2Q1EA

Altered dimer interface decreases stability in an amyloidogenic kappa1 bence jones protein.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
b'ATDIQMTQSPSSLSASVGDRVTITCQASQDINNYLIWYQQKPGQAPKLLIYDASTLETGVPSRFSGSGSGTEFTFTISSLQPEDLATYHCQQYDNLPYTFGQGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloidogenic immunoglobulin light chain protein AL-09
publication title Altered dimer interface decreases stability in an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 26
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q1eA00
2DTML 4QGYA 3QWQB 3FRPG 4G6FD 3Q1SH 4NO0B 4HUWA 3KPOB 2VNCA 4YO0A 5C07B 4KKBC 1RHHB 1D9KC 4YDJA 3THMH 1N8ZA 1ZXQA 3VFSA 1S9VA 2Z35A 3MRMB 3GB7B 2N1KA 1WT5A 1A8JH 3VFUB 4DGYL 5IFAL 4NUGH 4ZSOE 2UVEA 3IDGA 2VWEC 1G7MB 4FZ8H 4U1GC 5C0EB 3CUPA 1Q94B 1NKOA 5DMJB 5IB1A 1WFUA 1IFHH 3QUZC 3NCFB 3ABZA 5MENE 3QWRD 4U1IA 3U79A 5C8JB 1TJIH 1I1RA 3UC0H 5BZWA 1RZGB 2HRPH 2ATPB 4OZHA 4QWWC 4MNHB 3H3PH 1RUQL 5SV4A 3WNMA 1KPUB 1OAKL 2PR4H 4YX2L 5M7QA 4RWHA 2BCKA 2XT1B 3GFUA 4J8RA 1N0XL 4XNQA 5T3ZD 4EVNA 3G5VA 4WI5A 3P4NA 1NEZG 4LEOA 5E2TH 3LKOA 5CP7B 5DJ6A 2H1PH 1KLGB 3A6CL 2NY0B 3BP4B 3X3FL 4ELMA 4GH7B 3IDNA 4P5MB 1JGUL 1IQDA 1AI1H 5IB3A 4XTRC 3BJLA 4Z76A 4PP1C 1EEQA 5L88L 5KSAC 2G5RA 2A6IB 2AW2A 5FF6A 1NC4A 5TDOB 1NGWA 4M1GL 1I1AD 4NJ9H 4APQC 3ECBA 3U4BL 1WAAF 4V2CB 2ARJQ 5GGUB 2MQ0A 3H9ZA 3C60C 4F58L 1EZVY 1CD8A 5C08D 2HKFH 4H1LA 2FZ3A 4MS8C 4G7YL 5DJYB 5E2UH 4MNGA 43CAB 1HQRA 1CXLA 4KJYB 3QR2A 3MV9B 3HNVL 4OZHE 1W0YT 1FNEA 2FYYA 3OR7A 2XZQH 5ACZA 3L7FB 5IBTL 1NSNH 4Z7UB 1NGPL 4K07A 4KVNH 2EYSB 4G8GA 1TCRA 5J0BA 4FXLA 4TSBH 3CLEH 3VFWA 4XP5L 4CW1A 1EXUB 1M71B 3LDBC 4H8WC 3UYPA 5T33H 4MQSB 3VGAC 3GJFH 1S9YA 4V1DB 1XF5B 2DQDH 4JRYD 1QLRA 2EEAA 3F7RA 1CDUA 4KTYA 4ELME 4MA1B 1Y18A 3RGVC 1YUHB 4RFEA 4TQEL 4XPTL 2H3NB 4LBEB 3AS3A 3C8DA 1YA5A 1FVEB 3QRGL 5ESVB 1J8HD 2ZCKH 4KAQH 1BJ1H 4HK3N 2Q7YA 5BO1H 4IRZL 5DYOA 2WZPD 4HSQA 1SM3H 2FBJH 2RHEA 3LQZA 5I71B 2HVJB 1X5YA 5E4EC 1ONQA 4LLMB 4JREB 4X8JA 1SEQL 3WKMH 3OAUH 4WW1A 2B0SL 1MWAB 1BVLA 2CKBL 5C7XH 3GMQB 4OV5A 1K85A 3QI9D 5JPMB 3RTQC 1Y0LA 3O6FD 3B4NA 2V7HB 4P5TD 2HVKB 2F53D 1K3ZA 3LEYL 4M6NH 5C2BL 5T5FH 4TUOB 7FABL 1NMBH 3D25A 1CFSB 5E4IA 4ZUVA 5FGRA 1I1FA 1AXTL 3QUMA 4OKVA 4S1RL 4G8GE 4BH7A 4MGXA 1N59B 3VDBA 1J05A 1U8NB 2Y9RT 4PJ5A 1PKQA 3EYVA 3V5DB 5AUMA 3QDAA 4FA8A 3MRIB 3SQBA 3QUZA 5IBUB 2VXVH 3EZJB 5F1SA 1HQ4B 5C0JA 3QIUD 3ARPA 4OF3A 3U2SA 2J6EA 3QQ9C 3SJVB 3IF1B 3JUZA 2LTQC 1IKNC 1MCRA 1U8QA 1T0MA 2EIDA 1R24A 1JBJA 1CD0A 1OT1A 1U8OA 4KKAC 5SX4I 2L7UA 5FUZL 3WIIL 2GTWB 5H8DA 5T1LB 4L3AA 5I8CB 2YRLA 1UXSA 5KS9F 1RV6X 4X7TA 5FYKH 3SN6N 4EN3D 1FVCA 4HXAH 4QRSA 1M4KA 3K2MC 3C8HA 4YBLB 5KVEL 4WI8A 1P6AB 4KXZI 1J88A 1E27A 1K4DB 3NPSC 5LGJB 1U6AH 5F1NA 3ZYIA 5KSAA 5TE4H 1UADC 4JANA 3PXHA 1HHIB 3S36H 1OF2A 3LRGA 1KC5L 4JRWA 1U3YA 4PY7A 1FORL 2QQLL 2YD8A 3QIWD 4G8IB 4M5ZL 3ARFA 3TCLA 2VWEE 1PKQE 2Y07H 4PRBA 2B7DT 5D7JA 1EGJL 3MRQA 2BY3A 1LK2B 1KENL 1JF6A 4LHUA 1J18A 4RA0C 4MXVF 1QLEL 3LPWA 4F3FB 3K1KC 4GG8A 4GS7C 4LLWB 1QSEB 2NLJB 4QXUH 1KUMA 5JNYB 4HD9A 3W11C 2GHWB 1RIHL 3C6LC 5IB5A 5ESQA 2AXHA 3VI3F 5D7IA 3K46A 1FO0L 2EZ0C 1JGLL 5GRZA 3N06B 3L3OA 1NGXA 3SO5A 4KJQD 3LKSB 1WVZA 5J56B 5T1MB 1X5FA 4IMKC 5BCAA 2ITCA 3P73B 1KOAA 3GKWL 3RUGB 5KTEL 3PHQA 5CP3H 1VPOH 4YDLB 2ITDB 3BESR 3L5WB 3EFDH 5IESL 3DIFB 1U58B 4OT1L 5CEZE 3SE9L 4HCRA 4NRZB 3SCMA 4NQXB 3UTPD 2UWEA 2ZOKA 3IXAB 5LVEA 1Z2KA 4MXWH 4PJAB 4RZCB 4YE4H 2QQKL 4XCFH 4EBQL 4I18A 3S96A 1WBXA 4TPRH 4RISL 3NFNA 1XF2A 5HVHB 4PRHA 1NBZA 3OGCB 3PWLB 5FO8B 3WO3B 5I1LB 3MMEA 4XBEH 4YNYA 1IAMA 3ARDA 2KBGA 3MPCA 4L8BA 3NCCB 4XVJH 2VXUL 3F6LA 4PGJA 3AAZA 1KYOK 5CAYB 4YXLL 3C08L 2JE8A 5D7IE 3HLAB 3OF6A 4XP4L 1T0NB 5ID1A 5C0CA 2FGZA 3L6FB 4ZFZA 3WXWH 5JW5B 4E42A 4HKJB 4RMSA 3SQOL 4YWGH 4QF1B 2FHFA 3KWWA 1II4E 2DD8L 4PRPD 4H0IA 4G5ZH 3MR9B 2Q86A 2NYYD 4CL7A 2UWEE 4DVRH 3VXMA 3AVEA 3SKNA 4IDLA 3GHEL 1LO0L 2OL3H 5FDYA 3B2UC 4P59L 5CJ8A 4XVSL 3STZA 4NZDA 3QG7H 4PBWD 5C2UB 2VXTL 4XPBL 1I3GH 5J12B 4LAQH 5DEFB 4L3CB 4PRHE 1ZTXL 1AHWC 2BSRB 1S9XB 3QUXD 3S36X 5CZXD 5BZDB 2VYRE 2EE6A 1JV5B 1QACA 1IAIL 3HE7B 3MJ9A 4LP5A 4FNLL 4D94A 3UJJH 4NHCL 2QSTA 3EJJX 2HT4D 3EYOA 5FGSA 1HINL 2HLAA 2EDHA 3DVGB 5TGBA 3MQIA 3UBXA 2PYED 3L7EA 3Q6GL 1BAFH 1C5BL 3KPNB 5TE7L 5C0CE 1OGAA 1NFIA 2EO9A 4YPGA 5D1XD 4QXTB 2VO5A 4HDIB 3S98A 2BK8A 4MNQD 4KTEL 5K9QG 2F15A 3T3MF 2DLGA 4G6FB 2EDFA 1CWVA 3IDJB 2HKHH 4OGXH 2GJ6D 4PRNA 3C6LA 4GAFB 1U8JB 4IIQB 3ZKMC 4F7CA 3VXME 5IHZA 1FNSL 3LB6C 4EUPH 4ETYA 1UH4A 3TP4A 5DXWA 2EDRA 5DJAA 3X11A 1V3MA 2EDOA 4U1SA 1IEHA 2OYPA 4ONGH 5DEGB 3DVIA 4BK4A 1Q1JL 1X7QB 3O2DH 3WIHA 1MI5D 5KZCB 4IMKA 1T04A 5H94B 3RVTD 3C2SA 3TZVD 3ZL4L 1SBSH 2V5TA 4HUVA 1INEH 5D2NB 1CIDA 2EDKA 4MJIA 5C70A 2FATH 2J88H 5EIVA 3U83A 3L3GA 1U91A 3WNOA 1DUZB 2PW1B 3MOBL 3PP3K 1H3VA 1I7RA 3VMPA 2VDQH 4UDUB 2Y5TA 3X13B 5ICZA 4PJCB 5JQ6H 1OGAE 5J13B 2KUTA 4Y4FB 2DBLH 3S4SB 2QHRL 4K8RL 1ZVSA 4K94L 4UT7H 3O3EB 4WNQB 1DLHA 3VG0H 2GJJA 2E6PA 1Z9LA 1VGEL 2X4RB 1JUFA 3K7UA 3DX9B 4HJGB 3PUCA 1NCDH 2VXSL 2X70B 3HC4L 1F58H 5JLZB 3L3KB 5JUEH 4UILL 4GKSB 2UUDK 3CJJA 2WUBH 4WFFD 4QHMB 3CFEB 3C5ZB 1B2WH 4HKBA 4PB0H 3UYOD 3UTTA 3FO9B 3LN9A 1LNUA 2PKDA 3VG9B 2EKSB 5HVWA 1VSCA 4PD4K 3SKJH 1CDGA 5I15L 2RGSA 4LCUB 4BFBD 4G43B 4ZPVB 5F9WB 4PJDB 2CSPA 1SY6H 2GUOA 1KEML 3GGWA 3D3VD 4K8RD 1D5BA 2Y5EA 4MJIE 3HRPA 2X05A 1I8KB 5EA0H 4OM0H 2DQFA 4R90L 4YBHA 5CWSA 3ULUL 1OGTB 1A7NH 1ADQL 1UACL 4ZOAA 1ZLWK 1X6NA 3R0MA 5C09D 4QHNB 3QFJA 3LQMA 1JF1B 3JZ7A 3BEWB 2RBLA 4E0RA 2YEZB 1ND0A 4ZO8A 3WFCL 1RMFH 2VQUA 4FQLL 3TN0C 3H9SA 5BS0A 1AHWA 3U0TA 4EDWL 2P24B 2EICA 3B2VH 4LHJB 1QLFA 4YDVB 4I3SH 2VUYA 2Y7QB 3CVIH 4XNZB 5ECJE 4OFDA 4JRYB 2XNAA 2BOBB 1KIQA 1H0DB 1Q0YL 3NABH 4NWUL 3UTTE 2GAZA 1OM3H 1RU9H 1NEZB 1CLZL 1MUJA 3FONB 3ULUD 1NDGB 1LP9F 1OL0A 5DMGC 2AK4A 1IQWL 3EYFB 4X7FC 1J8HB 3F62A 1OQOA 2X4UA 1R3HA 4JHAL 1NH6A 2DLEA 1H8OA 1ZHNB 5MEPA 1WLHA 4R9HA 2AKRA 1HK6A 2R0KH 2DIBA 1MFAL 3W9DA 4D9QD 1IAIM 4L4VD 1RULL 2DDQH 5IHBA 2VAAB 4JFDB 4WEUD 4Y16C 3X3GL 5GS0C 2A38A 3BKCL 1I85C 3O6FB 4P5TB 1ED3A 2F53B 4FXGA 3QFJE 1KTLA 4EOWL 4DKFH 1Y6NR 4IRJA 1WFNA 3UYRL 3UJIH 1CICC 1MFDL 3EO1A 1CDIA 1F3DJ 4R3SB 1CLOL 5ID0B 3H7BB 3H9SE 5BS0E 4QYOA 4HMEA 4Y5XA 1A6ZB 3KXFD 2HT2C 2YMXL 3IFLL 1N4XL 2EDXA 5CMAA 4BYHA 3QIUB 1WZ1H 4J4PA 3BP5A 3WE6A 5BXFB 3WLBA 1Q38A 2EDQA 5F9OH 5J89A 2W0FA 1JNLH 4QOKA 4OZ4A 4AQOA 2AK4E 3RZCC 4Q97A 3VXOB 2GCYB 2FX8H 3O3DA 1GPOH 1ZA3A 2HT3D 1XGQB 5I1HL 1H8NA 1FNGA 1F3DH 4JHWL 1H5BC 3A6OA 2PXYB 3KYKL 4BFIB 4P3DB 4OZGA 4X6BB 4PGDA 3DV4A 1M7DB 1Z3GH 2W9LA 4JY6A 5DURD 3HI5L 2ZPKL 4HULB 5GRVL 5BV7H 1OAUH 1KJVB 4U1NB 4ZAKB 5B22A 1ZV5A 3N9GL 2NCMA 3MLZL 4PLKC 2IWGA 1S9WB 5GISH 4XMKL 2FH6A 1AGDA 2B4CH 3QIWB 4K7PY 2B1HH 2A6JB 2CIKA 5JORB 4YXHH 4N1EA 2XN9D 4D0BB 3H8NA 2FWOA 4HF5L 4MA3A 4WU7A 1S7UA 1A7BA 3ILPA 2D31A 2R23B 5I8KL 4R96A 1TZHA 4X6FB 3AM8C 4KRLB 3LVEA 4YDIH 2E7BA 1J0ZA 5FECA 4S1SL 5F7KC 3GM0A 1KB5A 4UQ2A 4GAJL 1KNOB 1WWCA 2FJFB 4QOKE 3ARWA 4HS6A 3OJDB 2OTUB 3C2AH 4RFOL 3SDAD 2XZCH 4DQOL 5I0DA 1HHHA 1DE4A 4F2MB 3BKYL 3G9VA 1YEEH 5DQDL 5DUBB 1LO2H 4OZGE 3MXVL 4NOBA 3DRQB 2FIKA 3DV6A 4JLRA 1GGIL 3CDGB 4LARH 5F21B 4MA8H 3W0WD 1TJGL 2OMBA 2A6DB 4Z7QE 5KVMC 1IL1B 3NFPB 3PJSA 1K5NA 5F97E 1PQZA 2VDMH 3Q5OA 5JHDA 3ZSTA 2HG5B 4XMPL 2BDNL 5CBAB 1JNJA 5MI0C 5IHUH 5J3HC 3HN3A 3T0EC 5BRZD 1QKZL 1D6EA 4QCIB 4F7TB 1BWMA 3PWPD 5DQ9A 5D70H 5EPMA 2QL1A 3HC0A 1KGCD 4AY0A 5F72S 4WY7H 1CFQA 3QEGH 1UZ6E 3NIFE 2GTZA 1HXYA 1F8TL 2F19L 2UZIH 4JG0L 2YSSA 1D5IH 1X5ZA 1I85A 3V5HA 2VDNH 4NQVB 2YWYA 1U8PA 2HTKC 4BSVB 1S5HA 1RZIB 2I9LB 1MLBB 4Y2DD 4JPWH 3W9EA 3OKDB 5SV3A 1OWWA 1AO7D 4XRCA 1P84J 4PJ7B 3TBSA 1WZLA 3MRBB 3IDIA 5IQ7L 3VRIB 3KLHD 4NKIL 5INCA 3MNVB 1IGTA 4JRXD 1FG2A 5FYJU 1A6AA 1Z5LA 2OS7A 1EX0A 3ARED 3BW9B 2DI9A 4ZO9A 4PRPB 4LOUC 1IGIL 4G6JH 1EK3A 2X42A 3RZCA 1AXSB 3WL9B 2YKLH 3HZKA 4JGJA 3MBXH 4E41D 4GG6B 1N3NB 2HFGH 3JV0A 4OCMC 1A4KB 1F6AA 4H88L 3JWOC 3TNNA 1D3CA 1MY7A 1QG3A 3B6SA 4LIQL 2CKNA 4X98B 2NY5H 1OAKH 4X0KA 4YX2H 4XXCA 4Q2ZA 4G6AD 3OKLA 2VZ3A 3QUXB 3IAGC 4YJZL 5CEZH 2N4IA 2CIIA 4ZXBC 3GHBL 4ETQA 4LDLB 5ICXA 3R1GH 1DTUA 3UP1A 1TFHA 3A6CH 3QNXA 2A0LD 1V7ML 4Y1AB 3INUH 5F3BB 1W72A 4QHUB 1VGKA 3M1BB 2D7MA 3D69A 4WFHD 2NW2A 1JPSL 1YNTA 3MBED 4NNXB 1T1YA 3AM8A 3PL6B 4UQ3A 5D1XB 3JV6A 2FB4L 2WAHA 4MNQB 1NGYA 3FOMB 1G9NL 3RWFA 4WTWA 4XNMA 4O2FB 3VWJD 2RFXB 2H6PB 4U6YB 3QHTC 3MNZB 3GIVA 1YECL 1MCQA 2GJ6B 3S35X 1FNHA 2X4NA 3GSWA 4HIHB 4L4TB 2DJ4A 3UPAA 1XGUA 4ZNCD 3VDAA 3P9WB 2V5RA 3BVNA 4FP8H 4UV7L 3ALWA 1C08A 3RWJA 1XAUA 2EEBA 3BMWA 4M5YL 1QBML 3EHBD 2YD4A 1MI5B 5D1QC 3L3DA 4EQ2A 1NFKA 1YN7B 3RWCB 4WFGD 4ZMAT 3RDTC 3MRGA 3UEZA 2G75B 5HHMD 2I60L 1FDLH 1E0OB 4YHZL 3D85D 4HIJA 1I1YA 5F96L 2AVGA 2V9TA 3GNMH 5EB9A 2F9BT 4NUJB 2MCG1 3LZFL 2ZG3A 3QDMA 3ZT7A 5HD8C 5HYQB 5ABDE 32C2A 3B43A 4M43H 4U6VH 3I02B 1QRKA 5MEQA 2IAMD 1Z9OA 3QSKB 5F9JA 3NMEA 1U2HA 4GMTL 3UJTH 3QRGH 4HC1A 2XQBL 4R7DA 3VD4A 3U7YL 1OSPH 2CJUL 3ILQD 4IRZH 5DR5H 1G6RH 4MCZB 5F7EL 5C71A 4J3TA 5CD3B 2CDFB 1CGVA 4AH2B 2Y36H 5F88A 5ADOL 2UYLA 1X4ZA 4UDTB 1JYWA 1O0VA 2F54A 1BFOB 2VJXA 4QNPE 3C5JA 2B0SH 5DK2A 2NY3C 4P46C 3B8YA 3RVWD 5MEND 2Y25A 4FFVD 3RNQB 1F11A 4BM7A 1ZHBB 3L5HA 5F1OB 3CZFB 2VLJA 1XR8B 1I8MB 4MD4A 4K3DH 3ZHLA 4AT6A 3G5ZB 4JHBA 3MCLL 3WS6A 4JGUA 3VFPA 2JELL 3GMRB 4S1RH 4N9OB 1UWXK 5F7UA 1ORQB 5HYEA 3C9NB 3FOLB 4WV1C 1NCTA 3FT2A 5HGGS 2HYMA 3MFFA 3MZGB 3QDME 4QHLA 2CMRL 5EIIB 5C09B 4D9LL 3IXTA 4XPFH 2XI9A 2FSEB 4K9EC 3H3BC 3P77B 1A3RL 1OT2A 3I9GL 4LVHC 3WD5L 5HBBA 4HIIB 1W0WA 2R39A 4LPUA 1VEOA 4H1LG 4ODTH 4OFYA 2CRIA 1AD9A 1KCRL 5FKPB 2KZWA 1V3KA 2F54E 3U0WL 3GSUB 2A73A 4YFLF 3DETC 3QDJA 4PJIA 3EO0B 4GKOA 1CLYH 3MUY1 3TJHC 5DF0A 3NN8B 4F7MB 4E5XA 2VLJE 3RVXD 4U6TA 4QRPA 4C4KO 2D7NA 3P4OA 3ZT6A 3U7WL 1TZGH 1CXIA 2OZ4H 5T1KA 1JZ3A 2CDEB 2QQLH 4PLNC 4HKXA 5DHVA 5ITFA 1T7XA 4MWFB 2CQVA 4PTTA 1KB9K 3BWUC 4DGVH 3CFDB 4L4VB 1EGJH 4RGNE 1KENH 2V9RA 2A9NL 3T2NL 3HE6B 4MD5A 2JJUA 3GMOA 3OKOA 3QHZL 2IQAB 3VH8A 5F6HJ 5E94A 3H6JA 1FZMB 4DN3H 4M48H 1K2DA 3L3HB 1KJ3L 1GGBH 1WK0A 2ARJA 3A67H 4PIRF 2DICA 5C0GA 1TVDA 2DM2A 1NC4D 2J8HA 3MLRL 3DVFA 4YAQA 1FO0H 4NO3A 5I17A 1HOCA 5MERA 3TT1L 3LRSA 2IADA 3QCTH 3UTZA 5IFJA 3O45B 3QDJE 4PJIE 2VDOH 3QCUH 3GKWH 4N8CL 5KTEH 1XFPA 1SEBA 3EIFA 3VJ6B 1S7SA 2AJZB 2GY5A 3IJSB 4CADA 4KU1A 2Q8AH 5DJ2A 4QRPE 1S5IL 4OT1H 4EQ3A 1IM3B 3CCHA 1ZLVK 1FL3A 2WWMD 5EOCL 1F6LL 4PJ8B 3VXUB 1NCUA 3QT2A 2ERJC 4XCCH 4RMTA 4G8GD 3K3QA 5AWNL 4OQTH 1RJCA 1T6VN 1R3LB 2CK0H 5EU5B 5DGRA 4RISH 1LK3H 2MNUA 4CU8A 5I66B 4P46A 3EBAA 4ZFGH 2FX9L 3MODH 4HAGA 1OP5H 1RUAH 3QUML 4L5FL 1H3WM 1AQKL 1XF4A 1GGUA 2NW3B 5KS9B 3B9KC 4JFOA 2VXUH 5I9QB 2ZUSA 3F7PC 4M9OA 4QY8B 4BQBA 5EZLA 1MCNA 1DL7L 1CG9A 5B8CC 1JFQH 4JQIL 4WV1A 5ACMA 3VXNA 2J6EL 1YMMA 3LAFA 3SKOA 3P0VH 4HS3A 1FFRA 2OR7A 1C12B 3JUYA 3RGHA 5HHQB 4ZYKB 1TVHB 2RR3A 4PBXA 4NKMB 3RWHA 1FBIH 5K9OA 2DD8H 3SDAB 5JPNB 2MKLC 3ZE2E 1KXVC 1QNZL 3D39A 3H2WA 3VCLB 4K3EH 2AV7B 2DM4A 4WTZG 5LBSL 5HDQL 2C3HA 3GHEH 1LO0H 4BFGA 4QXGL 4XI5C 5F1IA 4P59H 4WU5A 3V0VA 4PJ5D 2ESVA 2FHBA 4FN0A 4MAYA 4P57B 4AMKL 3QUZD 4UAOB 2AEQL 1MJ7H 5DRNA 4Z7VA 3T1FB 2Z91B 4GBXB 3S34H 2VERN 3RI5K 3VW3L 3QXDA 5D5MA 4JO2L 4C4KT 2DI8A 3KJ6H 4FNLH 1RJYA 2IG2H 5BRZB 4Z7OE 4CVZB 5I1AB 1MCIA 1U93A 4PP2A 4OUUA 4YBQC 3L3JA 1AXIB 1OW0A 2E7CA 3BGFC 3O6KL 5TFSL 3BKJL 4XX1G 4YUEH 5DWUL 1C5BH 5TE7H 4S2SA 4UU9A 1YMME 2OL3B 2OI9C 1GHFH 3PDGA 4PJHB 4M1DL 4Z7NE 2VB5A 4XNUL 4KKLD 4Y2DB 4OBRA 2HP4A 3GSNL 3RHWF 3OKNB 4ZFFA 3DX8A 1EUUA 3RX8A 4S1QL 3T65A 1ORSA 2APBA 4XTRD 3V4VH 1AO7B 2ZSWB 4PP1D 1B0GA 2AEIT 3D39E 4R97C 1DBML 4JFYB 5KSAD 1FZOA 5CEZD 1FNSH 1TZIB 2AK1H 4H8WL 4ZS6D 1ZT7B 3U4AA 1QO3B 1J0IA 4XH2A 4X80H 3TVMA 3ARFD 2XA8L 3BQUC 3V4PL 2ESVE 4JRXB 4P9ML 5FDWB 3KPRA 5D7JD 4PJFA 3AREB 5D71H 5TE6L 4LHUD 1DANU 2H8PB 3I84A 4Z7VE 4HK0A 4LSVH 4MD0A 4MS8D 1PSKL 4UBDC 4TNWK 5D5ME 4XPAL 4OLWL 3HPJA 4HCRL 4L8CB 4F37F 3HUJA 4XBPB 1U95B 4WWID 1DDHA 1HNGA 2FRGP 1YEDA 5DMIH 4WI9A 2W9DH 4XWOD 3MO1B 2PF6A 2P8PA 3IFOB 4MXQC 4NO2A 2BY0A 4PJEA 1KELL 1MAMH 5I74C 4KTDL 1PKOA 5C0NC 4DW2L 4YC2C 3O2VL 4JFQB 2QHRH 4NHUA 4LSTL 1DANT 2R9HC 4R6UA 3TBWA 1REIA 4WHDA 5F7DB 2Q7NA 1VGEH 3CSGA 1A1OA 5IVZB 3RRQA 1D5MA 3HC4H 4ZFOB 4PJXA 3RVUC 4UILH 2CRZA 5SWQB 5EH1A 1AC6A 3I6GB 3E6HA 1KTRL 5TQ2L 3ZKSD 4U3XA 5ITBL 3SCMD 3KNBA 1BBJB 1PFCA 4M7JH 1KB5H 2VISB 4HPYH 1EEZA 4OCNC 5I8OL 3IU3A 3TBVA 1GYAA 1V3LA 3KPRE 4PJFE 3LH2L 1WJ3A 3QQ4B 3VRJA 4CMHB 2CDGB 4AEIH 5CHNB 1XZ0B 1LD9A 1UC6A 3HCVB 4XC1H 1KEMH 1UB6A 1LE5B 3NCYP 4PRHD 3HUJE 4U7MA 4KGLA 4XP6L 1FLRL 3ARDD 1G7PA 1B90A 1ADQH 1BZ9A 3P40A 5HJ3B 1NAMA 4H5SB 5D72L 3BZFB 4CVXB 4PJEE 4HPOL 1NJ9A 3O41A 3H0TA 4L1DA 3MRJB 1VADA 2X6MA 1A14H 5E1AA 4HK3J 5I1IL 1TENA 1Q9OB 3OF6D 3BP6A 3TO2B 5FM5M 3IKKA 5C0CD 3WFCH 3BISA 5E8DL 2D9QB 3HS0A 5I2IB 5EO1A 3DTXA 3MJ9L 4DZBB 3E3QC 3CU7A 3L5XH 3O3UN 4PJXE 5GGTA 4KKAD 1UEYA 2NY0C 3DURA 1Q0YH 5DHYA 3OB0H 1A7RL 1OTUD 3HC3H 2IAMB 3LN4A 1TJHH 1QFPA 3ARXA 1CLZH 5HI4C 3VXMD 2BHYA 2XKNB 5JR1H 2RCSL 1QEWB 4HWZB 4JHAH 1MHEA 5CJXC 3ZKXB 4KV5E 4F57L 2DTSA 3CAFA 4LASL 2IQ9H 1HHGB 4O58H 4ZSOB 3MRRA 4H25A 4FFWC 3QUYB 4BZ2L 4YXKL 5HPMB 2RB8A 3FJTA 4OCYH 2YBRB 4WEBH 3WBDA 2DF3A 3IVKA 3LHPL 3QYCA 3QDGA 3T4YA 3BQUA 1L9MA 3X17A 1A7OH 4X99A 3UYRH 1OGAD 3TGXA 5ILTL 1KTKE 1FC1A 4JVPA 2IEPA 2M1KA 1NQBA 4XBGA 4XP1H 3U7AA 4R2GD 1MFCL 2W60B 5DVMA 4NC0B 3KDMA 2HFTA 2YMXH 3X12A 4KRMB 3GMPA 3TLRA 1I75A 2BX5A 4NZUH 1HI6A 3VGEA 4OF7A 5IVOA 4W4OA 3T0DA 4MA1C 1S8DA 1VFBA 4HUWB 2BRRH 3C6LD 1DJSA 5I1GL 3KYOB 3Q48A 4YDJB 5CUSH 4LNVA 4LPXA 5J1AA 1N8ZB 1OTTD 1HXMA 3WN5B 1FGNL 4WRLA 3VFSB 3K4ZA 2A83A 2EZ0D 5KBNC 2LU7A 4AIZB 1UCBH 5AYUL 5I71C 1ACZA 1R3JA 4KH2A 4JREC 3TO4B 1I7TB 1PEWA 4HH8A 1WICA 4WCYH 4DEPB 4NO0A 2YK1L 3KYKH 3KPOA 3PABA 3V2AR 3VWKA 5IB1B 5LWYL 4QRUB 3D6GA 4MJID 4XAWL 1ZEAL 4FG6C 1GL4B 4U1IB 3P30L 1JHLL 2ZPKH 3QDGE 2PNDA 4RAUA 3MRMA 1JCKA 1JTOA 3GB7A 1KCSH 3P9LA 5AG9A 1MCFA 1GAFL 4OV6F 4DUVA 2IPUG 4K3HA 2BCKB 5C0EA 3UO1L 1QZ1A 1Q94A 2DQGL 4JVWA 3QG6A 3TH4T 4J8RB 3UDWC 3DROB 3MLVH 4XNQB 3QP3A 4EVNB 3G5VB 3NIDE 3P4NB 1WIOA 4LEOB 4N68A 3LKOB 2FJHA 4P9HC 1EVUA 2UZYB 2ATPA 1UYWL 4NT6A 1IC4L 1LP9B 4MNHA 1CN4A 1MCJA 1U9KA 3UTTD 4B41A 1IQDB 4Z76B 1LO4L 1CF8H 2YPKA 5F3HB 5FF6B 1NC4B 1NGWB 2D0HA 2ZUTA 2DOCA 2KH2B 2YD9A 4ODHH 2HJKB 2I5YL 5EIQA 3FQWA 3ECBB 1ZA6A 4YBLC 5DQDH 1W8NA 3BZEB 1X5IA 2ILLA 2ICES 5HGHB 3MOAL 3RBSA 5L0QB 1L9NA 1GGIH 1IKFH 3RIAF 4P5MA 4H1LB 3E8UL 5J8OA 4GXVL 2FZ3B 5C0AB 4PJIF 4FXKA 1DLFH 4MNGB 2E7LA 2AI0H 4Q9BA 1J9CT 2A6IA 3ZDXE 4V2BA 3IDXL 4XMPH 2BDNH 1FQ9C 3QFJD 5ACZB 4HZAA 4RFNB 2F58H 3RX7A 1N5AA 1QKZH 4LGSB 5GGUA 4KVCL 2VDKL 4X5XA 4G8GB 1TCRB 4K7FA 2D03L 5JXAL 3H9SD 3K1DA 5BS0D 1F4WL 4EI5A 2JCCA 4CW1B 4M7ZB 5DJYA 3QZWA 1S9YB 4Z5RA 2F19H 3MV9A 4IOFC 4Z78A 4O4YL 3ZTJG 4KJPC 2O61B 1Y18B 3R0NA 4OIBA 3WNKA 4RFEB 2IC2A 5EULV 3HZMA 5D8JH 1BOYA 2AK4D 4JM2F 3I50H 5E2VL 2PTTA 3QH3A 2DQEL 5CJQH 4TVPE 4KHXH 1MAKA 4FFYL 2X9XA 3E3QE 2XG4A 4V1DA 1ONQB 1A7QH 4NKIH 4X8JB 1OPGL 3AXLB 2VL4A 3MRPA 3KLDA 4YDLC 5GHWL 1NDMA 1VEMA 1BVLB 1KJMA 4UI2A 1CU4H 1AGEA 4OV5B 2EC9U 3U4EB 1FVEA 3WHE0 4X7CC 5ESVA 3RVVC 3V95A 3D25B 4IRJD 4CU7A 1AC0A 4ZUVB 2QBWA 4GJTB 4BH7B 2V2TB 4PJ5B 1MVUA 1PKQB 3EYVB 2JCCE 5C3TA 1MWAA 4XNXL 3BH9A 4LIQH 5HVHC 2RQ8A 4TSAL 5C0JB 5IJVB 4C57C 1FVDA 4J4PD 2EC9T 2HFEB 1C7SA 3MV9E 2CR3A 1U8QB 3P0GB 1T0MB 1R24B 3GHBH 1U8OB 1GRWA 1CFSA 1A7PL 3GSRA 5DD6A 4QOKD 5BVPL 2C5DC 5DLMH 1FAIL 1U8NA 3T0WA 3V5DA 1DZBA 1J1OL 3RA7H 2FH8A 3MRIA 5F6HI 1V7MH 4OZFA 4X7TB 3SEPA 4AENA 3UDWA 1A1MA 1CD1A 3BEVB 1T83A 1FVCB 4HWBL 1X5HA 4V1DE 1RUKL 2G5BB 4YFLI 1HYSD 2VAJA 2FEEL 4JZJA 2BY1A 3GBML 4A6YH 5IK3B 1YECH 3GI9L 4ONFL 1E27B 4G6KL 5T1LA 4OCXH 4MDIA 5F1NB 5I8CA 1A0QL 3SE8H 5JTWA 1NCWH 3SPVA 2NY2B 4UV7H 3RQ3A 4RA3A 1D5XA 3ARFB 2DQUL 1HNFA 5J12C 5GGVY 4M5YH 3WUZA 1QBMH 4PRBB 5D7JB 3MRQB 1CGWA 1RY7B 1D5ZA 4ZOCA 4ODVL 2WUCH 5J6GA 2WMPA 5LGJA 4GG8B 3HE7C 4N0CD 4Z7VF 3GRWA 4YHZH 5E9DA 1VB9A 5GRJL 1FJ1B 5D5MF 1SYVB 2NTSP 1CFVH 1HKLH 3MLUL 5ESQB 4FQHA 1BFSA 3LZFH 5DC4B 3OJVC 3IRZA 2WK2A 4P23B 4PB9L 3G04B 4F3FA 3MLPA 5GS0L 2NLJA 4XWGL 2YD7A 1QFWL 2AABH 2ITCB 1WEJL 2CJUH 3NIGF 3PHQB 1RZJH 2GKIA 1MHCB 5I1JL 4IIQC 2AJ3B 1V05A 3VXSA 1NCBH 4XHJD 5JHDD 5KJRH 3SCMB 3EDDA 2OK0L 4N5ED 4DN4H 4X4XA 4Y4HB 2J8UF 5T1MA 5CZKA 2LQRA 4I18B 4OF6A 4YHIB 1WBXB 4Q58C 3S96B 4BZ1L 5D2NC 3N0PB 1XGPB 4KI5E 2A77H 4PRHB 5E9DE 1CS6A 1G0YR 3N1FC 4PUBL 5GS0D 3MMEB 4NQXA 3IXAA 3ARDB 4ODBD 4LCWA 1G6RB 3HUJF 3B5HA 3NOIA 4L8BB 2W0LA 4RZCA 2C3VA 3BDYH 3OXRB 1UKQA 5J13C 2YD5A 2CXGA 4Y4FC 4D9LH 2W9EH 3JVGC 4PY8J 1P5UA 2J4WL 1BREA 5C0CB 1QSEE 3QXAB 1AD0A 2DKSA 4Q9QH 5CINL 3MRDA 4RMUA 4HUUA 4HS8L 5FAAA 3O81A 3ZE1E 2ED7A 1MHPL 2BXZA 3KWWB 3ZZ1A 3ZDZE 3BO8B 5FGCE 3C5ZC 2Z8VC 4AIOA 5HVFB 3VXSE 4PJXF 3RZCD 2VR9A 4OLYL 5C6TL 3U0WH 1W72L 2X5PA 3K74B 2Q86B 5J4MA 3HLAA 2JB5L 2SEBA 3VXMB 2DL2A 3F8UB 3VG9C 2L4OA 4HKJA 5E00A 3STZB 3ULSA 3BMVA 5F9WC 4YHKL 1QP1A 5KSUA 4GAYB 5C6PB 4KV5F 4FOMA 2NR6D 4EI6B 4JFZL 2Z4QA 3MR9A 5D6DC 1A3QA 3OWEA 4LCWE 5FOBA 4PLKD 5GS1A 3EYOB 3PGFL 2XKUA 2HLAB 5TGBB 1N2RA 1AGFA 1CQYA 4YEFA 3SGKC 3ARBB 3MLTA 8CGTA 3PIQB 1OGAB 4HX1B 1NLDL 5L7XL 4OB5H 5EOCJ 3QPXL 1KJ3H 4YPGB 4NQSB 1S9XA 4R2GB 3L5JA 4ODSL 4Q6IA 4NNPL 3GBLA 4XNZC 4KUCD 3MLRH 4Y5YC 3CVHA 1JP5A 4ZQKA 3V4UL 3SBWC 1JI2A 1MJUH 2ENYA 5C0DA 3TT1H 3DVGA 3HNTL 3JWDC 3MLWH 4F7CB 5IHZB 3IDYB 4N8CH 2YD2A 5D7LA 5DJAB 1HSAA 3X11B 3TFKC 1X5LA 4U1SB 1V3JA 1OD7A 1HDMB 2IMMA 2Q3AA 3MREA 3P0YH 1S5IH 4YK4B 5LCVL 5EOCH 2XZAH 1NFDA 4HUVB 3HI6L 3ORJA 5DK0A 4WWKB 1EUTA 1FCCA 1U8JA 1GH7A 4GFTB 4XNYL 5J9PA 1UXWB 3L3GB 1U91B 3O6FC 1IGMH 2F74A 4P5TC 4P3CH 3NFSL 1I7RB 4KK9D 3CX5J 1JHKH 4K7PH 4DUWA 2ID5A 1UH3A 3QDMD 5ICZB 4AYFA 3K8MA 2ZWLT 2ADFH 5EU7C 5HYJB 3NZHH 1DLHB 1IMHC 1FSKB 4NNYB 2UY7A 1QFWM 4IM8A 4RRPG 3HAEH 5IJKC 1JUFB 3QIUC 4NP4L 2P46B 2PO6A 3D9AL 1DL7H 1IC5H 1RZ7H 1NAMH 4JQIH 3HA0A 3ZE0F 1LDPH 3NIDF 3DO3A 4MHHG 3JWOL 3TJEH 2PTUA 2F54D 4WENB 2P5WA 3UTTB 4Y4FA 5D7LE 3S4SA 1LNUB 2WM0A 3CK0L 4JDZA 2QADB 1E28B 1ZSDB 4HJGA 2VLJD 4G3YL 3WUWA 2X70A 4DFIA 4XZUB 2PXYC 5LBSH 4MAUH 1NFDE 5CIPH 3MX0A 4QXGH 1D5BB 4NZRL 1BD2B 1YEJH 3C5ZA 3IETA 2DQFB 2JK5A 3FO9A 4KWUA 5CWSB 2COQA 4RGND 1RZ8A 1CVRA 4ZAKC 2AEQH 3NA9L 2EKSA 3FQRA 4QRTA 3QFJB 3QIWC 3MRKA 4JO2H 3ZDXF 1IT9H 4LCUA 4AEHH 5D2NE 1DBKL 4LRIC 3J7HA 3EFFA 3H9SB 5D7SH 3BKJH 5DWUH 5TFSH 4OTXL 4GMSL 1ZANL 5D6DA 3DVNA 4OFYD 2XNAB 2B1AL 15C8L 4QHNA 2DM3A 2P5WE 4M1DH 4KPHL 1DR9A 2GAZB 3EZ8A 4Z0XB 1S78C 4XNUH 3QDJD 4YZFF 1JF1A 3DWTA 1MUJB 4QKXB 4Y89A 4WIQA 5E56A 4QO1A 3O0RL 3O9WB 4GRMB 1MQKL 1MVFA 2X4UB 1R3HB 4QRPD 1H9VA 2M2DA 2A74A 4KJQC 4H8WH 5MEPB 4BQ8A 1ZMYA 5T1KD 2AKRB 1EVTC 1H0DA 4LNRA 2QKIA 3V4PH 4P9MH 1J11A 2C3GA 1EEUA 3EYFA 3AMKA 3UMTA 5I1EH 3CD4A 5T3XE 1DQML 4FXGB 4OGAD 1RZFL 4YGAB 2KZ1B 4YFEA 4IRJB 3VGBA 1YEGL 4JZOA 2VL5B 5CSBA 1NMCB 5IBLC 4QYOB 3O2WH 4Y5XB 4QRRA 4WGWB 4UINL 4B50A 4DW2H 4JFDA 2JCCF 3BP5B 4K7PX 3WE6B 2A6KA 2HN7A 4OBSA 1IGCL 3FO2B 2E9IA 4QOKB 4MB3A 1JNHA 4ZTPH 5ID0A 3DHJA 3MJGX 2C4FU 2BC4A 3O3DB 2DQCL 3MJ6A 5EC1B 1A6ZA 1J0KA 1ZA3B 5DT1L 5B3JE 5ITBH 5CKAA 3VFMB 4WFEE 1K4CA 4GRWF 1TETL 4OZGB 2IPKA 2BVYA 4PGDB 3LH2H 4JY6B 3T0BA 2ARWA 4HIEB 4QEGA 2GCYA 4WO4B 3D5OF 4OLXL 4K9EL 1MCBA 4P46D 3OTTA 1ZWIB 1T5WB 2DLIA 1MCWW 1XGQA 3OGOE 4OSUH 2BVQA 1FLRH 3EOTH 1AGDB 1CDBA 3D48R 4X83A 2OMNA 2PXYA 4P3DA 1OAQH 2FWOB 4MA3B 4QRRE 1S7UB 3ILPB 4OCWH 1FIGL 2D31B 2MHAB 1P9MC 4R96B 4O5LH 4HWUA 2YUWA 1LO5A 4JFDE 5HYFA 5I1IH 3QUXC 5FECB 1KB5B 1YMMD 4U1NA 4Q0XH 4ZAKA 3KYNB 3IU4L 4ELKA 5GQBA 1S9WA 1AIFA 2EE2A 1PG7L 4HJ0D 2MPAL 4ONHB 4D0BA 1KSRA 3FT3A 3S37L 1TXKA 4LF3B 3WHXA 3ZDYE 1DQJB 2FX7L 2JJWA 4HUNB 3D39D 1A7RH 5D1XC 3PL6C 1DE4B 1ERNA 1NMAL 4NRYA 2VE6A 4WHTB 1INDL 4CAGA 3T08A 2OTPA 2FIKB 4JLRB 2VSDA 1QR1B 3VXPA 2ESVD 4X7EC 4B7IA 4MAYD 3BGMA 4Q7DA 4F57H 3DYOA 2C26A 2OTUA 3OJDA 3W2DH 4NSKA 1LMKA 4MHHI 3PJSB 4XVUD 1K5NB 1PQZB 5JHDB 5KSVB 4YXKH 2XRAL 3TIEA 4X7SL 1AE6H 1NEUA 4GRWH 1L0QA 4ZUSA 5I1KL 1D6EB 2JIXA 3QB7C 2OXHA 3DRQA 5EPMB 3HC0B 2XA3A 1U92A 4ZODA 3RVTC 2YPVL 1CFQB 3P11L 3U46A 1F2XK 3OL2A 2A6DA 5ILTH 2GTZB 1HHJB 1HXYB 4NKOA 2EO1A 5J06A 5AZEH 2F5BL 4JO3L 4KI5F 4W70A 1U8PB 5L8JB 1S5HB 5KW9H 3TWCL 4JM4L 4M62H 5IEKA 1HIMH 3W9EB 4QCIA 3KPLA 4KZEL 4YHMH 1YEIH 1B0RA 1IZKA 4XRCB 4AEFA 4KDWA 3TBSB 2CO6B 3IDIB 4F15B 5HHNA 4NZTL 3TVMD 2W65A 4NQVA 3SHSA 1FG2B 3V7AE 3HHRB 1Z5LB 5AYUH 3KPQB 3KPRD 2YZ1A 2I9LA 1U8MA 1MLBA 3HAEG 5EC2A 2YK1H 3ZE1F 5BOPA 5LWYH 4OZFH 3HZKB 5ALBH 2O5YL 3ZDZF 2DMKA 3MRBA 1ZLUH 3P30H 4KK8C 3GK8H 4EZMA 3MNVA 4RNRA 3KJ4B 4KKCD 4ERSH 2D7TH 4NN5B 4QT5A 12E8H 1GAFH 3PWVB 1G0DA 4X0KB 4DGIH 4R26L 5F8RC 4QHKI 3UO1H 3CXDL 1M6OA 3WL9A 3IAPA 2CIIB 3LEVL 3Q0HA 3BRGC 4ETQB 2R2EA 3WS3A 3OG6B 4HJJL 3TNMB 4F9LA 1EMTL 2AXGA 5KVDH 2BNRA 3DXAA 3QNXB 5I1CL 1UYWH 1ZGLA 4S1DD 3D69B 1AR1D 2NW2B 2AJSL 4X98A 1P9MA 2BFVH 2OTWB 1KBGL 3JV6B 3GRWH 4LPYA 3RWFB 3UZVB 2H2PD 2I5YH 1Q9WB 1RFDL 3AY4A 4P2RB 5DRWA 1OP5K 1U8KB 4NBYB 1AP2B 4J6RL 1YEFL 4Y1AA 5K33A 3MOAH 5F3BA 4QHUA 3M1BA 1XGUB 4NFDA 4GXVH 3BVNB 4NNXA 1C08B 3PL6A 3RWJB 4Z95L 5E8PA 4W6XB 2G60H 5JMOC 5DI8B 4U6YA 3MNZA 5FYJE 3L3DB 5B4MD 3OJMB 2JKXA 4JKMA 4KVCH 1KIRA 4L4TA 3HE6C 4L8DA 3PV6A 5LGHL 3WFDL 1F4WH 5BMFL 1I4FA 5JA9A 1J1XL 3GO1L 3IJHB 5E8OB 1T0PB 2BNRE 2IPUK 3DXAE 5I0ZA 4OLVH 2Z93A 4NCC1 2AEWA 3S88L 3Q3GA 4YBQD 32C2B 4RQQB 1U3HA 5IMKA 5MEQB 1EJOL 1YN7A 3D0VA 5F9JB 1PDKA 4NWTL 2DQEH 4HGWA 5C0RL 3VDCA 5C3LD 2B8OT 3U36A 1XCQA 1NCCL 5DUPL 3PV7A 2DQJH 5E1HB 3WXVH 4LEXL 3PGDA 5F88B 3S97C 1FL6B 3MXWL 4Y1AE 1OPGH 5HYQA 1R3KB 2GEEA 5GHWH 4F9PC 3C5JB 5DK2B 1BFTA 3RU8L 4K3JH 3V7MA 4I48A 1TLKA 3QDGD 4PJ8C 2C4XA 2VLJB 4MCZA 3BQUD 2R8SL 4M4PA 5JOPE 4AH2A 1L0YA 3P4LA 4L4TE 4PYGA 1NFDF 1NUGA 1BFOA 4ZUUA 1JYXA 4XNXH 4UBDD 4RGNB 5IW6A 5FIEA 3FT2B 1IE5A 4I13B 3MFFB 3GJFA 3RNQA 1AQDB 2P45B 1ZHBA 5EUKA 4QHLB 1I9EA 1YNLL 5E7FA 1XR8A 1I8MA 2VLME 4LCIH 4HLZH 1EFXB 1UM4H 1XH3A 5I9QC 5BVPH 3GMRA 1FAIH 4NQDA 2Z9TA 4K71B 5CBEA 4HXBH 5KN5A 2DI7A 3FB5A 1Q9KA 1AD9B 1UWEH 4NO0D 5EIIA 4M4RA 4TRPL 3VWKD 2A73B 1NBVL 3HNSL 3QDJB 4GAGH 4PJIB 3SDAC 1J0JA 3GI9H 1IGJA 4I0PA 3F7VA 3F65A 3OSKA 3AU1B 1GC1C 3NCJL 2R2CA 3OPZL 2Q6WB 4E5XB 3FFCA 4QRPB 1G1CA 4TVPL 3P4OB 1WAAA 4QTIH 4AM0B 3QZWG 4HKXB 3QNYB 4R4FH 2DQUH 4PTTB 1Z6JT 1RVFL 2DQHL 3EO0A 4UAOC 2UY6A 1MEXL 2VLKA 2EKJA 1T03L 4ZOEA 4MD5B 4GBXC 3MZTA 3WJJC 1DBBH 5ETUB 1RUML 5A2KH 1DN2A 2CRYA 3G08A 3VH8B 4PRDA 1GVIA 5GRJH 5E94B 2APVA 4FTVA 4JM2B 1VA9A 4A6YB 1K2DB 4FMFA 3RHWK 3OKKA 4DKEL 4NQDE 4MDJA 5MHSE 4MWFA 3MSPA 4S10A 4AJ0A 2XACC 4KHTL 5DD5L 5CCKL 1JWSA 2ICEB 3HE6A 4TVPD 1CR9H 4Y88A 4NQUA 3ARQA 1JPST 4PB9H 4E9LA 5I17B 1ZAGA 4FQCL 2VKXA 1L4IA 5MERB 3LRSB 2IADB 5IFJB 4XWGH 3LS5L 5CSZA 4Y2DC 2IQAA 2YUZA 1WEJH 2VITA 3BZ4A 4KFZC 2AQ3A 2XWTB 1NLBH 2DQTH 1SEBB 1SMAA 5I1JH 3NVQA 3FFCE 3IDMA 5DJ2B 4F37K 2JJSA 1WAAE 1JGVL 3LQAC 1FL3B 2OK0H 1H3UA 1KTDA 3TYFA 5FEBA 1XT5A 1T2QL 2AJYL 4JKWA 1NBQA 3HG1B 2LVCA 3AREC 4U4BA 5GJSL 3BD5A 3KS0H 3PDOA 2VLKE 3ZHDA 4EI5D 3F7YA 4JB9H 2D7OA 3OB0K 3GJEA 1HCFX 3VJ6A 3IJSA 3W5NA 3T1WA 4U1KA 1XF3A 3MV9D 1BQHA 3G6JA 1P69B 4OZFG 4P2CG 4FTVE 4PJ8A 3VXUA 1L6XA 5CEXB 5JA8B 1QHPA 4D2NA 1XF4B 3D0LA 3WNNA 4FQ1H 1MWAL 1PLGL 5FYKE 5D1ZA 5EZLB 3KHQA 1YYLL 2J4WH 1KXTB 1ZS8A 3VXNB 4MA7H 1QFUL 1YMMB 4V1DD 4X9IA 3SKOB 4HS3B 1WWBX 1X4YA 1A3LL 4XXDB 1UCTA 5K9OB 2NZIA 2YRPA 1JWMB 4XCNB 2B20A 2R4SH 2PYFB 1YJDH 1D7FA 4JG1L 4N1HB 3D39B 2CLRA 4UOW1 2CGRL 4P48A 1GZPA 3T8XA 3K81A 3VWJC 4WU5B 4BK5A 4LLYA 4P9HL 4CMHC 1C12A 4KY1L 1E4XL 2ESVB 4HUXA 3EGSA 5HHQA 4MAYB 1A4JB 4ZYKA 3SDDB 3QNZB 5GS3A 35C8L 4U1MA 3QEUA 4FG6D 4Z7VB 5DRNB 3H3KA 3QQ3A 5FYLL 3O6ML 3O3AB 4JFZH 3QXDB 3G6JE 4X9HA 5D5MB 3VXUE 1LVEA 3VCLA 1T4KB 1RJYB 5CS7A 1F90L 2X4OA 5FM5O 3EHBC 1U93B 3KVQA 4LLAA 4OUUB 4PP2B 5FUCE 3L3JB 4HHAA 3A0OA 5IM7A 4P57A 2EIBA 4S2SB 4Q9RL 1NLDH 3GI8H 4UU9B 1BF8A 3BD4A 5A16A 2Z91A 4GBXA 2ZNXA 2H9GA 1FAKT 5L9DL 1J1PH 1N26A 1SJEA 1FFPB 1IZJA 5I1AA 3V4UH 4X9GA 4ZFFB 3DX8B 1IM9B 1ORSB 4LFHD 5T1LD 1FPTL 2BHZA 2IAMC 3HNTH 1B0GB 1LQSR 2YOCA 1KIPA 4GKZA 1KPVA 4JDTH 2OL3A 2HAZA 2OJEB 3TVMB 3ZKXC 2ZUVA 3SDYL 2M26A 3O4OB 3BKMH 4PJFB 5ANMA 1PGRB 4Y0GA 2WBKA 5IUSA 3QUYC 4HK0B 4BSWA 1YEKL 1R5WA 4KI5D 3GSVB 2H45A 3HPJB 4JFYA 3HUJB 3RVWC 1DBJL 3FZUC 4XNYH 5E9DD 5E8NA 4FFVC 2DL9A 2ED9A 1TZIA 1YEDB 1ZT7A 2OP4L 2XTLA 3QPQD 4UB0H 4MXVE 5FDWA 3CC5A 1VCAA 4PJBF 4D8PA 4NHUB 4X4MA 1C5DB 4I5BA 1NL0H 3TBWB 1QFOA 4M03A 1ZVYA 4L8CA 4XBPA 1G7QB 4I77L 1OAYL 2JB6A 4ODWB 3NTCL 1A1OB 3D9AH 4IOFD 3TYGL 1I3RA 1D5MB 4KJPD 5K9JH 3VI3E 4KZDH 4PJXB 3IFOA 3RWGA 4JQVA 2Q76A 2MWCA 5EU6B 3VXSD 1GOHA 3QO0B 3WN5C 4GW4A 4EUPA 4JFQA 2AJVL 3CK0H 3QXTA 1EEZB 6FABL 4HLZG 3ULVF 3IU3B 1WT5C 4IOSD 3TO4C 3CSYB 2DWEB 3LMJH 4X9BA 3O2DA 5ANME 4ZDHA 3VRJB 4G3YH 4DEPC 1LD9B 4ZFOA 2HTLC 3ZLQC 1INQA 1MCOL 1UB6B 4HIXL 3S8WA 4LQ1A 1TQCB 3HAEB 3RVVD 5I18L 1BBJA 1QSFA 4R4ND 1G7PB 4LCWD 2VISA 1NAMB 3MRNA 2NY1B 2WQRA 1NJ9B 2FDBP 2R1YA 3O41B 1P4IL 3QXUA 5HHVL 4XCEB 3QQ4A 1ZGLP 1X5GA 3B3IA 2CDGA 2FD6L 1XZ0A 3BP6B 1FFNB 4X4ME 3N85H 3LV3B 3HS0B 3DUUA 5D4QA 1BM3L 2J2ZA 5EO1B 1YY8A 3DTXB 4KC3B 1I9JL 1I7UA 3SE3A 5L8KB 3OZ9L 1RUPL 1G9MH 4CVXA 4H5SA 3CXHK 4NGHL 4OKDA 1EHAA 5DJZA 1U8IA 5DHYB 5TJWK 1MQ8A 15C8H 2Q87A 2EDTA 4LSQL 3RIAK 1MRCL 1Q9OA 1QUNA 4K2UL 3WDHA 1EH9A 5F7NC 2VH5L 5GZOD 5I2IA 3IYLW 3T0AA 1UQSA 4DZBA 1BQLH 2B4CC 3HKFA 4WDIA 1MSPA 3S9DB 2I27N 1A6TA 1SY6A 5L0QC 1T22B 5L2KA 3BDBA 4R7NB 4UT6H 1DN0A 1QSFE 4G8EA 3MRLA 2CLZA 3FO0L 3ULVH 5EBGA 2PN5A 2WWMC 2EDWA 3T4YB 2H2SD 4HWZA 1GOFA 5HI5C 1RZFH 4RFNC 4EDXA 2FL5A 3BSZH 3HPLA 1JPFB 4X99B 2JF1A 1WCBA 4XBGB 2O5XL 5I1DA 3JV4A 1MNUL 3QUYA 4M7ZC 4Z7WA 3WYRA 1MCWM 2YBRA 4UINH 5LJYH 1HI6B 3QO1A 3UCRA 4PGBA 1VFBB 4TOYL 5CEYA 2EDDA 5FYJH 4L3EA 3RIFF 3WUWG 3ARVA 5D7LD 3LKRB 3ALXA 1HXMB 4PTUA 3T3ME 1EJ6A 1A5FL 1KN4H 1YEHH 2DQCH 5IW3A 4R4BA 1KV3A 5DT1H 1W0VA 4X6DF 1R3JB 1MIEH 4OFVA 3TV3L 2IFFH 4OJFH 3PABB 2AQ1A 5L2KE 3VWKB 1F02I 5GGRA 4P2QA 3KYOA 4K3GA 2LV4A 4LPVA 2OLDA 4LSRL 3WN5A 4XP9L 4LCCB 5T3ZL 1ACYL 4AIZA 4RAUB 2VN4A 1S3KL 3WFBH 3CFKA 3P9LB 4M7LT 5KZCD 5GGVH 2FO4A 3TO4A 1I7TA 1SYSA 1MCLA 2AGJH 2Z8WC 5CSGA 4BQ9A 4FQJH 5EG6C 3QG6B 4Z7WE 4QRUA 1FIGH 2P8MA 1OY3B 1P4LA 2PO6D 4BELD 3F12A 5I73B 2FJHB 2X09A 1D6VL 3TA3A 4NT6B 3IU4H 4L3EE 2P5WD 1ZKAA 2Z31A 4Y4FD 5EOQL 4PYHA 4LMQI 4F33A 5DD1H 2AXFB 2MPAH 2IJ0C 2YPKB 3B9DA 4JHZA 5IHLB 3QWOA 3S37H 4M6MH 3DROA 4NC2B 4KGJA 4OUOA 5M95B 2YUVA 2LE9A 3WDIA 1NMAH 3FQWB 3DX7A 1ZA6B 1INDH 4KMLB 5E6YA 4KKLC 4FQXB 4F80A 5TQ0L 3C5ZD 5E5RB 1LO3H 1LP9A 4P2QE 3QCVL 3PWUB 2NY5C 5DJ0B 2FNBA 4MX7A 5K9KB 1MCEA 3WCYA 4FXKB 5KVGL 4FABH 4ENED 2JJVA 1L7TL 1NGQL 2NY2C 5F3HA 4ZS6C 5T3XD 4P4KB 1E6JL 2XRAH 4GUPA 1UA6L 4X7SH 5AAMA 1N64L 2HJKA 3EYSL 3V8CA 2W38A 1DSFL 3ARFC 3M8OL 3B83A 5IOPB 1N5AB 5D7JC 4NYLB 1PY9A 4X5XB 3BZEA 2WWKT 5ADPL 3FN9A 4K7FB 4BKLA 5HGHA 4EI5B 2JCCB 3JWDL 2YPVH 4YHOH 3P11H 1R0AL 5IW1B 5C0AA 2IPTL 3QZWB 2J7LA 3FMGL 1N6QL 1JTPA 4Z5RB 3ZYJA 4LSPH 4Z78B 2HJLA 2AP2A 4XWOC 3QULA 3KPMA 3BGAA 5CZVL 4IRSA 3TWCH 4JM4H 3HZMB 3UTQB 3F5WA 3HRZA 1JE6A 2PTTB 2DN7A 3QH3B 4P23C 4WHCA 4O2CB 5CLTA 2EYTA 3QXWA 3HZYA 3W5MA 2XFXB 1HHKB 2X2YA 3PF2A 1RZKH 5F7FA 4WFED 1LP9E 3MRPB 2O61A 1NDMB 1KJMB 5F6IB 2CH8A 1AGEB 3P9MA 1GOGA 4J1UB 5BVJB 1X6LA 4OFPA 3SCMC 5J11B 4LSUH 4NKDA 5I76B 4EEEA 3TFKD 4DOHE 2O5YH 4WJ5B 4UTBL 3EYUL 1KN2H 2BXYA 5DD3H 4Y4HC 5DA4A 1CXHA 4I18C 3AXLA 3L3IB 1MVUB 2HWZL 4TUKL 4B53A 3BH9B 4O2EA 4QRRD 3RAJL 5C0AE 4MNGE 1WTGT 2FECI 3U4EA 4JFDD 5IMOA 1FVDB 4PGEB 2CK2A 3S3PA 4OLEA 1C1EL 3CXDH 4NM8H 3ARDC 4NDMB 3KHOA 2ZG2A 4OF8A 5FK9B 1HCVA 3GSRB 4HJJH 5DD6B 5E2WL 3G6JF 5TF1L 1EMTH 2VLRB 2V2TA 4GO6B 5CD5D 1FRGL 4OZFB 4M6OL 4AENB 1A1MB 1CD1B 3V7AG 2AJSH 5IJVA 2M8XA 1KBGH 2HFEA 3I2CL 4IMLB 4HH9B 1JZ4A 1X5JA 5CJOL 4JZJB 1TITA 2ZCHH 1A2YA 4PJGA 1YQVH 1HWHB 3QIBB 2AJUL 4EIGB 2QSVA 4X8XA 2DLTA 4BQ6A 2HFFA 3IT8D 1OTUC 3K8KA 4MDIB 1CDJA 2VZOA 1YEFH 1HH9A 3SPVB 2A1WL 3BEVA 4UIMB 4IJ3B 4PPTA 4OGZA 1JZ5A 2G5BA 1CBVL 1D5XB 3TEUA 2PXYD 3BPNB 5JDSB 5TPWL 4N90E 5D93B 1BIHA 1D5ZB 5IK3A 1GGCL 1I9RH 4NO5B 2QTEA 4KMTL 1F4YL 5J6GB 3IFNL 4Y19A 5FHBL 4ZAKD 3RWDA 5LGHH 5E9DB 3ARGA 4ODXA 3GO1H 3V5KA 4PJ5E 5HHXL 3ARBC 4FQHB 2E27L 3DBXB 4G6ML 3S88H 3W81A 2GSIA 4W68A 4WTZA 4UOW0 3GUTA 4OI9A 5IMMA 4R2GC 4TTDD 4M9PA 4U2ZA 5GRUH 1KYOJ 1Q72L 2KQNA 3ELAT 4DTGL 1H3PL 4PJGE 3G5YB 1FJ1A 4JE4B 1JJUA 1NCCH 1SYVA 1YY9C 3K8LA 4GSDH 4PJ9B 4I3RH 1S78D 4LEXH 4LLUA 4J12A 4KQ4L 5ESAA 3V9FA 5FGCB 1MCCA 1QRNB 3IDYC 3MXWH 3MV11 2V2XA 3VXSB 1UWGL 3LS4L 2EECA 1OTTC 3SO3B 2YXFA 4P23A 1VFOA 1MIML 3RU8H 3G04A 4X4XB 4K23H 2JIXD 4YK4C 1U3JA 3OAZK 4JO4L 4N8VA 4PREB 3H9HA 2FEDC 4M8VA 3VD3A 3UTSB 4WWKC 1MHCA 3I3EA 4Y19E 4JPKL 5DFVD 2AJ3A 1FP5A 1ZVHA 1OARL 2P4AB 4RCAA 4LCWB 1CT8A 3U9PH 5IT2L 2C3VB 1QBLL 3BN3B 3QAZB 3QQNA 4Y4HA 4HQQL 4YGVA 1KXQE 5L6YL 1S7TA 4YHIA 5IBLD 2CUMA 3CFBA 1B88A 1XGPA 1FSKC 3SE4A 3TIDA 1AD0B 2K7PA 3MRDB 4HUUB 5IVNA 4CJ1A 1G6RA 3Q1SL 4IHOA 3OXRA 5DVKA 4U0QB 1NBVH 4BQCA 3IRPX 2SEBB 2CKBA 43C9A 2QADC 3QXAA 2E9WA 1MRFL 3GMNB 3UAJD 5E00B 4XX1E 5I19L 3ULSB 1YMHA 3VI4E 2X10A 3U9UA 4R0LA 4O9HH 4ORZC 3RNKA 4NUGL 5FYJD 5KSUB 4J3VA 3BO8A 4FZ8L 1JIBA 4TVSa 1IFHL 2Z4QB 2NXZD 5FOBB 1T03H 5IGXH 1TJIL 4UV4H 5GS1B 2YRZA 3MV8A 3UC0L 5CJBA 1HZHL 1N2RB 1AGFB 1RUMH 3DXAD 2BNRD 1UM6L 2V6HA 3MLTB 1JZ8A 3H3PL 2YA0A 2PR4L 4GAYA 1QVOA 3IJYA 5DVLA 4EI6A 1TCMA 4Q6IB 1QPPA 4I4WB 4KHTH 5DD5H 5ACLA 1J5OH 4FQQA 3CVHB 3BH8A 4ZQKB 4FQCH 1DQDL 5DJDA 1PYWA 5C0DB 2ORBH 4I1NB 3LS5H 4Y1AD 2A9MH 3ARBA 2ICWI 3PIQA 1P7QA 4HX1A 1FZJA 3O9WC 5D7LB 1HSAB 1T7YA 2W91A 4QGTA 1CIUA 3PL6D 4NQSA 5IR1A 2E6JA 2P8LA 3MREB 2J12B 4EKXA 4HT1L 2FGWL 2PCPB 2B2XL 4GQ9L 2QSCL 4NJ9L 4DKDC 4HMCA 4LAJH 2OZ4A 5JOPD 3W82A 1NFDB 3ARYA 1RIVH 1MJ8L 4PD4J 5DK0B 1UG9A 3DMMB 4L4TD 1EGJA 2EDLA 3VMOA 5J9PB 1NUFA 1BX2A 5E6ZA 5E2UL 2F74B 1VFAA 3DGCR 1FL5A 3MV8E 5IIEA 5T5NF 5GGSY 1HDMA 1MF2L 4IRJC 3A6BL 3FB6A 5C0BA 2AJXH 1U3HD 3ROOA 3ETBF 4KVNL 1NMCC 1YYML 2VLMD 5CKGA 4CJ0A 1S7RA 4Y5XC 5D7KE 4WWKA 4OIIL 4X7DC 4KDTA 1PLGH 1VACB 2R1XA 3CLEL 1UXWA 4J4PC 4YFDB 3DO7B 2RAMA 1R5VA 2PO6B 2PUQT 1YYLH 4Z7WF 1FO0A 3EOAA 1UB5A 2A2QT 2OR9H 2AV1A 2DQDL 1KCUH 2VIRA 5A2LH 2R29L 5IROA 2P5WB 4U3HA 4XPHL 4JAMA 2F8VA 5IV2B 3FN0H 2X4TA 5HYJA 1T1WA 2DMBA 1IBGL 4JDZB 4NNYA 3OKEA 4KAQL 1GJIA 5BO1L 5EU3A 1QFHA 3BX7C 3WUWB 1SM3L 2FBJL 1HYSC 2C1PA 2XZZA 4RGMB 4GW1B 3TT3H 3WSQL 2V17L 4P9HH 3WKML 1H3GA 4N0YH 1E4XH 2QQQA 4OQTA 1DQTA 3IETB 5C7XL 2JK5B 2C7UA 4HWEH 4WO4C 2X4SA 8FABB 3BPLB 2VDPL 1RZ8B 1QQDA 1T21A 2BVEA 1CGSL 3BUYB 1RIUL 4KK8D 3FQRB 2X1OA 1E28A 4RWYL 3CSBA 1ZSDA 5C0BE 5T5FL 4QRTB 3MYJA 3J8F7 3MRKB 4PG9B 3VD7A 4XZUA 5GIRA 1F90H 1KEGL 3CFJA 2FR4A 1BD2A 4NQDD 3EFFB 5MHSD 5C92A 2JJTA 1ITCA 2VXVL 3G6DH 4N0CC 3DVNB 1ZLUK 1ZGLM 1J86A 1XEDA 2IGFH 4OCRL 1T2JA 1MAJA 5HYJE 3K2UH 3HZVA 4I0PD 4RDQF 2OXGA 5KAQF 4NQCA 3FFCD 2VDLH 3PHOB 2LU4A 1T5XA 2A74B 4OF5A 3BWAB 3VRLE 3BD3A 3TPUB 4KK5D 4MVBD 4DCQA 1BLNB 4JKPL 3PWNB 4XVTL 4LNRB 1XCTA 2QKIB 3SDYH 2OR8A 4Z0XA 1BQHG 4FQIH 2Q8BH 5E08H 3GM8A 1FZKA 3MYZA 2VLKD 3AS0A 4XHJC 4ONOA 3O9WA 1SVCP 4GRMA 4CKVX 1YC8A 1B0WA 1BFVH 4N5EC 3RWIB 1FYTA 3S36L 2E9BA 4JZOB 4FTVD 2R4RH 1BD2E 1LEGA 4ZUWB 3KLAA 4U1LB 5EBMA 4QRRB 2E7MA 5FYKD 2YA2A 3HE6D 4TNVF 5DHXB 5FCUH 1IEAA 2A6KB 2HN7B 4OD2A 1KJ2H 1CTOA 4MJ2A 4M1CD 5HSFA 5FO7A 4P3WA 4YDKH 5LXGL 5HGAB 1CGYA 3TYGH 5D9SB 5L2JA 4PBVC 1JNHB 2VL5A 1FH5H 3TBTB 2BC4B 3P3YA 4NBZB 5KVFL 1F4HA 4N0FB 4NQCE 5FM8A 3MROB 4F15C 2F8XC 4LU5H 3OAYH 5GS2H 2HLFD 1O7SA 3EYQD 3HMXL 1HEZA 4F7PA 1K4CB 5I8EB 3MV01 3V52L 2IPKB 5DS8A 2YD1A 1T7VA 3FO2A 4WI7A 2HMID 3EFDL 1MCOH 1FYTE 3FFDA 3RJQB 5EC1A 4PGCA 1CL7H 3NACL 3Q5TA 2BVQB 3CDFA 2K1MA 5I18H 3BIKB 4PJ8D 4MXWL 3VXUD 4WTXA 3VFMA 2P5EA 3KJ4C 1A6UL 3LKPB 4NN5C 1P4IH 2X1PA 1GXEA 2CUIA 4FHBD 4XXCC 2ZZUT 4GW5A 1LO5B 5D1ZD 1CK0H 2V2WA 2NR6C 2BOCA 4HIEA 2AEPH 1MLCA 1G0XA 2QQNH 4WO4A 1P4BH 1ZWIA 1T5WA 4WI6A 1BM3H 4ZTOL 4ELKB 5DJ8A 4OLUH 1GC1L 4HAFA 3DSFH 1AIFB 3GIZH 1RUPH 4XVJL 5I6XB 1JTTA 4YQXL 4XPGL 3FT3B 4FQ2H 2MKWA 4LDOB 2WINA 2MHAA 3WHXB 2ZNWA 5AZ2H 2ICWB 4NRYB 4K2UH 2VE6B 4N8PA 4OGYH 3BFOA 2VH5H 4L9DA 3KYNA 3S5LA 4YWGL 3VXPB 1L6ZA 5DFTA 3BGMB 4ONHA 4NSKB 4PJGF 4HBCH 2NX5A 3ISWA 4LF3A 1DQJA 3ET9F 4G42B 3TIEB 4DVRL 1V7NL 4WHTA 2P5EE 1CZ8L 2R69H 4ZUSB 1ADQA 2OL3L 1XIWB 1BEYL 2JIXB 4RSVA 5DVOA 1YN6B 1U92B 1QR1A 4LAQL 5HGDA 3U46B 1VENA 2WIMA 4BSJA 4NKOB 2O5XH 4PJDF 5KSVA 1E4JA 4GBXD 3BHBB 1S7XA 3FTGA 2C3WA 2XXCB 4KK9C 4CN4A 1JPGB 3LQAL 2NY7L 2HJFA 5DMKB 4G7VH 4EUPG 5IEKB 3MCG1 3KPLB 3AC0A 2GK0A 2BERA 4TOYH 1B0RB 1GIGH 5D6CA 1ZE3C 3WEXA 1BAFL 4UIKL 4DAGL 1JZ6A 1HHJA 3EDKA 5JZ7D 1V5JA 3KG5A 5HHNB 4M02A 1A5FH 3FQUA 2R2BA 2W65B 5H37H 1U8MB 2DTMH 4NZJA 1HE7A 5EC2B 2YWZA 4KQ3L 2NX5E 1IAKA 2HKHL 4OGXL 2HRLA 4P2OA 5I75B 1RPQA 3CSPA 3C8KA 3D1MC 3WNPA 3MV7A 4ONGL 1M1SA 4XP9H 4GRLA 3I3DA 5T3ZH 4RNRB 3O2DL 1S3KH 3KPQA 1WQVT 3WS6C 5IQ9B 2ADJB 4ZFOL 4QT5B 4DGYH 1OLZA 2DS4A 5IFAH 3VI4F 3TH2T 5JHDE 4XC3L 1M6OB 4BFEA 4RGNC 2NXZB 3CPLA 2FATL 3T77B 2O26U 2R2EB 3WS3B 1JK8A 2AXGB 4G9DA 1QOKA 4IEFB 4S0SD 2BNRB 3DXAB 1BJMA 1D6VH 2EH8L 1S7VA 4L9LA 1ZGLB 5CGYD 3N1GC 5JQ6L 3VXRB 2DBLL 4JJ5B 1RUQH 1DUYB 3NBNA 3PWVA 4J3SA 4K71C 1YPZF 4JEGB 3VG0L 3GMMA 1GZQA 4GKNB 1N0XH 2W59A 5E6IA 3TNMA 1F58L 5T5NG 1I9IL 5JUEL 2WBJA 1JHTA 3WFHB 4QTHA 4MQ7A 5DRWB 2XY2A 4P99A 4BA8A 2XWBB 4PB0L 5DJXB 3X3FH 2ZP0T 3E1F1 2BVUA 2Q1EA 1L7IL 1JGUH 5IF0A 1QSFD 3D2UB 3T2QA 5KVGH 2OTWA 5L88H 5E8PB 3MLXL 2R1WA 3SKJL 1IAOA 3SKMB 1E6JH 4D0DA 1UA6H 4M1GH 4FFZL 3B9VA 1Q9WA 3U4BH 2GW5A 3DARA 4P2RA 1U8KA 1NC2A 1AP2A 1KIRB 1MOEA 5ADPH 4C56B 4HGMA 4L8DB 4F58H 5EA0L 3PV6B 2J1KA 5HYIA 3VE0A 1I4FB 1JF5A 2D4FA 3OX8A 4G7YH 4OGAC 3DGGA 5IVXF 1S7QB 4OLZL 2KQMA 1E4KA 4YLQT 2Z93B 3HNVH 2FO1A 5BW7C 4JM2C 3Q3GB 5DI8A 3DHMA 3EOYG 1U3HB 5IMKB 5CZVH 5IBTH 3V0AC 4MJ5A 4AZ8A 1NGPH 3D0VB 3CFCL 1AGCA 1RMFL 1F42A 4X6DB 2YR3A 4LLVA 4HGWB 3B2VL 4XP5H 3U36B 1XCQB 1BMGA 4U7SA 3IJHA 5MP6L 5E8OA 4IOIA 3PGDB 3SY0A 5L2KD 4NKQB 4RQQA 1OM3L 4JVUA 3AFLA 4TQEH 4XPTH 5EZOL 2PTVA 1KLFA 2L0DA 4I48B 2QHLA 3BPCA 4UTBH 3EYUH 3T4AA 1UT9A 4MQXD 2I25N 2VDRL 4P2RE 5FM4A 2R0KL 1FL6A 4G9FB 3C6SA 1QR4A 1SEQH 1UJ3A 4ZUUB 1R3KA 3QUYD 1WITA 4TUKH 5HGBA 2CKBH 1B4RA 5IW6B 1B4JL 5ELIA 2XY1A 5J1SC 3FZUD 3GJFB 2IH3A 4JY4B 4RDQG 5EUKB 1KB9J 1T7WA 4XCYA 4NRXA 3LEYH 3KYAA 5C2BH 4Z8FL 2WBWB 1RZJC 2YC1B 7FABH 2Q3ZA 3UJIL 4L3ED 5F44A 5E2WH 1J87A 1AXTH 1A6WL 1XH3B 4HEME 4NQDB 2XPGA 3HB3D 4GQPH 3MRHB 5CBEB 5KN5B 3ESUF 3FB5B 3R06B 3OG4B 3G5XA 1AQDA 1Q9KB 1CFNA 3I2CH 3V6FB 1IARB 5I30L 1F4XL 2AQ2A 5F9OL 4JQXA 5CJOH 4HJ0C 1JNLL 3SDCA 4P2QD 5FUZH 1EFXA 3WIIH 1IGJB 4I0PB 4PS4L 1DVFA 3F7VB 5JXEA 1GPOL 3O8XB 3RFZC 3OBAA 5IG7B 3FFCB 3F58L 4I8DA 1CCZA 4XB8A 4J2XA 3T2PA 3MLYL 1PBYA 4UOJA 3QA3A 3RKPA 3TO4D 2EDYA 3UPRB 4RRPA 4MAYC 4ZOBA 3SDDC 2HTLD 3VRLF 5KVEH 1Z3GL 1BZQK 4HG4K 2VLKB 4XVUC 1GGCH 3B5GA 4KMTH 5KG9A 3IFNH 3T09A 2IALB 3AU1A 2Q6WA 1OOAA 5FHBH 3G08B 1EHLL 3TA3D 1ES0A 1UFUA 1NUNB 1KC5H 4PRDB 4AM0A 1ZT4A 4Y4KA 1MCHA 4FTVB 2B4CL 1OW0C 2B1HL 1FORH 2NY6B 2Z31D 3M17A 3OKKB 4P0DA 3RX5A 3QNYA 4M5ZH 4MDJB 4KK6D 4YXHL 5HHXH 2E27H 4RAVB 1BOGA 1JWSB 2VZ1A 4YDIL 1FFOA 3PP4L 1QLEH 3WHE1 5AYQA 4FZEL 5CJ5A 5ETUA 2EYRA 3KR3L 4HUKB 4BJLA 5CSZB 1E4XI 3EOBA 1ZT1A 3KGRA 2VITB 5BW7A 4RBPH 4A6YA 4JM2A 3BZ4B 1RIHH 1YQ2A 3C2AL 4KQ4H 1T3FB 1ZLSL 4H0HB 1CGTA 3IDMB 2QSQA 4XMLL 1MRDL 3B9EA 3LS4H 5J57B 2ICEA 5GGSA 3S35L 3R4DA 5JW4R 1CGUA 4LLQB 1KTDB 3TYFB 1MIMH 3TVMC 1JGLH 1I8LA 1LO2L 3O4OC 1JWUB 4LARL 3PDOB 4JO4H 2Z8SA 2XV6B 4LIQE 5L8LB 3F7YB 5H37G 4DK6A 2H26A 5C0AD 2XWTA 3GJEB 5IESH 4J7RA 1I8IA 4JPKH 2VDML 3FL7A 4U1KB 3TC9A 1XF3B 1BQHB 3MRCA 1OARH 3SE9H 1P7KB 3G6JB 4ZG1A 1AKJB 1T1ZA 1UENA 5F1KC 5HI5D 5IT2H 4IRSD 1QYGL 3HG1A 2QQKH 4KKCC 3FQNA 1QBLH 4BH8A 4U31A 5FO9B 3D0LB 3IFPB 5D70L 4EBQH 4HQQH 5L6YH 4WY7L 1LEIA 5D1ZB 2V5YA 1ZS8B 1WIUA 4RMWA 2G9HA 4LPWA 5E8EA 2VDNL 4JPWL 1YNKL 5CEXA 4S1DC 1FNFA 1AR1C 3CMOL 1PVHA 4YXLH 3C08H 3N1QC 2CLRB 1J10A 3G6AB 4XP4H 5K59E 1GZPB 3T8XB 4CDGC 1MRFH 5I19H 4LLYB 2H2PC 2WANA 3SQOH 4HUXB 3EGSB 4U49A 3QFDA 1JGEA 4N90D 4XXDA 4U1MB 2X44D 1NANH 3QEUB 4NM4L 5E99L 3DOSA 1JWMA 4G6JL 4XCNA 3QQ3B 4OD1L 5JOFB 1TQCC 2PYFA 1B3JA 2YKLL 3VFVA 2BNUA 5JIIA 2ZSVA 3MBXL 4XAKE 4XT1C 5C0FA 2NY1C 3HG1E 2X4OB 4X4YA 2HFGL 3N1PC 1EFQA 4XVSH 4HHAB 1HZHH 1N5YL 3RKDD 1UM6H 5IM7B 2VXTH 1A4JA 4XPBH 5B4MC 3SDDA 3K0WA 3QNZA 2NY5L 2OCFD 1SBBA 1ZTXH 5A16B 2X4PA 1JYNA 2H9GB 3O3AA 5CEZL 1IAIH 1SJEB 1T4KA 4I9WE 4NHCH 4YHNB 1DQDH 3R1GL 4HMDA 1HINH 1DBAL 1CL7I 5FXCH 3INUL 3Q6GH 4J3WA 1KIPB 1J0YA 4WHYH 4N8VG 4GKZB 1KPVB 3K4DA 1WTLA 2EDBA 4TTGA 4JFHE 3TBYA 3N1MC 4HT1H 4KTEH 2FGWH 2B2XH 1FFPA 4GQ9H 5ANMB 2QSCH 3GEWB 1OCWL 4LQFL 4BSWB 1IM9A 3SGJA 2MTPA 1R5WB 4Y19D 1MJ8H 3NGBB 5E8NB 3ARGD 2NY2D 4FP8L 3GBNL 3SKUD 1CE1L 2X41A 3MGTB 1C5CL 2J8UA 4N0UB 3ULUF 2L7JA 2OJEA 1YDPA 1MF2H 4ISVB 1CE6A 3A6BH 5B38G 1SJXA 2N7BA 1Q1JH 3CC5B 1BJ1J 3Q6FB 3RIFK 4D8PB 1T20A 1YYMH 3ZL4H 4I5BB 1LGVA 4N0RA 1FDLL 3DI3B 4OIIH 3GSVA 4Q74A 2JB6B 4M7LL 1CDCA 3BRFA 1NUDA 5GSRB 1I3RB 3MOBH 4W4OC 4LDEB 3GNML 3STLA 3RWGB 2Q76B 4L29A 5TDNB 2BSTA 4FQPA 4L1HA 2R29H 4M43L 4U6VL 3OXSA 4XPHH 4GW4B 4EUPB 4P23D 4U6XA 4K8RH 4K94H 1C5DA 4J3UA 2NPLX 3UJTL 1IBGH 3NIGE 3UROR 2BMKB 5JQHC 1G7QA 1OSPL 4ODWA 3UX9B 5DR5L 1G6RL 4ZDHB 2XTJE 4Y5VA 2VXSH 2X9YA 5FUOL 4OCLC 4NJAL 3VWKC 4Z9KB 4HZLA 1INQB 2Y36L 4JDVA 3WSQH 4G8FA 2V17H 4U33A 5EU6A 3KPSA 1EERB 4JCMA 3QO0A 2XQYG 5EUOA 1QSFB 2J8UE 4LCCC 2VDPH 1T7ZA 5ICYB 1D9KA 1CGSH 3OV6A 3MRNB 1RIUH 2CLVA 4JO1L 5F89A 2R1YB 4Y4HD 3GJFK 4RWYH 3QISA 3CSYA 2DWEA 3B3IB 2J3SA 4K3DL 4XGZA 5I15H 3FQTA 2V7NA 1AJ7L 4JFEB 3JSSA 1KEGH 2BVOA 3NH7L 3DUUB 5HHPA 2E9JA 3QUKB 3RJDA 3HAEA 1YY8B 4R90H 3ULUH 4CRPA 5I73C 1I7UB 3WNLA 5BJTA 4OIAA 1F3JA 1UACH 3LEXB 4MMXC 4ZUTA 4DKAA 4M6AA 1T66C 5DJZB 5HDBE 2KDGA 1U8IB 4XCEA 3MTRA 1VESA 3FAXA 4OCRH 4XPFL 1FFNA 4OZIA 4M7KL 3LV3A 4FQLH 3CMGA 4JZNA 5TF0A 3HFML 2DAVA 4EDWH 5LQBL 2H32H 1UQSB 4X6EA 4ODTL 4WDIB 4CN1A 4FQXC 5CIPA 1A6TB 1TPXB 1OAZL 4XVTH 4JKPH 5EU6E 3GSQA 3LSOA 5L2KB 4NWUH 3KPSE 3M07A 2FBOJ 5EUOE 1DN0B 5LG1A 2E7LC 4G8EB 3ZO0A 3MRLB 2CLZB 1CLYL 1IQWH 3VGFA 3BT2L 5EU4B 4P4KC 3MV8D 2DWDA 3RY4A 5DJCA 3ZT5A 1LDSA 4EDXB 4F7EA 2FL5B 3IKCA 2ZUWA 3HPLB 1TZGL 2KL6A 2OZ4L 1HILA 2EXWC 1WCBB 1TTUA 4APQA 5I1DB 5D96B 2IBGA 3JV4B 1MFAH 4EI5C 4DGVL 1T22A 5D7KD 1WF5A 4Z7WB 2YD3A 4R7NA 1DQQA 1KG0B 1RULH 4PFEA 3C60A 3ES6A 5J6HA 3X3GH 3BKCH 3QO1B 4PGBB 2GJZB 3NCMA 4M8QB 3WIHL 2EE3A 2IF7A 5CEYB 4EOWH 3CLFL 2JLLA 5LXGH 3D18B 3ARBD 4DN3L 4OZIE 1JPFA 4L3EB 4M48L 3BN9C 1MFDH 1P7QD 3WLWD 2K9UA 1GGBL 3A67L 3LCYA 3GSNA 1CLOH 4O51B 3BP7A 3DYPA 2VOTA 4PTUB 5KVFH 4R4BB 1AY1L 4MMZC 3IFLH 5DQJA 1N4XH 1RJLA 1W0VB 4IS6A 5T1DL 5SX5H 1A02N 3HMXH 1JL8A 1YY9D 1ZHKB 2MQ3A 3ARUA 3QCTL 3V52H 1TQBB 5F6IC 2VDOL 5HY9A 5FA3A 4PR5A 3QCUL 5GGRB 4P2QB 4PJHF 3RGVA 3LKRA 1QTYT 5J11C 5GJTL 1EAPB 4POZC 2Q8AL 3S6CA 1KJ2B 1UKTA 4PRIA 3NCBB 3CFKB 3NACH 5I1HH 5C0BD 1MCPL 2FO4B 2XIDA 4YHLL 2DMCA 5I16A 1SYSB 4JHWH 2WIIB 1A6UH 4XCCL 2FEDD 4WWKD 5JO5A 4OQTL 4D3CL 2CK0L 2P8MB 1P4LB 3HI5H 3O4LA 1LK3L 1GGTA 3F12B 4QLRA 4C83A 4LCCA 5HYSA 1OWRM 3RTQA 3T3PE 3LOWA 3TA3B 4ZFGL 3N9GH 4ZTOH 1EZVX 3MLZH 1GC1H 3MODL 1RUAL 4XMKH 4RAHA 3DJ9A 2Z31B 4F33B 2DQIL 5HYJD 4YQXH 4XPGH 2IANB 4HF5H 3QWOB 4ZD3L 5C0IB 1T83C 5I8KH 3B9AA 3ZE0E 4IDJL 4MCYA 1JFQL 3QDHA 2I07B 3DX7B 3MJ8B 4S1SH 3FKUS 5DK3A 3P0VL 4JZJC 4GAJH 4WW2F 1VDGA 3QIBC 2RIKA 1IKNA 2EDJA 5FFLA 4ZO6A 4MX7B 1FBIL 2AXFA 3WV0A 25C8L 1CXEA 2YPLB 2QR0A 4RFOH 5DC9B 5BV7B 2QADD 4DQOH 4IJ3C 4PRIE 4GUPB 3JTTB 4DOHB 1H15A 4K3EL 1KLUA 1V7NH 3BKYH 4X9FA 1CZ8H 1U41A 4WHYG 3BPNC 5D93C 1BEYH 5CILL 3MXVH 3RP1A 4FQXA 2X7LB 1BD2D 4MYWB 3C09B 4BKLB 5ENWA 4TN9A 1K8IA 3PWUA 2UZXB 5DJ0A 1A6PA 2BJML 5K9KA 1DFBL 3O4LE 1TJGH 5JW3L 4KI5C 1NAKL 3R8QA 1FCGA 3GKZA 2QEJA 1MJ7L 2KPNA 5SWZA 3S34L 3CGTA 1G7HA 2HJLB 4NN6B 4P4KA 5EFIB 3BYYA 3QPQC 3KJ6L 3KPMB 3QULB 2IG2L 3LQAH 3REVA 2NY7H 4IRSB 5IOPA 3F5WB 5EO0A 4NYLA 3HRZB 4P5KA 4U1JA 4YUEL 1CVSC 2EYTB 4R8WL 4NQCD 5IW1A 5JW4Q 4UIKH 3HZYB 4DAGH 4KMQA 3G9AB 1F8TH 2QLVB 4PLJD 4YZFE 4JG0H 4Q6YA 1GHFL 3LKQA 4PJ9C 1BHGA 2DKMA 4A2LA 2DIAA 3UTQA 3P9MB 4KQ3H 3O9WD 3V4VL 4NKDB 3NA4A 3SO3C 2EIZA 1FYTD 4O2CA 1PEZA 5C86A 2HH0L 4KI1A 2DKUA 1IC7L 2AK1L 2XFXA 1HHKA 4UZGA 5IQ7H 4X80L 3CFIC 5K59F 1WBYB 5D71L 2DBJA 4O2EB 3N50A 1O5DT 1MFEL 4W81A 2GSGA 5SWZE 4J1UA 4LSVL 1DP0A 5IMOB 5BVJA 1IGIH 5I76A 4XC3H 4R4NC