2Q1EA

Altered dimer interface decreases stability in an amyloidogenic kappa1 bence jones protein.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
ATDIQMTQSPSSLSASVGDRVTITCQASQDINNYLIWYQQKPGQAPKLLIYDASTLETGVPSRFSGSGSGTEFTFTISSLQPEDLATYHCQQYDNLPYTFGQGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloidogenic immunoglobulin light chain protein AL-09
publication title Altered dimer interface decreases stability in an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 26
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q1eA00
1JMZA 4K94L 1RUPL 5LGHL 3ARGD 3PJSA 4DOHE 3C5ZA 1AHWB 2AJYL 4J6RH 5F88B 5F7KC 5IBLC 4NM8H 1JPTH 2YKLH 5JORA 3IF1B 1OGTA 4KMTH 4NO2A 2EC9U 1HH9B 2LQRA 1OGAD 1I8KB 1AQDB 3L3GB 1NUDA 5SWSE 1G7JA 2DLHA 2CR3A 3TN0D 3BP7B 1BZ7B 1ZOXA 1FNEB 4XMPL 5EUOA 1BIHA 3SGEI 2HVJB 1CCZA 5CJ5A 1MFDH 3L3IA 4NKIH 5EU6A 3BYYA 1IAKA 1QACA 3GSRB 3W11D 1YJDC 3EOAA 4Y5XA 4YUEL 3QIWC 2F54A 3BVNA 3V0WH 2KL6A 3DHMA 1UVQB 4P23D 4DAGL 3CFBA 4J3UA 4IHOA 1PAMA 4X4YB 1BFOB 1JMXA 1BGXH 4ODVH 4GW1A 5DJXB 3S36X 3HZVB 3IU3B 3RWDA 3BQUB 1KULA 4YDIH 1TJIL 1AXSA 1FAIH 5TJWK 1I1AA 5C9JA 4PIRF 3E6FB 1BF8A 1DQDL 4MQXD 5K59F 4P5TD 4WWKC 1CK0L 4NQCD 1XCQA 2Q7YB 4Z7NF 4QO1A 1XF3B 2MQCA 3TJHC 5L6YL 4WFFE 1J1OL 1MAMH 3I3BA 3REVA 5JIPA 1OAZH 4TVPD 3LPWA 1ZVSA 3KPRE 4LRNH 5GRZA 3W5NA 2NX5A 1RIHL 2ERJC 2CK2A 4OLUL 4M7JH 4C56A 3BHBA 1CLYH 2VH5H 4LSRH 5JPMB 1P7KB 2GTWA 5F71A 4KKCD 2VZSA 1LP9F 1I7TA 2ICWJ 4HH9A 1IEAB 5D7JA 3I84A 5HGDB 5IB2B 1Y6NR 1JTPA 4ALAL 4WHTB 1IC7H 4NNPH 3TO4C 3W81A 3MJ9L 4NZJA 5FK9A 1ZTXL 4JANA 4KVCL 3MA7A 4HX1A 4W4OA 1A3RH 1BOGA 3F12A 2DTML 2F19L 2XA8L 5IIEB 4HBCL 1RPQA 1AQKH 3PJSB 4CDHA 4MNGE 3C5ZB 4AEFA 2PXYC 4LIQL 1B2WH 5IVXA 4QCIA 2ARJA 1K5NB 4M1GL 4GAGL 5HHPA 5DVOA 1NLBH 1T1WA 1U41A 1II4E 5D7KE 5JORB 1OGTB 4NO2B 2DQCH 4Z95H 5I30L 2OXHA 1L7TL 4RX4D 1G7JB 1WWWX 1EGJH 3LKSA 5EUOB 4E41D 4Y4HA 1OSPL 3L3IB 2WP3O 5F1KC 5EU6B 2W9EH 2DLTA 1IAKB 4WFGD 5BW7C 5EZOH 4Y5XB 1CFVL 2F54B 3BVNB 5E8DL 1FLRL 2HRPL 3HI6H 4RWYH 3CFBB 1OVZA 4IHOB 4GW1B 1IGTA 3RWDB 2HRLA 5I74B 4LP5A 1AXSB 3O2VL 5BO1L 3B5TA 1AY1L 1FNLA 1I1AB 1N8ZA 1TENA 4LCWD 5C9JB 1FSKC 3MV7A 1KN4H 3C6LA 1XCQB 3UAJC 4KGJA 3QWRD 3ISWA 3WO3B 2AABH 2XZAH 1P6FA 1DQTA 3Q1SH 5E99L 3BSZL 4GSDL 5F72S 2W59A 2KZWA 3REVB 3O6MH 4DEPC 3QA3A 3KPLA 4N0YH 2OZ4A 3S88L 3TA3D 1ZVSB 2NX5B 3O4LA 2HFFA 5L9DH 1SEQL 3BHBB 3E2HC 1IZJA 4C56B 4U0QB 4I1NB 2GTWB 2XKUA 3O8XD 2VC2H 4UAOC 2J4WL 1JRHI 3HZYA 4O9HH 3ULUH 5KS9E 4ZO7A 1I7TB 4XVSH 4HH9B 5D7JB 1QBLH 3JWOH 1CDYA 1QFOA 4PJDF 3VDBA 2NY1D 1RIVL 2P5EA 5FK9B 5T3XD 4R97C 3HMXH 1EVUA 2HVKA 1QG3A 2Z92A 4JANB 1ZLWK 1C5DA 1ND0A 3MA7B 4M4RA 4HX1B 4S0SD 4PLKD 4UV4H 3X3GL 1X6NA 3WNNA 1BOGB 3F12B 3GSVA 3QIUC 3NCFB 3VRIA 3UPCA 1SM3H 1UZ6E 1ORQA 5JR1L 1I9JL 1MFBH 4V2BA 3O4OC 4KRLB 3MRDA 4QCIB 3PGDA 2ARJB 3P9LA 4MA1C 1E6JH 5GS0C 5HHPB 2CRYA 1LNUA 1T1WB 4NZTH 4XXDA 4Y16D 5EZIH 4GT7A 1G7IA 1TETH 4OQTL 4R4FL 1YY9C 4C55A 1BQHG 1PEZA 4FFVD 1D3CA 3LKSB 2O5ZL 4Y4HB 1CGYA 2I27N 5KVEH 2YD9A 4PTUA 1RZJH 1RI8A 3VXMA 2DJSA 4JLRA 1TQCC 2E7LC 2B1AL 2J5LB 1IGIL 4G9FE 4EOWH 1OY3B 5KSVA 3WIHH 4L3AA 4K2UL 5JZ7D 1CD1B 1IGTB 1GIGH 3BJ91 2I9LB 3ESUF 2ZNXA 1S7UA 3A6CH 1MCJA 1LDSA 1N8ZB 5C07D 4A2LA 4Z7VF 3MV7B 3C6LB 4CADA 5GQBA 3LN9A 4DKFL 3WXVH 3O11A 4P3CH 5HI3D 3A67L 3LAFA 3K4ZA 5L7XL 2NY5L 4O00A 4KQ3H 3QA3B 1F97A 3KPLB 2PW1A 4EUPA 2HFFB 2VQTA 1P4BH 2ZUXA 4JFED 1P9MC 3EO1A 4XVTH 3Q2CA 3JVGA 1S9VA 3N1PC 4UOW1 3O9WA 1KOAA 3HZYB 4LU5L 4F15B 5E2UL 2JELL 1U91A 3H8NA 3FONA 3MV8E 2P5EB 2QJDA 1FGNH 1ZT1A 2VN7A 4KRPB 2HVKB 5E2WH 2Z92B 12E8H 1ND0B 1C5DB 1Q9KA 4MDIA 5IJVA 5C3TA 5KG9A 2V5YA 5HGAA 3QPXL 3WFBL 3GSVB 4OLZL 4A6YL 3CLEL 3NCJH 4KK9C 3VRIB 4G6FB 4WV1A 1UYWL 5D1ZA 3KLSA 3GSNH 5JIHA 3MRDB 3PGDB 4GRLC 3P9LB 4ODSL 5CKAA 1LNUB 4UUJA 4XXDB 5ICXA 4RSVA 4YHKH 1L0XA 2A0LD 4S11A 1G7IB 3TIDA 4Z7UE 4X9IA 3HAEG 3T4YA 4FFYH 1BBDH 3QCVH 4JGMA 3SE4A 3GJFK 4KMLB 4PTUB 3V4PL 3DYMA 1VESA 5E5UB 5JQHC 4JGUA 5HBBA 3VXMB 5KJRL 1MNUH 4JLRB 2VTFA 5EOQL 4UIKH 5D7SH 1KXQE 2FBJH 5KSVB 4JN1H 3MLVH 2N7BA 3THML 3IFNL 3H42H 2EDDA 1A47A 5DT1H 1S7UB 4HSQA 3U4AA 4PRNA 2DOCA 2YN5A 4PJ8C 4EI5C 2DQIH 4YHYC 3LHPH 1IRAY 4QEGA 3HG1A 4RQQA 4ZFOL 4CADB 3QB7C 5IP4A 4CVUA 3O11B 2NZIA 5SX5H 5I15L 1WITA 4JG1L 3ZT5A 5EIQA 2C4FT 1EJOL 2IEPA 1L9MA 2PW1B 4EUPB 4ERSH 1UENA 3EO1B 4PR5A 2VOTA 1LDPH 1S9VB 4KJYA 3O9WB 1I9RH 4CMHB 5IW6A 4K7FA 1C5CH 1D5XA 4JG0H 5KSAA 4ZNEA 3SDAC 5TQ0H 5E6IC 1U91B 3ABZA 4KKAD 3FONB 2NQCA 4XNXL 3GHBL 1JZ3A 1ZT1B 5CIPH 1Q9KB 1OB1A 3FQXA 3CNKA 2NXZD 1WFOA 4MDIB 5IJVB 5KG9B 2X4NA 3WFEH 2A73A 3UZQA 5HGAB 4EN3D 5HHQA 2EEAA 2Y4SA 5K9JL 2DQHL 5D1ZB 4UOW0 2FZ3A 4WUUD 5HHOD 5GGVH 4NRZA 4I4WA 1ZLUK 4WW2C 1LO5A 5EWIH 3QG7H 3P0VH 4UUJB 5DJAA 3HNSH 5ICXB 3ZT7A 3TIDB 4W6YB 3SGDH 3GMNB 4OCLC 4QHNA 3GO1H 3TC9A 2ZOLA 2APFA 2OL3A 3T4YB 5C9KA 1CDBA 4JY4A 2D7MA 5BRZE 4RMQA 2MQ0A 3ARFD 4HKJA 4YHML 4N90D 2D31A 3VD7A 3UTPD 3UDWC 1E0OB 3ULVD 5BVPL 3MRCA 4CN1A 1HHIA 1JGLH 1VEPA 2BNQE 1SY6H 4OIIL 4H1LH 1BQHA 4HJGA 1KLUA 4NM4L 3BZFA 3FHAA 4LCUA 4PRNB 1UA6H 2NY6C 3BZEA 2A9NL 3D0VA 3HG1B 5JA8B 4RQQB 5C70A 3VXSD 2IH1A 3S3JA 4GS7B 5CEZD 2Q7NA 2HFGH 5EO1A 4KGLA 3QUXA 1UM6H 4K3EH 1MHCA 5F7UA 4LGRB 5L2KA 4BFBD 1DQJA 4MXWH 4X6FA 4YC2C 5SWZA 3LMJH 4PR5B 5T3XH 5D7LD 4KJYB 1J86A 1NGWA 5IW6B 3U83A 4K7FB 3VFUA 3GMMB 4G7YL 1D5XB 1RUMH 3C09C 3ZHKA 5C1MB 1HXYA 5DVLA 5LGKA 2VUOA 1F3JA 2BNRD 2ESVD 2J8HA 3HUJE 5DXWA 2W0FB 1RUAL 3G08A 3MJ7A 3U46A 1A4JA 2V5TA 1OB1B 3FQXB 3VWKD 3MLPA 4KK8C 2X4NB 4TTDD 4XVUC 5BQ7A 2FO1A 4JFYA 4HUMB 3UEZA 5HHQB 1GGIL 4I0CC 4QTIH 1JBJA 1WT5C 3QWOA 4TUKH 2R39A 3IGAA 1B3JA 1HWGB 2FZ3B 4JPWL 4I4WB 4NRZB 1P4IL 1QKZH 3RKDC 1LO5B 5F1SA 5DJAB 1NCDL 1FV1A 2QSQA 4LLVA 3ZKQD 5FUZL 1F3DH 2FBOJ 1ES0B 3MUJA 2IBBA 4R3SB 2QHLA 3SCMD 1I85A 1VCAA 5JMOC 3HC4H 2ZOLB 3NIFE 2OL3B 2V5RA 4FQQA 4L8BA 1U93A 4JY4B 1TJGL 3ECBA 3EJZC 4YXLL 2PF6A 4HKJB 4P59L 2D31B 1P7QD 2ZJSH 4H20H 2B4CH 1DE4A 2BFVL 3ELAT 3NCMA 1HQRA 3G6JE 4WHCA 1HHIB 2QLVB 3K1DA 3BRGC 1CDIA 1KN2H 1S7SA 3WEXA 3GMPA 4PJGA 3VFMA 1BQHB 4HJGB 5EBWA 5GIRA 4JM2A 1KLUB 4J6RL 2R1WA 1EXUA 3KWWA 1H3VA 4LCUB 2F53D 1JPTL 2YKLL 4JFDD 3BZEB 4KMTL 3MOAH 2AXFA 3D0VB 4OZIE 4P46C 2IH1B 5F97E 7CGTA 2J8UE 5I0DA 3DBXA 2UWEF 1F3RB 5EO1B 3QUXB 5AYUH 1MFDL 1MHCB 4NKIL 3RZCC 4M00A 5L2KB 2BSED 3ZZ1A 3BRDA 2CD0A 4X6FB 5SWZB 1P5UA 4PRPD 3V0WL 1C5BH 3RQ3A 1LWRA 2VXUH 1NGWB 1W0WA 1TLKA 2OM5A 3VFUB 3RY5A 1BGXL 4ODVL 3CMGA 1HXYB 4ODHH 3DVGA 3HE6C 1MCSA 4YDIL 4Z78A 1F3JB 3M8OH 1FAIL 3G08B 3MJ7B 5DVNA 3U46B 1A4JB 4RFOH 2NTSP 3WJLA 1OTSD 4L3CA 3OZ9H 3TBVA 3K8LA 5CEXA 4P57A 4V1DD 5BQ7B 4JFYB 1EERB 3V2AR 3U7YH 3QWOB 4OZ4A 3IGAB 5SWSB 1S9YA 3K1KC 1MAML 1ZAGA 4GW5A 5F93C 1OAZL 1T83C 3D39D 4LRNL 4MQTB 3HI1A 3RA7H 2NTFA 1FV1B 4LLVB 4M7JL 5FYJD 1CLYL 2VH5L 4LSRL 3DGCR 1FNAA 1JWSA 3T08A 1SQ2N 1FVEA 3J8F7 4ZS6D 1MWAH 5MENA 2N7AA 4ZSOE 4FQQB 1IC7L 4L8BB 4NNPL 1U93B 4U6XA 3BDBA 1MCQA 3ECBB 3NOIA 4CVXA 3K8KA 3AMKA 4Y2OA 3RHWK 5HJ3A 1JYWA 1A3RL 4UNUA 3TBTA 2V5MA 2JIXA 4PJAA 1DE4B 1X9QA 1HQRB 1AQKL 1BWWA 1NCNA 5DJYA 5IKCA 2PW2A 1S7SB 3MPCA 3WEXB 3AC0A 3GMPB 4PJGB 1UB6A 3VFMB 5EBWB 2PO6C 5GIRB 4JM2B 1J5OH 4LCYA 2R1WB 1EXUB 3KWWB 1NLBL 2X10A 5J7CC 5K9OA 2AXFB 2DQCL 3KPRB 4Z95L 5AWNH 4EDXA 5FA4A 4WFHD 3S97C 4S1QH 2BY1A 3QJHA 5F9JA 3DBXB 1EGJL 1GXEA 3PXJA 3D69A 5B8CA 2W9EL 4KHXH 2XXMB 3BRFA 2W92A 5EZOL 2QQLH 4JRXA 4JFXA 5IG7A 1JVKA 4Q9RH 3HI6L 4RWYL 1TNNA 1W0WB 2CLRA 4XB7A 1U2HA 1I1FA 1N4XH 3ZYZA 4OTXH 3DVGB 2EH7H 1HHKA 4B0MM 4MSWA 4Z78B 3MBEA 3V95A 1LO3H 1ZE3C 5E0QA 3VFGL 3RU8H 4XHJC 4L3CB 3TBVB 4LQ1A 4P57B 5DQ9B 4PGBB 1KN4L 5IW3A 1LD9B 1PY4A 5F3HB 3RVWC 4OZ4B 2AABL 2XZAL 1S9YB 3Q1SL 5FO7A 3QIBD 1IGMH 3O6ML 4GW5B 2DRUA 4N0YL 1KNOA 3LQMA 1L7IH 1B90A 3HI1B 3MA9H 2NTFB 3D87B 3HE7C 5L9DL 3CSGA 4N0UE 3CXHJ 1HK6A 3RWGA 2C3HA 5GZOD 5CBEA 1JWSB 2VC2L 5JW5A 4O9HL 3T0AA 3ULUL 2BSRA 1FVEB 4OFPA 4XVSL 6FABH 5MENB 3ULVH 5EUOF 1QBLL 3JWOL 4U6XB 1W0VA 1IGJA 3HMXL 3UMTA 4CVXB 5HJ3B 4UV4L 3OR7A 4DKAA 3TBTB 1X3DA 1XFPA 2JIXB 3KPNA 4PJAB 1TTGA 3MNZA 2YUXA 5D2LE 5E8NA 4JFFE 5DJYB 5IKCB 1CICC 1SM3L 2PW2B 5C2UB 3CUPA 3EYOA 1UB6B 3LEVL 1MFBL 4LCYB 1T20A 1E6JL 3BEVA 1UWGH 5CEZH 1DCLA 2I60H 1RY7B 4NZTL 4DFHA 5EZIL 5K9OB 4F7TA 4MJ4A 4EDXB 5FA4B 4F7CA 3UPAA 1TETL 4YXKH 4MQXC 3E6HA 3QJHB 5F9JB 2CMRH 1HOCA 3PWLA 4UT9H 1G9NC 3LQZA 3D69B 3TCXA 5KVEL 3VD4A 5B8CB 1RZJL 1UH3A 3DECA 1H8OA 2MKWA 4NKOA 4JRXB 1KFAH 4Y0GA 4R2GD 4JFXB 5IG7B 5MEOA 4EOWL 4POZC 4KI1A 3WIHL 2CLRB 2D0FA 4KKCC 2VERN 1I1FB 1GIGL 2JJSC 1HHKB 4MSWB 1QHPA 2R69H 1CE6A 3MBEB 4NKDA 2DM2A 8CGTA 4PLJC 2H9GA 4DVRH 3NPZB 5C0BE 3SDDC 3NCYS 5L88H 4RA0C 2IFGA 5I1AA 3WXVL 1MRCH 1EJ6A 2VR5A 2H32H 4P3CL 4Z7UA 3RWJA 2XWJA 3C5ZD 4HJJL 3O3DB 5FO7B 1X5AA 5IVXF 4KQ3L 2ZUTA 1N2RA 3PWVA 1KNOB 3R0MA 3BFOA 2XQBH 1P4BL 3FOLA 3U1SH 1MHEA 1T6VN 4XVTL 5B39G 2A6JA 5F7DB 4P0DA 3RWGB 4IRJD 2AJZA 5BV7B 1UQSA 5CBEB 5JW5B 1JI2A 2BSRB 2AERT 2DI8A 1W0VB 1IGJB 1F8TH 1FGNL 5E2WL 3QUMA 4XP1H 12E8L 2NY3B 1AGBA 2A6KA 3OR7B 2F54D 4BH8A 3KPNB 2VDNH 5H37H 3INUH 3MNZB 2Y07H 3NCJL 2XWTA 5E8NB 3IVKA 3RGVC 5CZVH 3IFOA 2VL5A 3CUPB 3EYOB 2J88H 3UTTA 3GSNL 3QFJE 4Q58C 4J4PD 3KNBB 4F3FA 4PUBH 1I1AD 4GBXA 2CRZA 3BEVB 1A3LH 4GMTH 4MD0B 1T0MA 4F7TB 4F7CB 3OJVC 1I1RA 4K3GA 3T2QA 3V5DA 3D9AH 1HOCB 3PWLB 1OT2A 4FZEH 4FFYL 1FZOA 5IVZA 3V6OE 1BBDL 3LQZB 3QCVL 3DARA 4PBWD 4IDJH 5I1DA 4KKLD 4I13B 4NKOB 2W38A 2BOBA 1G6VK 3FRPG 4FZ8H 1MNUL 1TTFA 3QH3A 4UIKL 5JNYA 5MEOB 5D7SL 3F7PC 3EDFA 2HT4D 2HT3D 1WEJH 1UACH 3DXAE 3DPBA 4JN1L 5D7JD 3RL2A 2X1XR 3TLRA 1KCVL 3MLVL 4CNIB 1CIDA 2DI9A 3H42L 3OKOA 1G7PA 5DT1L 1CE6B 4NKDB 3QP3A 2H9GB 1YMME 1ZEAH 2DQIL 3LHPL 4NN5C 4NBXB 3LRHA 2AK4E 5GJSH 5I1AB 3ZDYF 1NUFA 5IK3A 4Z7UB 2XWJB 2ED9A 5FYJH 3T2PA 4D9RE 1N2RB 3DUUA 3PWVB 2H41A 1IE5A 5BRZA 3MQIA 2B5IB 4ERSL 3FOLB 3H9HA 1MHEB 4B50A 1EA9C 2A6JB 1VGEH 2OX5A 2AJZB 1I9RL 3MJ9A 1R24A 1UQSB 5F89A 4B41A 1C5CL 3PHQA 4JG0L 3S4SA 2P45B 4YX2H 5TQ0L 4Y4HD 4G3YH 4LLMA 3T3PF 1FCCA 3QUMB 1NBVH 1AGBB 4UBDD 2A6KB 1J88A 3QDMA 5CGYD 5SV3A 3WFEL 4BH8B 1RZ7H 5CP3H 1IZKA 4MHHI 2XWTB 4DTGH 3IVKB 1A7BA 1QVOA 2GIYA 3IFOB 4PJEA 1MPAH 2EDNA 2VL5B 3C8DA 3UTTB 4ENED 5GGVL 3QXDA 2CRMA 5GZNC 2BXZA 4F3FB 1MHHA 4HC1A 5CJOL 4GBXB 2OTPA 3FAWA 3QRFM 5EWIL 3QG7L 3P0VL 3J7HA 1T0MB 3FO9B 1DVFA 2UZXB 4OCYH 2RB8A 4D0DA 4I9WD 4UB0H 2VZ1A 2R9HC 3V5DB 4XBGB 2YEZA 3GO1L 2VLRA 1K4CA 4ISVA 3CCHA 1FZOB 4RFNB 5IVZB 4O5LH 5I1DB 2ITCA 4G5ZH 3ZKND 1MEXH 1MJ8H 5T1LA 1JZ4A 1NAMA 2CIKA 1IGCH 1ZHKA 3QH3B 5JNYB 1UWXK 3LB6D 3GB7A 4DUVA 4N8CH 1JGLL 2HH0H 1FIEA 1KF9B 1NMCC 1SY6L 1UWEH 3RL2B 3GDBA 1FE8H 2VR4A 4PBVC 4NQDA 3OKOB 5ACZA 1G7PB 3E3QC 4R7DA 2BRRH 3QUYC 1E4WH 1CGVA 1UA6L 2MPAH 3QIWA 3OAUH 1HKLH 4OGAD 3I3DA 3NGBC 2VJXA 4JRYA 4M6NL 4G6FD 4YZFE 3W82A 2GJJA 5IK3B 1OP3H 4HZAA 5CSGA 2HFGL 1T2QH 1EFXD 3WUWG 1KG0A 4K3EL 1VFUA 4G6JH 4H25A 1NC2D 5B22A 4R4BA 4MXWL 4XCNA 5BRZB 3WKNA 1HKFA 3H9HB 2FB4H 3LMJL 3BPLB 5T3XL 5DRWA 5IOPA 5GRXG 1R24B 4KTYA 5F89B 3PHQB 1RUML 3S4SB 4HCRA 4Z0XA 4CN6A 2O5YH 2CUMA 4IMKC 2BNQB 3CFKA 4LLMB 2YUVA 4OF8A 2XZQL 3VXMD 3N06B 3X14A 1NFKA 4MZ2A 3H9SE 2J6EH 4PRBA 5IBUB 3UO1H 1YC8A 4QTIL 5B39A 1JYXA 4TUKL 2DQUH 4UTAH 1QVOB 4OLWH 4PJEB 3TO4A 1D5BA 3IYLW 5FOBB 1UJTA 1AJ7H 2ICEA 1EHXA 1V05A 3QXDB 4YGAB 1QKZL 5EIIA 1MHHB 4YBHA 3EGSA 1DVFB 3AGVA 4XNZC 1YEEH 4D0DB 2LV4A 3BP6A 4Q7DA 1A6UH 2YEZB 5DK2B 3HC4L 2VLRB 1CD9B 1K4CB 3GGWA 4ISVB 2PXYA 4OM0H 3MNWA 4P5KA 2VLJD 2N56A 3QQ9D 2IPTL 5A3IC 4YQXH 2ITCB 2ZUVA 3PGCA 5CKGA 5CHNA 5E5RB 2ZJSL 4H20L 4HK3N 5T1LB 1NAMB 2CIKB 3L95A 2B4CL 2EYSA 3OJ2C 1NJ9A 4G42B 3O9WD 3CH8A 3GB7B 3EBAA 2XN9D 3KAAA 1KN2L 5KZCB 5DZNA 4MB5A 5KSBE 4NQDB 5ACZB 4R7DB 2VWEC 4TPRH 3T0BA 2L7UA 3SEPA 3QIWB 4K71C 3MOAL 4ACPA 4FABH 1BPVA 1O0VA 3FRPA 4IOSD 3ARBD 5F7YC 4JRYB 1T89C 3CZFA 5DD1H 4KFZC 2DKMA 2Y23A 5D1ZD 4PJCF 5AYUL 1KG0B 4L3ED 4ZSOA 4GRWH 1WZ1H 2AGJH 3VI3F 4H25B 3OJMB 4FQIH 4XCNB 1F90H 1PJ9A 5FYLD 2VDPL 1V7NH 1MCWM 1C5BL 2EDWA 5DEGA 1E4KC 1KENH 2VXUL 3KLHD 1PG7X 2YPLA 5DRWB 5IOPB 3S8WA 1DN2A 3FQTA 2O5XH 1MCDA 4Z0XB 4QHMA 4ODHL 4Z7QF 1K9TA 3C60C 3CFKB 3M8OL 3UTSA 1JZ8A 4HS3A 4B7IA 4RFOL 4U1MA 4A6YA 4PJBA 3X14B 1NCWH 3OZ9L 4AY0A 5DFVC 5F6HJ 3SHSA 4PRBB 1AIFA 4WI8A 5B39B 3U7YL 2HFEA 1CE1H 2D9QB 4XNMA 2EIEA 5FO9A 2VXVH 3TO4B 1D5BB 5CD5C 4POYA 4ONFH 3CX5J 4JDTH 2QQQA 5EIIB 3MOQA 1UB5A 3GZKA 3RA7L 2LFGA 3EGSB 3QIUA 4LVEA 1EHNA 5DK0A 3BP6B 5DD6A 1MWAL 3D48R 4FQJH 3GGWB 4IJ3C 4OUOA 2PXYB 4QOKE 4K8RD 3MNWB 4P5KB 1MVUA 1I1CA 5IWLC 1TIUA 3PGCB 3ZTNL 2DJ4A 4KXZH 5CHNB 2I24N 1JYNA 3L95B 5C0CA 1CVRA 2VDOL 1B0WA 4P9HH 5E4EC 2EYSB 1YYMH 1NJ9B 3KYOA 2X1WL 1XGQA 3REWA 4XP9H 4OCRH 1J5OL 4NO0D 4ZFOA 3M07A 2R0KH 5I1HH 4MJIA 4YEFA 2H2SD 3LDBC 4YBLB 4JY6A 5AWNL 3FMGH 4S1QL 4N0UA 4GJTB 3CZFB 4M8VA 4NUGH 4LOUD 5TDOA 4K7PX 4D9LH 4ZSOB 4PJ9D 4KHXL 4QT5A 2Z31C 2QQLL 2GJ6D 4FOMA 4Q9RL 5DEGB 4N9OB 2WBJA 2YPLB 2QADC 3FOMA 1N4XL 4X7FC 3FQTB 5D2LA 4OTXL 4QHMB 2EH7L 5AUMA 3UTSB 3WUWA 1T6WA 1HN1A 4HS3B 4K9EH 1CFQA 4U1MB 4A6YB 1LO3L 3IDUA 4PJBB 5TFSL 3RU8L 2FJHA 3E2HB 3QEQD 32C2A 3CSBA 1QTYT 1AIFB 4TNWF 1A5FH 4FMFA 4X6CA 1FQ9C 3RX8A 4XNMB 5FO9B 4PJGF 5DJ6A 1GC1C 1OAQH 1IFHH 2XQYK 1IGML 1SYVB 4JM2F 1WICA 4NCDA 1IVLA 1UB5B 1L7IL 5FGBC 4UT7H 2BERA 5LVEA 2YUWA 3QIUB 1AD9A 5DK0B 5IF0A 2YA1A 5D1QD 5DD6B 6FABL 2R0WH 3ULVL 5LQBH 3QUXD 3O4OB 5DVMA 5DA0B 1ZLWH 5DEZA 1CDHA 3NFPA 2EICA 4MA1B 1RD6A 3DVFA 1WAAE 5SWZD 4N68A 5C0CB 4JE4B 2X4SA 1ZV5A 1KIUA 3FJTA 4LHQB 4FHBD 1KCKA 4CJ1A 3KYOB 4JN2A 1WTGT 4P2RA 1XGQB 3REWB 5HYIA 4CU8A 3SE9H 1QFHA 4YDLC 4HMEA 2XKNB 4XNUH 4ZFOB 4MJIB 4FQXC 1EHAA 2QBWA 1UWGL 5CEZL 1FL6A 5I8CA 2I60L 1TQCB 2UY6A 1ZHNA 5KAQG 4JY6B 4YXKL 5EBLB 4N0UB 2CMRL 5HYJE 2C26A 2F8XC 4U6TA 2P5WE 5SWSD 3BIBX 4UT9L 5A2FA 5JW3H 5C08A 5TDOB 5C3LD 4K3JH 5EA0H 1AFVH 5C6PB 1IGYA 3CJJA 1BVZA 3NH7H 2Z91A 3MX0A 4QT5B 3SGJC 3SQBA 4XXCC 4WWID 1T4KA 3RHWF 3VGHA 1X6LA 3FOMB 1YECH 5D2LB 3FQRA 2V7HA 5C0DB 3S96A 1FORL 3IU4H 2VRAA 3Q6GH 5AUMB 5FXCH 1CGSH 2R69L 3K80A 4OGXH 1KPVA 2VKXA 1CFQB 1CTOA 4YNYA 2EEDA 2FJHB 4DVRL 2OI9C 4PJAF 3WNOA 32C2B 4L4VE 4O51A 2IMNA 3S6CA 5L88L 3EDEA 1MRCL 5MI0C 5GRWA 4X6CB 3SDAA 4PJIE 1CFNA 5E6IA 5DJ6B 3IDYB 3TVMC 5ELIA 5DC4B 5FM5O 3GM0A 4WFFD 1C08A 3CVIH 4P4KC 1CLOH 2XQBL 3U1SL 1TXKA 2J1KA 3KPRD 5F70A 1AD9B 1CYGA 2CK0H 3QUZC 4CL7A 3N0PB 2PUQT 1NCBH 1AXIB 3EJYC 3U0TA 3T3ME 4EUPH 4WFEE 4KZDH 1P5VA 1TITA 1F8TL 4U2ZA 3NFPB 1ORSA 4XP1L 4S2SA 3BN9C 1D5IH 3JSSA 5FUOH 1JWUA 2VDNL 1YMMA 3INUL 1YEGH 2X4SB 2Y07L 3OG6B 1A6AA 4NC1C 5CZVL 4JN2B 1OOAA 4U0RC 4GAJH 4P2RB 2VLKA 1INDH 4PGDA 2J88L 4X7TA 5FO8A 2FEEL 5FYJU 5BCAA 4PUBL 1A3LL 4GMTL 3ZTJH 3UDWA 5I8CB 1FL6B 1N0LA 1ZHNB 1FJ1A 1HXMA 2GK2A 5D7KD 2H2PC 3X3FH 3RIAF 1NCAL 3D9AL 5F7WC 4FZEL 5FYLH 5C08B 4G9DB 1K2DA 4PY8J 4U7SA 3GJFH 3BGMA 3DI2B 4IDJL 1IGYB 3ZKMC 2Z91B 3W0WE 1EDQA 1H3UA 4U6YB 4YHYB 4FZ8L 3U6RA 1T4KB 5D6DA 3ZSSA 1TVBA 1MCCA 1WEJL 4ZAKD 5FV1L 1UACL 3O41B 3RVUD 1JV5A 2C1PA 3FQRB 2V7HB 3WSQH 4UIMA 4HLJA 1E6OH 3S96B 3WN5A 1X5IA 2D4FA 3R8BB 3V6BR 1N0XH 3L7FA 1SMOA 1KPVB 2HYMA 5CINH 1ZWIB 4YNYB 1ZEAL 4MAYC 4Y5YC 4O51B 2XYCA 3S34H 3M45A 1MFEH 4D0CA 5GJSL 1GGYA 1OPGH 1BD2E 3VXRE 3HCVA 3SDAB 4DKEH 4FNLH 1CFNB 2IANA 5E6IB 5FYJL 4H88H 4JPIA 1W8NA 5B38A 2XY2A 4N5EC 3V8OA 3P4OA 1FFOA 1QSFA 3F65A 1PEWA 1C08B 1V3JA 5I17A 4DCQA 4K8RH 4U1HA 5DHXB 1WT5A 5FB8B 1VGEL 5LCVH 4XB8A 2RR3A 2Q8AH 3RDTC 3U0TB 3E3QE 4ZOBA 1DN0A 2PTTA 2HTKD 5FGCE 4YX2L 2I25N 3MGTA 4RMTA 4L4TA 4G3YL 4WIQA 1UJ3C 2EO9A 4U2YA 1ORSB 4WI2A 1CR9H 4S2SB 1NBVL 1R3KA 2FHFA 1RZ7L 1JWUB 4L8CA 1YMMB 1A6AB 3BPNC 4DTGL 4I18A 2AXGA 1MPAL 5E9DE 2VLKB 2V9RA 1RZGA 4PGDB 5D8JH 1ZLUH 1A0QH 3VXTA 4BQ6A 4X7TB 5FO8B 3QHFH 3MROA 4DW2H 3FFDA 4NQSA 3CFCH 5MERB 3QCUH 4EXKA 5C09A 1CN4A 4QGTA 4WI6A 1EGJA 3DX9A 1FJ1B 1HXMB 3CFEA 2EIDA 4UB0L 2Q6WB 5T1DH 4C57C 3MREB 2DM7A 3BGMB 4D9QE 4O5LL 1Y6MR 2NY6B 1JPFA 4G5ZL 1MEXL 1OAXH 3LD8C 1MJ8L 2OL3H 4C58B 3U6RB 5CJXA 1IGCL 2APXA 2WIMA 2R1XA 2MFNA 4N8CL 1ZA6A 2HH0L 4G9FD 1UWEL 4R8WH 1JV5B 3ROLB 3O2DA 2C1PB 4UIMB 1FE8L 3RZCA 2F5BH 4JM4H 3WN5B 3L7FB 2BRRL 1E4WL 2NY3D 4YC2B 2MPAL 4HIXH 4LVHC 1IJ9A 2I9TA 2EDXA 1HKLL 5EN2A 1FIGH 3NCCB 3FAXA 2FR4A 4D0CB 2ADFH 1N64H 3C09B 3DIFA 3HCVB 1GSMA 4ZXBD 2HKHH 3VDCA 1T2QL 4JPIB 3ZYIA 5B38B 1QD0A 4QRUA 3P4OB 1FFOB 1QSFB 4G6JL 1UH4A 4O58H 4J4PC 5I17B 2LU3A 1I8MA 2NY4B 4DCQB 2FB4L 4U1HB 3SO3C 3FZUC 1X5XA 2B39A 4YE4H 5ID1A 2NY7H 3HMXA 3B6SA 1WV7T 3S35H 3LQAC 1DN0B 2R0LH 2O5YL 3KHOA 4LKXA 4S10A 2EIBA 4BFIA 5CCKH 5L2JA 5F1NB 4L4TB 1C16B 1LEGA 3MXVH 2YA2A 1R3KB 4YFDB 2J6EL 2H45A 2BCKA 4L8CB 3UO1L 3VGAB 1MQKH 2QQKL 3NACH 5EH1A 2DQUL 2EDFA 4HG4K 4JPVH 4UTAL 4H0IA 5SX4I 1U8MA 4I18B 4OLWL 2HT3C 2AXGB 1RZGB 2OP4H 1S3KH 3VXTB 1AJ7L 4FXLA 1KTLA 2JK5A 3MROB 3LZFH 3FFDB 4NQSB 1AP2A 3SOBH 3F8UB 4H1LG 4RGNB 5I75C 5C09B 3UP1A 2GSGA 3DX9B 3CFEB 1YEEL 1B6DA 2WM0A 1A6UL 3JUYA 1IKNC 3S3SA 5HD8C 2FIRT 2Y5EA 4OM0L 3NPSC 4GKOA 3AS0A 3VGGA 2VDKH 1X5LA 1MSPA 4GG6E 2MMXA 4C4KO 4YQXL 3OHXA 4DK3A 1JPFB 3WIHA 3VI4F 3TIEB 3LVEA 4Q9BA 3V4VH 1H3TA 1KCUH 3C2SA 3QDGA 3AY4C 2R1XB 4NPYA 1ZA6B 3EO9H 3R0NA 3BP5A 4DN3H 3RZCB 3SQOH 1JNNL 4QXTA 5F96H 1X5KA 4QRTA 3B9VA 4LPCA 4TPRL 5HGBA 2Z9TA 2I9TB 4FABL 4X4XA 1X5FA 5EN2B 5ANMA 3VXQA 2FR4B 3VDAA 5I2IA 5E2VH 3QDJE 5JPNA 3O81A 1NKRA 3DIFB 4PV8A 4PJEF 5DD1L 1DL7H 3HE6B 4AJ0A 4XPFH 3NIGE 3MODH 3UTTD 4LPTA 4QRUB 1WZ1L 2AGJL 4QOKA 4GBXD 4FQIL 2HJLA 1F90L 1I8MB 1V7NL 1HCVA 3NZHH 1KENL 4FQ2H 1JYVA 5ID1B 4HKXA 4XMKH 3B6SB 4HJ0D 2O5XL 3ARGA 1WJ3A 3AAZA 4LKXB 4NYLA 4L4JA 4BFIB 5L2JB 1F6AA 3WV0A 4LEXH 1LEGB 5ESVA 1U8PA 2Z8VC 4OCWL 4U33A 1NCWL 1X5YA 1TFHA 3EDJA 4YHNA 3NVQA 2BCKB 1CF8H 5GSRA 1Q94A 5CBAA 2DQGH 3GSNA 4NBYB 1CE1L 1U8MB 1F6FB 2VXVL 3CFIC 2X44D 4LRIC 4ONFL 3P73A 4JDTL 1KTLB 2JK5B 3ZDXF 1AP2B 2DKSA 5IQ7H 1PX4A 2GSGB 5ETUA 2HWZH 4P23A 3VG9C 3JWDC 1CICA 3PWJA 4FQJL 4WTXA 4H26A 2P4AB 2PO6B 3H9YA 4FN0A 1U9KA 3WO4C 3OHXB 1A9BA 1ZANL 4LNRA 4X9GA 5BRZD 5TE7H 3GSXA 5AZ2H 4Z7OF 2ADJA 1QSVA 4P9HL 1YYML 3QDGB 3W2DH 4NPYB 4P5TA 4JO2L 4NQCA 5I1GH 1N26A 3BP5B 4JQVC 4XP9L 2BNQD 3H3PH 4QXTB 4PFEA 2E7MA 2VZ3A 4QRTB 3ZMRA 4OCRL 5I1HL 2R0KL 1DQMH 3QZWG 2DL2A 5HGBB 4ODUA 4XWOC 5J12C 4X4XB 3U7WH 4RAHA 5ANMB 3FMGL 5E03A 5I2IB 1U95A 5JPNB 1A14H 1YPZE 4PV8B 3HR5A 2WP3T 5DS8A 1G9MC 4NUGL 4GW4A 4D9LL 3K74B 2ICCA 3K81A 4MCZA 5FA3A 4QOKB 1TNMA 3STZA 3UYRH 2HJLB 2NZ9C 4L1HA 1CZ8H 4ONGH 5EC2A 1CDUA 1DVFD 1MJJA 2HMIC 3MJ8A 4HKXB 5HY9A 2FGZA 1D9KC 3ARGB 5I19H 3MV01 5DD0L 3AAZB 4NYLB 1F6AB 5ESVB 5IBLD 1B0RA 3U0WH 4K9EL 1U8PB 1JTTA 2NXYC 3CD4A 5D7IA 2P47B 4YHNB 4JDZA 2IAMC 5F9AC 5GSRB 1Q94B 1A5FL 5CBAB 1FYTE 3GSNB 3LN4B 4J1UB 1DBAH 4KI5F 2R23A 1U6AH 1YY8A 1OAQL 1IFHL 2FGWH 4E41A 3P73B 3T0WA 1WBXA 1R5WA 3QIWD 4MHHG 1OM3H 2EKJA 4UT7L 3KYNA 5ETUB 4X7DC 2R4RH 3OXSA 4P23B 4JZJC 5HHVH 1ITBB 3RGVA 1CICB 3TPKA 3PWJB 2R0WL 5DJ2A 5LQBL 4H26B 2HAZA 3V4UH 1PFCA 1TZHA 4XPTH 5BV7H 5HYEA 4G8GE 1A9BB 4LNRB 3FQWA 4HDIA 1IAIM 3P9MA 1SY6A 3GSXB 4LCWA 4PREA 4H1LA 4WWKD 1RJCA 4AIOA 1KTKE 4Q2ZA 1IC1A 4P5TB 4NQCB 3X17A 4LBEA 3TJHD 3QWRA 2PTUA 3OGOE 5IW1A 5GGSY 3SE9L 1FZJA 2VNCA 3PHOA 3IDXH 4XNUL 1I3GH 4PJBF 4ODUB 3TA3A 4XRCA 3O2WH 1E28B 5CMAA 5C2BH 5IROC 1U95B 4YHZH 5F9WC 1HNFA 3HR5B 1WLHA 1TJHH 4GW4B 3BH9A 3TO4D 3WD5H 2EZ0C 1KB9K 1UEYA 4U7KA 5JW3L 2IPUG 4K3JL 1AFVL 1H8SA 1AR1C 1O5DT 4MCZB 5FA3B 3WHE1 5T3ZE 3STZB 1RJZA 5EC2B 1VFMA 4NC1E 1V8HA 1MJJB 4ELMF 43C9A 3VA2C 3MJ8B 5HY9B 3OF6D 1YECL 2PXYD 4LDOB 3RIFK 2R15A 3IU4L 3Q6GL 1CGSL 3K4AA 4NN6C 1B0RB 4I3SH 4OGXL 1AKJA 4WHYH 4HGMA 3ES6A 4LLQA 5D7IB 3LOWA 3KPSE 4JDZB 3C9NA 5D5MA 4XNQA 4Q9QH 2R23B 3IDNB 1YY8B 4H8WC 5DMJB 2V7NA 4E41B 1T1ZB 1PSKH 1WBXB 1QBAA 3CVIL 1R5WB 5ABDE 2NMSA 3NN8A 3NIDF 5EIVA 3KYNB 1KTRL 3OXSB 2CK0L 3WLWC 3RGVB 2JLLA 1NCBL 4AG4H 3MRHA 5DJ2B 4KZDL 2MSPA 2C4FU 2YSSB 1TZHB 3QEUA 4OV6F 3AROA 4DN4H 2YS4A 5DC0A 1H5BC 1FHGA 3FQWB 4HDIB 3P9MB 4LCWB 4DWHA 5C07A 1D5IL 4PREB 4H1LB 5FUOL 3PP3K 2W60A 5I9QC 4Q2ZB 1MREH 1YEGL 3UAJD 4AEHH 1T7ZA 3QUMH 1AH1A 1JZ2A 4LBEB 5D2LF 4GAJL 5IW1B 1INDL 3GSQA 3LRSA 4U05A 3U2SA 1BD2A 2FWOA 1FZJB 3UTSD 1MAJA 3PHOB 4YHIA 2DMKA 1QYGH 3TA3B 1RUKH 4XRCB 1WBZA 3I2CH 4K7PY 1IARB 2YD3A 4JFEA 1QNZH 5CMAB 2NYYC 4Z7WA 4X6CF 4LHUA 4QTHA 3IRZA 3UTOA 5BVJA 3T1FA 4AM0A 4E5XA 5FYLL 3BH9B 5JHDE 1WWAX 4HEPG 3QUYA 5DC9B 1Q8MA 3BZDA 1RJYA 1KSRA 1RJZB 4Q6IC 5DHYA 4NJAH 4I8DA 3TH3T 1UKQA 3QIUD 4WEBH 43C9B 4I3GA 4Y4KC 1D7FA 1BMGA 4NQTA 3RUGA 1A7OH 4HF5L 3WSQL 4WU7A 1W72H 4PJXF 4YAQA 5E9DA 5C0RH 5GS0D 3MLUH 3HI5H 5CINL 4Y5VC 1DLHA 1AKJB 1U3JA 3B9KC 3ES6B 4LLQB 1ETZA 3O6FC 1DQDH 1VFAA 3S34L 4ZFGH 1MFEL 3C9NB 5KBNC 4G43A 1NBZA 2VDMH 4OUUA 1OPGL 1YY9D 5D5MB 2AI0H 4XNQB 5FM4A 1NDGA 4DKEL 4FNLL 4IMKA 4P9MH 4H88L 2V7NB 4PRHA 5H37G 3LS5H 1MF2H 2OR7A 4F9LA 4KTDH 3NN8B 1MWAA 4K8RL 3SE3A 5DK3A 1D5MA 5LCVL 3EOBA 2Q8AL 5DHVH 3MRHB 4HKBA 4O2CA 3HZMA 1Q1JH 2ICES 1ROWA 1DDHA 3QEUB 4BA8A 4LVNC 2MCPH 1CR9L 5EO0A 2N4IA 5C07B 1KJ3L 2W60B 1ODAA 3TFKC 5BOPA 4HBQA 3UTZA 1L6XA 4OBSA 4JVUA 3LRSB 3GSQB 4N9GA 5D8JL 3U2SB 1BD2B 3QHZH 1DFBH 2FWOB 5T1MA 1A0QL 1TVDA 4FTVE 3CX2A 3QHFL 4DW2L 3V52H 3CFCL 3VRLE 4LHJB 1IEBA 1WBZB 4JFEB 4AK1A 2NR6C 1JN6A 1MH5A 4Z7WB 4HC1H 5K33A 1NMCB 4WTWA 5T1DL 4RMUA 4LHUB 4QTHB 1H9VA 5BVJB 3T1FB 4AM0B 4E5XB 1YEFH 1PY9A 1CQYA 4JO3L 3GIZH 4XPBH 3QUYB 3CH1A 5EOCL 1OSZA 1RJYB 1OAXL 1KGCE 2OL3L 5DHYB 2PR4H 5L8KB 3VD9A 1A6ZA 1AR2A 3NGBB 1X4ZA 5INCA 4I3RH 4KK9D 2ENSA 1T89A 1JUFA 2BSSA 3MGOA 3WNKA 2EDYA 4R8WL 1NAMH 2BZDA 1YUHA 3IFLH 3FKUS 4WU7B 2F5BL 4JM4L 4YAQB 4M9OA 5E9DB 4GRLD 5HHOA 1MFAH 1DLHB 4WY7H 1UEMA 4ONOA 4HIXL 1AO7E 4JREC 1ETZB 5IMOA 1E4KA 1FIGL 1VFAB 5E4IA 3MLRH 5C0BD 1YEIH 4G43B 1NBZB 2ADFL 4OUUB 1YJDH 2OK0H 1NDGB 2HKHL 3C60A 4GMSH 4WTZA 2DLFH 1HCFX 5E99H 4PRHB 5SV4A 5DMYA 3MXWH 3IDGA 4HWUA 4O58L 3S5LA 2BRQA 3EYSH 1MWAB 3B5HA 4YE4L 1D5MB 2EXWC 3KYKH 1R5VA 1TVHA 3DUSA 2NY7L 3EOBB 5IEHA 3S35L 3GKZA 1T7XA 1BBJA 2R0LL 4HKBB 4O2CB 4PLNC 3HZMB 3AUVA 5CCKL 2AP2A 4GKNA 1NL0H 3TO2A 1DDHB 3MXVL 4PJ8D 4X98A 2Y6SC 4J7RA 4EI5D 1VKXA 2ZOKA 2WQ8A 4HCRH 1T0PB 5EO0B 2ORBH 4KZEH 3S37H 4XNZB 2VLMD 3A6OA 1MQKL 4LCCC 3NACL 3VXSA 4JPVL 3UTZB 2YRZA 4XNYL 3QDJA 4N9GB 2OP4L 5T1MB 2V5SA 1S3KL 5IWLA 1T2JA 4HK0B 1CFTA 5GRUH 1G84A 5DUMH 3F62A 3LZFL 1I4FA 1HI6A 2C9AA 2XTJC 3QFJD 4Z18A 3SOBL 1IEBB 1P6AB 3ALPA 3BW9A 4RNRA 1JN6B 1MH5B 5D7LA 3DV4A 5I8OH 1JP5A 3EO0A 3SDAD 4PGZA 5D1XC 5E6ID 2C7UA 5CEYA 4WO4C 2O5ZH 1CD8A 5E1AA 2BNRA 3FL7A 2D7PA 5JXEC 1FCGA 3CH1B 3MV9E 1OSZB 4K71B 5ACLA 3T0EC 4RAVA 3GSWA 4GXUN 3V4VL 2K9UA 3VWKA 2AXJA 4AIXA 1A6ZB 5INCB 2UVEA 4P3WA 3EO9L 1DBKH 1X7QA 1JUFB 2BSSB 3MGOB 3R06A 4DN3L 1CT8A 3D25A 3DXAD 1YUHB 3SQOL 5F96L 2XKSA 4PJHA 5HHOB 2BVUA 3ILQC 2Z31A 2HJFA 4FS0A 4XX1G 5BZWA 5B3JE 5IMOB 3EUUA 3WS6C 3DSNA 1YMMD 3EZJB 3WDIA 4P2QE 1BQLH 5E2VL 2AK4D 3B43A 4LAQH 1DL7L 2VITA 3C60B 4FG6C 1LK2A 4XPFL 3MODL 1LE9A 4WU5A 4MLSA 5CGMA 4MXVE 3SGEH 4D9RD 3IDGB 3B9DA 3S5LB 4P99A 2DQFA 5JXAH 1P7QA 1OP5H 2XG5A 4F8TA 4BFEA 3NZHL 2G9HA 4FQ2L 3VG0H 3EHBC 4HUXA 1R5VB 1TVHB 3DUSB 5T5FH 5IEHB 4XMKL 2I07A 3P40A 4LU5H 3KG5A 4ZDHA 1BBJB 2E9JA 5E5MB 1VFOA 4LEXL 4GKNB 3TO2B 3GK8H 2UYLA 4X98B 4LNVA 1VKXB 2EDOA 3VWJC 5FGBA 3ARPA 3RPKA 1IBGL 3FFCE 2DYPA 4JFDA 1UKSA 3EIFA 5KAQF 3L1OH 1CF8L 2DQGL 3IDIA 1FNGA 3VXSB 3K2UH 4U1SA 4IJ3B 1F3DJ 2L7JA 3ORJA 4NUJA 3QDAA 3QDJB 4WEUD 4K07A 5JTWA 1OQXA 4OF3A 3TZVC 1CFTB 3PL6C 1I4FB 1HI6B 2E9IA 5CZXC 5IQ7L 4LARL 1I9EA 3PUCA 4AENA 2HWZL 3EAKA 3BW9B 4RNRB 3UROR 5D7LB 3DV4B 2H26A 3EO0B 2B20A 3MLZH 5EU4A 2C7UB 4NNXB 4QRRE 5CEYB 5E1AB 1QSFD 2BNRB 1V3LA 4FQXA 1Y6KR 3ULUF 3MR9A 4KK8D 3V4PH 3MGAA 1P2CA 2NY2C 3ALXA 4XVUD 5TE7L 4RAVB 3GSWB 3VWKB 1FFNA 4ZUVA 3UXFA 3SKJH 3W2DL 5GS0H 4KDVA 3UZEA 5I1GL 1X7QB 4X7CC 3R06B 1CT8B 1FYTA 3D25B 3THMH 2Z0BA 4ODBD 3H3PL 4JFHE 4PJHB 2OJZH 3MRNA 3RKDD 1DQML 3L3DA 2Z31B 5EDXA 1IAMA 2HJFB 4WGWB 5BZWB 4OD1H 4NQVB 4EI6A 3U7WL 1INEH 1RK1A 5E56A 4LQFH 3VGDA 1A14L 4HULB 1GHFH 3MZTA 2VITB 1LK2B 3LRGA 1LE9B 4WU5B 1BOYA 3ZE0F 5TDPA 1Q9WB 1QSEE 1UM5H 3GBNH 1CZ8L 4ONGL 4IM8A 2DQFB 1P7QB 1QFUH 2C5DC 2G9HB 3RJDA 3QXAA 4HUXB 2IQ9H 4OM1H 2I07B 5T1KD 1F42A 4ZDHB 5I19L 3TVMA 3EYFA 5K59E 4Z7NE 2UYLB 3U0WL 5CP3A 2BMKA 3QYCA 2DYPB 4JFDB 5IGXH 4P46D 2MHAA 3FO2A 3QUZA 1X5JA 2ADGA 3BISA 1WFTA 3IDIB 4AEEA 1FNGB 1C8PA 4U1SB 1DBAL 1U6AL 4NUJB 3JTTA 1KJVA 3RZCD 2FGWL 5E95B 1PLGH 3ARXA 1LP9E 5I76A 3G5XA 4LDLB 1OM3L 5IJKA 3WIIH 4X5XA 2AEWA 1JPGA 4JEGB 2R4RL 2UZYB 4P49A 2EH8H 5HHVL 2E5EA 1ZA3A 1MCKA 1BJMA 3HE6D 2XACC 4D3CH 5J9PA 4YDLB 1JRHH 4Y4FC 5EU4B 4JKKA 3V4UL 4XPTL 5BV7L 4FQXB 4NDMA 1NUNB 3MR9B 1P2CB 2DL9A 2X9YA 1FFNB 3MRBA 3AVEA 4ZUVB 4HWNA 2B8OT 1NANH 5E24E 4Y1AE 4U6VH 4PJ7A 1FYTB 3IDXL 2JJUA 5HI4C 3QIBA 4D2NA 5IQ9A 3MRNB 4N1EA 1I3GL 1A7RH 3O2WL 3ZDZF 4KJWC 2KBGA 4EI6B 4G8IA 4P5MA 1WUNT 1RK1B 2DBJA 1AQDA 5C2BL 1QLRA 5E8EA 4YHZL 1KCRH 2AVGA 4XCEA 2JJTC 1TJHL 4OCXH 2D7NA 3WD5L 2CSPA 2IPKA 3BH8A 2F9BT 4LLWA 2GAZA 1J9CT 3RY6A 3QG6A 1SJVA 5TDPB 2E6PA 2WSKA 5D2NC 3SJVE 5JIIA 4MAYA 3O6LH 3QXAB 5MI0B 3MLSH 2YHGA 3TVMB 2PO6D 2IQAA 4A2MA 2J6EA 2GUOB 4ODTH 4I3SL 5DMGC 2BMKB 1KYOJ 5A16A 1H8NA 3KJ6H 5I66A 1CLCA 5IR1A 3BQUC 5DI8A 3FO2B 3QUZB 2ADGB 5DUPH 5L0QB 4KKNA 2QTEA 4PJ5A 5JOFB 4Q9QL 1KUMA 1XF3A 5I18H 3JTTB 1KJVB 1HHHA 1QQDA 2ADIA 3QO1A 1PSKL 4MQ7A 4GXVH 1P4IH 5I76B 2BNUA 1SVZA 4PJDE 4ZPVA 4X5XB 1JPGB 2R2EA 1T7WA 3C8KA 5IHBA 3BOVA 1ZA3B 4AG4L 4KJQC 5IB2A 5J9PB 2XOTA 2CUIA 2UZIH 4FQLH 4QOKD 4W4NA 4DN4L 1TMCB 2LTQB 4NDMB 1FGVH 2E7CA 1UGNA 4XHJD 4MJ2A 5F8RC 4CW1A 4NQEE 3U30C 4ODXA 3MRBB 3PV6A 3H7BA 1MREL 1J8HE 1N59A 3RVWD 3RWHA 1MCWW 1NH6A 4MYWB 2X7LA 4L29A 3QUML 4AEHL 4HT1L 4ZD3H 1KTDA 5GRVK 1JIBA 4PJ7B 4LSDA 1VEMA 2YXFA 2J3SA 2E9WA 3QIBB 4HXBH 5IQ9B 5DD5H 4UILH 4U1LB 1K5NA 1QYGL 1T3FA 3HE7D 3KLDA 3MRKA 5D7IF 3U82B 1RUKL 4MAUH 2B1HH 3I2CL 5CJQH 1PGRB 4G8IB 3AB0C 4P5MB 4R0LA 4N8VA 4KDTA 1QNZL 1RZKC 3D3VE 4IRJA 4YDKH 1QLRB 5E8EB 4XCEB 5J13B 1IKFH 5EO9A 2IPKB 3BH8B 4LLWB 2GAZB 2VDRH 4XMLH 3EFDH 3QG6B 2HLFC 4N0RA 4NJAL 4MAYB 4WEBL 1IAII 4LPVA 2CLVA 1AGCB 2UUDK 1EX0A 1CICD 5CGTA 1A7OL 1V5JA 3WNLA 4Z7VE 1NFDF 4PD4K 3ALWA 1W72L 1UM4H 2IQAB 5KVFH 1EAJA 2DDQH 5C0RL 3MLUL 2ZUQC 3HI5L 3V7AE 4J4PA 2ZZUT 4R90H 4EUPG 3NZ8A 3PQYE 5A16B 3RL1A 1EZVX 2FSEA 3VJ6A 5I66B 5IR1B 4F80A 4ZFGL 3R8QA 2Q1EA 5DI8B 4NRXA 3RDTB 4MD5A 2VDML 1E4XI 1KLFA 2AI0L 4PJ5B 2A9MH 3B83A 4P9ML 4OZFH 1HHHB 1QQDB 9CGTA 2ADIB 3QO1B 1N6VA 1EO8H 2GK0A 4M48H 4MQ7B 3LS5L 2VISA 2X89D 1MF2L 2D2OA 2BNUB 4ZPTA 1PVHA 1KXTB 4KTDL 4Q74A 4ZPVB 4R2GB 4UTBH 4POZD 2R2EB 2XFXA 3C8KB 2GSIA 5FYKU 4MDJA 5IHLB 4J3TA 3ZTJG 5I6XC 1Q1JL 3U36A 2R56L 4PLJD 2MCPL 2F74A 4WUUE 3B8YA 4HMCA 3SDDD 4CW1B 2BVOA 2KUTA 4ODXB 1MJ7H 3PV6B 2FX7H 3H7BB 1Z0NA 1N59B 1RUQH 3RWHB 2X7LB 4L29B 1KTDB 4CVZA 4TNVK 4JCMA 1XF1A 3QHZL 1DFBL 3V52L 1G7QA 4DGVH 1H0DA 1T3FB 3MRKB 3LD8B 3TH4T 1WGOA 4FFZH 3AY4A 4R0LB 3CFDA 4N8VB 4NWUL 4HC1L 4IRJB 4GRWB 3UTPE 5D5MF 4QNPF 5HYJD 5EO9B 1YEFL 5DJ0A 2P5WD 1BJ8A 4YWGH 3LKOA 4XPBL 3GIZL 2OYPA 4XCFH 1MCPH 1S9WA 3VFSA 1HINH 1NEUA 3GSUA 2NY0C 2PR4L 2LE9A 4I3RL 4LLUA 4MVBC 2CLVB 4JFOA 3RGVD 3DMMC 2WZPD 5FEBA 1JGVH 5DVKA 1CD1A 1NAML 2XTJE 3IFLL 2WBWB 2I9LA 1MFAL 4DK6A 4WY7L 3NZ8B 3O2DH 3T09A 3VFGH 3SO3B 3RL1B 3VJ6B 2FSEB 3MLRL 3U0PA 1YEIL 4NRXB 4MD5B 4L4VD 1YJDL 4X6BA 2OK0L 3KJ4B 4GMSL 3OKDA 1WC7A 2DLFL 4YEEA 4H0HB 2GK0B 3NTCH 4KHTH 3T0EE 3MXWL 2FHCA 2VISB 3PXHA 4B5EA 1MOEA 4ZPTB 3EYSL 3MV9A 1NEZA 1T80A 4Z7WF 2XFXB 2GSIB 2R4SH 3KYKL 3WNPA 1QRNE 4MDJB 1MVFA 1MCOL 3I6KA 2QL1A 2BOCA 4HH8A 3MRRA 3U36B 1NL0L 4XCCL 1TZGH 3E1F1 5HGGS 2DQJL 2F74B 5ESQA 3ZE1F 4HCRL 5I75B 5DGQA 2BVOB 5JMRA 2ORBL 4KZEL 3V9FA 3S37L 1NANI 2VABA 3PG2A 3F7RA 5C0GA 1D6VH 4KRPC 3RUGF 3LIZH 1ADQA 4CVZB 2BC4A 4HFUH 3DRQA 4MD4A 4NQUA 1EFXA 3GI9H 5J1AA 3LEVH 5GRUL 5DUML 1VDGA 5HPMA 1G7QB 1H0DB 1K3IA 1AKJD 1NC2A 2VKWA 4UDTA 5J56B 4KV5F 1OQOA 3CFDB 1DBJH 1B4RA 5I8OL 4JQVA 5IMMA 5A2JH 1JHKH 5DJ0B 4LFHD 4PLOB 4YDJA 1F4HA 1S78C 3LKOB 3SKNA 3F7VA 4OLXH 1WZKA 2MCG1 3STLA 1S9WB 4MS8C 3VFSB 5I8KH 1GGTA 3GSUB 1D5ZA 4GKSA 3W0WD 4BQBA 5ECJE 5M95B 1WZLA 5LGJA 2AJSH 2F53E 3FFCA 4JO4H 4LLUB 4JFPA 3HB3C 1IMHC 4JFOB 3LKQA 1DBKL 5ICZA 1QSZA 3PP4H 2EC8A 4JKWA 3B9EA 2ITDB 2RAMA 3TYGL 5GZND 3KXFA 4FQHB 5CLTA 3IS0X 1E4JA 1G6RA 5JW4Q 1QLEH 1W0YT 4ZO9A 2E8ZA 1P84K 3U0PB 2R9HD 4QRQA 5TDNB 2FLBT 1BQLL 1WIOA 4X6BB 1D9KA 4LAQL 4CBPA 3F58H 3OKDB 1BD2D 3VXRD 1WC7B 4WCYH 1DANT 4HJJH 5IB3A 2VLJA 2CKBH 1S9XA 4QRRA 3PF2A 2RFXA 2YBRA 4LSQL 5JXAL 3MV9B 2YWZA 1NEZB 3EJJX 4Q6YA 3VG0L 3QXTA 2IBGA 1C7SA 5T5FL 4LHUD 2BJMH 3I6KB 2XN9A 5I1CH 5CZKA 2BOCB 1WISA 3MRRB 1P4LA 3GK8L 3JVGC 3QUYD 4ESKA 2Q87A 1FL5A 5ESQB 1WCBA 2YA0A 3TPUA 3L1OL 2VABB 4JZJA 3VG9B 4AZ8A 1FFRA 3DX7A 3ARBA 5C0GB 4ZOAA 3K2UL 4NGHH 2BC4B 3DRQB 4MD4B 1ZXQA 4J3OC 1EFXB 5E9DD 5J1AB 3T65A 5EG6C 4L3EA 3WO4B 4OV5B 5HPMB 4HAGA 1ZGLA 4OJFH 1CXHA 2JJWA 4UDTB 1NC2B 1XR8B 4ELKA 4OFDA 4YHPA 1QSEA 4WV1C 4CJ0A 3DRTA 3GJFA 1Q72H 2CLZA 4X9BA 5HHME 1EEZA 3GMNA 2BHZA 5IMMB 3MLZL 4YDJB 4PRHD 3BPOC 3SKNB 4QXGH 5IEKA 2D9CA 2APWA 4U4BA 5EZJA 3F7VB 5LKNA 2QQNH 3STLB 4D9QD 4YPGA 2FIKA 1WCQA 5J12B 1QFWH 1D5ZB 3HRZA 4GKSB 3ULVF 1G7MA 1M7DA 3W9EA 3SKJL 5LGJB 5IROA 3VMNA 3FFCB 4PRAA 5GS0L 4JFPB 3SE4C 1RURH 3LKQB 5ICZB 2FO4B 1KCVH 2OTUA 3DJ9A 4X6DA 3KXFB 3U48A 2OJZL 1FG9C 4L5FH 4HUNB 4IRSC 1G6RB 2UWEE 2AW2A 2PKDA 1G9NH 4OD1L 1RFDH 2NW2A 1T1YA 1INEL 1RV6X 5HGHA 4LQFL 3K8MA 4QRQB 5J8OA 2AV7A 4TVPH 1D9KB 1GHFL 4RMSA 3B2VH 5F3BA 5A3ID 2VQ1B 5IB3B 2VLJB 1S9XB 4QRRB 4XCYA 1UM5L 2EXYC 2RFXB 3GBNL 2YBRB 4JFQA 4GS7C 4PB9H 3JV5A 1QFUL 4LSTH 4CUCA 1T66C 5SWQA 5AEAA 2JCCE 2IQ9L 4OM1L 3AU1A 4OZGA 3O45A 3GMMA 2XN9B 1U8QA 4Y1AA 3NAAH 1P4LB 3T1WA 3G9AB 4BZ2H 1EIBA 2W0FA 4NO0A 5ADOH 1FL5B 3SDXA 3V6OC 4DKDC 1WCBB 5KSAC 3TPUB 5IGXL 1WIUA 4JZJB 1ZSDA 2GI7A 3BD4A 3DX7B 3ARBB 1BLNA 4LSVH 3MOBH 4PGCA 4M4PA 5AAMA 3IJHA 4OZHA 4PJHF 4TQEH 3MFGB 5D2NE 3T65B 1PLGL 4L3EB 3MLWH 1PG7W 1A1MA 1ZGLB 4PJ9A 1H5BA 4MXQC 5CJOH 3SE8H 1MHPH 4ELKB 5K93A 3WIIL 4YHPB 1QSEB 3V8CA 2GJ6A 4HD9A 5FHBH 1ES0A 3BMWA 3DRTB 2EH8L 4OGYH 3GJFB 4R3SA 2CLZB 2IADA 1EEZB 35C8H 5ILTH 2W07A 3B8SA 4D3CL 3C60D 3OQ3B 1JRHL 1FVCA 5E08H 5IEKB 5L8LB 1U3HC 1VB9A 3QQNA 5EZJB 1LMKA 2WWMC 3MCKA 4YPGB 2FIKB 4UOJA 5DFVD 4EKXA 3HRZB 1G7MB 1M7DB 3W9EB 3QEQA 2XT1B 3GI8H 1NC4A 1XR9A 4L9LC 4PRAB 5F9WB 1M7IA 1Z9OA 3FN0H 4U6VL 3FQUA 4RCAA 5CD5D 2OTUB 2XZCH 2DWDA 4X6DB 1KC5H 3KVQA 2YPKA 4PV9A 1U8KA 1J1PH 1MFNA 4G6AC 1QBBA 2P1YA 1A7RL 1LP9B 4WGVB 2NW2B 4KVNL 1T1YB 4MA7H 1MIMH 3C08H 5HGHB 1DP0A 2RCSH 2VDLH 1KCRL 1JPSH 2AV7B 2X4QA 4M6NH 4PS4H 5D1QA 4OCXL 3QDJD 1WBYA 5F3BB 7FABH 3SKOA 1CD0A 1X44A 4NN6B 3UYPA 4Y5VA 4P2OC 4XCYB 4JFQB 3O6LL 2D3VA 3QQ4A 5SWQB 4NQEA 3ZO0A 2CUHA 1FFQA 2VN4A 3AU1B 4OZGB 1J8HA 3MLSL 3O45B 5FYKE 1DBBH 4OFVA 3TWCH 3M17A 1U8QB 4JY5H 3BKMH 4OKDA 2LU4A 4Y1AB 4OLEA 2ZG1A 4ODTL 3BP4A 3MLXH 3HN3A 4NO0B 5ALBH 3SDXB 3VH8G 3MRIA 2IFFH 2XZQH 4KROC 3KJ6L 4J3SA 1ZSDB 5DUPL 5ALCH 1BLNB 4DGIH 4JJ5A 3D3VA 4G7VH 4PGCB 4OFKA 5I18L 5SWSA 3IJHB 4OZHB 4XAWH 1HEZA 2DF3A 3U9UA 2ZSWA 4GXVL 1A1MB 2Z31D 4PJ9B 1H5BB 5EUOE 3UJIH 1CIUA 5EU6E 5I9QB 2GJ6B 4Z0BH 1NCCH 3ZKXC 5DUBA 2QADD 2IG2H 2IADB 2F54E 5IESH 2YD7A 4KRNA 4RMVA 3RFZC 3LV3A 3TT3H 4J3XA 1FVCB 4Z8FH 3RVXC 1ZKAA 3SDCC 2UZIL 4FQLL 5KVGH 3ARRA 4RFEA 1VSCA 2IPTH 4XPGH 1FGVL 3MCKB 5CILH 1G7LA 3OMZA 2E27H 3PP3H 3QEQB 4LGSB 1NC4B 1XR9B 1X4XA 1QP1A 4ZD3L 5CD3A 1M7IB 2IGFH 2SEBA 3FQUB 1P1ZA 4AYFA 4M7LH 2DWDB 4YFLI 4XVJH 5H94A 4PV9B 2YPKB 4RDQF 1JE6A 1U8KB 1MAKA 4HS8H 4HXBL 5DD5L 4UILL 4M43H 3BKJH 1FG2A 1B4JH 1VENA 2VZOA 4MAUL 2B1HL 2DYPD 5TPWL 2EDBA 5CJQL 3P9WB 1CXFA 3WJJA 4HQQH 3KPRA 4PJDB 1A1NA 2NX5E 1T03H 4YDKL 4JM2C 3CSPA 4C56E 2X4QB 4WHYG 5D1QB 1IKFL 1WBYB 3SKOB 5D96B 2VE6A 5EPMA 2VDRL 4XMLL 3EFDL 3FHQA 4Y5VB 3I75A 1DTUA 2Z93A 3HS0A 1J0YA 2VDPH 1EAPA 3QQ4B 4NQEB 3DO7A 1J8HB 1EEQA 3M17B 3PNWA 2M26A 1UM4L 5KVFL 4U6HA 2DDQL 5LWYH 4MNGA 4FQXD 3BP4B 4DOHB 5DJ8A 4PJFF 4R90L 2FX8H 5KW9H 1SJEA 3MRIB 1ACYL 4TULH 2XZZA 5IVXE 1MCFA 5DQ9A 4PGBA 1KYOK 1G1YA 1LD9A 2Y25A 5F3HA 2X9WA 5B4MD 4JJ5B 4PJ7F 4Q0XL 2A9ML 3D3VB 1FYTD 5DGRA 3VE0A 3WJLC 4I2XE 1HEZB 2Z4QA 1EO8L 4M48L 3U9UB 2ZSWB 3P2TA 4MB4A 2A83A 2W1NA 1J0ZA 2XNAA 2YD2A 1A2YA 2P7TA 4UTBL 5DUBB 5DURB 2WLYA 3U79A 1CGUA 4YJZL 2X4OA 4ZAKA 2VAAA 3EOTH 3LV3B 1A6VH 4RFEB 5DRNA 1QFWI 4CKVX 1L0QA 3ZTNH 1A64A 1G7LB 3IETA 2OXGA 4G8GD 1MJ7L 2FX7L 2VDOH 1RUQL 4X7EC 8FABB 1LEIA 4TVSa 5D1XA 2R29H 5CD3B 3G5VA 2SEBB 3MV7E 1P1ZB 3TVMD 2VQUA 2P44B 4WO4A 1CL7I 1YNKH 3MMEA 5H94B 1R6VA 1L6ZA 5JXEA 3MUHL 1VEOA 2DLEA 1I75A 4KDWA 4P4KD 4P2YA 5JIKA 2ZCHL 4DGVL 3MFFB 1FG2B 5C6TH 2GW5A 4FFZL 5FDYA 1RZ8A 5GJTH 3QUZD 2IC2A 4HMDA 1A1NB 3O4LE 3EJYD 2ED8A 4HIJA 2AV1A 3W9DA 3E8UH 4M1CC 5KS9A 4YWGL 2VE6B 1QFPA 4UV7H 5EPMB 3QXUA 4MMZC 3BN9D 43CAA 4XCFL 1MCPL 3I75B 4O4YH 1U3YA 3WYRA 4JREB 1HINL 2Z93B 3RWEA 2VXTH 5T3ZD 2G60H 2P5EE 3HS0B 3WS6A 3HC0A 2B2XH 4KKBC 1EAPB 2X41A 2AK1H 4LDEB 1CGXA 3G5YA 5B8CC 3DO7B 1JGVL 1LO0H 3PDDA 3PNWB 4U6HB 3ZDYE 2KPNA 3MYZA 5HVHC 1IAOA 4MNGB 5DJ8B 1JL8A 5GXBB 1SJEB 5HDBF 3O2DL 3RKPA 5TFSH 1VACA 2H2PD 3N1QC 5DO2D 4J12A 5F6HI 5BS0E 3KPSD 3ARUA 1F02I 2HT2C 3MBEC 3S4SG 5DD3H 5CJBA 3VE0B 4XPHH 4NCC1 1FBIH 3O3DA 1Z3GH 2Z4QB 1Q0YH 2X4TA 3NTCL 4KHTL 4LCIH 2AXHA 3ZKMD 2W65A 5DWUH 3VWJA 2A83B 2E7BA 3GNMH 3BZ4B 5IB1A 3VH8A 2XNAB 5IBUG 1KLGA 1A2YB 3T3PE 2P7TB 3ME0A 4WUKH 3G9VA 1PKQE 4NKQB 5F7DA 4GRWF 2R4SL 1JFQH 1W8OA 4OF6A 4OLYH 2X4OB 4ZAKB 2VAAB 4G9FA 3DNKA 3GSOA 3CDCA 2V2WA 5GPRA 4BH7A 1CU4H 2DD8H 5K9QG 5DRNB 4ZUSA 1PX3A 1TZGL 2GFBA 2ID5A 3VFWA 1BFVH 3IETB 4MAYD 3P4NA 1LEIB 4QHUA 3CGTA 1D6VL 5IT2H 1KB5A 5D1XB 3LIZL 3G5VB 4HFUL 4R7NA 3OXRA 5CUSH 4ZXBA 4N5ED 4WO4B 3TT1H 4RGMB 3GI9L 3MMEB 3OV6A 2E8YA 3KNBA 5DQDH 2MTPA 5KANG 2G75A 3F5WA 2BSTA 4MD0A 2V6HA 1RZ8B 1DBJL 3RDTD 5F6IB 4HIJB 2AV1B 3IXAA 4PJ5D 1UCTA 3W9DB 4C4KT 1QRNB 4WHDA 2Q3AA 4OBRA 1JHKL 2P43B 4TSBH 5KS9B 4OLXL 43CAB 1CFSA 4N0CC 5I8KL 3MV8A 1GVIA 3RWEB 1FDLH 3HC0B 4JHBA 1FP5A 2AJSL 4JO4L 4UU9B 4LSPH 1C1EH 5FKPA 3KPOA 3G6AA 3G5YB 3JTSA 3CVHH 3PP4L 3DHJA 4CNIA 1T21A 1FORH 1A1OA 1V3KA 1IAOB 1EUUA 3QFDA 4J3WA 4LVOB 1QLEL 1NBYA 3BUYA 4JHAH 1VACB 2G5BA 1UFUA 3FT3A 3OR6A 5H2BA 5GGSA 1YYLH 3F58L 2NNAA 1F6LL 4KK5C 1XT5A 2QSTA 1A4KA 4WCYL 2F5AH 2YC1B 1PQZA 2CKBL 2X4TB 5JUEL 2W65B 3QDHA 5D70H 3VWJB 1L0YA 5IMLA 5IB1B 3VH8B 1KLGB 5ISZE 3X13A 4N1CA 4QHKI 4OCMC 2BJML 5I1CL 4G9FB 3PWNA 3GSOB 2B5IC 1CQKA 2V2WB 3WCYA 1NQBA 4BH7B 3AREC 4PG2A 3EYVA 4ZUSB 4RZCA 4XTRC 2GFBB 1I7ZA 3VFWB 1GC1H 4NC2B 4CU6A 3P4NB 3CC5A 2V9TA 1GPOH 3S36H 3I6GA 4QHUB 1KB5B 2B7DT 3GMOA 3HG1E 4NGHL 4K94C 4R7NB 4Y4FA 3OXRB 4RRPA 2BX5A 4ZXBB 3GIVB 25C8H 2XA3A 3I6LE 4TSAH 4OJFL 5DJCA 1JJUA 2NY2B 5C0FA 2DQDH 3IJSA 2G75B 3F5WB 3FZUD 2BSTB 3FO9A 1CVSC 4EJ1C 2MJWA 4HIHA 1Q72L 4LLYB 3HNVH 5CWSA 1NCAH 3IXAB 4XBGA 2JCCA 3CDGA 4ODWA 3U4BH 4QXGL 3L7EA 1YNTA 1L4IA 1CFSB 2QQNL 1BREA 4XAKE 3MV8B 2WW8A 1QFWL 2BP3A 3WKMH 1JGDA 4RFNC 1KGCD 1W72A 5FKPB 4BUGA 1RURL 3KPOB 3G6AB 3JTSB 4BUHA 2JJTA 3B2UC 2EE9A 1T21B 1KJ2A 1M6OA 3BWUC 1RJLA 4YFEA 1A1OB 4L5FL 2VZTA 3JUZA 1UCBH 5D2NA 3QFDB 2PETA 1G9NL 3BEWA 4PJCE 3BUYB 1NBYB 2Q8BH 3UBXI 1RFDL 2FDBP 2M2DA 2G5BB 3VI3E 1OP3K 5KOMC 1AO7D 3FT3B 1NUGA 3OR6B 5H2BB 3MRFA 4M6MH 5HD8D 4TVPL 5GGSB 2NNAB 3B2VL 5HHMB 5DMIH 1A4KB 3LN5A 1PQZB 4MWFA 5H35A 1CGWA 5I1JH 2F8VA 1S5HA 4Z7QE 5C0AE 4OB5H 4PB9L 5IMLB 5DHVA 3MUGA 4LSTL 4J8RA 3X13B 4GQ9H 4MCYA 1FRGH 3GBLA 5I1LA 3PWNB 4Y2DC 3O3UN 3NAAL 2BNQA 3JXAA 3EYVB 3BPLC 4MA8H 4BZ2L 5FFLA 3Q6FA 3DI3B 2FJGA 4RZCB 1LK3H 2RHEA 5ADOL 1I7ZB 2DS4A 3T0XA 3CC5B 1VGKA 3I6GB 1YDPA 5DR5H 3GMOB 4F8QA 2IWGA 2ARJQ 4LSVL 3MOBL 4Y4FB 4KUCD 5FOBA 4TQEL 4KPHH 1MCBA 3ARVA 3MLWL 2QR0A 5DJCB 5I1KL 2C1OB 5C0FB 3SE8L 4KK6C 3IJSB 1MHPL 5F7NC 4WEMB 5L2KE 4ZNCD 2YRLA 5FHBL 2H1PH 2P48B 3OPZH 1I8LC 3BAEH 4OGYL 2Z8SA 2ZUSA 4FMKA 4HIHB 2O93L 3LPFA 4JQXC 5CWSB 5SWZE 35C8L 5ILTL 1KCSH 3MACL 5DK2A 5T3ZH 2JCCB 4APQC 3CDGB 1F4YH 2WAHA 4ODWB 4PY8I 5E08L 3L7EB 3IFPB 2FD6H 1YNTB 5EORH 1ONQA 1K6QH 3HUJA 3MV9D 1GGUA 2NLJA 5ITFA 1SJHA 5FF6A 1JGDB 1HYSC 1W72B 3GI8L 2P8PA 1CXLA 4G42A 2UV3A 1INQA 3MSPA 4AQOA 4EVNA 1VFBA 2OSLA 3FN0L 1DUYA 4JZNA 3HPJA 2XZCL 1KJ2B 1M6OB 1ULVA 1RJLB 1KC5L 2DMCA 1J1PL 4DUXA 5D2NB 1JGEA 1FZMA 3BEWB 4H5SA 4LPWA 3RPIB 2AEIT 2CR6A 4MA7L 4JRWA 1MIML 3C08L 2P8LA 3Q0HA 2RCSL 3VMPA 3MRFB 2VDLL 3G6DH 1JPSL 4PS4L 1JNHA 4GLRI 4P2QD 7FABL 1E27A 4HWEH 3LN5B 4OF7A 4N0FB 2QV2A 4MNHA 3UJJH 4MWFB 5H35B 2OS7A 4XP5H 1S5HB 2XQYG 1XEDA 5JDSA 5DHVB 1J8KA 3MUGB 4J8RB 3N1FC 4WWKA 1I3UA 4MCYB 4M6OH 1DBBL 3TWCL 1BM3H 1EO7A 2DTSA 3G6JA 4X80H 1KIQA 5I1LB 4JY5L 5FUCE 3BKML 1H15A 3RVTC 3VFVA 1QHOA 1EBAA 3ILPA 3Q6FB 3MLXL 1DEDA 2FJGB 4PJGE 4XWOD 5ALBL 4NOBA 1EO5A 2IFFL 3ZE2F 5MHSE 2WQRA 1KXVC 3VGEA 3DO3A 3FFCD 1VGKB 4YH6A 4B53A 2GHWB 5ALCL 1YDPB 5C92A 4DGIL 2QQKH 3P11H 1CS6A 4G7VL 4AT6A 4OZIA 4XI5C 4X6DF 1QBMH 4XAWL 2J8UA 3KXFD 3EKCA 2NZ9D 3S7GA 2QR0B 3UJIL 3U30B 3V6ZA 4QY8B 4Z0BL 2HMID 1NCCL 2HKFH 4AH2B 4X9HA 2IG2L 1D9KD 5IESL 1NKOA 3OF6A 4MLIA 1GGCH 3TT3L 4BM7A 4Z8FL 2HTLC 5KVGL 3QEGH 4QRRD 4P3DA 1ONQB 3TF7C 4XPGL 2NXYD 5CILL 3CFJA 2E27L 3HUJB 3LS4H 4PP1C 1S7QA 3AB0B 2IAMD 5ITFB 2NLJB 1SJHB 5IHZA 5FF6B 4X4ZA 4KUZL 2P8PB 1INQB 1FO0H 4OZGF 3T4AA 4EVNB 2N1KA 1VFBB 2Q76A 3CAFA 2OSLB 4XC3H 2IGFL 1DUYB 4JZNB 3SY0A 3HPJB 4M7LL 4OQ1A 3AXLA 4XVJL 1JNNH 2A1WH 2DBLH 4HS8L 1OTUC 5A43C 4I2XA 4M43L 3SDXF 3BKJL 1EH9A 1JGEB 1FZMB 4JFHD 1B4JL 4BYHA 5BW7A 5JW4M 2GT9A 4H5SB 2Z8WC 3BGAA 4KI5C 4HQQL 3DURA 4PYHA 4GG8A 2VUYA 2P8LB 3DMMA 1M1SA 1T03L 4YBQC 3CSYA 1JNHB 2DKUA 3EOAB 4OZHF 1WFUA 5C0NC 1E27B 3RNKA 3TJEL 3OAZK 4JHWH 4YBLC 2HJKA 3ESVF 2ZUQB 4MNHB 2NY5C 5HDQH 5MENE 3MCLL 3MJ6A 4TSCH 5JDSB 1QSED 5ID0A 1UXWA 4RIRA 3VW3H 3L5WA 3I85A 4EBQH 2XY1A 4WWKB 4PP2A 2UUDH 1BJ1H 4PJAE 1JGUH 3X12A 3G6JB 1KIPA 1KIQB 2WMPA 1H15B 2GQHA 4URTB 4OIAA 3LY6A 4FXKA 2BVTA 3VFVB 4YK4C 3IS1X 5LWYL 3ILPB 1CTNA 3IRPX 3ARDC 3IKKA 2FX8L 1OAUL 2W0KA 5KW9L 2ERJB 4TULL 3F7QA 4OCWH 1OTTC 5J11C 1EMTH 4IOFC 1J05A 2BVPA 4MJ5A 5I6XB 2EZ0D 1HILA 4AT6B 4OZIB 5GHWH 3I9GL 1AR1D 2J8UB 1SYVA 3LQAH 5D71H 4TOYH 3V6ZB 3R4DA 5HDLA 5J3HC 3OJDA 2X1OA 2X4RA 1R3LA 4JRXE 3K4DA 3KPMA 2EDRA 4IRZH 3EOTL 4JHZA 1H3XA 4MZ3A 4KTEH 5FM5M 1BFTA 2GY5A 1OHQA 1A6VL 4J23A 2X5PA 2FH8A 4P3DB 5F8QC 1ZANH 3CFJB 1WTLA 1S7QB 5IHZB 4BJLA 2WBKA 1I7UA 3WL9A 3DSFH 5IVXB 4Z6AT 2DQEL 3T4AB 4NO5A 2Q76B 2R29L 4JO2H 5BS0A 1CDGA 4XT1C 3SY0B 4Y1AD 1W2KT 1YNKL 3AXLB 2XWBA 3FO0H 4M3JA 5JOPE 2XKNA 3N1GC 4I2XB 3OB0K 3IDMA 2NY0B 2GT9B 4BSVA 2X05A 5C6TL 2E7LA 2ZCKH 2EDHA 1FFPA 3DURB 5GJTL 4GG8B 3WLWD 5IV2A 4POUB 3DMMB 5EBLA 4V2CB 5HTSA 2GYSA 2ZKHL 4R4NC 1PKQA 3CSYB 3H2WA 5HVWA 2XXCB 2ATPA 5BXFA 3BDYH 3E8UL 3RNKB 3C87A 4FFWC 4UV7L 1MI5E 1LQSR 2HJKB 3Q5OA 4M8QA 3RTQD 3S3PA 4BQCA 4M93C 4O4YL 1F11A 2VXTL 2G60L 4OZFG 5ID0B 1FSKB 1UXWB 4RIRB 2B2XL 3L5WB 4JB9H 3SJVD 4PP2B 1A7NH 2AK1L 4BK5A 3X12B 1LO0L 1KIPB 1NPUA 3O3AA 3MZGB 5B38G 5DD0H 5C0DA 5JO5A 4JFFA 1A3QA 4FXKB 4DEPB 4D0BA 3MRLA 2WBJC 4NP4H 1B9ZA 1R3IH 4S1RH 1P9MA 4U1KA 2NYYD 1NC4D 3ARQA 1URLA 3P77A 1J05B 2BVPB 2UVFA 4UAOB 4MJ5B 3H3KA 5EU5A 2GITA 5DD3L 3O4LB 1HILB 2KKQA 4XPHL 5E94A 1FBIL 1Z3GL 3PDOA 2XG4A 1Q0YL 4LCIL 4R97B 4NHUA 5B21A 2FATH 3NA9H 5DWUL 3GNML 5GS2D 3OJDB 2L0DA 4Y4KD 4WUKL 4ETYA 3DV6A 3IDYC 5E6ZA 2G5RA 2X4RB 5EUKA 1JFQL 1R3LB 1IILE 3KPMB 4M7ZC 4OLYL 3TBYA 1X4YA 5F7LB 1GYAA 1CU4L 1VERA 2DD8L 5C8JA 4GRLA 3B9KD 1BFVL 3O6FD 2WLZA 5H8DA 3WUZA 1ORQB 1I7UB 4NQED 3WL9B 5C0BA 5IT2L 1F4XH 1RMFH 1J8HD 4NO5B 5BS0B 3ARSA 1YEJH 4QWWC 3ZKSD 5CUSL 3TT1L 5SX4H 3JWDH 2XWBB 1A22B 5DQDL 1JHTA 3IDMB 1ADQH 2Q20A 4BSVB 1NGPH 2WV3A 1FFPB 2MQ3A 4QRSA 5IV2B 4LASH 5ISZA 1PKQB 3D3VD 2ATPB 5BXFB 3NCEB 4FRWA 5B4MC 4TSBL 5BZDA 4G9DA 4IRSA 4M8QB 1FZKA 3BPCA 3T0DA 3VXPA 4PJ8A 1F11B 5GGVY 4I0PC 3WHXA 4EI5A 4U6YA 3DETC 1FDLL 4I5BA 3TFKD 1SBBA 3D2UA 5DURD 4LSPL 1C1EL 3CVHL 4R6UA 3O41A 3O3AB 3PHSA 5J57B 4OI9A 5JO5B 3HTLX 4JFFB 4BELD 2R2CA 1YEDA 4D0BB 2D7QA 3MRLB 3LPGA 3P3YA 2FX9H 3WLBA 1G9MH 2HFTA 3QFJA 3UTTE 1ZWIA 4JHAL 4L8DA 5EZLA 2NR6D 3BXNA 3PQYD 4U1KB 1HH6A 1EV2E 3P77B 3ARWA 4AL8H 1G6RH 1DLFH 5EU5B 2GITB 1BHGA 1YYLL 2D03H 1Z9LA 5E94B 2F5AL 3PDOB 2XIDA 3QAZC 1ZK9A 3P4MA 1I9IH 4NHUB 5D70L 3V6OA 5E6YA 1FAKT 5FGRA 3BN3B 1IC5L 3OKKA 3DV6B 3K3QA 5FB8A 5EUKB 3PGFH 1NGXA 3TBYB 5DJDA 3CXHK 2Q86A 4D8PA 1QO3A 5KS9F 4HS6A 5J6HA 3DXAA 3RVVC 5C8JB 4WW2A 1ZLSH 4GRLB 4HUWA 1VADA 1GC1L 1HIMH 4WV1B 3MJGX 3SDYL 2UY7A 1GPOL 4PJCA 3S36L 5C0BB 2BK8A 3WBDA 1I7RA 2AK4A 2EE6A 4PGEA 4LSUL 3BPOB 1U3HA 2R8SH 1UZ6F 25C8L 2CH8A 4TSAL 4M5YH 1JHTB 4OGZA 5MERA 4EZMA 2DQDL 4YXHH 4L9LA 5C0AA 2EXWD 4QRSB 5DO2C