HTFA 4UDXX 2CKDA 4PSKA 1RU3A 3EC1A 4TKUB 1L9XA 3RYFB 2N42A 1PSDA 1T5DX 1Q83A 4JBGA 4COKA 1ZK1A 1UL1X 1F2UA 3LW8A 1XO1A 1WULS 2XNHA 3TQQA 1I6LA 3ANMA 3I6QA 1P9NA 1L4LA 2QDXA 3DT6A 3OQ6A 4OQPA 2VCYA 4FGJA 1I2MA 4H2DA 4H35A 4PLFA 2BY4A 1E3LA 4YRQA 1IRXA 3L01A 6AT1A 3ZLUA 1C1XB 1WXXA 2C4NA 3CYFA 1A88A 3LT5A 3M6FA 5IJ9A 2MSWA 1J9GA 4P5EA 1VA4A 1LKZA 4RA6A 1HQKA 3WLQA 2Z2YA 2LCQA 2CYBA 5HFAA 2M2IA 2XVXA 4DQKA 2BFFB 3HU1A 4JI2B 4EVIA 4WHMA 4DV0B 2IBSA 5JO9A 2B34A 4O1MA 1OOEA 5K8LA 2DTXA 3A6DA 4N0EA 3OQOA 2GTPA 3VUFA 2IYQA 4CMIA 4BC0A 4JYMA 1GN8A 1ZK0A 1YFZA 1PUJA 2JBAB 4UCWA 4PVDA 5DEOA 3KAKA 2Q9UA 3L6BA 4CM8B 2QMOA 4U5XA 4ALMA 4V1CB 5IKPA 1RXYA 3ZJTA 3E7PA 2I6UA 4QO7A 4W7SA 1CDOA 1G2IA 1XQXA 2CEKA 4ZTBA 3RT7A 1XP5A 3OG9A 4B40A 2GBPA 6ABPA 4MV5A 3A2KA 2RSLA 1NU6A 2A67A 3KVRA 3OHPA 4DIOA 1KJIA 2Q3EA 3DJFA 2YVUA 1YZYA 1HOTA 1P5RA 3IUBA 1ISGA 4PCAA 3WYCA 1QG0A 2BMVA 1KDVA 4FE4A 3RH0A 1QLHA 5F7ZA 4WY8A 3SIRA 2BKVA 3IJPA 2C7BA 1GAQA 5FOSA 4W82A 4CR7A 1U3CA 4RV9A 4P3YA 4PY2A 2APJA 2JH3A 4RPGA 3X3HA 1U90A 2Y6VA 5JQGB 5JY6A 3VKGA 3NCHA 3PFFA 3H2IA 3NAGA 3CNQS 5AHKA 5JROA 1BGVA 4URFA 1TEZA 1X9IA 4EG1A 3WYAA 1J0BA 1J1IA 1QHHA 4FHFA 1MABB 2P6PA 4OK3A 4RV5A 1GPJA 4YPVA 3EXEA 3W1WA 1RXEA 1YSCA 5E6SA 3WWCA 1JR2A 2GJAA 1KYIA 3IBTA 1LSOA 1L7EA 4U3JA 3SF0A 4CIAA 3NCTA 2IOHA 1I7LA 4IDEA 1XEXA 3W2IA 1EGVB 1WMBA 2EZ4A 3WNCA 1J25A 1R6XA 1S2MA 3V34A 3A9VA 3D7NA 3P19A 1XZBA 5CYGA 1FW6A 1RTTA 1W5SA 1E9FA 4MS4A 3KK0A 4A7PA 5K8VA 4TPKA 1BMFD 1FYDA 1MG0A 3TFQA 4ZQBA 1OV4A 1TQ6A 2ZAMA 4M1TA 2PS9A 1XYYA 4EKDA 2EARA 3ELUA 3TW8B 3SHFA 1CUDA 2JJ1D 2Q45A 3G1TA 2DUMA 1AKNA 1NVMB 2W6IA 4RHTA 2YZMA 1BN6A 3I37X 4LMPA 4LWQA 1W87A 2XQVA 3QJYA 4I6JA 2XRFA 1NVEA 3DUFA 4FMBB 4IUCS 4ZT6A 3I62A 4MO2A 3QMVA 3BKXA 4AXBA 2Z5GA 2OEPA 1MDFA 3OWHA 5BNZA 4D98A 4AS1A 1HL3A 4HMPA 4XM2A 3FHLA 3JD0A 4B6SA 2ODNA 4AYTA 3L9WA 1BCSB 4MQUA 3R7SA 1OYYA 3LAWA 4MR9A 2NW6A 3ZE2B 2XGGA 2XH8A 4HWKA 1F5NA 1I3OA 2FPKA 2ID4A 3CRZA 4LJYA 4B73A 4IP0A 4HDSA 1POWA 1RYEA 4YMSA 1JQ5A 3FOAA 1ISRA 5EIFA 5JSYA 1ID8A 3E22B 1GZVA 2PKQP 1XMSA 4IIJB 3UWOA 3OFND 1IY9A 2K5UA 5EJMA 1BOFA 3GLFA 1U2GA 1MNAA 2CHEA 3JQFC 4FHZA 5EWJB 2WYVA 2OHVA 1KVTA 3S2GA 1EINA 3OM8A 3M4ZA 5ECGC 2CVZA 1CZUA 2AFVA 2OWDA 2OSVA 3A6JA 3BFJA 1G7SA 3X1KA 4XWOA 1QP8A 1RQGA 4IIUA 3UW3A 4C21A 1O97D 3OEED 1AN9A 2E7ZA 2HFKA 4RJ2A 4CRWB 3U44A 3BGVA 5FAKA 3H1PA 4F97A 4JUIA 1A1SA 1VJTA 1AO3A 1GCUA 1X7DA 2C96A 3MQ4A 4F96A 4EMUA 5HW0A 5JTUA 1WUJS 4NFSA 2HCTA 3IDSA 4UHFA 3RUFA 3CHYA 5DCWA 4FNOA 1G59A 2ZE7A 1NF9A 2GTIA 4UXIA 4YBZA 1P0MA 3GD5A 1YRAA 3SZMA 1OA0A 4NCBA 3K53A 1KBZA 4B3CA 2HU5A 5SYMA 3OJWA 4DCPA 1DBSA 2WTMA 3R77A 4K26A 3NPAA 5EP4A 4ZGGA 1E3JA 2FFAA 2HO5A 5JAMA 1JEQA 4FWBA 3HFGA 2YICA 4BO6A 3AFMA 4B71A 4B82A 4EYGA 1U9JA 1R66A 2H4YA 1DTWA 1IOWA 1G5HA 2C2BA 4XYBA 1OTXA 1WDMA 3EXHA 1E3SA 1XAJA 2H2FA 2RCYA 3EQZA 4HQRA 4Q12A 3RTEA 3QJ5A 4CZ2A 3I53A 3E70C 4MIEA 5K2OA 2C99A 3BGDA 3WNBA 2O2IA 4ZVNA 1C7QA 1XEWY 3V7UA 3LFHA 3C43A 1EAMA 1WHSB 4TLBA 2V0NA 1E8DA 2XTMA 4H15A 4PX9A 5LBIA 5E6RA 2PQ2A 4AX8A 5C8YB 1PJ3A 5EUCA 5I9NA 1DJOA 3L4BA 4TS1A 3DDOA 3BMOA 5KKCA 3AERB 1F0KA 2DKNA 1H6AA 2IHKA 2JIRA 1L5KA 3AJDA 4LDRA 4RKEA 3UJ9A 1E9EA 4DM7A 4I1UA 1CV2A 2OKGA 2FX5A 4C6HA 3EEQA 4PZ9A 4YI3A 5GQSA 3VJKA 4RTMA 1NUTA 3OLVA 4HY3A 2VI5A 3ER8A 1OPXA 7AT1A 2G7MC 1M2HA 1JQ3A 3UUEA 2D1TA 1LV7A 1SVNA 2Q5JA 3NXKA 4PYNA 3E15A 3WIUA 1XI2A 1AF7A 4XKJA 5KHAA 1E2LA 1GPKA 1KMHA 3WSVA 1LUAA 1ETHA 5B1IA 1Z5GA 4C3OB 2XCOA 5LXTB 1YGYA 2QQ5A 2HI0A 3GDGA 5IUKC 2PWZA 3T5CA 1OJLA 5KI6A 4E32A 4G0NA 4UPVA 3E7XA 3WLPA 3D4LA 2FQYA 3HYSA 5EIWA 4Q4LA 4MQEA 5JASA 3LBHA 4MP3A 5LDDC 4ZYUA 5BN3A 3L9XA 4XM1A 4E3ZA 1KJZA 3PXAA 2CCJA 1LDGA 2FK7A 2J3QA 4MUNA 1Y98A 1FK8A 1I7NA 4MI6A 3T0GA 3ISJA 5AVQA 4ZVLA 2ZIZA 3RG8A 5JY1A 5EKXA 2CYCA 2EP5A 1DUSA 1P2TA 2JNWA 2W6OA 3M1LA 4WSOA 3SF8B 2H07A 2ISSD 1L4UA 2B2CA 2O8CA 1UXIA 3AP1A 3DA8A 2JFBA 4J4BA 1JNYA 5K8IA 3S8YA 1JI3A 1XDGA 2FE4A 1KYZA 1GA6A 1WQ4A 2I6FA 2XYPA 3KSZO 5BW6B 4C07A 1HG0A 3FPBA 2HMYB 3NRCA 4C2AA 2WUEA 5CDTA 5CLIA 2X7XA 1G38A 3ES9A 4KB5A 4IH9A 3KZXA 3AM3A 4R84A 1EBBA 2NT4A 4Z8YA 2WHQA 4J2OA 4UNNA 2SHKA 4LY9A 5F5XA 2QHXA 1YCFA 4KN5A 1A2KC 1S2LA 2XY4A 1FNDA 3BM5A 2C9BA 1U94A 4UHBA 1JSCA 1Z6PA 3KQMA 5EXSA 1JPNA 3I5MA 5ELLA 2GPSA 5C7YA 1AZWA 3CXRA 1EXDA 1BXRB 5ALTA 4BVGA 1HQYE 3V3TA 1CETA 2FWMX 4R71A 4JP2A 1PR9A 1EP1B 1KMIY 1GKUB 2F9FA 4O3FA 1R5OA 3BRSA 4X84A 4YAFA 2HADA 3SX2A 4UEQA 3C6MA 5PGMA 4BAUA 1NGSA 1ZUIA 4D0SA 1XMVA 2O8BB 1ZR4A 1L5NA 3DP7A 1EFTA 1HT0A 1ZU4A 1WR8A 4Q4AA 3GGOA 3FCAA 4QOJA 4C7KA 4KN8A 2REXB 1MA0A 3JQ7A 2GZDA 4D41A 1OZ0A 1ZIOA 3EYWA 4X1IA 1YR2A 3B89A 1XWWA 1QDLB 4PTLA 2XUGA 4PRKA 3ZHRA 1FW8A 1X1QA 4I55B 2IHVA 2HUNA 2ZSDA 5EZYA 1CEXA 1BFKA 1LTHR 2EGGA 2ZREA 1J5PA 1SKYB 1ZIYA 1U0RA 1B4DA 3DVLA 2R65A 1XFAA 4H60A 4PNEA 4TTRA 1CP2A 1ZH2A 2FFRA 4GDMA 5DCYA 2C84A 5CFOA 5HR5A 3DW3X 1ISPA 3LC0A 4A27A 2VRCA 5DP2A 1TMGE 5MGBA 3Q6IA 4FIZA 4UMDA 2EG9A 1Z75A 3QG5A 1TM4E 2ZDGA 3H2JA 3OZBA 1KAEA 1KI2A 2PWAA 2WG1A 4MWEA 5LMZA 4MUHA 1P0IA 4AWBA 3GLTA 4GEGA 3SEFA 4BLRA 2XECA 4L2IA 5I8PA 3UGQA 1P6QA 1WXEA 4OFZA 3NM4A 3BEDA 1YXMA 3HGMA 3OZFA 4Z3DA 4I46A 3S8EA 3FZQA 1G8SA 4W8GA 5A4AA 4E5MA 1L7DA 3IAS1 1IU9A 4KI7A 1N1MA 5CVUA 1G0OA 2CNWD 3IALA 1K4MA 1C29B 5GPBA 1VG0B 5JI2E 1DS6A 2ZSUA 4BJ3A 1AH2A 4LTDA 1J99A 1XQ1A 1ZONA 1FJHA 1I01A 5BT9A 2EBWA 5KVSA 5BNTA 4XPIB 4GKBA 2XQIA 5A3QA 3AQIA 1BKDR 2W2QA 3JXEA 2WJZB 5BQ3A 1HLFA 2ZRPA 3B9RA 2IV3A 1JDBB 2JIPA 1JWLA 3PE6A 4G25A 2P6OA 4J0FA 3ROFA 1NJ1A 1A69A 3UXMA 1XKTA 3EA0A 2WM9B 3DFKA 3PD1A 2P2SA 1S2IA 3W5HA 5C7LO 4URXR 4AT1A 1P2BA 5F9MA 1T1GA 3BIJA 3MTQA 2WT9A 3FDZB 2CL6X 4KIJA 5JSKA 4TQGA 1JJ7A 3NYWA 3RVQA 3JYHA 3ZY6A 1UC8A 2CDCA 4KPUB 2Z30A 1K8XB 1S1CA 4RCZA 2EZ9A 3VKVA 4GSKA 3I9MA 4B84A 1Z6GA 3VPGA 4RK5A 4XSHA 5CBPA 5LIPA 2AHRA 3ESYA 1UBRS 4G86A 3UAWA 2BM8A 4DLZA 3AEXA 2NG1A 2A6PA 3ET4A 4W9NC 1U02A 2GPNA 2VNKA 3OUTA 4F8YA 1KMQA 2VP0A 3NV9A 5CVDA 2SNIE 2XJ4A 3E81A 2J7PD 4MW5A 4CMEC 3T41A 2A30A 4Z4GA 4HVLA 1EB9A 4P7KA 4CM5A 5I9BA 4ZYLA 1MO2A 2DUWA 3K16A 2VA9A 3QI7A 4GGPA 4TL7A 4ND6A 2BP7A 4YRZA 5BO5A 4YACA 5ALRA 4OJNA 1P4AA 5B1EA 2JD1A 3SLKA 3T9EA 3CH6A 1YA6A 1K86A 1W76A 2PIDA 3CQ9A 3O8QB 1C14A 5FT9A 1L4YA 3TW0A 1XA3A 2W6PA 3KYJB 3B9BA 3M8KA 4X1OA 3WJ1A 3NVKI 4L4RA 3OF5A 4JT4A 1MBZA 1P0FA 3E8MA 3GU3A 4QJBA 3TOXA 5KBYA 1HEYA 1V4NA 2O8EB 3PHBE 2DR0A 3ZI4A 1U8XX 1JKJB 4QBGB 3K2BA 1OE0A 1PLLA 4Y0AA 2F8MA 1GNQA 1NF3A 2Y92A 5EJGA 1NDHA 2Z6UA 1J2UA 4FR2A 1E7RA 3RE1A 4C14A 4FFPA 1OBVA 5JMWA 2OHXA 3K6RA 3N0XA 4TTPA 3EFOA 4IDPA 5KDLA 1W4RA 2QN1A 2RI6A 2Z3VA 3UPTA 2OXEA 2R6JA 3GWGA 5EQTA 1XR3A 3K9HA 1VJCA 2BHSA 2AXPA 2CHGA 2F90A 2PGOA 3L7BA 3NJ8A 3OE1A 4IDQA 4ZDJA 4PNPA 3QHPA 2I91A 3VHRA 2QP9X 3WYNA 2JD0A 1V3TA 3PEFA 4GYYA 1EWKA 4IGIA 4INAA 4HUQB 4UM5A 4F2PA 3TJZA 1EJ0A 1I1OA 1A8IA 4M49A 1WEHA 5G4KB 2DFKB 3F90A 1T8WA 4A26A 3B3FA 1OFIA 3D3JA 3QWAA 4OXIA 1YMUA 1WQ1R 2OQVA 3WBKA 1HF3A 4D8TA 5CXQA 1DAOA 4PIMA 1CJKC 4D9CA 2W90A 2YIDA 1W4BA 1YBAA 3IMEA 5DGTA 1NNLA 2QL7A 3H5AA 2CJFA 1CU1A 2VXBA 3FZEA 4ZO4A 2Y9MB 2WDZA 1RZUA 2IYVA 2WILA 3DLAA 1TM1E 3LIPA 3NASA 3WDKA 1PSWA 3JQ9C 4A0HA 3EIEA 4EHKA 2VNSA 1H94A 1BWQA 2COKA 1M5UA 4QDTA 3KT0A 3HNPA 1OTHA 3CLTC 3SMVA 2YV4A 1DADA 1PT9A 2I03A 2OXRA 5LLTA 4MKGA 5DPMA 1KVUA 1SUAA 2QN8A 1LDYA 4KSYA 1OASA 5FOWA 4Z4IA 1SBNE 1NUPA 3KPVA 3CJQA 3O91A 3K9GA 1G8KA 5MN6A 3GLGE 2EZUA 4MMYB 4P7FA 3KKEA 1P91A 4M46A 1JLHA 4G0ZA 1GJRA 1WPGA 1H23A 2C07A 1HE3A 2ZJ8A 3ZW8A 1A50B 1ZVJA 2POQX 1R88A 1DO2A 1H0RA 1Y3DE 5LYJA 1RI1A 2B20A 3DCNA 3FZGA 4DJEC 4JLJA 3NEAA 4D5GA 1X39A 1RBQA 1YL5A 2FKNA 1WO8A 2PX0A 3A27A 1KVRA 2X0IA 3O90A 1E1RD 2PWBA 5AJHA 2ZIXA 5FI1B 5ILOA 2NVOA 3HLTA 1JEYA 3ZWAA 1PTJC 1PV1A 2IYNA 3B1KA 3SJBA 3PTAA 3DEAA 5DV9A 2C3OA 5AW6A 4UHHA 2ZAYA 3ZS9A 4DAEA 3IQXA 3RRFA 1U0FA 1ZRMA 1CG6A 2JC3A 4ZVKA 2H0AA 2GJ4A 1ESMA 3GVXA 3ZJYA 4MLZA 3DKPA 1AC5A 2A5DA 3WGNA 2IZ1A 1NJ6A 1UANA 2DQYA 2AJBA 3AKCA 3A4IA 3SHWA 4J91A 2QRPA 3B38A 3INYA 2X9QA 1OAKA 4XR9A 4MUEA 4OCZA 3V1KA 3WQHA 4EP1A 2AK3A 2ABWA 5T64A 5ICCA 1OIVA 1R0XA 1RW4A 1P9WA 4GSYA 4WRRA 1KETA 2BDTA 1QOQB 2NNLD 3N70A 2Z2XA 4HNSA 1IN7A 4IIDA 4D0NA 2YJ3A 1UWVA 4M88A 3AI1A 4E12A 2JL1A 3I3SR 3NYRA 4MWBA 3OF3A 5JNUA 2QMHA 4LRYA 4RGVA 5K3DA 3REOA 3VYSB 4QT0A 1BXGB 2HDOA 4YLYA 1WBBA 2CJWA 2R1UA 2YDYA 2Z1NA 1KTVA 4KQHA 1NVVR 1G20E 3VGPA 1JSXA 4EGAA 4EDHA 1QTRA 5F3WB 3PFCA 2GUWA 2HGSA 2JFUA 3UFXB 3TNJA 1L5HB 3GZJA 3GDHA 4JVLA 4YJHB 5GIOE 3E9DA 3FTPA 4U7GA 1VM6A 2WHEA 3ZDRA 3GGDA 1B6SA 4ID3A 4FZVA 4IV5A 3RSOA 1YOVA 4MRVA 1U1EA 4HQ6A 2VUHB 5THQA 4UAUA 2V3CC 5DLYA 3UW1A 1ULBA 2YHIB 1LXCA 2H5EA 4HO1X 1W0JA 5ECWA 5B2ZA 1M7HA 4LA4A 1UJ5A 1UPTA 4GXNA 5KKAA 3D5QA 3VPBA 4D4KA 3BDIA 5A7HA 2ZRAA 4JB2A 4CE6A 1NONA 1YNOA 5KX5B 4XWWA 1EWTA 4JXZA 1J1ZA 1YKSA 4MRMA 1X87A 4NHOA 1ZY2A 3AJ9A 4KXFB 2GK6A 4J6EA 1DC4A 3FYUA 4OOFA 2YS7A 4AI6A 2Y1GA 3U7HB 4V0QA 2V45A 2Q9AA 1WKBA 3BMQB 1G5IA 4MO9A 4MVJG 4YXWD 1OW3B 1DKLA 2FG5A 2IY7A 3DDCA 4LYHA 4PTZA 2VF2A 5IT9A 5F51A 2HOQA 3KSMA 4KWEA 4S3MA 2AG6A 3YASA 3FXAA 5KYYB 2GAIA 4BEBA 5DNCA 8MHTA 1Z36A 2H48A 2I2BA 5LP6C 1SXHA 2GJ9A 2MSDB 4TLCA 1P8JA 3N0WA 4X6LA 5A9SA 1BW9A 3KKMA 3MCUA 2YNMD 3SD7A 3UHJA 4DQVA 3PRKE 1TYEB 3K6SB 4JD5A 1YB1A 2LPMA 4OA5A 1HDGO 5BVGB 4Z8XA 1V1RA 1TF2A 4A8JA 5DOVA 4PS1A 1N75A 3WHIA 1GGHA 2DFPA 4RYDA 4WZBE 4H17A 2PUGA 2ZKLA 5CR9A 3P9QA 1T3SA 3OLCX 4X8LA 5BN4A 1B0AA 1CERA 1TZ2A 3HDVA 2EF1A 3UWMA 3A6PC 3ET5A 4LJAA 2AR7A 3D1JA 4DARA 5MGNA 1OVGA 3QE4A 3KEMA 4IDOA 3E5HA 1Q2XA 5HFJA 2XNJA 1JEJA 1U6IA 5CMLA 2OOKA 1LPOA 1SKQA 1YZ3A 1JLRA 1GPNA 2X3FA 1ZNXA 3H2BA 3HYNA 5EIOA 3R76A 1OCEA 3AUTA 1P2FA 1L7QA 1J06A 2FJUA 2GBLA 2H17A 2VK8A 1Z7BA 1GY8A 3OIFA 4HQOA 4I5DA 4IMIB 3RKRA 4C20A 2FG7C 2FY8A 4HJRA 3JD2A 3RFVA 4KK4A 3BL8A 1DRWA 3MWDB 4NWIA 5E9AA 4QEZA 1OT3A 3C1OA 5AI0A 3T7IA 3T9DA 3DLHA 5TR9A 5EP3A 4HZIA 3INRA 4UARA 1GUZA 3VV2A 1AUXA 3U3OA 1QZZA 3K0CC 2XKJE 4ALIA 1DKOA 1R6UA 1R4NA 2P78A 4I9GA 3GJTA 5JS8A 2HYIC 2ZQZA 2WD7B 1RKVA 2WYUA 3UK7A 4ARZA 4GLOA 4YJFA 3H2ZA 2DH6A 7MHTA 2HJSA 1V2GA 1SZDA 4LSZA 4N0DA 4K9RA 3AR5A 1UBJS 5AHOA 3T7EA 5A9RA 3DDHA 2EFJA 4TZ6A 1WHTA 1XRPA 4KFSA 4ZC8A 2BI4A 2QD1A 4BL5A 4M22A 4F4UA 1GCGA 3TVDA 3GUYA 4GPAA 1WSWA 1Z2NX 1L6RA 4YH1A 5GIPE 4BDSA 1U9ZA 3A1NA 2FKAA 3T94A 2BGLA 1XK7A 4M0MA 1T2NA 3SHQA 1GTJ1 5AKYA 2OCYC 3AOGA 2EWWA 3O0DA 4YP0A 3P2YA 3NBQA 1Z2DA 2JLWA 2NQ2C 2FSSA 3FDFA 5AVOA 1Z0FA 1FFCA 1OU4A 2B7LA 2CFOA 2ZFUA 3MB8A 3PF8A 2F9MA 2X6QA 4PGHA 1VOTA 5A9TA 4KV9A 3O2NA 1PDWA 3Q3JB 1YB7A 1B00A 2K6GA 4BQSA 5C8ZA 1N5JA 3ZU5A 3MRXA 4ZWNA 5C1PA 3MBOA 2VK1A 1KIAA 5MN5A 4Y2UA 4JMPA 4G84A 4CNBA 4BNFA 4H6VA 4C0KA 4MGIR 1T0HB 2FSVA 3OCZA 2GN0A 3WAGA 1X1TA 4R8MA 1L5LA 3PNPA 4NBRA 2FR1A 2OBXA 3ZCTA 1Y1KE 2G4CA 5F78A 2CF5A 4J3JA 1NKTA 4TV8B 1D09A 3LQFA 4LVCA 4ZO9A 2IS4A 3WL5A 1ORDA 5BYJA 1NKSA 1XF1A 2A0KA 2XYRA 4GPD1 4J9UE 1QTNA 4LCEA 2YWXA 3EZ2A 4L9RA 4YCLA 3JVIA 3R3UA 5C34B 5JR3A 1Q0PA 2ZSHA 1KXZA 4R2XA 4DRXA 1NVVQ 5I5EA 2PX8A 1AHNA 3WMWA 3A4TA 1M73E 3EG9B 4JAVC 1MW8X 3WYFA 2CF6A 5U1PA 2ENUA 4OLJA 1RLUA 1YBHA 3I2HA 5LNK1 3HO6A 3I8XA 1UJ4A 3ND5A 2BFOA 2PLNA 3LC7O 5JU6A 1IN1A 2B69A 1PW5A 2ODQA 4NYJR 3SC2B 2NTVA 4Y0VA 1MFZA 5IG2A 4J16C 2PU7A 3M4NA 2XW6A 1CY7A 4X1KB 1RLTA 4I1RA 4JC4A 4I1OA 4CFSA 4YMLA 3W5BA 4RIIA 3FCUB 2GASA 3O5AA 3T0FA 2JAXA 4CHGA 4LKRA 2ORED 2RHDA 1LEHA 2AC2A 4C7BA 3PJGA 3HRIA 5EAIA 2FQQA 3HSYA 3CE6A 3N3AC 3BBPA 4IUYA 1O96A 2FB9A 3GGCA 2CBXA 1ZHFA 3HCOA 3L84A 1Y1RA 1N2OA 5FQNA 5JALA 2J48A 4GO1A 1YF3A 1C9NA 3LY8A 3QOYA 4DY4A 1A9OA 1L5RA 3UOWA 3ZWKA 5EHXA 2X8JB 3ESCA 1ULHA 1TM3E 1YQ9A 4AIIA 2IOYA 3KQKA 1ZI6A 1Q12A 1G9XA 1CBUA 1XRNA 1I0IA 3H9GA 4E46A 2I76A 1C8VB 4CKZA 2H1OA 2IVZA 2P9QA 3MHTA 2MCFA 4F6RA 2YY6A 2QIPA 3LI2A 1QWOA 3WL3A 2IEGA 3D8SA 1EP9A 3OM1A 4NABA 3RFUA 1IHOA 5BV2P 4ENUA 2P3OA 1E6KA 1R6AA 3A04A 3JWIA 1XKLA 2QYHA 5J23A 1NBHA 1VBFA 4YUAA 2XUIA 4DMCA 1GAWA 2FZCA 3DXXA 3EIQA 1R6BX 1WPRA 4TTVA 4BVKA 1M1YE 5JIBA 2BKEA 3L1KA 4FC6A 4FS8A 4R9RA 2PWPA 3A3OA 1H6DA 4OXXA 2ZRI