2Q0XA

Alpha/beta hydrolase fold protein of unknown function
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
294
structure length
294
Chain Sequence
SRPEPVQGHLFTYYKDPYCKIPVFMMNMDARRCVLWVGGQTESLLSFDYFTNLAEELQGDWAFVQVEVPSGKIGSGPQDHAHDAEDVDDLIGILLRDHCMNEVALFATSTGTQLVFELLENSAHKSSITRVILHGVVCDPENPLFTPEGCAARKEHVEKLMAEGRGEDSLAMLKHYDIPITPARLAGGGFPTLQEAVWNPCIRKEFDVLRRSVGVIKVPLLLMLAHNVQYKPSDEEVGTVLEGVRDHTGCNRVTVSYFNDTCDELRRVLKAAESEHVAAILQFLADEDEFRTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Trypanosoma brucei alpha/beta-hydrolase fold protein with unknown function.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 102
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08538 DUF1749 Protein of unknown function (DUF1749)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q0xA01
2JGKA 2G5PA 5HCUA 1XQWA 4YASA 1WHTA 5ALHA 3HC7A 5AKGA 2CEKA 4PSUA 4Y2QA 3D2CA 2CJPA 1XROA 1L7RA 1O6FA 5AI4A 3WZMA 2XMSA 2QT9A 4QLOA 3W9UA 1K63A 1GPNA 2GZSA 4U2FA 4HS9A 4J0JA 3I1YA 5CTAA 2OCIA 1IUOA 2GYVA 3I6ZA 1Q84A 2LIPA 5LZ8A 3H2JA 4X71A 1R50A 2OPHA 5SYNA 5IH7A 2HADA 3AZQA 2QOEA 1EB9A 2I3ZA 4H77A 3BWXA 5T4HA 1YB6A 3VJMA 4XJVA 1CUYA 2PKYX 5FUMA 3ZI7A 3WWOA 1UOPA 1XZJA 3OPMA 1ZD5A 1DWOA 3L1IA 3STYA 4XIIA 2H9YA 5LLSA 2ORYA 2JGLA 5EFZA 4EA6A 4OUKX 4B6GA 1WPRA 4UFOA 4G1FA 4U2DA 4OYYA 4LXHA 1WCYA 4AQDA 1H22A 4L72A 2J4FA 1XZAA 3E3AA 1BCRA 4CG1A 4J7AA 3ESBA 1PV1A 1QIGA 2ZYSA 5AI6A 1DTEA 1E5TA 4GWLA 3D59A 4X6UA 1GXSA 3C5VA 3D5EA 3VVMA 5LIPA 2DCMA 1VXRA 4EY5A 1U4NA 4GEGA 1F0NA 4JUIA 2ZJ6A 1TCAA 5T4BA 1BE0A 3VISA 1QIKA 1O6GA 2Y2VA 1NX9A 4WDQA 4LIPD 4A5SA 3EIOA 4FNMA 3V1MA 1CUXA 4QDZA 2VTVA 1TRHA 4QDOA 4QA9A 4B9EA 2GZRA 4EUSA 3FVTA 5DLPA 2BCEA 1M33A 2Y6UA 1X2BA 2QMQA 5AH0A 1MX5A 4UBNA 3P2MA 3M3DA 3FLAA 3R3YA 1ORVA 4ZI5A 4X6YA 1N5RA 1VA5A 4LHEA 5I8PA 3ESCA 3LIPA 2K2QB 5CT4A 1Q0ZA 4GBGA 1DINA 3LLCA 3C5WP 4UUQA 4FLEA 5JIBA 3G8YA 2RONA 4MXDA 1ACLA 2WIGA 1XZHA 1XZMA 3SX4A 1CRLA 3I28A 4J3JA 3DYVA 5KREA 4KR0A 4Q3LA 4BVJA 1MAHA 3IULA 4AO6A 4QDXA 1EDDA 3FWHA 4Y2YA 3HXKA 1UK8A 3U1TA 3W9BA 2AJLI 2VAVA 4Q82A 5ALWA 2V97A 3H04A 3WIOA 4LYDA 1XLVA 3AINA 1GGVA 1XRNA 5EHNA 1XQYA 4X6XA 1UKCA 2PM8A 3OM8A 4B85A 5C81A 3S8YA 2H7CA 3O4HA 1NU6A 3G0IA 3TEJA 4HXEB 1CUUA 2QUAA 3TRDA 1K5PA 3ZLVA 4M0FA 2DQYA 4J0GA 1VOTA 4DSAA 3TGLA 5EIHA 3M83A 5AKZA 4GW3A 1E8MA 5AM0A 1WOMA 3AZPA 3R3ZA 4P93A 2XE4A 2JF0A 1A88A 3GELA 4BB0A 3O9VA 5JALA 2X5XA 1SC9A 3IA2A 1YAJA 5HZGA 2WHQA 2ZJFA 4V2IA 5LZ4A 3NGMA 4EY6A 3DJYA 1AZWA 2Y6VA 4BZZA 2VJAA 2RHWA 2ROQA 1SCIA 1K8QA 5CXXA 4BVKA 2AJCA 3STUA 4N8EA 2XUPA 1EA5A 4C01A 2JEYA 1TIBA 1SCKA 3QH4A 2ZYIA 5EI5A 1UT6A 2HIHA 4PSCA 2YYSA 3ANSA 4OU4A 4UBLA 4BP8A 1BRTA 1YCDA 5AKXA 1DT3A 5DNWA 3CN7A 4MQMA 4W1SA 4JNCA 2AXEA 1EK1A 3OC0A 4H7EA 3H0CA 3I6MA 1YAHA 4P92A 2VT7A 4YPVA 5CURA 4NZZA 2PSFA 1VA4A 3Q0TA 3IUJA 5EIEA 4G4JA 2WKWA 5JYCA 1CVLA 4OB7A 4J0HA 3FSGD 3WK8A 3U0VA 4DIUA 4G4GA 3I2JA 1FFDA 1ZI9A 2WILA 2BUAA 3K2IA 5LKAA 3A2MA 5CT9A 2QJWA 2O7VA 4BZWA 3QZUA 1B41A 1C7JA 1IVYA 4DMHA 2B20A 4MYDA 2RAUA 2WU3A 3G02A 1ZJ4A 4B83A 3AIMA 3ICWA 1AX9A 1G5FA 1EVQA 4OSEA 5BWCA 5DTJA 4K5QA 2OGSA 2ZYHA 2AJBA 4E14A 3FNBA 2XB6A 4WY5A 1R3DA 1UOOA 3WKEA 5DNVA 2Z8XA 4B80A 1FFEA 3STVA 4KAFA 4ROTA 5JD5A 4U2BA 5DJ5A 3WYNA 2XDWA 3H2GA 4J0KA 5C8ZA 2EDCA 2VJDA 3BF8A 3DQZA 1CUEA 4MEBA 1U2EA 3I2FA 3H2KA 4Y2VA 5AM5A 4X97A 4XVCA 5DYTA 3UUFA 3LCRA 2OCLA 1HDEA 2VT6A 4KRYA 2WHPA 3WWCA 4UBOA 2GBGA 2WIDA 5AKLA 5FPQA 1QFSA 4WY8A 3BIWA 2GBIA 4KAJA 3KWFA 4F5ZA 1VZ3A 2QM0A 4QZVA 1CUZA 1XZEA 1XLWA 2WTMA 3WYDA 4CCYA 4UHBA 3T52A 1R88A 3WK4A 1LGYA 5CRIA 5HF6A 4LXGA 2CB9A 4DSZA 3DS8A 3F9CA 3FVRA 5JZSA 3BIXA 4N5HX 3IBTA 1DQZA 4JYMA 1BU8A 2XUHA 3GZJA 4W1QA 3JYHA 5AKYA 2ONCA 4CCYB 1P0PA 5JAOA 4DMKA 1MJ5A 2WJ6A 2WHRA 4IHAA 1CQWA 2JGJA 4BAGA 4H7IA 3B12A 2DHDA 3LS2A 5AM3A 1ACJA 4FBMA 1JMYA 4X85A 3RKSA 3GFFA 5A71A 5A2GA 4Y2TA 5ALOA 1E66A 1YR2A 5EGNA 2JBWA 4DNPA 1R4ZA 1BROA 1QONA 1UK7A 3EBLA 1FFAA 4Y2RA 3WQHA 5BWBA 2XUDA 3G9XA 3GA7A 5AM4A 1QIIA 3WKAA 2HA2A 2OCGA 4RE5A 1MNQA 3PFBA 3OURA 3DD5A 3I2HA 1E89A 3WL7A 3G9UA 2HU8A 2ECFA 2HDWA 3GROA 1WB6A 3OOSA 3WIBA 2W22A 1VLQA 4EZIA 3O0DA 1TKRA 3DEAA 2GYUA 1JU4A 2DR0A 1PFQA 3QYJA 5FOQA 1Y7HA 4KYVA 3C70A 1IZ7A 1YS1X 2WUGA 2B9VA 4HXFB 2OCKA 4X90A 2HA5A 5JANA 1KU0A 2H1IA 5AKKA 3R3XA 2WFMA 4HXGA 4BP9A 3G0GA 1P0IA 1UK6A 3STTA 2HA3A 1YB7A 5FDFA 4KE9A 2ZSHA 3H2IA 5D6OA 3VXKA 2OAEA 4E15A 4OYLA 4OU5A 3W04A 1ZD2P 1CUWA 2HU5A 1VJ5A 5AKEA 1CR6A 5HFNA 3D4LA 4J0CA 3C6YA 5T4EA 2RIPA 4L0CA 2OGTA 3RARA 4OB6A 1ODSA 2WG1A 4U2GA 1HKHA 5AI8A 3ANTA 5J3JA 4QEKA 1MTZA 3O9MA 4G8BA 4ITVA 3SWWA 1EXWA 5C7YA 1PJAA 4H7JA 2C5GA 1DT5A 1QIEA 1R9NA 5AOAA 3BJRA 4BYMA 3DL4A 3G0DA 2PVSA 2HA4A 3CXUA 4DNQA 2I3DA 1IUPA 2RI6A 4J03A 1CPYA 1XRPA 3BE8A 3L1HA 5SYMA 2JGEA 5H3HA 5LYYA 4BDSA 3PI6A 2XUGA 4F21A 3GBSA 5AOCA 3DOHA 4QWWA 3QMWA 1T2NA 2HFKA 2YASA 4KJXA 4HTAA 4CI9A 1MX9A 1RYYA 2Z3ZA 1Y37A 4TGLA 4DM7A 3KOOA 4GHWA 4UBKA 3BL8A 4B9AA 5K3EA 4PQEA 4PW0A 4G9GA 5JD6A 4X93A 3IVMA 1UZAA 1W52X 2WFLB 3IUQA 5ALGA 3FAKA 4H18A 4H7KA 3W06A 2VSQA 4X3CA 1HBJA 2V96A 1LBTA 5ALNA 1D07A 5K5EA 4AN1A 5FPPA 2HRQA 2G5TA 5HQ3B 2QR5A 1MPXA 1E8NA 3WL5A 2V9ZA 4Q3OA 4OD0A 4GECA 2JGFA 2E3JA 3R40A 1U8EA 4TPKA 4UHEA 5IVHA 3A6ZA 2HRRA 1TAHA 1XRQA 1DWPA 4ZV7A 1XFDA 2J3QA 2XMBA 5ALUA 5FLKA 1QOZA 4F60A 3WK6A 4L3WA 1BCSA 1DU4A 1GQRA 4KEAA 3HACA 1DX6A 2XT0A 1GQSA 5K3BA 1UFOA 5E4TA 1GKKA 3HI4A 5A62A 1CLEA 2I78A 3EQ9A 5HK8A 1UKBA 3KWJA 1ODTC 4BTLA 1VE6A 1LPPA 2D5LA 5E2IA 1EH5A 4AZ3A 5AI0A 3WA7A 2WU4A 4AB1A 1YA8A 1XRLA 3LIIA 2XUAA 5K3DA 2X8BA 5ESRA 1EK2A 2XMDA 2QUBA 2R8BA 1XLUA 4WFJA 3KXPA 5HK9A 1R9MA 5JADA 3YASA 4F0JA 4UFPA 3FOBA 3A2LA 3WL6A 3A2NA 5AIAA 2XUQA 4MWSA 3V1KA 1Q83A 2B61A 5AK4A 1EDEA 4TVKA 1BN7A 2XQIA 2O2GA 1AURA 1DQYA 4EY7A 1TK3A 4XX1A 3DLTA 4U2EA 1QGED 3NUZA 1EVEA 5FKJA 1AC5A 1MAAA 1YASA 1CUVA 4DLNA 3IDAA 5D3ZA 1FFBA 2PPLA 2DHCA 4DNFA 1W1IA 2IITA 1LPNA 3MUNA 3RLIA 2Z8ZA 3PFCA 5ALZA 5CW2A 3E4DA 5ALMA 2NW6A 2WJ4A 5IVIA 3TJMA 4MJ3A 5AK3A 3V9AA 4CG3A 4FLFA 3G0CA 5AIBA 3R3WA 4UHCA 5E4YA 1P0QA 4RPCA 5AI5A 3H18A 3EQ7A 2D0DA 1C4XA 4K2AA 1SFRA 5ALSA 1G66A 2WIJA 3D2BA 3IURA 4Y2SA 4BRSA 1MNAA 2CBGA 3SK0A 4YK7A 5EHXA 2GYWA 1G42A 1ODCA 4ZXFA 2WTNA 4JEIA 3ESDA 4B7ZA 3JWEA 3BXPA 4EY8A 2EDAA 2DFPA 3QBJA 4K6GA 5AP9A 5DYYA 1EB8A 1Y7IA 3K9BA 1WM1A 5EHZA 1UOQA 2RHTA 4Y7DA 1H2WA 4CCWA 4Z49A 1W75A 3RM3A 1XZLA 2CZQA 4DMCA 1LZKA 4B81A 5I7UA 3FBWA 2GBCA 2VJBA 4BC0A 1QJ4A 4PF1A 5HKBA 1QZ3A 5CMLA 2XMRA 4CIBA 2PSHA 2OXEA 4GLBA 5HFAA 5I9IA 1BS9A 2XUIA 3M81A 4XWGA 3DCNA 5ALKA 1MX1A 4D9JA 3A70A 5K3FB 1HQDA 4NS4A 3PICA 1MU0A 1SOMA 3V48A 1LLFA 1LNSA 2PUJA 3HRHA 3WMRA 4X00A 1AMNA 2XLBA 3PUHA 4W1PA 3ZLUA 4Y2PA 4G4IA 5HF8A 1AKNA 4WJLA 3MVEA 3ICVA 5IVKA 5FXMA 4AMZA 4IH9A 4L9AA 2PSDA 1WB4A 3DYIA 4RGYA 2WQZA 3FCYA 2AJDA 3ILSA 3DKRA 4BTVA 1EI9A 4J0IA 1A8QA 4G8CA 2ZJ7A 1N1MA 1ZD3A 4NMWA 3I2KA 5AM1A 1QIFA 3QMVA 1Z68A 1ZIYA 5AJHA 5ALEA 2CKMA 4C88A 2HU7A 1QE3A 4IO0A 3S2ZA 5ALPA 1DX4A 2P8SA 4FWBA 5HF9A 2HA6A 1XZIA 2QRUA 3R3UA 2XUKA 1LBSA 5FP0A 3QVMA 2X76A 1IZ8A 4H7FA 1ZIXA 1GKLA 5ALTA 2XQGA 4KAAA 1H2ZA 4E11A 2QXUA 3H17A 2WHPB 1GPKA 4AO8A 3STWA 4LKOA 1XZGA 4Q34A 4GXNA 5CBKA 4UBMA 2G63A 1K4YA 5D7BA 4BE4A 2HFJA 1QIHA 1CIJA 4UHFA 2IIVA 4EB0A 1USWA 5JZ9A 2UZ0A 4H0CA 1LPBB 3K6KA 1A8UA 2DSNA 1QIJA 3DL7A 2XMCA 4PO3X 3UMJA 5FRDA 2C0QA 4G8DA 4G5XA 2ZSIA 1YS2X 4FFVA 4AZ0A 4Q1VA 1X70A 3VDXA 1QO7A 5A7GA 3PF8A 4C4XA 2Q0XA 4IQ4A 3AZOA 2J4CA 2H7XA 4BRZA 1MO2A 4PSDA 5K3CA 1J2EA 5JARA 4B0PA 3WZLA 3B5EA 4H7HA 5ALVA 4BAZA 1YA4A 1CUJA 4C4ZA 4P9NA 1HL7A 1ETHA 5JASA 5CH3A 1EHYA 3HYSA 1JT2A 5HKAA 1XZFA 2WFZA 4W63A 6YASA 5HQ3A 1B6GA 1OILA 2QTBA 3F96A 3H1AA 1J07A 5DNUA 1BEEA 3JW8A 3AILA 2PBLA 2WJ3A 4GDMA 3WJ2A 1IUNA 1VZ2A 1CUCA 3MGAA 1Q0RA 4BCDA 2QKYA 3WJ1A 4Q3KA 3WL8A 3L1JA 3O4GA 1J1IA 5K3FA 2R11A 1W6RA 2C0PA 5BV7A 1X2EA 5C8XA 1H23A 2Y2UA 4QE3A 1ZOIA 2PU5A 5DTIA 3ZWQA 1XKLA 1CUGA 1QTIA 4Y2UA 4DNOA 3DNMA 3FLEA 1QTRA 4K6HA 3O4IA 1F0PA 2XMGA 3C87A 4EY4A 3QITA 2WUFA 3WK9A 1LPOA 5IKXA 1FSSA 5D3KA 3ZPXA 1U65A 1CV2A 4Q05A 4UHDA 4WFIA 1S8OA 3H2HA 4C4YA 3EF3A 3PUIA 3KD2A 2EEPA 4BDTA 4AX4A 1L7AA 1TQHA 4QWMA 1UWCA 3M82A 3ED1A 4ETWA 3OG9A 1XKTA 4QDUA 4ZV9A 4LYEA 2FJPA 3I2IA 1MT3A 4DYHA 3LP5A 3QPDA 1H2XA 4C6HA 1LPAB 3HSSA 1J06A 5CH5A 1DWQA 2BJHA 4BAUA 3NOXA 4X94A 3X3HA 3ZLTA 4BBZA 2VEOA 5ISMA 4ZWNA 3HJUA 1XQXA 5ALYA 3BDIA 1ZI6A 3CCBA 1N5MA 3HEAA 4FTWA 3F67A 5LZ7A 5JAHA 4FFWA 1GPLA 5KWIA 2DHEA 3V1LA 4W9RA 4MEAA 1ZGCA 4BCCA 4MQLA 2QXTA 5ALRA 3V1NA 4OPMA 5AK6A 1JMKC 4U2CA 3SC2A 2ZYRA 1QO9A 3E0XA 4KRXA 4O08A 3O95A 2W6CX 3ESAA 3HLKA 2VATA 3HABA 4PNZA 2I03A 5EIAA 2WLSA 1W4LA 3QMMA 1VE7A 2VQ6A 4MWTA 4X92A 2CUTA 2C58A 4ARAA 1AGYA 2WIKA 1LPSA 4BATA 3GUUA 3FLBA 5FV4A 1XZCA 1F6WA 4K6KA 2Z3WA 4AN0A 5E4JA 2HA7A 1ZJ5A 5JAPA 3I1IA 2OQIA 1JU3A 1L7QA 4CFSA 3C6ZA 3R0VA 3C6BA 4Y9SA 1QIMA 4AMYA 2BUCA 5AI9A 5ALIA 3WWDA 4GI1A 4CG2A 1WHSA 4QNNA 2BKLA 2BGNA 4YX9A 2O7RA 5KBYA 4ZREA 4ZGBA 3AJAA 4BVLA 5IVDA 4HVTA 4FMPA 4FHZA 3AUKA 5A6VA 4FKBA 3ZV7A 1LPMA 1BN6A 4N5IX 1VKHA 3D3NA 1G4HA 3KSRA 2HHAA 4I3FA 4J0DA 3D0KA 3FYTA 5EHQA 4KE6A 4B82A 2O2HA 3QPAA 4UBJA 3AIKA 5ALXA 2CMFA 4X7BA 4Y2XA 3W2TA 1I6WA 2Z5GA 3H1BA 2WG0A 5YASA 3WLAA 3G9TA 3O4JA 1EDBA 4FBLA 4BCBA 4BC1A 2VF2A 2Y1KA 1ZGBA 3I6YA 5AK5A 4RE6A 1XZKA 3IB3A 2VAXA 2G4LA 1CUIA 3WI7A 3EQ8A 2VA9A 3WKDA 1HPLA 3WKBA 1QIDA 4B0OA 1KU6A 3G0BA 3QM1A 4ZRDA 5AKJA 3OTQA 5KWJA 5HF5A 5CT8A 3IUMA 3RK4A 2BGRA 4EBBA 3F98A 3I2GA 4UFNA 4UHHA 1RP1A 5AICA 2C7BA 5ALFA 1A8SA 2WSLA 1CUAA 5AHXA 1CEXA 5LZ9A 4WDRA 2ACKA 5JZBA 3FYUA 4A23A 4FOLA 1YSCA 2ES4A 1EINA 4WFKA 4QLAA 3PDCA 3WA6A 4KE8A 5A7HA 2JGMA 4FDMA 1THGA 3AIOA 1C7IA 2OG1A 1ZD4A 3C8DA 2BFNA 1P0MA 3G9ZA 1H2YA 2RGUA 4P08A 3F97A 4M0MA 2H7YA 4AXBA 4C89A 4INZA 1UKAA 3MUOA 1HLGA 2XMZA 3CCCA 1IMJA 5CXUA 4H35A 4DMFA 5AOBA 4X95A 3IUNA 2DQZA 2OQVA 4UPDA 3WWPA 1OXMA 4OB8A 4WCVA 5JD4A 1W76A 5CH8A 1FJ2A 5AM2A 4I19A 2XUOA 5LZ2A 1UK9A 2XMQA 2HL6A 5CT6A 4M0EA 2V98A 1T4MA 2PUHA 4Y2JA 1CUBA 7YASA 4X91A 2QVBA 3FYUB 4AO7A 4H7DA 1FFCA 4W1RA 2WIFA 3BF7A 5F4ZA 3VKFA 5ALDA 5LZ5A 4BE9A 2WUEA 2QS9A 2OAGA 4E46A 3AFIA 2GBFA 2JGIA 3HZOA 1CUSA 3WK7A 3FCXA 5AKHA 2C5FA 1JI3A 2QJRA 1CQZA 4IH1A 1UXOA 5ALQA 2OGZA 1LZLA 2BAGA 4HZGA 5JAUA 2WM2A 2XI4A 3D2AA 3DDUA 4LXIA 2ACEA 5BOVA 4UBIA 1SCQA 2XUFA 2PSEA 3UUEA 3R3VA 1N8SA 1XRMA 2O2IA 3G7NA 1RWQA 2B4KA 3B3QA 1F8UA 4MYSA 1CUHA 4NVRA 5DWDA 2JIDA 3FSGA 4EHBA 1XZBA 5C8VA 4CIAA 1ISPA 5AKIA 2PU7A 2FUKA 4C87A 2XQKA 1XRRA 2JEZA 1TCCA 2ZVDA 3E1GA 1ZI8A 5DYWA 1A7UA 1BEZA 1CUFA 3N0TA 2PL5A 4JH0A 2HA0A 3QPCA 4IH4A 2J3DA 2PX6A 3C6XA 4PV7A 1JJFA 3N2ZB 1AUOA 1GT6A 2XQFA 1VXOA 3STXA 3NWOA 4S0XA 4JYPA 1EX9A 1JJIA 2YH2A 1JFRA 2WFLA 3DOIA 4KE7A 4FLMA 5ALLA 3D7RA 4QDTA 3VJLA 3W05A 3C8HA 4OCZA 1OCEA 3DKKA 2VJCA 4N8DA 4B84A 4KACA 2HM7A 3IIIA 1XZDA 2IX9A 1KEZA 1WB5A 1GZ7A 3H19A 1WPXA 1R1DA 3WK5A 4DGQA 5LP1A 5T4FA 1E3QA 2YXPX 3CN9A 5K3AA 1JKMA 1JJBA 4A16A 3FYUC 5ALJA 2WG2A 5AO9A 2QZPA 3WWEA 2WUDA 2XUJA 3VVLA 1TCBA 4G9EA 4ARBA 1QFMA 3BDVA 3PE6A 1ORWA 3Q8WA 1E8DA 3VJKA 2BUBA 5A7FA 2XQJA 1CFJA 1ZICA 5CT5A 4DTCA 2PSJA 1K6EA 2FJ0A 1XQVA 3T4UA 1CUDA 4N8SA 3C43A 5JATA 2OLEA 2AJ8A 1NU8A 2XLCA 3R41A 1AQLA 4HRYA 3BJMA 4HRXA 3PF9A 3C45A 4FNGA 1MN6A 3WKCA 2C4HA 2FX5A 4HAIA 5LKRA 1THTA 1QLWA 3F8SA 4RNCA 3KDAA 4I4CA
chains in the Genus database with same CATH superfamily
3EE6A 3OUUA 4P3PA 5K0SA 5EHIA 2QF7A 1BJKA 2Y1OA 1UXJA 1XQWA 3AI3A 2DPMA 2QT0A 4L5JA 3G7UA 5HCUA 2E4XA 2XNDD 2ZI6A 3OCJA 3SS8A 4D9EA 5DH9A 1JFFA 3N7UA 1FQKA 2NO7A 1GUZA 3OEHD 4XB6B 3FJYA 3DEJA 3UGQA 1LF5A 2OXFA 2O5CA 3ZY3A 2O8FB 1BH2A 2PCJA 2YWFA 3D2CA 3GLQA 1XROA 4ZAVA 1WXHA 3BBLA 3HCCA 1J8VA 1O6FA 4D9IA 1GPUA 3IT0A 5BQXA 5FFNA 3WTCA 1MOPA 2HN9A 4PRZA 2BSQA 3K9FC 4QLOA 2VK8A 2GZSA 2GBLA 4EPWA 3QKSA 3K20A 3OQMA 4O3FA 4HEQA 3I1YA 3VVCA 5B3JC 2ZZKA 4CTJA 2OCIA 3TFOA 3ZYCA 5DDIP 1CWUA 4C7KA 3IKMB 1J7JA 1M5TA 4MZXA 3T7IA 1YK1A 3HKBA 1ZM4A 3R8CA 1L5OA 1NULA 1IAQA 2PGNA 5CNIA 4AJHA 1W2GA 2XTAA 3E3NA 4WNIA 3PPWA 5JAZA 2I5PO 2LIPA 2PCLA 2RK4A 4FB5A 5JSFA 1R4MB 2WBLC 3BM5A 1O8CA 3MTIA 4ESVA 2BZGA 3WOVA 2GEDA 4Q9NA 1AZSC 3WYEA 5LMCA 2PS3A 3OX1A 4C20A 5SYNA 5A5VA 3QELB 2ALJA 1F4PA 2QYHA 2QOEA 2D13A 2LD4A 4RENA 2RHDA 5L53A 1FPQA 2HEGA 2P9EA 4H77A 3OJXA 1H3NA 1J70A 1GZUA 3Q8KA 2EHDA 3RTEA 3NH9A 4EG8A 2EKQA 4YRQA 3R7AA 1SCUB 3PRKE 3TEFA 1XRSB 3OQOA 3TLZA 1CUYA 4IIJB 2W0SA 3D0QA 1RM0A 2HTFA 2I9PA 5G0VA 3AL3A 2O8CA 3EB9A 3T12A 3OPMA 1QGYA 3L1VA 3LC2O 1ZD5A 4BEBA 2P4QA 2PK3A 3L1IA 2FGKA 4CHTA 2O23A 121PA 4K0RA 3G5MA 3PD7A 3CW9A 4KO4S 2X9NA 2VZ9A 5JTUA 3T6KA 3A04A 5EFZA 2EWMA 2VXCA 3NOQA 3WAKA 2X13A 4Z51A 5K8JB 1VP3A 1VLLA 4HX5A 4PAMA 2NTJA 1MDFA 1WCYA 3O83A 4JP1A 2IUEA 1IIBA 1X0XA 4NAUA 4RJKA 4NABA 1EMDA 1H22A 3CW8X 4P82A 4BJ5A 4KMRA 4EECA 1I4WA 2AKAB 1EG2A 1SZCA 3N8GA 4BN0A 2J4FA 3C6MA 2FZGA 3I9FA 5C5CA 1P62B 2VIIA 4CG1A 1X8XA 3PLNA 4CTKA 3ESBA 1JQKA 4I7EA 4X8LA 4ZEXA 5BSVA 2HHLA 2ZYSA 3OQ1A 4R0VA 1UAAA 1I1QB 1DTEA 1E5TA 1NPDA 3EA4A 4HQ6A 3RUCA 5CFQA 3JALB 3PHBE 2F6RA 2Q4BA 3RTCA 3M4ZA 4ZIRB 2PX8A 1G21E 4P3NA 3BXEA 3KIPA 4RVGA 8ABPA 4UNRA 4X1IA 3K0HA 4BMSA 5LIPA 4LBVA 1S9DA 4X20A 4EG3A 4I1YA 4EY5A 3SGLA 2I4MA 1NG1A 5LA6B 4XYMA 4IHJB 5IKOA 1QMPA 3UOGA 4Y6PA 4D4KA 5BN5A 5LLDA 5A4DA 3PUKA 1BE0A 2BC9A 1QIKA 2J67A 1WMDA 5C52B 2X77A 4MW4A 5CFNA 4RTJA 2Y2VA 1E4EB 1A50B 4QBTA 1GQQA 1OE0A 4A5SA 3EIOA 2IYZA 3L8GA 2ZRBA 5KNBH 1UAGA 3IAUA 1A2BA 4HGYA 4GZ3A 3LOUA 4R31A 3HDHA 3QKRA 1DADA 2AB0A 4GXTA 1NMEA 1XU7A 3P8ZA 3QLVC 3TIVA 3V1MA 2FQ1A 4C0BA 4D0LB 1CUXA 3RAGA 5EWLA 2QR2A 4CMIB 4D45A 1TRHA 3WL4A 4LXUA 1FQJA 5EEGA 1ARZA 3QIVA 3ZGLA 1DDOA 3R74A 1PWXA 2ZXUA 3LM8A 1EFDN 1M33A 3OTHA 1W2WB 5EJ9A 1C81A 5KQGA 5T3UA 1IWPB 4L9SA 4DCGA 4ETNA 4LFBB 3PXGA 1FU4A 2HK8A 4O1MA 3SJBA 4DV4B 1Z28A 2XB4A 1RZRD 2EU8A 2Q1WA 2W93A 4TWAA 3CWCA 5A6SA 1GR0A 1M54A 3FOWA 3OLQA 2GZ2A 4ZCPA 2QVCA 2O1XA 3RV3A 5F5XA 1EPUA 3KYJB 5K03A 4KHPB 3U4QA 2JJ1A 5DHUA 4YDRA 1W25A 2ZWMA 3PL5A 4PC6A 3OE5A 1E7QA 1VA5A 3P4XA 1RWMA 5CLQA 1UFRA 2QTHA 3T9AA 3UV3A 2D7CA 3BFPA 3LIPA 5D86A 2HHJA 3CLTC 5CT4A 1YRAA 3COVA 3QVTA 1Q0ZA 3BUSA 4BNYA 2QQGA 5L3ZA 1Z6XA 5LB4A 3DAFA 3NETA 3LCJA 4MR9A 3H65A 4HLDA 4F2DA 1F9EA 1PJTA 1E7WA 3LLCA 2YZNA 1FLVA 3G8YA 2RONA 1OBCA 3S0JA 5FD8A 2YWJA 4YUXA 1Y1TA 1VIDA 2ZBQA 1E1QD 1X6VA 3GJ6A 1JJ7A 3FA2A 3H13A 1WVGA 3UT5A 3FPFA 3CJQA 2O6HA 3RGWS 3VAYA 3RYCB 4JNKA 1P77A 2M1XA 5K0TA 1HR0B 4IWNA 1JTEA 4KPUA 4Q1CA 5ELMA 3VYVA 3H86A 4JL8A 2HSEA 3OMLA 3TW8A 2B7LA 2C2YA 4BVJA 1G41A 5FJIA 1BKDR 2A5JA 4GKJB 3GDWA 1OLUB 5I4IA 1EDDA 5IPFA 1A9ZA 1KK1A 4Y2YA 3UC9A 3X1YA 3F47A 1M2FA 1R27A 1NQWA 2X6RA 5IH3A 2VUTA 1AVTA 1I0ZA 2ZWVA 1GG8A 4H9GA 1MORA 3E5HA 3DMTC 2ASEA 1R5OA 3ITKA 4GGMX 2V3WA 2F17A 3G13A 3KU1A 3NHFA 2WAYA 1U3DA 2YVQA 4IYJA 1IN6A 3W9BA 3WV5A 4B35A 2Z09A 5EKSA 1TMOA 3ELYA 2AJLI 1BXRA 3LTEA 1PR5A 4KN8A 4LOHA 4LY3A 1YB2A 2L2QA 3OLZA 4LHYA 3BREA 1E2KA 5FNVA 3BS4A 1Z56C 3KZKA 3K3PA 1RQRA 1PNOA 1TUGA 3PEVA 4RKFA 4YHBA 3EGXB 3ONEA 5K05A 5K0JA 5DN6D 3AINA 4EMSA 2VT2A 2XOXA 3GUZA 3E7DA 3IBSA 2LIVA 3I9V6 3OPYA 3QVXA 4UPVA 2O4CA 2JRLA 4X6XA 4ZOBA 1P1CA 4K9DA 4HZIA 2VQFB 5FNZA 3HDYA 4FZRA 2W4MA 5BT9A 1XD2B 1W4CA 1U04A 4Q1FA 3AWIA 3VC2A 4JBHA 1GTVA 3O0TA 3O4HA 3G0IA 3JPYA 2W90A 4L50A 3DQPA 4QTZA 1C7ZA 4QHTA 5DWQA 3FTCA 1HY3A 4CE6A 1JAYA 2JFOA 5DM4A 2GAIA 4ZVQA 1Y1PA 2QJOA 4GR5A 2G07A 3SJ7A 4UM8B 2QRMA 4BLVA 5DM0A 2CXRA 4XIYA 1XD8A 4QAJA 2VZLA 3TGLA 2A88A 3V6LA 1E6EA 5AKZA 3LY8A 4ZJZA 3C7CB 1E8MA 5BSFA 1WOMA 3AZPA 4LOIA 5CNKA 2H11A 1QM5A 4NU8X 1J39A 4TLMB 4XPZA 2ZIUB 3NTQA 5F1YA 2ZPTX 4IF6A 4GOOD 2FN9A 3O9VA 4WINA 5JALA 2IP4A 4XDHA 1SC9A 1XR3A 2HNKA 3K0AA 2W2XA 3AG6A 3SJCA 1N6IA 1TPZA 2HRDA 4F3KA 2VYNA 1T1RA 1JP7A 2PBRA 5HJ5A 1YAJA 3WE7A 1UJCA 1V11B 5A1JA 2HV8A 4LV8B 2ERYA 3B1ZA 3NGMA 3UUGA 5EG5A 4HX9A 2Y6VA 3GT3A 721PA 1DIHA 1GG9A 4BZZA 3PJRA 3FB4A 4GYYA 1MP0A 1A9RA 5CXXA 4N8EA 2XUPA 4PQYA 1F12A 1EA5A 2H2WA 5LQAA 4BKOA 5EZYF 1SD1A 3NDRA 4N39A 4KGZA 4CM7A 4UTRA 3B60A 3TX6A 2ZYIA 4PZEA 2H92A 3ODPA 5ED0A 1UT6A 3K7EA 3G68A 1NW5A 3ANSA 4OU4A 2B99A 5GVRA 5LLTA 2VCHA 1R3UA 3HKCA 4UBLA 1B0UA 2FPGB 2VDLB 1BRTA 5AKXA 4FM9A 4DUGD 1JHYA 1SKQA 3S8MA 1ZD8A 2F90A 3ND8A 3ZH2A 5WRFA 4DQKA 1DT3A 4K1LA 1Q7BA 4GL4A 1KTIA 2RHRA 3CN7A 1Z2PX 4W1SA 5AQ1A 2VAMA 4V1CB 3LFHA 4ALLA 1I6MA 4H6XA 1EK1A 5B3LA 5AJWA 2C3YA 3ND9A 4C0LA 4RD3A 4XJTA 1USKA 4DUPA 1N7IA 4RH3A 5CX1A 1P2SA 3GNSA 4RYDA 3KVYA 4NBNA 4X84A 5GGXA 3RRNA 3UK1A 4B4OA 3Q0IA 2DTXA 1YR1A 2ONKA 3KL4A 4TYMA 4OP1A 1F06A 4CKXA 1EJ6A 2W7TA 4HGNA 5ITZA 3MA0A 4D5GA 4UVDA 1QC5B 3SZRA 1W4RA 4GPEA 4ZODA 2CDBA 3GHYA 4DVJA 3E5MA 3BORA 2H5JA 5KJCA 1VA4A 3NAGA 4HY3A 1Z0JA 3GVHA 3FFWA 4HPJB 1X1QA 3BK7A 3IJ5A 3Q1KA 5CR9A 2NMVA 3LHDA 2XCUA 2CXQA 1ADFA 5JYCA 1CVLA 3VR4H 5HYVA 1E3IA 2HGZA 2GPYA 1V6CA 3I8OA 4QEDA 1JECA 4R2LA 1QP7A 4UW9A 5D5PA 3T38A 1SXQA 4HYEA 2DHQA 2ORIA 2Y68A 3EASA 5DX0A 3T99A 2YNMD 4QM6A 3ZDEA 3B7WA 3A6JA 2ZR9A 5LBUA 2RG7A 2GGSA 1Y5LA 3NHRA 1A04A 1P80A 4M0KA 3S2UA 4LRXA 5LOVF 5GVSA 3QFSA 3OX3A 1HLDA 4N7JA 2H0QA 4WSOA 3F2IA 3Q9NA 4WERA 5EC8A 2FN8A 1OIWA 1K68A 1H0KA 4E5YA 2QA5A 1QAQA 3TXXA 1R4NB 3ZHTA 3NTVA 3UMFA 1KZHA 3V55A 1JG7A 1T6YA 4DMHA 5C5IA 5IJWA 1GNTA 2FPIA 3I05A 2RAUA 1CVIA 4IMIB 1IEVA 4BNNA 5IN4A 4B83A 2PUTA 1JFLA 4KVGA 3W8RA 3OT4A 1WS6A 4UNQA 1OQAA 3M8KA 4BTEA 3LUGA 2P2YA 4MLPA 1FB5A 2BTQA 3U61B 5GIPE 2IOHA 1K86A 2PMDA 3QVJA 4OSEA 3ZK9A 1W2HA 5DTJA 4Q3AA 1M83A 4QNRA 3CUSA 5DOZA 5CEJA 3TSCA 4X8HA 1JBEA 2G5GX 2NVUA 2YMQA 1Q15A 4NJEA 3SYKA 2JLVA 1A71A 3IXQA 5JFGA 2VPZA 3DEIA 3ND7A 3IV7A 2XB6A 2XIJA 4JLNA 3WKEA 2W2VA 3OQJA 3BK2A 1SKUA 3NVAA 1FUKA 4K9PA 3O4VA 4B80A 2XYRA 4NPHA 4I50F 4ZRNA 1JSCA 3KB8A 1U1EA 3S28A 5CB0A 4O1HA 1L8OA 2BM1A 1T1IA 1RZVA 2PGOA 2ZG6A 4HP8A 4MYRA 4P4GA 3UC5A 3H2GA 4BO0A 2Q28A 3KKMA 3R4VA 4NZYA 3KT6A 2JD0A 5C8ZA 2EDCA 2PBFA 2VJDA 3DQZA 4HBGA 4J9UE 4CPDA 1N36B 4L8LA 3UO8B 1YGYA 3BK1A 4LZNA 4F56A 1M75A 2A58A 4F96A 4F3RA 3KQYA 2AK3A 3H2KA 3ND6A 1NLFA 2QD1A 1BGXT 3PTLA 4BNDA 3UA4A 3URMA 4FGKA 4BMDA 4PLYA 4CL0A 2VSFA 2HDHA 3UHJA 1HYQA 2A57A 3RK1A 1NT2A 5KNDD 4L5AA 1QSGA 4DV3B 3JQ9A 4N3AA 2OA0A 1AA6A 5JPIA 2EZ4A 4BFTA 4C78A 5JYDA 3WIUA 1TA0A 3BB4A 4ZZ0A 4X8MA 1T0HB 1PYGA 2WIDA 5IT0A 3A4MA 2HIAA 2WVGA 2ZB8A 4XM1A 1SWWA 4HQNA 4RCZA 1B0ZA 1XAGA 2PPVA 2OXTA 3W7AA 2VHZA 4XYBA 1U7HA 1E7RA 1ZA1A 2X0FA 4CM6A 1U9JA 3DC2A 5FOVA 4AJ9A 4QZVA 1EQUA 5IYZF 4QC2A 3KUXA 4AWXA 2O3SA 3CZ9A 2F9MA 5GJCA 2E89A 4NESA 1KARA 2BM8A 2W2OA 3PITA 4I6EA 4RSGA 1P9RA 2CWWA 4JC8A 1R88A 2HWKA 3A9RA 5CW1A 2LNDA 3NEJA 3WK4A 1XDSA 2ASVA 1WBBA 2PMWB 2Q99A 1P1KA 1L6IA 3NEYA 1Y4DE 2CLHB 3F6SA 5EKDA 5KB3A 3FN4A 3SC6A 1A7JA 2WJGA 1MB0A 1N2SA 2I33A 4LXGA 1YS7A 4H60A 4A4DA 2Q0HA 1N6KA 3F9CA 1MIOA 3FVRA 4HCJA 4KWHA 2XRFA 4H1TA 1TECE 4BLPA 3FOEC 5KYWB 4P22A 3IBTA 3MJHA 2B25A 1XHLA 4K88A 3RU3A 1RI4A 4G1BA 4MUHA 4O4LA 2PYDA 1SC3A 3GCDA 1N1GA 1BU8A 4OL9A 4DMMA 1S0UA 1SVMA 3PFGA 4ON9A 4ARZA 4YY3B 3GVCA 4PN3A 5K8IA 1TXGA 5AJUA 2IYFA 1YFJA 2I62A 2OC9A 3CF4A 2A1TR 2Q2NA 1NR7A 1Z34A 3KJHA 2VHEA 5A4FS 4DMKA 3SP1A 1P6QA 4R83A 1JN0A 4DQXA 2VEDA 3FMFA 3AY7A 3SS7X 1QTNA 2I6XA 3DT8A 4YYZA 1FP2A 2WJ6A 1IOWA 1GSIA 3L7MA 4TYYA 2WHRA 1UDWA 5G4KA 5C35A 1CYDA 5LU9A 4I4TB 1O6CA 1KVTA 1DC6A 2C9DA 4WZBA 1R5JA 1CQWA 3OQIB 1T6NA 1MCZA 5EGSA 2JLUA 1D7OA 1J5XA 1D2GA 1FNSA 1P2TA 2JGJA 2PLWA 3AP3A 4CM8A 3B12A 2DHDA 1I3CA 2HSDA 5KJEA 3M6MD 4CV2A 3ZVNA 2KHZA 5F33A 4HV4A 1IJFA 3PX7A 3AHIA 4GVPA 1SH7A 3PU6A 3HDTA 3OVMA 3PTZA 3PUWA 4ZEOA 3RIGA 3ICQB 3H1PA 4UTZA 1JMYA 2XVAA 1PJ8A 1L7NA 3AH8A 1A2OA 1OC4A 1U8YA 2DQKA 3B9RA 3HA2A 3VYSB 5EJ4A 4JVNA 1E2JA 4RV4A 2GCOB 5E1OA 3RKSA 3GFFA 5A2GA 5TPWB 4Y2TA 4UM9D 1YRQA 1U2QA 4N18A 2F1HA 3NHAA 3WBKA 2IYXA 1PJLA 2ZTUA 3ZU4A 4AW9A 1R4ZA 3D3WA 3ZIAD 3L6CA 4KLZA 5ENDA 2GM3A 1NRWA 4GPTA 2ZM6B 2CW5A 4O0LA 4WZBB 3ZW9A 2VPQA 4AKTA 1E3EA 2PXCA 2Z8YA 5H81A 3Q6NA 4AJEA 4RHEA 3BCHA 5KDDA 3GCWA 2OSVA 5JJ5A 4UDOA 1AQUA 3EXHC 1AGNA 4HJRA 4KK3A 1QIIA 4TWIA 3UJNA 4UXIA 5KQSA 1SQ6A 3VR4A 3EWIA 4AP5A 2EX1A 1E20A 1UZMA 1MNQA 3Q40A 2WE7A 2H85A 5HIJA 5JYBA 2O57A 4G63A 2HU2A 3OURA 3BTOA 5DP1A 3VKUA 1I33A 5CTJA 3DD5A 3EZ2A 3HN6A 4ZOLB 5K01A 2C4VA 2C2WA 1V16A 2WJPA 3CG0A 1E5XA 1E89A 3OLYA 4GGPA 4IY1A 2HC9A 1N2BA 4EB3A 3O5AA 2DCUA 4GPZA 1FRVA 4UZSA 2HDWA 5CDFE 1GAWA 1Z29A 3T3GA 1OB5A 1YOVB 1UJ2A 2OZVA 1Z37A 3OD1A 3Q98A 2O20A 3C41J 4PR0A 2DWQA 3FTEA 5ICEA 3RHFA 2BFBA 1MV5A 1J21A 3L1UA 5DIFA 4EZIA 4HDCA 4DDMA 3HCEA 2QX4A 5F21A 3D43A 3QBVA 4X24A 1GNSA 1ZWKA 5I47A 4JELA 1YZGA 4ES6A 1RVDA 1U0TA 3K53A 3LYHA 1AKWA 4JP3A 3DEAA 3H8SA 4ZVNA 3ZXIA 4RTLA 5GTDA 3QYJA 4Z3OA 1F8FA 3GMTA 2JLBA 3M70A 4MRAA 3SOPA 1BRMA 3QOXA 2OZLA 3C70A 2X9QA 2HSJA 2OO5C 3E2MA 4AF6A 2VJKA 2W8ZA 1IZ7A 1V4BA 3PC3A 1EUZA 5CYOA 2EZTA 2P6OA 4FOSA 4DIBA 1AUXA 5BYKA 1G1MA 3EC1A 4RGQA 5BRNA 3T0FA 5L7WA 1FK8A 2CMDA 4D8YA 4F1WA 3U4GA 3QW2A 3H1FA 4I3GA 5TGDA 1TM4E 3EOAI 3WG9A 3GVXA 4GQIA 4CODB 1KU0A 1RHRA 3KVNA 1WAMA 1O0SA 2VJMB 2B34A 3KWLA 4I36A 4I8IA 4LSGA 3A1CA 1PKEA 5J5AA 2R8OA 4LMPA 2PVPA 2HSWA 2ECQA 1H1DA 2AFIB 2BKUA 2YWGA 1S4MA 3EVBA 5JNLA 1N77A 2XBMA 3C5HA 1FYEA 4H4DA 1F51E 1QHIA 2IPXA 3DCIA 3WNDA 3PBKA 4GE0A 1RYDA 2P40A 4KUHA 3VX3A 2GNOA 2OO7A 4OYLA 1TM1E 2NX2A 1J24A 4DEYA 1DE0A 3W5IA 2GJ9A 1M5UA 3NFYA 2G17A 3ICCA 1HG0A 3AFNA 4IXMA 4U6SA 1CUWA 4DIKA 1W49A 1IC6A 3FSJX 2X0IA 1Z2DA 2HWWA 5LP6F 1D0IA 4EVSA 1DJMA 1U1IA 1YJ5A 4NENA 4G86A 3D4LA 3R9XA 4MWBA 4QDJA 5SY4A 3TUJC 3U5TA 1B1AA 2H2FA 3FIUA 5DT9A 2RIPA 4RC9A 3S4YA 1SR8A 2BCGY 1NW6A 1CY0A 1NUUA 1QO0D 2OGTA 2YHAA 1XP5A 3AUJB 3GHHA 3KRTA 2ZJ0A 1CB7A 2AFHA 4O4LF 4V39A 4OB6A 3RH0A 1KAMA 4PCUA 5I45A 2XTNA 3DLCA 3FNHA 3I8XA 3K96A 4URHA 2X0RA 2JFPA 1EFTA 1MH9A 1OYVA 2QY9A 4TV8B 2OYCA 1WQ1R 2Z6QA 3PUXA 2C2XA 3KB2A 3FYHA 1G60A 1VCNA 3HUFA 1Z0UA 3IBFA 2C98A 4G0XA 5AI8A 3SBOA 5J3JA 3AVWA 3GRVA 1MTZA 3WMGA 3F4BA 2RHCA 5I7RA 2LDBA 2FW9A 4IXTA 3KPYA 3SSNA 1V25A 4RK5A 4X1KA 4BQOA 2CHUA 2PH3A 3MQ4A 5I7HA 4B3TB 4KN6A 1PJAA 4H7JA 3WQQA 3QBTA 4BV3A 1Q22A 1APBA 1DT5A 3P0RA 1NC1A 1KERA 5IHPA 1AUVA 1CY8A 3GV0A 1BE8A 1BMFD 3JQ8B 2Q3HA 4KQIA 4OHKA 4B4VA 1JXOA 1CJTC 1P9WA 3H9UA 5HCIA 5BSMA 3ZZTA 2CGEA 3VR5D 3ZUPA 1K8YB 1X9HA 4BYMA 3EXIB 3GDGA 1XGKA 3LECA 4NYJR 2AR9A 2G4CA 4UCWA 4A73A 4W9NC 3A10A 2QX9A 1I10A 2G06A 3EGDA 2R48A 3PEFA 4XUCA 4PPYA 3ZIUA 3UIEA 3B36A 1UKZA 3HYRA 4J03A 1DRUA 4D9FA 4NOLA 3JQQA 2VZEA 2BD0A 3TMYA 1DOAA 2PZKA 3KTDA 4I5FA 1J6UA 1NBMA 3E22A 4OYRA 5FTJA 4RHTA 4AMBA 5C8YF 4R2IA 3PJEA 2JGEA 1QHHB 3M4JA 1CE8A 3K9QO 1QXSA 4D46A 1YB5A 4MW0A 5KU7A 2BKAA 1J00A 3M6LA 1AS0A 3GA5A 3GBSA 3WLFA 1WZNA 3IEXA 3ZTTA 4NONA 1HT2E 1R12A 3P32A 1S8AA 4MYCA 4XFJA 5HJ2A 4E08A 2O8EB 1L8AA 3WVNA 1TEHA 2HH9A 3C4VA 3HXTA 4YAEA 5F1PA 2XXAA 5A0VA 3SFTA 3HLYA 4YRBA 2YYZA 4IXWA 4QTUB 2HFKA 3G2HA 1X1DA 4KJXA 4G8JA 4PAWA 2ZUTA 1Q3HA 3ML1A 3RSGA 4P3YA 4K46A 2OBMA 5AUOB 1KQPA 1MZPA 3ASZA 1KVSA 1EX1A 1Z5UA 2BFFB 3R7LA 4C2AA 2VF5X 2I4TA 4AZ0B 2BFCB 3O82A 3RTGA 3AYXB 1Y37A 4TGLA 1E61A 2WF9A 4DM7A 3RAFC 2QLNA 3DBVO 1XAIA 1SPBS 2ZT6A 3AY6A 3KHKA 1AB6A 1CSEE 3MCZA 4H17A 5LBIA 3SZMA 2ZRQA 4MK4A 3U9LA 1DEAA 4KV9A 4BBPA 3O91A 3SX0A 2Y66A 4TVSA 4A8JA 2OORC 3QWAA 4G9GA 1ZMXA 2VDWB 4PYKA 3VZSA 2Q7OE 4EJFA 2D5IA 5JD6A 4HEJA 3IVMA 3C6KA 4PGFA 1SK9A 4FE7A 4BNKA 1X14A 1JA9A 3GJSA 4U7GA 3MJFA 2XZOA 3EEYA 3LY7A 1JUDA 3QK7A 3GMIA 2OD2A 3AI1A 1MKYA 1ZIPA 2A4KA 3A4TA 2V96A 2PL9A 2C9CA 2YC4C 1C4KA 2EKLA 3JS5A 3LKZA 1LBTA 2WSSA 1WXWA 4FKMA 5ALNA 5TPZA 4CUJA 1JJVA 4F45A 5K5EA 4KQGA 2XE8A 1WB9A 1ZGGA 5CCDA 1UC4B 3H1EA 5FPPA 5LOVA 4ZT2A 1CRZA 1VMAA 1VSVA 2FMHA 3KTOA 4I3HA 1GM5A 1ISIA 2QYSA 1E69A 4IVPA 5JJLA 1U8UA 1O5TA 3NYQA 4C3ZA 1RYZA 4IIBA 3WL5A 2V9ZA 4OBBA 4Q3CA 1VE9A 3ROXA 3NT2A 4BO3A 2GUGA 2P3OA 4MAMA 3QEBZ 1YZYA 3MUEA 2GUWA 1TQ6A 4R7TA 1CR1A 1EBUA 2GAFA 5IUJC 3ZDYB 1YJXA 4C7JA 4D82A 1DAHA 1KDOA 3HKEA 1UBUS 1II0A 4XCVA 2FN3A 5EL0A 2ZWOA 4EEKA 3A6ZA 1EE9A 4B8ZA 1TAHA 1Y9JA 4DABA 1D03A 4U5XA 4RVCA 2IBSA 4EY3A 2AC7A 2XMBA 3PX2A 5FLKA 3ZHVA 5DM1A 1QOZA 1UKEA 2OOSA 2ZBRA 4FT2A 3WK6A 4K6MA 3P9SA 1C7FA 4IDFA 4L3WA 1DU4A 3CJTA 2C04A 1WKCA 1UWVA 1U0GA 2J85A 4UJ3A 3SKVA 1E60A 1IM8A 1AF7A 3H8WA 3HACA 4LISA 4C5BA 1YZVA 1WUTA 4EVQA 1Z4KA 4Y0NA 5EXDA 3EXHA 1S8FA 2AV6A 1RXEA 3ZVRA 1IHPA 5E4TA 3H2SA 1AXEA 1E5DA 1L7EA 1JYFA 1RPZA 3BWBA 2B8TA 3EQ9A 5HM6A 4TTJA 4IFTA 5DV9A 1ODTC 3EVDA 1T0JB 421PA 4BIMA 3G88A 3A26A 2I34A 2QW1A 3G5AA 4E09A 3AL0C 5FQOA 4RIEA 2UXDB 1NBWB 5E2IA 1PX2A 2VKQA 2QMOA 1TT5A 2P6NA 1SEPA 1IM2A 1RE0A 1YA8A 4INOA 2VP4A 1XRLA 4R69A 1OHHD 3ZU3A 1U90A 5LXTA 2XUAA 3DFKA 1R6UA 2X8BA 1OA1A 5JFOA 1Z7YA 1F8XA 3NIDB 1DARA 6REQA 5ECWA 2OV8A 3I1JA 1E1KA 4KLNA 2VTBA 1HLFA 4LNUA 1UH5A 2OAP1 1ISMA 2RKBA 2ZRNA 3B7GA 3AM5A 2H1HA 4N0QA 4NBUA 4PONA 3ENZA 4FU0A 5IBQA 4E7PA 5I5GA 4HWOA 2GKSA 3ZVLA 1E1CA 1WZ2A 3HKCB 3A2NA 2JFZA 2CK3A 2X1VA 1VKRA 2OAQ1 3KBBA 1PVVA 3KJIA 3MHPA 1PQ4A 4HHEA 1NDQA 1FS6A 2P9FA 1Q83A 2B61A 4MWSA 4YI5A 4M8KA 3L0SA 2Q41A 4L07A 1EDEA 1VL8A 3JTEA 3E4CA 3AJ9A 3DMYA 4D79A 4ZOEA 4JFRA 4X3OA 1PL0A 2O2GA 2XOEA 3HPQA 1CT9A 1M9NA 2IXFA 3BCUA 4QYXA 2LCIA 1YZ3A 1DQYA 2JI7A 4CKCA 4EY7A 2O7SA 3F49S 5TF4A 4U2EA 3ZS8A 2GSWA 2WJYA 1WW8A 3NBKA 3SC2B 4K87A 3H5TA 4YJKA 1JAHA 3T4XA 1YASA 2EL9A 5D5QA 1SKYE 4ZAGA 4DHEA 4YMUA 1RAGA 3O8OB 1W73A 3QWFA 1U9IA 4IOLA 5D3ZA 2NUAB 3FPAA 1PZGA 2DHCA 1XD9A 2G67A 1W1IA 4M53A 4DNFA 1KPHA 1ZNWA 4HQKA 3T5PA 3BXFA 2IITA 2HBRA 1AOXA 3S2FA 2PT6A 3SF0A 3HB0A 2CEAA 3EPJA 1P9LA 1CBUA 3SAJA 5JXWA 5MN5A 4REQB 2VNAA 4PAOA 4I9NA 5CW2A 2C99A 1CG6A 2C07A 4A8HA 1JZQA 1R8JA 3E4DA 4HMQA 4WFQA 2NW6A 2ORED 3NVMB 4Q7EA 4KNYA 2FOXA 5C80A 5BORA 1Z8DA 2PZJA 2GN8A 3B89A 3AEQB 1O4WA 3AVQA 3EGDB 2W4IA 3FCOA 3LGAA 3LT2A 3NASA 1UMDA 2WR8A 4JMLA 4JOSA 4MKFA 2OO5A 4B48A 4CG3A 4FLFA 1T9GS 4FINA 5D3QA 2EERA 3H5IA 3G0CA 1Z5OA 1RI5A 4NCKA 3X1KA 3CG4A 2REQA 4H3HB 4UHCA 5CLLA 4A2WA 3ZDZB 2OHVA 4RPCA 1QWOA 5JMTA 2FEPA 1JPUA 3TRKA 1Z16A 3DP7A 5J43A 1C4XA 2AG6A 3RIMA 4KH0A 3WHIA 3LRPA 5KOJA 4Y7CA 3L40A 3BMOB 3V8MA 2IIPA 2PAFA 2VRCD 2QPLA 2PV0A 1BU5A 2NADA 1G66A 3QWHA 3G7SA 5CJPA 1ZS9A 2I2BA 2YUTA 4Y2SA 2IKQA 1W0KD 3LA8A 4I0WB 3BTSA 1MNAA 3VZDA 1AE1A 5AW8A 2WZDA 1T2EA 4GI3A 1V7ZA 4D3ZA 1SY7A 5AW1A 1YVUA 1O96B 4N82A 1DO8A 1T26A 2GYWA 4DGSA 4OHYA 5C4MA 3BZUA 3N2GB 1WV1A 4FSXA 5KYYB 3NM4A 4WLVA 2WPDD 4NG4A 1EP1B 5ENZA 2IU4A 1EVKA 2H48A 4JJKA 4WW0A 4KFUA 1Z15A 4OXXA 3UB2A 2B1RA 1BH6A 1RXUA 4MQEA 1P0FA 1VLMA 4H27A 2H4XA 1KYYA 3NC0C 2Z43A 5GONA 5HIIA 2Z04A 4FS8A 2RAPA 1E0DA 2FA9A 3JWEA 2CNDA 4NCNA 2XBLA 2TMKA 3U16A 4EY8A 1Y48E 4UARA 4JVLA 1ZM2A 2A0WA 3ZDDA 4N49A 2QMZA 3W3AA 4NL4H 2YQ4A 1RRCA 1N3BA 4LJAA 3CHYA 4HN2A 1GFZA 1GQ2A 2H06A 4FN5A 4LGCA 4ZA2A 3VHXA 1LH0A 3W5SA 2Q29A 3TZBA 4HWSA 1NM5C 13PKA 2HPVA 1LSUA 3HV0A 5DYYA 1DS6A 1G20A 3HBMA 4PPNA 2D00A 1J2TA 2EZ8A 5FPYA 4MR8A 3SR0A 5KVAA 1UOQA 1KGSA 4HLQB 5JQGB 2ZJ2A 3NAQA 3CR8A 2O07A 3EN0A 4B4KA 3EMBA 3PGA1 4B43A 4A6EA 3RM3A 2GJSA 4RO0A 1JEQA 3CONA 2JRCA 3WSWA 2E49A 3OZ7A 1XVTA 4BKRA 8MHTA 1LZKA 1NHGA 2W11A 5T7BA 3HXQA 3ENWA 2NT4A 1B43A 1M8FA 1YQ9A 2YWBA 4HI0E 4S0ZA 2H4JA 1DKOA 4BFVA 2A33A 4UXJA 2IEGA 3OTOB 1N7GA 3HA3A 3IIJA 2IQ5A 3MCUA 1FRZA 4R8RA 1PNVA 2LDXA 3KZ1E 2I7DA 1BX0A 3ELUA 4IHJA 4KYUA 5GV8A 1RPJA 3SMQA 3VX4A 4BC0A 1S2DA 4LZWA 1W46A 4B2YA 4YDHB 2Q5HA 1G20E 3GJ7A 4MUXA 1DLJA 4KQ2A 8OHMA 2ODWA 4J75A 4MUJA 5FOUA 2XMRA 4CIBA 3X1JA 3G2PA 2G77B 4JUBA 2IHJA 2ZT7A 3O74A 3QJGA 1BTOA 5FWAA 4PHTA 3WY9A 5L3QA 4ZAZA 5JS8A 4OV6B 3IOYA 2E4ZA 1NMYA 3C3EA 2GKGA 4RVOA 1S4QA 3PJGA 1BMQA 3BMNB 2XUIA 3GPBA 1IY2A 1N75A 3RTBA 3R3JA 4A8JC 1G9SA 2Z6UA 3SSOA 1CCWA 5IMBA 2HMSA 3LFTA 3PJDA 4C0AC 4DCJA 2G72A 5ALKA 1ULUA 1JIXA 4Z4IA 3WIDA 1E2BA 1H5UA 3TCNA 3FCUB 1UEJA 5JDIC 3L7NA 4OSPA 1TADA 1XQ1A 2PFKA 5L6MB 4KXNA 1LTQA 1MC1A 3CLUC 3DAYA 1RHMA 1HQDA 2ID8A 4R54A 4JIMA 4C1NA 1E3WA 3WADA 2XTJA 3JAKA 1HK7A 3G1UA 4LOKA 3AKCA 5BN3A 1MIHA 2V59A 3KJGA 4UNIA 1OOEA 1CEYA 4KQJA 2FW8A 4MHTA 5I7FA 1SOMA 5JT1A 2EG9A 4CQNA 5E6SA 4DPKA 2ENWA 3R6TA 3EQ6A 4UREA 1Q7EA 1VPLA 3GUVA 3SVLA 4EPRA 3UMYA 3HRHA 4C7OA 1ES9A 2XLBA 4H7PA 3PYMA 4AM8A 3HI6A 5BYJA 1HRDA 3K2BA 3UEOA 4EK9A 1GQYA 5KO2A 1B00A 4DDKA 1SPXA 3V3KA 1AKNA 3BFXA 3W2IA 2OESA 3UOWA 1XNQB 1KFEB 3GLTA 1LC3A 1KRHA 2PS0A 3MVEA 4HC4A 3ROPA 4AJ2A 1G5PA 1KEPA 3FNFA 3Q15C 2WIBA 4O4IF 1DUSA 2YV1A 1CJBA 5FO1A 2BFEB 4FI3C 3ZHOA 5JS6A 3W8EA 1E0SA 5B7GA 3K2QA 2R7LA 3OQIA 2ZB3A 1TKCA 1E5LA 3GGCA 1C4WA 1WD7A 3N28A 3EGWA 4RGYA 4YMGA 3X2SA 3FPJA 2WQZA 3HP1A 4IJKA 2KBEA 4RFVA 2E5FA 2VOEA 3NBMA 4N7BA 4B47A 2PXXA 2E0IA 1IXYA 1PD0A 3ILSA 4BWYA 4JI8B 2AN1A 1EI9A 3ZD6A 1D6MA 4IM7A 4TTSA 4J0IA 1XNRB 2Y0PA 2ZJ7A 3W2GA 5ECYA 5IASA 1JKJA 1ZD3A 2WK1A 3I2KA 4G67A 4NMWA 1DCFA 3EZ7A 1ABFA 3N75A 1OFTA 2PGXA 4EMTA 4ZQBA 2OTCA 3LCUA 4PAQA 2WVJA 4PC3A 3JWIA 1WMFA 1NVTA 3I9MA 2CKMA 2D2EA 3KR1A 4RK6A 1QVZA 5TQ0B 1OFGA 4C88A 2YMPA 2FOIA 3K0CC 4OGFA 3AW9A 2FAXA 2NIPA 3C5EA 1QE3A 4BX0A 3ZDXB 4G56A 1WDMA 5H83A 5LB2A 5T3YA 2AOVA 4FFLA 4NULA 4PXAA 4YA6A 4D4IA 1YVRA 1XNGA 5ALPA 3ONNA 3CINA 5HF9A 5IP5A 3E7XA 2HWYA 4KO1S 3UGKA 2M9MA 3E81A 3MELA 4A91A 5TSDA 5EZSA 1ZJYA 3KXDA 4YCLA 1XZIA 4ZCLA 3RVNA 5BYAA 2A0XA 4WLFA 3R6WA 4X64B 2FQXA 3A6DA 3E9EA 3FFBA 4EABA 2VRNA 2XF2A 3DEFA 1KMHA 5FP0A 5JHHB 3L7YA 2ZYDA 3RR2A 4H7FA 1Y8RA 5JSZB 4TLBA 5DI3B 4LJ5A 1T9BA 3AEKB 4WZAA 1UPTA 1N6HA 4TLCA 3QNMA 3GB9A 4IW3B 1BJTA 2B37A 2FEAA 2Q2QA 2Q6OA 3H9GA 3PHJA 1Q21A 4EG1A 5ABPA 4HDRB 3FCCA 5IS2A 3G79A 2QL7A 4ZJUA 3GLSA 4M1TA 2QTTA 3CZMA 3SEQA 1NP3A 3DDHA 5F77A 5A03A 1I94B 2MIIA 3DOUA 3GP5A 4RD1A 3DPSA 2WHPB 1ISHA 1RBZA 3U31A 4D56A 3PWTA 3STWA 4JOQA 1XZGA 3M1AA 3NDPA 2KM1A 1N9GA 3G82C 1EUCA 1F8GA 1G21A 1WJGA 2DU8A 3LWBA 2O3QA 2WJZB 2J07A 2F1OA 3NDJA 2JFFA 3CV3A 4OKSA 1JGTA 4R9RA 4YIHA 1NVVR 2A7XA 2GPBA 4HR7A 4BE4A 1OPXA 5KYGA 1E4OA 3OF2A 5D00A 5FI0B 1JHAA 1W9HA 1O1YA 1V1MB 1DX9A 3WMWA 4DV1B 1P4HA 4MVWA 1Y6JA 1YWGO 2PIAA 2YQ5A 3OQHA 3LXMA 1N33B 1USWA 2D1YA 4OHVA 4MDYA 1Y1KE 5GAJA 2XV1A 1LPBB 3F6YA 1RBYA 4HGQA 4IQ0A 5K8CA 2GEUA 2HCTA 3AETB 1NLMA 2DVMA 4IHJF 3IODA 2QAGC 4GKKB 1HKUA 1JQBA 4FYYA 1Z33A 2JKYA 4P7FA 3IEKA 5IFLA 3UMJA 1GZ6A 4WXHA 7GPBA 3DT9A 3KAKA 1U28A 1OH5A 2C0QA 3NORA 4G8DA 3KXIA 4GMHA 4DLSA 3RQIA 4G5XA 2ZSIA 4IIGA 5FJJA 5KTKA 2JJYA 4ZHQF 1KETA 2WTXA 3CRW1 3F3SA 3N0VA 4QFMA 4FMDF 4HDKA 2I4LA 3WMEA 3NBXX 4P2BA 4TN5A 4BY9E 3TCXB 2IOFA 3ZUGA 1OSNA 1NASA 4D8WA 4Y9TA 4UAVA 1CJCA 1VPTA 2W37A 2ZIXA 4OF4A 2J4CA 2IYNA 4GYKA 4ED9A 3GCGA 2BEKA 3G23A 2YRFA 1KHTA 4DCVA 1CJVC 4CN9A 5K3CA 2EWVA 2GAOA 2BPOA 3VDQA 3D7KA 1HE8B 3PVSA 4WNAB 5JARA 3GPCA 4P80A 4UNPA 4JP8A 1N1EA 4W4TA 3IAS6 5J2TF 4JWKA 1Z73A 4I5DA 2OPBA 1EESA 4OOFA 4OHOA 2CXPA 4JUFA 1ETHA 2E4WA 3EGVA 5KYYA 1L0BA 2IYYA 3EXHB 1JT2A 4C0XA 1FSPA 4AXXA 4UM9B 2WJIA 2P67A 1XO1A 1XZFA 2WFZA 3AR3A 4B7CA 6ADHA 2ZWAA 1B6GA 3F96A 1U94A 4W5WA 1YR8A 3UVEA 1J07A 1TD9A 4MW7A 3VGJA 1A8IA 4WOPA 1T4CB 1UDAA 2MYPA 3AILA 4DA4A 2YWEA 3LUKA 3LK7A 2PKRA 4DQDA 2QW0X 1Z4QA 5D51S 4CV0A 4O25A 1JWBB 3MTQA 2VNIA 2BMEA 4LXYA 4AG5A 4TMFA 3LP8A 4CMKA 3MERA 1WUKS 2QKYA 3WJ1A 2WF7A 1EIZA 2JL1A 3L1JA 2DY1A 1U9CA 1I80A 1RHUA 3IP6A 3OU2A 2AFVA 1I3NA 2H0AA 1H8HD 4U5QA 3I9V1 1GLNA 4XCQA 2IUFA 3A0UA 1A95A 2C82A 5IX8A 1W6RA 1YT5A 2HRBA 3JATA 5BV7A 1X2EA 1ZEMA 4YAWA 3I2YX 5C8XA 1BQ3A 1UQUA 1XDDA 2ZIEA 3A9VA 4RXUA 3EAGA 4OHWA 1GNRA 1Z12A 2PU5A 1VCOA 4EX7A 1SULA 5DTIA 4BJ6A 2WW8A 3T35A 3U7RA 3VZPA 4D0RA 1MC8A 3OZDA 1OTYA 1YTUA 1QTIA 5REQB 3UK7A 2QRLA 2HNAA 5KX5A 3J7AC 5FBVB 2AJTA 1SKAA 1H1LA 3DNMA 1SBIA 1EYZA 5HRCA 1J0CA 3LUCA 4ZAXA 3VH3A 4FFPA 5BOSB 3O4IA 2AG5A 1UZNA 4DDWA 2XMGA 2X23A 2R65A 1I36A 1ZUIA 2W0MA 4BX9A 2L19A 1COWA 1X9IA 5DBGA 4EY4A 3VSAA 1U7DA 2WUFA 3AK4A 1OMOA 1XVAA 4FGUA 3WK9A 1NI4B 2ZJ4A 2P69A 1IK6A 3H05A 1OZ0A 4BB9A 1OA0A 1ONSA 4YUAA 4PLCA 4C08A 1GPJA 2Z30A 1FSSA 5C3UA 1DIOB 1AUQA 5E8JA 3O31A 4I1OA 3ZPXA 4F2HA 4RTPA 1PW5A 3ER9A 4KREA 7MDHA 1JRLA 5M5BA 1R18A 4MQBA 4WFIA 3V2GA 4EI8A 1XAHA 4BNTA 3DLAA 1E58A 5HILA 3PUIA 3QKTA 1E6UA 3NIFB 1BHSA 1FFXA 3MD9A 5L3SA 4MQFB 2ZUBA 4G5OA 1UJBA 1EP9A 1GUYA 4XUEA 1RR6A 4QWMA 1ONNA 1P5HA 4YLGA 1X80B 4PIVA 3ED1A 3EPLA 4KR7A 1EM8A 3PQ8A 4ZTBA 4MIOA 3HNPA 4ZVKA 1LB1B 1Z82A 4ALMA 2F1RA 3UUWA 4Z8YA 1Y33E 4IGAA 5J23A 3O2NA 3PNYA 3BIOA 1AKTA 4JGGA 2BBTA 1Q50A 1T36A 1NATA 2WJAA 2VJYA 3GRFA 1QB8A 3F8TA 4J2OA 1GO2A 4W5TA 4C6HA 3HSSA 3SVTA 1VJRA 4IRXA 1CQIB 1YONA 4MUBA 3X43A 4LA4A 5IJ9B 1M1YB 5H9VA 4HDNB 1GCOA 3HA5A 5LIRA 3L8ZA 1Y4ZA 2EXXA 2OP0A 4MQ4A 4GS5A 5CHYA 3VAAA 1GGJA 2IY7A 3BZWA 1WY7A 5CK5A 3L4KA 3QUQA 4XOUA 4BWVA 4EA9A 5I4BA 2FN7A 3DSRA 4BXOA 3EDMA 1G6OA 2XITA 3WYAA 5JDIA 1HTBA 3U44B 1PG2A 3M5PA 3E18A 2FUNB 3EFOB 5TRTA 1JEDA 1QRAA 3P2JA 4E32A 4GO1A 1KR5A 1QZUA 3UJ3X 4DILA 3OMXA 4FFBB 1ZYUA 3IGFA 4S05A 1BDHA 1Y8CA 2OGWA 3TGPA 4MQEB 4KQEA 4HNUA 4ZWNA 1M7GA 4TUYF 3HJUA 4F12A 4O1IA 5E6RB 4EO9A 2JIBA 3REQA 1XQXA 4Q19A 5B7PA 4M4SA 2HJVA 3ZKWA 4MS4A 1C1XA 2XX3A 3ZU6A 4G0UA 3E8MA 1ZI6A 4LC0A 2MTBA 3KK0A 3CCBA 4EI9A 4FCTA 4MKIA 5KNBA 3OT1B 4DM3A 1IN4A 3GLUA 4KO8A 3R5JA 4G23A 4QXQA 2O2CA 1T9KA 3QFFA 1QNFA 4OXNA 4D5EA 1J5PA 4FR0A 1Z4LA 1ACMA 4KPUB 5FOTA 5IYZB 2OHJA 4PZ0A 3PKJA 1OROA 2XY4A 2ZLBA 5KWIA 2F1IA 1A72A 1A5AB 4W9RA 2WQ6A 4EW3A 1ZGCA 2LUOA 4I2NA 4OK6A 1EHIA 5H59A 2C2KA 1J0DA 1IB0A 2Q5FA 1KOJA 2YHUA 1GADO 2JCXA 2YZ2A 4MVJE 1P3Y1 2P5SA 3IP3A 3N1UA 1P6XA 2GPNA 4UVEA 5AJVB 1KQNA 3FXAA 4L6CA 4ZZ2A 2BGWA 1MEEA 1UMCA 3JD1A 4XIGS 1HV8A 4FILA 5ALRA 2VPYA 1AT1A 3K0KA 5UKDA 1JMKC 5HIKA 3HJFA 2CVOA 5JJIA 5GGYA 2UVDA 5JG7A 2BEVA 4HDKB 1NDUA 2HBQA 2FDRA 1N0WA 1PYDA 1T9ZA 3E0XA 1C8LA 3INNA 4KRXA 3GAAA 4O08A 3U37A 2HREA 2QVXX 4R1LA 4R01A 2QAIA 3HLKA 4FIDA 1AH2A 1RQXA 4Q03A 2J3IA 3E05A 5IABA 1WF3A 1YR6A 1WG8A 2BE7A 2G9UA 4V0LA 4DZRA 1GV0A 2VQ6A 3HVKA 2CUTA 1FLAA 4PBRA 3TO5A 3PUYA 2FPIB 4YRZA 1CK4A 1LPSA 2H57A 3HG7A 4XDZA 1TJ3A 5AVJA 1NMSA 4HNGA 3K0FA 3EUAA 2RG1A 5I9NA 1L5VA 2XA9A 2JGDB 1ESMA 4K6KA 1TUBB 4BX3A 1CB0A 3WRYC 1E4VA 2VPIA 2FWMX 2YBEA 3AU9A 2PUCA 3I6QA 4J7UA 4K9RA 2ODEA 5JAPA 5INTA 2OQIA 4YQYA 1P2BA 4ZOLA 4RLSA 1JSZA 3MK31 3PV0A 4LDPA 2CXXA 5JBQA 5E38A 4XEUA 1XL0A 4XQGA 4TTRA 2ZSFA 2JCVA 5C34B 3AF0A 3DMDA 4Z7OB 3GMDA 1SHKA 4TMVA 3A4VA 1DTWB 2D2XA 3G0OA 5I51A 3HYLA 5DNEA 3S8EA 4MEJA 4LJ7A 4UHKA 3R0VA 2VHUA 1J20A 2P5TB 3KKPA 2RGNA 1QP4A 3RC2A 2RK3A 3LU1A 1QIMA 3AGQA 5D5HA 1UM8A 1Z2AA 2BUCA 1H94A 2C42A 1UPFA 3PNOA 4B71A 4KPYA 1DBPA 1S6YA 3FVWA 3M5DA 3TWOA 3R20A 4CG2A 4DY4A 1ZHOA 3D0OA 4M1SA 4RPKA 2MSNA 4UCXA 1ZFNA 3NM6B 3P0EA 2DP4E 4YJGB 1ZXLA 5TJHA 2GN6A 4D97A 3LHFA 2O5EA 4YBRA 5KBYA 4IVRA 5EINA 4FW9A 4ZAWA 1NR5A 1Z4MA 3VNQA 4ZGBA 3WLKX 2HEIA 3O92A 4BVLA 3P9CA 2TMGA 2Q62A 4WNAA 1NY6A 1SA0B 1M5RA 2PZMA 1ZMTA 5DRYA 3QVVA 4Y6LA 2A5DA 4CV1A 2XWSA 2YJNA 3KG2A 4FHZA 4FMPA 4GE3A 3DMNA 2O8DB 3FOCA 2OHIA 3P9ZA 2J0UB 2A67A 3I58A 3AM1A 3EUEA 3ZV7A 3WLIA 3O2JA 2E5WA 1C7RA 4MHOA 5I4CA 4JLMA 1BN6A 2X5KO 3D6JA 1VKHA 3D3NA 2OBXA 2VPPA 3LRXA 4ZQGA 1G4HA 3PFIA 4V1CA 3DBHA 3GDFA 2PJZA 3GEPA 4M0PA 1MGOA 3K16A 2F3TA 2Q9BA 4B1FA 1WCWA 4I3FA 3IPCA 1ULBA 1Y9EA 2BR5A 2AN5A 4I1PA 2EZ9A 4P0PB 2IEBA 1VKZA 2BGKA 1RWOA 3CEAA 3OFJA 2NXJA 1PJ4A 1V6SA 2B5OA 2R1VA 4RVFA 2C7PA 2O2HA 2AWOA 4R9UC 3QPAA 4UBJA 2ZATA 1L4EA 1NNLA 4QBKA 5DXFA 3CVYA 1U2PA 3THOA 1DBIA 3L6OO 2FP4A 4IIHA 1JQ5A 4L08A 4RK0A 5I3CA 4DJEC 4QGSA 2G0NA 3KELA 4O8CA 2AI1A 2Z5GA 4RW0A 1FYWA 4E5UA 4DANA 1VGRA 3H1BA 5IDXA 5KNLA 4TTAA 3HPRA 1WKVA 2W6JA 3PR1A 2N46A 2WG0A 3CF0A 3TRJA 5E2AA 3G9TA 5KTTA 3O4JA 3OZFA 4EAAA 2E1PA 5DTEA 2YWHA 4WZAB 1OI7A 3PPYA 2VWQA 3OQ6A 4A26A 4C4RA 3IPYA 3DEKA 2J3JA 3FFXA 2ZE8A 4FBLA 1O3YA 1V9LA 3JQEA 4BCBA 1KIAA 4DR5B 1JA0A 3D3KA 1M8JA 4MTLA 5PGMA 5I3ZA 2Y1KA 1LBQA 4MJLA 2GKOA 2WD7A 4J2TA 2WU1A 4M8IA 4KNWA 1JA1A 1T1JA 2JHCA 2P2LA 1NQ5A 3GRKA 3ZHUA 4DBVO 4ZPXA 4GNRA 3ZCVA 2OEPA 4MUIA 5DOVA 5GZ6A 3ZXUB 2H07A 3ZWVA 1TQ4A 2Z2JA 2VAXA 3OH8A 1A2QA 1CUIA 3ZHSA 4HDNA 1WR8A 2QUHA 4QEZA 1FC0A 3AHEA 4RJ2A 3HBAA 4QTXA 4MW5A 4Y30A 1KC3A 1YZKA 3A05A 4DRZA 4RF5A 1SKYB 1KU6A 1VSQA 1C2YA 1JIUA 1LK5A 4ZRDA 3I04M 5AKJA 1AK1A 3KT8A 4JBGA 4ZARA 5KQMA 2QVLA 5HF5A 1K7EB 2ABWA 4L74A 5CT8A 5ECDA 3RFCA 1ZIDA 4YAUA 3DR3A 4FFDA 4MVJH 4YCDA 4BRUA 4AUEA 1E3DA 2HW8A 3IHWA 1JHXA 4IIXA 2XSZD 4IUBS 1GKIA 3S1AA 4E2YA 3LPLA 1JLLB 2C7BA 1J9ZA 1FRQA 1D2AA 2B1JA 1CUAA 3OCZA 4EUHA 4Y6SA 5J4VA 2BTQB 5C4GB 5CD1A 3E27A 2YV3A 1CEXA 4HLUC 4Y6GB 4TN1A 4BVHA 3RYHA 4WBNA 3C7TA 3Q5GA 2O8VA 3C3XA 3FPLA 1TA4A 4CLXA 1NJGA 1TAGA 3Q7SA 3FCEA 4G01B 2FKNA 2PO7A 4FOLA 1VYVA 1WEKA 1Z5WA 2ZANA 2Q0SA 1BVRA 1HDYA 1YKGA 3L02A 3GP8A 3TIGA 1YMVA 3V8BA 1GSAA 1Z63A 3UKDA 1ESNA 1S2LA 4L75A 2IPLA 5FV7A 4GZ6A 2JGMA 4B3SB 4W8GA 3H4IA 2IH4A 4ENRA 3JYOA 1Y80A 3AIOA 4A2PA 4PYJA 1C7IA 2AMJA 4GMFA 5A9RA 1NXSA 1SAYA 1BHJA 2F7SA 4JT9A 3T3HA 4AMUA 3JQAD 2R6CA 4EKYA 3C8DA 1MC4A 5IAJA 3MQFA 4I1VA 4B6RA 4US0R 2BFNA 4F3TA 2BLLA 3KEQA 4ARIA 1U7ZA 3LVFO 4R41A 2J0SA 4CT0A 3NW9A 1FP6A 4V0NA 3NPAA 2ZT5A 5AW9A 2VDKB 1SU7A 3GD5A 3QU7A 4P08A 4Q15A 5E0KB 1B2LA 1NONA 4DV5B 1LDMA 3CLVA 3RSCA 4XTCS 4REMA 2DLNA 4C89A 4Z54A 1VG1A 3RROA 3PE3A 1JFVA 3LBHA 4WLOA 3GMSA 1UKAA 4O02B 4MA5A 4G5HA 1XN4A 1G64A 4DV7B 3P2IA 4AS2A 5LD2B 3AJRA 5C5EA 1Y9ZA 1KKUA 1NXTA 2AHRA 4KU4A 5FHQA 4NK4A 1FTWA 1AIPA 1X1RA 2ZVJA 4P4TA 2HD4A 5AOBA 3UNXA 3G59A 2QD4A 1YCHA 5FBKA 1ZVKA 2DQZA 3ZDQA 5B53A 3ICEA 2WP8J 3PPIA 1NOKA 1JR3E 3PFFA 4B87A 1T3TA 2NU8B 1TTTA 3VNBA 1O95A 1IRIA 2ACWA 4PBSA 4EUEA 3OOJA 4OB8A 2XYQA 3JASA 5JD4A 2K2WA 3E9DA 3EOBI 2ZETA 2F4NA 3PQ5A 1Q14A 4HEA6 4I19A 3GA0A 1G3UA 1XCLA 5LZ2A 1WSWA 4D9MA 1Q6YA 2I3GA 2HL6A 1P0CA 2AQ8A 2VJMA 4Z9BA 4D1YA 1VC2A 4GPD1 5J4YA 2C9BA 3TXAA 1UL1X 4LGVA 4UOZA 1FTSA 4BLOA 3V4RA 4Q1AA 5BR7A 3SLGA 3B52X 1Z06A 2M32A 4MB6A 1GVHA 1Z6ZA 4G0OA 4HO1X 3DDZX 4RFLA 3MSXA 3EVNA 1FFCA 3ZG6A 4F04A 4HUTA 3UJCA 1ABBA 3BF7A 4NCIA 1XB2A 1KS2A 2PZGA 2X3UA 3KOYA 4COOA 1CF2O 4V03A 1M6NA 2Q21A 1NVMB 5HBGA 1PHPA 3S40A 3TSAA 3VR2A 2VJLA 2GZ3A 3KP1A 5DW3A 5D85A 1W0JD 2NOAA 4ZT4A 1H8ED 2ZIGA 5LMNB 1GGHA 4FCWA 4NNOA 3ABZA 1H6BA 1UBHS 1IE3A 1QGZA 3MBKA 4LI0A 1G3QA 1TOAA 5IF3A 2QD5A 2MINA 4D57A 2X7HA 1JI3A 2QJRA 1XBTA 3L0PA 4IPTA 1CQZA 4PX9A 3D8RA 3HA7A 3CH5A 4IH1A 4K40A 2P9HA 2AOUA 2W2TA 2CWDA 2XJ9A 3MIIA 3ZKAA 4JZKA 3RUHA 2X8WA 2MT9A 2OGZA 2VP3A 3UJ8A 1II8B 4A3SA 2BAGA 3FMOB 1BFKA 1KMQA 1KOLA 5JAUA 3RG2A 3UHAA 3N2EA 2ZE7A 4EF6A 2JIOA 4AF8A 3N3AC 2XI4A 3PXDA 1ZINA 1NQTA 4G4SP 3DDUA 4LXIA 5FUYA 4Q7QA 4URFA 3KWMA 3UWDA 5M3BA 2O52A 1SOWA 3Q3IA 5JJKA 2XE6A 1O2DA 2PA3A 2PSEA 4GRDA 5EFOA 4D41A 5CAEA 3L4JA 4EEZA 3S5JA 1JQJC 1A9OA 1XRMA 2BDUA 3ANYB 5AWFC 2ZUFA 1AF4A 1ZW6A 1P4JA 3EIUA 4LPKA 4TTTS 2J0VA 4JVOA 3QUSA 3WMFA 3NNDA 2G1PA 1XV5A 3NIWA 2NV2B 1EFVA 2AOUB 3KAPA 1U98A 4CQLB 2VK4A 3G8AA 4W7HA 3GIWA 4H1WA 2F62A 2G9ZA 3A6LA 4L3OA 4MYSA 4LNUB 4MZDA 1IQ0A 1KGDA 3I39X 3X1MA 1TD1A 3FUWA 4AU1A 3FSGA 4W99A 2XNDA 1KZ6A 4LWZA 5EZ6B 4E5SA 4Z1MA 4EHBA 1XZBA 2ZXEA 4EJMA 1OUMA 2DC1A 3NIGB 1FXWA 1L4LA 1NTRA 1FNMA 1ZKDA 4CKZA 3ZDAA 1AQJA 2NU7B 4B3RB 3MOGA 4TVOA 4CIAA 3WGKA 2GR9A 3EY9A 1L4KA 1OJ7A 1QCDA 2YRWA 4FZVA 4W5RA 4LSWA 3TDMA 5AKIA 1ADYA 4X7PA 1BKSB 3L9XA 2TYSB 4GBED 1KO4A 1L5GB 3VM6A 4BP3A 4Z4GA 4M88A 2H2GA 2ZVDA 2QLLA 3LGSA 5EY5B 2AF4C 1JZTA 1KBQA 3BB3A 3LPAA 4P3KA 1ECPA 1R9GA 1TPYA 4QFBA 4ZVOA 3VH2A 4AY4A 4XQCA 4MVJA 4C6TB 3UN1A 4JBWA 1JDBB 3LDHA 2PWPA 2H1LA 2JIMA 2NZWA 4CR8A 2VDMB 1KY4A 3OZEA 3T1OA 3CUVA 3FGPA 1DPGA 1NVKA 3QE2A 2ZB7A 4JH0A 4OIFA 2HA0A 2M98A 2XKJE 4DTIA 3QPCA 1BWPA 1TU3A 3KV3O 4IH4A 1FZQA 1NVGA 2PX6A 3C6XA 3UXMA 1SQSA 4PV7A 4W9MC 3TPCA 2WU8A 1KAQA 3N2ZB 1C0LA 2DBVO 3PC8A 4KH1A 3HCDA 4ZYXA 1EFRA 1NRXA 5BO5A 2COKA 3WLNA 1VXOA 5BQPA 4CMEC 1JHPA 2HMTA 1IL0A 1RI1A 3N53A 3IS3A 3R5TA 4S0XA 4G36A 4DLWA 1EX9A 1QGOA 1JJIA 3UB4A 1I7NA 2YH2A 2V4ZA 2OKCA 5HQTA 3VTAA 3DOIA 3DWEX 2PGAA 4Z99A 1NL3A 3WICA 1OYWA 1H4SA 3EIWA 1TC1A 5EYPA 4LF5B 2Z83A 5EEHA 4AS1A 3SEFA 3PEYA 3F78A 1SBCA 2BFEA 4ZP1A 1UDCA 3LUPA 4LUCA 4WUVA 5B1SA 3TIFA 4L7VA 1Z0FA 4XDYA 2C3OA 3PHLA 1M2OA 1I0LA 4MH0R 2EBWA 4EGAA 5C3MA 3KQOA 1YMQA 4N0PA 1C9NA 1OAAA 3KKKA 2X3FA 3A2KA 4UJ5A 3I61A 5JCJD 3QENA 3LPCA 4Z2YA 5GOZA 4EG7A 5KC8A 3DKKA 1IWOA 5KVSA 5HUJA 1ICIA 3B7PA 5E9QA 1FA9A 1HEYA 2AA3A 2GN0A 2ZR8A 4KACA 3IIIA 2ZKIA 1XZDA 2EX0A 2XUZA 2G82A 2GO7A 3H3JA 1EZ1A 1RAIA 1ECFA 1VL1A 1YQUA 1GZ7A 1WB5A 3HDVA 4Q1BA 3H19A 1UQTA 5I48A 4X0EA 4JKYA 4ISCA 1R1DA 3GG9A 3N2KA 3WK5A 4WK4B 2A1IA 1POXA 1LC0A 1VRVA 3HCOA 3UK2A 5JH7F 3EZXA 3CF4G 4KP7A 1ENOA 2GPSA 5J63A 1W30A 3NWEA 2XJ4A 1XTRA 3MT8A 4LZPA 2EFDB 3ILVA 3IE0A 5FA6A 5LP1A 3THYB 3HBFA 2RAVA 5BWMA 5CDYA 3TG2A 3CN9A 4B3HA 4ZHSA 3HCNA 1O8BA 2VWHA 3HU5A 2XT9A 5A9SA 3FUUA 5B36A 4ZN6A 3EFBA 4IKPA 1PR0A 4RDCA 2OD7A 2YZMA 1MB4A 3NXSA 2VTKA 1KH1A 1ZNQO 3FDXA 4QRHA 3ZWBA 4EDHA 5DSTA 3RUEA 3CEHA 3UAVA 1L7VC 2FFHA 3WWEA 4ESHA 1H2AS 3Q6MA 4RKYA 5FBLB 4XLZA 3VUEA 2VUUA 1RT9A 1QYWA 1ECJA 5K8VA 3NDBB 3WO1A 1ZXXA 1VGQA 1FTYA 3RC3A 4EKGA 2CT8A 1JDZA 3PE6A 2DPXA 2YOGA 1ORWA 3R8XA 1X80A 3FZNA 1HYEA 4IFBA 1IY0A 1E8DA 3KD3A 5F76A