2Q1EA

Altered dimer interface decreases stability in an amyloidogenic kappa1 bence jones protein.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
ATDIQMTQSPSSLSASVGDRVTITCQASQDINNYLIWYQQKPGQAPKLLIYDASTLETGVPSRFSGSGSGTEFTFTISSLQPEDLATYHCQQYDNLPYTFGQGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloidogenic immunoglobulin light chain protein AL-09
publication title Altered dimer interface decreases stability in an amyloidogenic protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 26
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q1eA00
1MJ8L 1RSFA 2BVTA 2ZCLL 1JHTB 4ZO8A 4U1IA 3MV9A 5EN2A 3UC0L 3PHOA 2YOCA 4YXLH 2NYYC 4M8QA 2X7LA 1XIWD 1Z9MA 4JHWL 3WCYA 5CMAB 4ELKA 4OCLC 1MPAL 1NBVH 1LP9F 4XT1C 2J5LB 5E7BA 4GAJH 1X3DA 3GHBH 3O4OC 4HBCL 3TBWA 3WHE1 1FQ9C 1U8IB 3MRQB 2BVQB 4I18B 1X5YA 5IMKB 3HRZB 4ENED 4JQIH 5EUOA 3DNKA 4JKKA 4FQPA 4S2SB 4IIQB 4U1SB 1IC1A 1YUHA 5CUSH 4XNYH 4YH6A 1Q0XL 5DWUL 2F5BL 5E2VL 3ZKMD 4JLRB 3KS0H 1D5ZB 1QBBA 2BSTA 3ECBA 1YECH 4F7TA 1T89A 5IW1A 2ZWLT 5AYUL 4Y16D 4DW2L 3A6BL 4JRXE 2O5XL 3EYFB 3MRFB 2BXYA 3S88L 5SWSB 4LSUH 3ZYIA 1FH5H 4KJWD 2Y1VA 4WENB 1AR2A 3WN5C 1NC4D 1H3GA 3MO1B 4HGKC 5HHVL 3VFGL 3A6OA 1AE6H 1D5BB 5EU3B 4XX1E 4Y4KC 1YEKH 3MLYH 1ZVHA 4XP6H 1YYLL 3D3VA 3BPNC 1OAQL 4F7CB 5IT2H 3KPTA 4QNPF 4FXGA 4YE4L 1I3VA 1KJ3L 4K3HA 3U7WH 2DDQH 3SKNA 4CU7A 4MJID 5FYLH 3D25A 3IXAA 2ZUQB 4YLQT 1UYWL 3LRSB 4NO3A 5D1XB 3NZHH 1A02N 1IC4L 3IDJB 4L4TB 2DQEL 2J88L 3H9ZA 1YJDC 1RV6X 3PIQA 1J05A 3B3IA 2EDJA 2J8UF 4Y2DB 3IF1B 4NN5B 5B4MC 2BOBA 2DTMH 4WFHE 5JIIA 4OM1H 4YX2L 3QZWA 1MFBH 3QH3A 1JBJA 3C5ZA 1YEEH 3V5DB 3HCVA 2HLFC 1EGJH 5IHUH 4M7LH 4I2XB 4NQED 2DQFA 4X7TB 5DRXB 5D7IB 2V6HA 2OTWA 4N0UA 5DFVD 5C0CB 2FX9H 1JMXA 4MWFB 1F97A 3WFCH 1AGDA 3BUYB 3MNWA 3D0VA 2YWYA 1S7RA 3OKKB 3WLBB 2AK4B 1HINH 3SCMB 4NO0D 3VXUD 5C9JB 1U42A 4OLUL 3BD5A 1FBIL 3DXAB 1I8LC 1LK3H 1AXTL 2DMKA 1SJVA 2YPKA 1CXEA 3MLWL 5GGUA 1FLRH 4KQ3H 4DUWA 4PJEA 3ARTA 2X42A 2FJFB 4QT5B 5EIIA 1CDIA 1IM3A 1S7QA 2DQTL 2XTJB 3VXNA 5IEHB 1ZTXH 1I3RA 1FE8H 4D9LH 4UBDD 2ICEB 2FLBT 3DUHA 3PWPE 4KK8D 2CDGA 4JM2B 4XH2A 4ODVH 4ESKA 3P9MA 2GITB 1J8KA 1L9NA 3KJ4C 5I1GL 3KYNA 4L9LA 3NFNA 1ND0A 4XC3L 3CSYA 1CICD 3C6LB 3AC0A 1MCRA 4OF8A 1CLOH 5IG7B 5CZXD 3K1KC 3KXFE 5E7FA 1X6LA 4Z7UB 2NW3A 5IB1A 1ED3A 3BQUC 1QNZL 3VWJC 5DJAA 2DQCL 1N3NA 4JRYD 4N5ED 2XNAB 1KB5B 1HH6A 3JV6A 2R29L 4LARH 1N5YL 2I9TA 4HS8H 4QHUA 4P2YA 4LSTH 1A7NH 1FAIH 4AYFA 1NAMA 1ZHLB 5GS1B 2JB6A 4TSAH 3H9HB 5HHXL 4I3SH 3HC3L 4HJJL 3DSNA 1K6QL 3QG6B 2VDPL 3CX5K 4NSKA 2RJMA 3A67L 4LSSH 1RK0A 5TE4H 4Z78B 4XZUA 3LV3A 5H37H 5IW6B 1GOHA 1HKLL 4X6FA 2X6MA 2BCKA 4LMQI 3FQXB 5CEZE 5GJTL 3OG4B 5I8EB 4G9FD 5FM4A 2AJ3B 5DR5L 5LXGL 1NFDA 3BEWA 4JY4A 2DL9A 3ABZA 1ADQH 2VXTH 4JREC 2Q6WA 4ETQA 5D7LB 1NGWB 1UM6H 4N0YL 3MV8A 1KULA 2X4PA 4XMPL 3TNNA 3GIZH 1MI5D 3WFEH 4PLJC 5ITBH 1NUNB 1YMMA 5CEYB 3LH2H 5FOBB 4EUPG 1EDQA 4AEHL 4DZBA 2FHCA 4BFIB 4O2FA 4JFPA 1CLZH 2NY6C 3ELAT 2ICES 1DLHA 5ANMA 3TVMB 3LCYA 3EOAB 3NFPA 2WWMD 3C08L 4XNQB 4A6YA 4S0SD 1KIQA 3HAEH 5JHLH 4LASH 3TFKC 1XF5B 4YWGH 1G7QA 5ACZB 5I1EL 1ETZA 5J3HD 5C6TL 4O51A 4FQCL 4OZGE 1WZMA 4DTGL 3O6ML 4APQB 4PJDB 5SWSE 5BRZA 5ITFB 4YQXL 1HHIB 2NXYD 2EDTA 3MJGX 1KLUB 4XNMB 1IL1A 1YPZE 2JIXD 2DKMA 2X4NB 3B2VH 3WNKA 1LEKA 4D0BA 1A9BB 4YBLB 3HI5H 4JQXC 4KRLB 43C9B 4Z7VE 5D96B 3U30C 4UI2A 1S78D 4MXVE 1NAML 2DQHH 4IMKA 1HYRC 3GSOB 3SDXF 4NO2B 4UUJB 4LVOB 3DTXA 3N85H 3H7BB 4L3AA 5AG8A 3OR7B 1JGUH 2YUWA 4GLRH 5DJ2B 2ATPA 4ZQKB 2O61B 3DVGA 1U92A 4L4TE 5KS9E 2FEDC 2Y36H 3MLRL 2D2OA 5HD8C 3WUWG 2OM5A 1SYVB 2ZUSA 1CD0A 2X4QA 4R8WL 4FMFA 4G7YH 1B88A 1ZA6B 4GAGL 1JPGA 1MFEL 3NN8B 4HAGA 2R0KL 3VFSB 3HZYA 5TE7L 1J0IA 3GIVB 1FYHB 4RAUA 4XCCL 5D7IE 3KPOA 1HZHH 3BYYA 1LE9B 5C0CE 1V7NL 4HPOH 5DDHB 2CXGA 4NDMA 2DM4A 4A6YL 2AK4E 1Z5LA 4Z5RA 1EK3A 3EDKA 4ALAL 4BFEA 4LCYB 1IEBA 1VADB 3QDGD 5EWIL 1G9NC 2G5BA 2GTZB 1MNUH 5E95B 4S1SL 1FZJB 4JFXB 3V5HB 2P5WD 1WIOA 4WW1B 4N5UA 2XTJE 1KTLB 3MMEA 4GMTH 2XN9D 1XCQA 4I4WA 4PJAB 3TO4D 4WFED 5E9DD 1JZ3A 2A6JA 4Z77B 1TIUA 4HK0B 1OF2A 1PLGL 1U6AL 1R3LA 1RUQH 4JPIB 4YPGB 4OCWH 3NVQA 5FYLE 4XTRC 3DPBA 2UUDH 1NQBA 1CFNB 1F45A 4N8CL 4Z7UE 2LTQB 5ESQB 5DVLA 5TDNB 4J3WA 3TM6A 4NQDA 1XGQB 3MLZL 2I60L 1WCBA 2FGWH 2RAMA 1E4XH 5IM7A 3HHRB 5DJ0A 2XZQH 3SDAA 4C83A 4P23D 5D6CB 3IETB 4JFOA 1BVLA 3VFVA 4U1JB 5C0DB 3EBAA 1N5AA 2E3VA 2YA0A 1IGFH 2GJ6B 5LGKA 5FDWA 3FMGH 4F9LC 1UM5H 2R1XB 1M6OA 3AY4C 4NQEB 5C0BB 2FHFA 3BJLA 3LS4L 1C12B 1CFBA 4NPYB 4N8VA 3PABB 3QWQB 4M6ML 1CDUA 1I7TA 5D7LE 3CZFB 3KHOA 3NPSB 2EDXA 2QHRH 1JUFB 4KMQA 3FCTA 3O0RH 5DVNA 3CSBA 1DN0B 5IQ7L 3QEGL 5IESH 3ZTNL 1SY6H 4Z95H 3VGDA 3V6FA 5HI5C 4HX1A 2VAJA 4X99A 2XZCH 4KDWA 2MOVA 3QQNA 4NZDA 3ARFC 3D18B 1R0AL 1P7QB 3MV7D 2A6DB 3DBXA 2OL3H 4G8IA 4E5XA 1QLRA 3BZEB 2J5LC 4WVRA 4LEOB 4MJ5A 3V79C 3IFLL 5D70L 4ODBD 4XHJD 5DD1H 3GEWB 4YZFF 3QG7L 4I18C 5AZ2H 1IGCH 4NIKB 3LB6D 3QO0B 5ADPH 2XV6B 3TIEA 5F97E 2JJTC 4IIQC 3RKDC 4YHNB 5GGQH 1RD6A 3D2UA 5IB4A 4HIHB 1FIGL 2DLHA 5E8NA 1V05A 3TYGL 3HMWL 5FKPA 3QR2A 1BOGA 4WW2A 1S5HB 3HG1A 3VFUA 3C5JB 2NLJB 1PG7H 4PUBH 5ID0A 1WBYB 1EEQA 2HRPH 2R1WA 4ZYKA 2AJZA 4TUOA 3CC5A 1U8QB 1CS6A 5HYQB 2Q86A 4LSRH 3L3KA 5F8QC 4GG6F 1I7RB 4HDIB 4X9HA 5LCVH 1MFCH 4ZO6A 3BIBX 4OQTH 2AJUH 2EDKA 5E08H 3QIUA 4J6RL 3QEQD 1NGPL 4WO4A 4H1LA 3I75B 3QIWB 2P46B 3ILPB 3RWIA 1OTTC 2QADD 4K2UL 1DBKH 4Y1AB 1AI1H 4XPGH 1TENA 3TNMB 1DQLL 5C7XH 5DD5L 1S9YA 2ZUQC 1YN6A 4HXBH 5D1XC 5F1NB 3VFNA 2F74B 1FNHA 3G6AB 4PJIF 3M8OL 3VGFA 1H3WM 1L7TL 5EOQL 5KOMC 3MGTB 3B83A 3DX6B 4LPUA 2DIJA 1WVZA 1MJ7L 3EO0B 4WDIB 1XZ0A 3EO9H 4LSPH 2OL3B 3ARZA 4Y2DC 4ZFOB 4NN5C 4LBEA 5JQHC 2OK0H 1OAKL 4PYHA 1CF8H 2E6JA 1K85A 4YK4C 3D3VD 5CSBA 1JYNA 1RUKL 1AP2A 3GBLA 3B2UD 5K33A 3GMLA 4JGMA 2EC9T 1LEIA 4XP5H 2WUCH 4ODSL 4CADA 5SX5K 4AT6B 4C55A 3SKOB 1G7PA 4XI5C 4QGYA 5EO9A 4YC2C 3FB7A 3WIFA 4GAYB 4KZDL 2N7AA 1RUPH 3CK0L 1WBZA 1UKQA 2NXYB 3MJ8A 1I9RH 3FB6B 2R0WL 3LVEA 3SCMC 1I8MA 4KDVA 2A1WL 1A4JA 2AEPL 1KENH 2EH8H 2GTWB 4XCEB 4FQHA 4PJ7F 3DVNA 3C5ZD 2YD7A 3IRZA 3NA9L 3RKPA 3K2UL 1J1OL 1B0GB 3GJEB 3QO1A 4WV1A 2OR8A 5D7KE 4H20H 5ABDE 5IBLD 2VXQH 3RHWK 4G6JH 3PGCA 1JHKL 2XTJC 3BDYH 1MJ8H 2ZG1A 4V1DB 2ZCLH 3HE6B 1DUYB 1BHGA 3UC0H 1YC8A 4JM2C 5DZOA 4JHWH 2Z93B 2VLJA 1XH3A 4PJHA 3EJJX 1ORSB 1MPAH 5D1QC 5ILTL 3UJTL 3C6LC 1K8IB 1OWRM 1XF3B 2GJ6E 4ZFFB 1Q9KB 2BSED 4HBCH 3QI9A 3ZYZA 1QSFB 5C0BE 1IAKA 4QHMB 2OQJA 4HZLB 3MACL 1NKRA 3SGDI 1A6TA 5HVGB 4ZUTA 5HHOB 3E0GA 3F7PC 4DN3L 2XA3A 4YNYA 1T1ZB 3RVWC 4KMTL 1Q0XH 5DWUH 5DHVH 2XICA 2F5BH 5E2VH 2MKWA 1G7IB 2Q87A 3TBSA 3V4UL 5EZOL 4M7LT 2BRQA 4DEPB 4PRNA 1KEGH 1N59B 1WISA 2JCCB 3MREA 5AYUH 3VD5A 1TZHA 3IFPA 3DYMA 4DW2H 3A6BH 3GMNB 2O5XH 2HT2C 3S88H 2W59A 3GB7B 3X13B 4XBGB 1XGPA 3O4LD 3R0MA 5SV4A 2OCFD 4KGLA 5F21B 1JRHI 3C60A 4LGSB 4JKMA 4FQQB 2EICA 5HHVH 3VFGH 5DRNA 5ID1B 1ACYL 1SBSH 1G84A 5E4IA 1QD0A 3SKMA 1YYLH 4C4KO 1OAQH 1U2CA 4R7DB 3GBNH 3BZ4A 5IW3A 4FXKB 4WFHD 4YE4H 1DBBH 1KJ3H 4P59L 4GBXD 3S3PA 4F7EA 5HGHB 3L6FA 1W2KT 3TVMC 1FNGA 1FZKA 1PQZA 1UYWH 5C07B 1IC4H 2FL5B 3U0WL 2GFBA 2FH8A 4LCWA 2J88H 2OMNA 5I8KL 1UA6L 2E7MA 4LLYA 4APQC 5F1IA 2BP3A 3U0TB 3O8XB 1YMMD 3BYTA 4P23B 4UNTA 5D2NB 3REWA 1WWWX 2C3HA 1T7WA 4QRPB 4J1UA 2F58L 5JIHA 2DBLL 4YBLC 4XP9L 3FRPA 4XPHL 1ZANL 5T3XL 5I17A 1MCKA 5D96C 3SGJC 2XYCA 2AXFA 5DHVB 1DBAL 1I4FA 4Y1AE 1OP3K 1LO2L 1PSKL 3T2QA 2EDQA 4LVOC 1T21B 3JV5A 4OLUH 3ZKSD 1PKOA 5I1LB 3WEXA 4JFHD 1QUNA 3PWPD 2X4TA 1FBIH 4NQXB 5BRZD 1AXTH 2VXSL 5E94A 3ZMRA 2CDFB 4KWUA 1KB9J 3GBML 3MLWH 3QJFA 1OGTA 5E8EA 3KAAA 3QXVA 3HFML 3QUYA 3D39E 3OTTA 4RWHA 1KPUA 2DWDB 3DHMA 3BP7B 3KPQB 4ZODA 1GHFL 2DQTH 2GK0A 5C6PB 1CT8A 4DVBB 4KXZH 2XKNA 3U36B 5FM5O 3GRWA 4TPRL 5TQ2L 4ONOA 1WFTA 1ODAA 1R3JA 4UT9L 1MCNA 3FT4B 4IMLA 3WDHA 2RFXB 2E7LA 3PWJB 4XPTL 4DUXA 4U1IB 3MV9B 3N1MC 1J0YA 5EN2B 3X12A 3RPIB 3BE1L 1AD9B 4M8QB 5E99L 2H45A 2X7LB 4UOW1 4ZS7L 4YBQD 1QNZH 4ELKB 1YY9C 2DQCH 4FN0A 5FO9A 1N5YH 1TTUA 2R29H 2Z9TA 1FO0A 3TBWB 3V6OA 3WNMA 1VSCA 3QQ9D 4Q0XL 1JK8A 5ALBL 5EDXA 1YA5A 4V1DE 1GZQA 4LSQL 4CW1B 3HC3H 1GJIA 2EYTA 3H9YA 4HJJH 1LP9A 3HUJF 1K6QH 2P8PA 1UENA 3A67H 4IOFD 1NBYA 1HXMA 4HJGB 3CNKA 4K7PL 1SVCP 1HKLH 2BSTB 5GRVL 5GJTH 5DR5H 5LXGH 3PL6C 1WF5A 5IW1B 4JJ5A 4BQ8A 5DQDL 1TXKA 3IDIA 3OKYA 3ARQA 2LTQC 1QSFE 4N0YH 4XMPH 5HHOE 4I3GA 2APFA 1DUZB 4AEHH 1F3JA 1WWBX 1IGJA 4PS4L 2VH5H 5FKAB 3OXRA 3NACL 3C08H 4XPFL 1F5WA 3ARBD 3MBEA 4NYLA 3GRWL 2JCCE 3W0WA 4MYWB 2APVA 2DAVA 4FXGB 4OFVA 2DLGA 5I1EH 2HA1A 2O5ZL 1KTKE 5C6TH 4S1RL 4FQCH 3O6MH 5I0DA 4RMUA 1CFSA 3IXAB 5T5FL 3U46A 4YQXH 4NO3B 2YD5A 5E2UL 1V8HA 3VXPB 4KI1A 1S7VA 4ZMAT 4P9HL 3VG0L 5F88A 4EI5C 3B8SA 3NPSC 5HPOA 3PIQB 1J05B 3B3IB 4MB5A 5K93A 5JLZA 1TJIL 3SDAD 2BOBB 5IVOA 3AM8C 2EDBA 3QZWB 2VR5A 1FO0L 2AGJL 2VDKL 1NAMH 3BGAA 1HNGA 2DM2A 1CDJA 2XY1A 3M1BA 2LV4A 1T1YA 4M6AA 2DQFB 1FFOA 4PB9H 2VOTA 5C0JA 1C5DB 2ILLA 2OTWB 5IMOA 5C07E 2W91A 1UXSA 4LAJH 3MNWB 2WM0A 3E6HB 1S7RB 2VIRB 3S5LB 3CU7A 3S37L 3ULUF 3MLRH 1QRNE 3MRGA 1JV5B 4L3EA 2FH6A 1YEDB 5GGVL 1G0DA 5FECA 1WWCA 2H32A 3GKZA 3ZZ1A 4R8WH 4YFEA 1LD9A 4QRPE 2YPKB 4GAGH 4X4MA 1MFEH 2R0KH 3CPLB 5EU5A 5TE7H 1EHXA 3BXNB 1BZ9A 4XCCH 4PJEB 5IVZA 3SN6N 1NMCC 1EFQA 3OX8A 4GG8A 5EIIB 3UBXG 3QUZA 1V7NH 2YUZA 1IM3B 1S7QB 5E2TL 3S4SA 3VXNB 1I3RB 4A6YH 5EC2A 1INQA 4M6OL 3MROA 2VZ1A 4ALAH 4DKEL 2DD8L 2XPGB 5EWIH 5SWZA 4L9LB 4HJ0D 5TF0A 2PF6A 3D2UD 3NFNB 4Z8FH 4JFFA 4NJ9H 4S1SH 3V7AE 5I1AB 1R3HB 2VQUA 3QIWC 5D1QD 2FJGA 1DE4A 3VE0A 1F58L 2V5YA 2A83A 1ED3B 2M26A 5DJAB 32C2A 1N3NB 1FLTX 1FVDA 3UTSA 1JWUA 2I9TB 3ULSB 1T04A 4DQOL 1N8ZB 1QEWA 2ED8A 5GGRA 5JXEC 2JB6B 4G6FD 1GIGL 1PLGH 3CFIC 1ZGLP 3N9GL 3EYOB 3STLB 4HSQA 1G9EA 3RP1A 4WO4D 3DRTB 1RK0B 3VI3F 3O9WA 4XCFL 3B43A 5F44A 4MA7L 4XZUB 1IQDA 3LV3B 3P0VL 2I60H 1KCVL 4UTAL 5I8OL 3BEWB 1YNTA 4YHIA 1H8SA 3VFRA 1AFVH 4EIZC 3OAUL 2YD3A 2VLKA 2PW2A 3MV8B 1YDPA 2X4PB 1VFAB 4TYUA 35C8L 3TNNB 4HEME 4PYGA 3S36X 4CMMA 1YMMB 2AXGB 2HTLC 3H7LA 5CJBA 2FRGP 5DGRA 4DZBB 1DEEA 1Q9WB 4O2FB 3MRDA 4JFPB 4U2ZA 2AEIT 5CD5D 3WUZA 5JDSA 1DLHB 5ANMB 2EXYC 3LS4H 4HQQL 4A6YB 1U3YA 4FG6D 4HC1A 2EZ0C 3TZVA 4JFEA 1IRAY 1ZWIA 1F2QA 3FB5A 4OB5L 1L0QA 5BJTA 4F15C 4I3RL 1M05A 4O51B 3HB3D 2HT4C 1HYSD 5IQ7H 2RCSL 3SBWA 3ZTNH 7FABL 1SJXA 1GL4B 3HE6C 5BRZB 3BWUC 3QUMA 1BD2E 3PDDA 2NY0C 5CILL 3LZFL 1IL1B 3QDMD 5F89B 4QRRA 3ZE1E 4MD4B 5E8OB 4D0BB 1R0AH 1JNLH 2R8SL 3T0EB 5FF6A 5GIRA 5L2JB 3L3JB 4NKQB 4FQIL 3FONA 4JJHA 3VG9B 3IFLH 5D70H 2ZUVA 3VXSA 4N90D 3QG7H 3DTXB 4PRHE 4FZ8L 5TGBA 1MCFA 4IDJL 4AIOA 3O3EB 3IKCA 4PGCA 2ATPB 2Y6SC 1ZS8A 1U92B 4PB0L 4AIXA 5E5MB 4IJ3B 1FIGH 1CGTA 1NFKA 4QYOA 2ZOKA 3SDXA 2OLDA 4NQCA 4P0DA 4P2OA 2EDFA 3HMWH 3TYGH 2VUOA 4DEPC 3LOWA 2VLJD 1G9ML 5C0IA 4RISL 1I3UA 5MP6L 3AVEA 2F8OA 4HCRA 2Q8AL 2EE9A 3U4EA 4G8GA 5IVXF 2Z35A 5F9OH 5A3ID 3B4NA 1JHLL 4R7NA 3QFJB 4J6RH 4NDMB 4HC1L 3DURA 2EKJA 1Z5LB 1NGPH 3HZKA 4X5LA 3L5XL 3VD7A 4Z5RB 3WE6A 5CGTA 1I9JL 1PD6A 2P5EA 1JF5A 5EOCL 3EYQD 1IEBB 4NZJA 4K2UH 1S7WB 3QWRD 5HYSG 1U8NA 2D7MA 2EO1A 1DQLH 2NTFA 3PWNB 2C4XA 3DGGB 4OSUH 5DD5H 3QUML 4PJEE 2FBOJ 3M8OH 5EOQH 3UYPA 2V5TA 3C60D 1MJ7H 5DURB 3MMEB 2C3VA 1XCQB 4I4WB 1OAKH 3O8XC 2F9BT 3G08A 1FHGA 1X5GA 2GEEA 2YUVA 4B5EA 3WHXA 3DX9A 4NC2B 4X5WA 3T3PE 1V3JA 3FOMA 4ODSH 1KIRA 1RUML 3SDCA 3QUXB 4MVBC 1T5WA 3IRPX 4KZDH 4PRBA 1LNUB 3CK0H 4NQDB 2P24A 1WCBB 4LCWD 2I07B 4OV6F 1WFUA 2A1WH 5MEPB 2AEPH 1S7SB 3HS0A 1EHLH 3K4ZA 5DJ0B 4O02L 4QXTA 4FOMA 3U4BL 3SDAB 1UWXK 4C83B 3S9DB 3LKQA 3KG5A 4OF3A 4HBQA 4HCRL 3NA9H 4OUOA 1KJVB 3K2UH 4M1DL 1J1OH 1N5AB 3HI1B 5D72L 3NIGF 3D0LA 5FDWB 1EBPA 3VMNA 3RNKA 1M6OB 3RI5F 3STZA 1I8KA 1JHKH 4L3CA 3T1FB 3X3FL 2NX5B 3ARGD 4MCZA 4M7KL 3L3GA 4PLKD 3D85B 5GS3A 3SY0A 4H1LH 1E27A 4IS6B 5MENA 2ZOLB 2ARJA 5DUBB 2X1PA 5HGDA 1FCCA 2YRPA 4Z7QE 1U2HA 3KPSD 5DT1L 5CP3A 3ZLQC 5ILTH 3UJTH 5T1KD 3V6FB 4HX1B 5AAWA 3HA0A 4MDIA 2BJML 3QUYD 3F58L 1R5WA 2NY1D 3MRJA 2IAMA 3MACH 4X7FC 5ANME 3MOBL 3BZFA 2VR4A 1U8JB 3JZ7A 4DN3H 4G8IB 4E5XB 1A7RL 2VZ3A 1QLRB 4I9WD 4KMTH 4MJ5B 4PTUA 3MODH 2MHAA 2PXYD 2DM3A 3V4UH 2PKDA 5EZOH 3FO1A 3EOTL 4J3OC 5AUMA 1N6VA 1T7VA 4H26B 2UZXB 3VXTA 1WAAA 1SQ2N 5F1KC 5IB4B 4Y8AA 4PJFF 3A6CL 1CLYL 4WTWA 2EEAA 3OR6A 5T1MA 4F58L 3T0EE 3QXTA 4C56B 5E70A 3NZ8B 1BOGB 4WW2B 3HG1B 2NZ9C 5TQ0L 4EI6A 3MOQA 3BP5A 2X5PA 3WDJA 5ID0B 1ACYH 2E27L 4DCQA 3ARYA 2R1WB 4GQ9L 4ZYKB 4N0FB 3GSRA 4TUOB 3B5GA 1UCTA 4KKBC 1WQVT 1U8PB 2OTPA 4P59H 3AU1B 3QIUB 2CXKA 1JCKA 4ZO7A 4RMRA 4C54A 4JHAL 3RWIB 1QP1A 3RY4A 3GSNH 3QPQC 4MSWB 3MJ9L 3U0WH 2YD6A 1NGQL 5ESAA 3L7FA 3I3EA 5I8KH 5J11B 1KTDA 4GG6A 3EFFA 2GW5A 1DQDL 1UA6H 1U8LA 6FABL 3PDGA 4Y5XA 3KPLA 5HJ3A 4QHKJ 3VFNB 1GPOL 3MNZA 2MQ0A 5BV7L 4TVPL 1IQWL 1QLFB 5E5UB 2F58H 1E28A 1K4DA 3QFJE 2DBLH 2EKSA 1XZ0B 4GKOA 4XP9H 4XPHH 5T3XH 1EZVY 5K9JL 3CAFA 3W9DB 2VC2L 4NZRL 4R4ND 4Y5VB 3QJHB 1HSBA 2V2XA 4D9QD 1DBAH 2IANA 1LO2H 3GMLB 1PSKH 4G6ML 1MVFA 3T8XA 4KK5D 2R2CA 1P53A 4C4KT 1FNEA 4L8DA 4HWBA 1G7PB 5EO9B 3FB7B 4AEEA 3ZDXE 3KPNA 2VXSH 3HNVL 1NL0L 1OTUD 3ZT6A 3GBMH 5CWSB 3MJ8B 4MQXD 1NMAL 1HILA 1A3RL 5DYOA 5J6HB 3HFMH 1A4JB 5K9QG 3ZKNC 3PHQA 4ZPTB 1GHFH 4BZ2L 4M5ZL 1E6OL 4FQHB 1JMZA 4YDIL 4JO3L 4RCAA 3QO1B 3ROOA 2YHGA 4WI5A 2IMMA 4TPRH 5TQ2H 5F1OB 3RQ3A 3TBYA 3WYRA 3UTQB 3IFOA 3PGCB 3U9UA 1ZGLB 2WUBL 4UT9H 4P3DB 4PJ7A 4XAWL 4G7VL 4XPTH 5T1LB 3R06B 3GSNB 3BE1H 4MHHG 1J7VR 3J7HA 4L3ED 3RRQA 3MYZA 4U7MA 5E99H 4ERSL 3V4PL 3PV6A 5DJZA 4PJHB 1S9VA 2DYPA 2G75A 3G5VA 4O58L 4M3JA 5HDBE 1CCZA 2BNQA 3WS3A 3F6LA 2E9JA 4QKXB 3QHZL 2F54A 3QI9B 3K7UA 2XI9A 4Q0XH 1V3KA 1IAKB 5C0EB 1RFDL 5ALBH 2NX5E 1KXTB 3QUZD 4LSQH 1A6TB 4ZUTB 5HHNA 3MR9A 2NCMA 1HHGA 4P2RA 1RAMA 4K7PH 3BSZL 3VI4E 2CUMA 5SWZD 5DA4A 1P1ZA 2RIKA 1U8KB 4KAQL 2Z8WC 4HWBL 1A6AB 4J3SA 3IFPB 4PY7A 5DQDH 5KVFH 3CFKB 5SX5H 5JIPA 1H15B 4HLZG 1HK6A 4D0CB 2BK8A 2P1YA 3B6SA 4MXWL 3TWCL 3H9SD 3VDBA 4LNRA 3MGAA 3C60B 4PS4H 4EJ1C 2CRMA 4GW4A 1HSAA 3NACH 1I7UA 3SPVA 4XPFH 4RGNB 3GRWH 2R0ZL 3BZ4B 4I0PD 5GGSY 2O5ZH 4P49A 3RX8A 4S1RH 4JY6B 5J1AA 3L6FB 5BZDA 5MEOA 3NIFE 1FNGB 5D5MA 3O9WD 5J06A 1XGYL 3NCJL 5E6IA 2BHUA 5T5FH 4U1MA 4LP4A 5E2UH 4C56E 5K59F 3RFZC 4W6WB 5I8CB 4P9HH 2YZ1A 3VG0H 3CFCL 4MDJA 1ZVSA 3IDXL 2IADB 1M7DA 4Q6YA 5HHPB 4RDQG 4LLYB 1TJIH 5LBSL 5I2IA 3ESVF 2AI0L 1QRND 4P57B 5B3JE 1FO0H 4YHPA 3AUVA 5FM8A 2AGJH 1RZJC 2VDKH 5EFIB 3REWB 4J1UB 4KRPD 4MA8L 4UU9A 3MTRA 3MCKA 2V5MA 5KSBF 1EEYA 3AB0C 1IARB 3U6RA 3T0EC 5I17B 1JPTL 1AHWA 4KI5D 4WUKL 1RURL 2AXFB 3VG9C 1FORL 1I4FB 1ACZA 1ITCA 2OX5A 4LCUA 4U1GB 3S37H 1V3LA 1GRWA 1F13A 3OQ3B 1P5UA 4PJ5B 4P46D 2EDNA 5GGVH 3WEXB 2AJSL 4X9IA 4PJ9C 3DUUA 1AGEB 3F8UB 4PR5A 5E94B 1FVEA 4IJ3C 4MD5A 2Y06L 4EBQL 3QJFB 4KJPD 5JW4Q 1FZOA 2ITDA 3QUYB 4YPJA 2NY3B 2NY1B 2VXUL 3ZE2E 4RFOH 5C0RL 5IIEA 1KPUB 3PP3K 3MC0A 1JZ7A 5E2TH 4HGMA 4LHUA 1J0KA 4EVNA 3VXSD 5DSCA 4M6OH 5IUSA 3IFNL 4JHZA 3NABH 1AQKL 4P2QE 2H6PA 2NY5C 3Q0HA 5I1HH 2P7TA 3LD8B 4JKLA 4DKEH 2APWA 3EJYC 2DD8H 2R39A 1P9MC 4HZAA 1QR4A 1R3JB 1TPXB 1OP5K 5IOPA 4IMLB 3VW3L 2VDML 3I6GA 2WIIA 4JZJA 5LWYL 3KYAA 1ZEAL 3UTPD 3R4DA 3X12B 4ZFGL 4NQCD 4P2OD 1F58H 1M7XA 3QUKA 3ARDA 3GSWA 5FUCE 3WKML 4QRTB 5GJSH 1A1OA 1AXSA 3VFPA 2DN7A 5FGBC 2J2ZA 4DQOH 4WHYH 5F7EL 1I1CA 2I5YL 4AIZB 3VRIA 1GIGH 3N9GH 1GZQB 4P5MA 3LRGA 4IRSA 3SE3A 5DMKB 4P3WA 2EYTB 1LP9B 1FYTB 3LQZA 2XWJB 3WFBH 1HXMB 4XCFH 5E8PA 4Q6IB 2P5ED 4MA7H 4UQ2B 4HHAA 3P0VH 1KCVH 4UTAH 2VZSA 3RIAF 5I8OH 1OP3H 2H2SD 2HT3D 2GK2A 3OB0K 2OI9B 4JJ5B 3QUXC 1E4KA 2H32H 3HUJA 2WWKO 3OAUH 3AAZB 1KIPA 4CN1A 3V8CA 35C8H 5GZOD 3FAWA 1UQSA 4H25A 1XR8A 4NOBA 1ZLVK 3NCCB 3OXSA 2O5YL 1T20A 1F3JB 5GRXG 1F4YL 1BD2D 4ZTPL 4W6YB 2Z4QB 4O9HH 2E7BA 1HHHB 4MNGA 3ZSSA 2ADFL 3WFZA 5T33L 4HQQH 3VXRA 1BMGA 1MHPL 4HS6A 3MBEB 4NYLB 4RAVB 2BNRA 1N0XL 3W0WB 5DRZA 1BP3B 3FQWA 4I3RH 1BJ1J 4ACPA 5DD3L 3SDCD 5I1CL 2C4FU 4BKLB 7FABH 5HGAB 3U46B 4PRHD 5CILH 3LZFH 1S7VB 5BO1L 5F88B 2WNGA 4LRIA 2ESVA 3WUWA 4Y8DC 1QFPA 4CVZB 2R8SH 3Q6GL 4RGNE 4OLZL 1JZ2A 4CJ0A 4FQIH 5BZWB 4XVJL 2APBA 5ESVA 5B38B 2Y5TA 4AEFA 1E4WL 2VLRA 1T1YB 4FZ8H 1FFOB 3L5IA 5KSAA 1ZHBA 4IDJH 3RU8L 5C0JB 2J8UB 5IMOB 3UX9B 4OD2A 5ICXB 4QEGA 5MEND 4PB0H 5C1MB 3VXOA 5EUKB 1NH6A 3DMMD 5EO1A 1HI6A 5FECB 2H32B 1G9MH 4J8RA 4NHUA 1RHFA 5BW7A 5L8JB 4RISH 4TNVF 5MP6H 2VERN 1MFNA 1HXYB 4TVPD 4U6XA 4LQFL 2Q8AH 5I0ZA 4HEPG 5EU5B 4ZS6D 2IAMD 3L3DA 2JB5L 4WHTA 2NY2B 4GG8B 3OX8B 1MEXL 4WW2C 1UT9A 1F3DH 3EKCA 1YQVL 2GT9B 1JHLH 3S4SB 3CLEL 4P5KB 2VNCA 4P5TA 4HC1H 4JY5L 1INQB 4HUWB 3X11A 3MROB 4YHZL 1L0XA 2VQ1A 1I9JH 4UOJA 4PJ5E 5EOCH 3UCRA 4MCYB 2R1YB 5MHSD 4ODHL 5SWZB 1KCKA 5TF1L 3V95A 4GS7C 3BN9C 3RZCB 3QIUC 5CBAB 1IEAB 4JFFB 4NWTL 1MIML 3NIDF 1KXVC 3QUMH 3UJJL 4BQBA 2A38A 3KS0J 3DARA 4FQ2L 1DQJB 3F12A 1FPTL 1XF2A 2EO9A 1FVDB 4PRPD 3UTSB 1U3ZA 1JWUB 5E24E 3H3BC 1LE5A 5HYJA 4WI6A 1T04B 5FYJE 4L4JA 5GGRB 4MD0A 4QRQB 1F2XK 4ZNEA 4J3VA 4N0CC 1MJJA 4Y5VC 2PO6B 2YC1A 3WXVL 2J8OA 1C1EL 3FN0L 4ZO9A 5GS2D 3U7YL 2Z31B 1FJ1A 1YNTB 4YHIB 1EEUA 3VFRB 3P4OA 3W2DH 3W82A 3UDWA 4OZ4B 2VLKB 1UWGL 2PW2B 1YDPB 1FFNB 4HCRH 2P47B 4U1KA 4CMMB 4M1DH 3ALPA 5D72H 4L8CB 3F6IA 3ZO0A 3ULUL 5IVNA 1LP9E 1P7KA 2CQVA 1DEEB 1FYTE 1T4KA 4PRID 3C87A 1TJGL 5JDSB 3X3FH 1S9WA 4M7KH 4PGBA 4JO2H 5FUCC 5T3ZL 3WNNA 2IAND 3TZVB 4JFEB 3TN0A 1ZWIB 4WFFE 5GSRA 3FB5B 3SGKC 3RI5K 4ISVA 2YD2A 5DQJA 5BJTB 2CR6A 3S34L 5ENWB 1EPFA 1M05B 1NGXB 4IEFB 1JZ4A 2BC4A 2X4OA 2BERA 1JYVA 5DMGC 5DT1H 2CLVA 4OIIL 4CMHB 1RZGA 5K9QI 3SE4A 2BJMH 4F7MA 4QRRB 3TH2T 3EFDL 1BEYL 3CZJA 1I1AB 4OJFL 5FF6B 2C3GA 2KQNA 5ICZA 1INDL 3ZYJA 3RJQB 3V0WL 3W5NA 3W0WE 2AK1L 3QI9C 3RX7A 4POZC 2AKRA 2PTTA 4X0KA 3EOTH 4MHHI 4NZTL 1EJ6A 3E6FB 5JXAL 3IKCB 4PGCB 3W11C 1JL8A 4FHBD 1BBDL 2CO7B 1ZSDA 3A6CH 4PJ9D 4HAFA 4QNPE 3BPOC 1CQYA 1T6VN 4QYOB 2ZOKB 3SDXB 4F58H 5GZNC 3B9VA 3AMLA 2OMBA 4XRCA 2Q20A 4YEEA 1GOFA 2V9RA 1VGKB 3QHTC 2DYPD 4PJGF 1KJMA 3PP4L 2BNQD 3CD4A 4M43H 3RDTA 1T1WB 2E27H 4Y5YA 5GS0D 4GQ9H 1MQKL 4QHKI 3U4EB 1NUDA 3GJFA 5F7DA 4DFHA 4G8GB 2J8UE 5EBLB 5LQBH 2J7LA 2VQTA 1KTRL 5BS0D 3DURB 5IJVB 1OVZA 3HZKB 4AK1A 4JHAH 2Z91B 3WE6B 3R1GL 4RGNC 1TVBB 3AREA 3I3BA 1B0RA 4JANB 3MJ9H 5F9AC 1BAFL 1NGQH 3O3AA 1M1SA 3Q6FA 4M4PA 1GGTA 4EDXA 2EIEA 1DQDH 1U8NB 3NTCL 4HLJA 3S97C 2NTFB 1EBAA 1HHJA 4X4ME 5CP3H 1DQTA 3MZTA 3P0GB 3PQYA 2GUOA 1CGVA 4LSVL 1QFHA 5BV7H 4TVPH 1IQWH 1H3PL 3O3BA 1QG3A 3F7VA 3VD3A 2UWEA 4X8JB 5FV1L 3KVQA 5K9JH 4AL8L 2VC2H 4NZRH 4OZIE 3G08B 1JZ8A 1MOEA 4U6HA 1NCUA 4WUUA 4WU5A 4F7PA 1C5CL 3EOBA 4UB0L 3DX9B 2O93L 4G6MH 4BH8A 4X5WB 4X6CF 4JFFE 5IBUG 1W0VA 1BLNB 1KIRB 4URTB 1NLBL 2LU3A 1JVKA 2LVEA 1T5WB 1UWEL 4PRBB 1RZKC 1YEHL 3HNVH 3PJSA 1NL0H 1IAIM 4Q2ZB 4M03A 4LDOB 4U1GC 1NMAH 5GXBB 3UTSE 1T7YA 1A3RH 3GMMA 2HRLA 3HS0B 4JVWA 1L9MA 3TJHC 4BZ2H 1X5LA 3NA4A 4M5ZH 2V7HB 1E6OH 3IKKA 1OAUL 4U3HA 4UV7L 4U1HA 4YDIH 2EE6A 3LKQB 2HMID 4JO3H 1DVFC 1BFSA 1S8DA 1B4RA 3S6CA 4DFIA 1T0PB 3D0LB 1KN4L 2NY3C 4W4OA 1IM9A 1CDGA 2AV7A 3RNKB 2XIDA 3STZB 4N8PA 1I8KB 4L3CB 2WUBH 4MCZB 1FP5A 1E27B 2JF1A 4WJ5B 5EUOF 3KLHC 4ZUWA 4F80A 1SJHA 3NCYP 5AD0A 4GXVL 3LD8C 2ZSWA 1TJHL 1YNLH 1J18A 5HGGS 2ARJB 1AXIB 4FZEL 4ERSH 3HC4L 5HGDB 4ZUUB 1TPXC 3WLWD 4HPYL 5CHNA 1NBZB 3IJYA 4HF5L 2Y5EA 4O58H 1OM3L 4PJXE 5EU6D 3HPJA 4MDIB 5IWLA 5LG1A 5D2LF 3QHZH 4L4VB 4P9HC 5BV7B 5IKCA 1R5WB 1RFDH 2IAMB 4WWKB 3BZFB 1RMFL 1UC6A 1I7ZB 1AKJD 4GKZA 1KB9K 4E41B 1FDLL 4JFEE 4GRWE 1PBYA 4F57L 4PTUB 4LLQA 2MHAB 3IVKA 2LQRA 5H37G 3BSZH 3U4AA 4MAYA 3FO1B 3VCLA 3IU3B 1C16A 3MRLB 2EDWA 4KAQH 5AUMB 4JPWL 4ZDHA 4HWBH 3VXTB 4TTDD 5E8DL 1DANU 4QRRE 4MJ4A 1MWAA 5ICYA 2WBKA 5JOPE 3LEXA 4Q6IC 3OR6B 4L29A 1RULH 3QIBA 2D31A 2VISB 4MXWH 3TWCH 5JHDB 1BQLL 2VN4A 3ARDD 3P11L 1Y18A 4EI6B 5J7CC 2OI9C 2JJWA 5D1ZC 1VACA 4PJFA 3HAEG 4DCQB 4KROB 1P69B 1UWXH 4BUGA 3GSRB 5L8LB 2R0ZH 3IDGA 3FJTA 1PW3A 5FOJA 3WJJC 3IXTA 3VRJB 5CJXC 2VE6A 4D9RE 1YN7A 3NCFB 3GSXB 3NCJH 5CZVL 4EOWL 2P48B 4CN4A 1CGUA 2DQIL 3MBEC 5IK3B 1IVLA 2HKHL 3DETC 5ESAB 3CFCH 3L7FB 3IDXH 1KTDB 4GG6B 3EFFB 4LMQE 1VHPA 1U8LB 4Y5XB 5LBSH 3KPLB 3JTSA 5HJ3B 4F33B 3ZKXB 4CN6A 5ETUB 4G8GE 1QR1B 1NEZA 4MA8H 3MUJA 2D7OA 5DO2C 1E28B 1K4DB 4KHTL 2EKSB 1DSFL 3BKYL 1I1YB 1JPTH 4MLIA 4PJ8A 3VXRD 4EQ2A 4WUKH 4A2MA 1HSBB 1RURH 1FL6A 2BHZA 3D87B 3ME0A 4PJIB 2V2XB 1FORH 4MA1B 2LU4A 4Q9QL 4JDVA 4ZXBD 4OLEA 1SMAA 3T8XB 5KVEL 3EDDA 1BX2A 5MEQA 2WBJD 1FNEB 3FQRA 1NANI 2AJSH 2Y9RT 4NM8L 2A0LC 3MJ6A 1IAIL 1MWAL 2Y06H 4EBQH 2H3NA 5EBWA 5DMJB 2ESVD 1CZ8L 2VXUH 1R3KA 2X89D 1O5DT 2VMFA 4FFVC 3PHQB 3QCVL 4IRJA 1MCJA 4HT1L 3GO1L 1QSVA 4HK3N 5HHQA 1QLEL 2AAVA 3SDDD 1A0QL 3IFNH 2YD1A 1AQKH 1BIIB 2VLRD 2NY2C 2P42B 5KSAD 3TBYB 2Q8BL 2OYPA 3U9UB 4F9PA 1K9TA 4LCCB 1BREA 3VW3H 2VDMH 2DJSA 4PJ7B 1NDMA 2YA1A 5LWYH 1P7HL 3EJZD 1ZEAH 3UXFA 4RMWA 4ZFGH 4KJYA 3GMRB 1KBGL 3L3HA 1MCPL 3B9KA 4M1CD 2ZJSL 3MUHL 1J8HA 1BECA 4RA3A 4V2BA 2IQAA 4HXAH 3PV6B 5DJZB 3RZCC 1S9VB 5L6YL 3WKMH 2G75B 4QOKB 1P2CA 3O6LL 3I85A 4D8PA 3WS3B 2F54B 5F7EH 3VFOA 1NFDF 2I5YH 4OGAD 3UP1A 3HRPA 2D7TL 3HE7D 1EERB 4HUUB 1EX0A 5H2BA 1ZHKA 4K3GA 3TA3A 4PV8A 3MR9B 3CFEB 3INUL 3W11D 4P2RB 4HW6A 3SGDH 2C3XA 4MX7A 1P1ZB 5J89A 4MNQB 4FTVA 3PG2A 4L4VE 2PO6C 3RVTD 4K8RC 4GMSL 4G43A 4M9PA 4KKCC 3RIAK 3TH3T 3UEZA 2PETA 2O5YH 2Z31C 5E03A 4E41E 4LNRB 2C7UA 1F4YH 1WC7B 4OGYL 4ZTPH 1MY7A 3TCLA 1HQRA 4BQ9A 4G42B 2P4AB 2ADFH 1HSAB 4OF0A 4U3CA 3S35L 4EN3B 3TIDA 4H88L 5T33H 3SPVB 1E0OB 3IDYC 1MHPH 3GK8L 1MUJA 2DKSA 2YR3A 1N0XH 3ZKQD 1IAOB 5DD3H 5I1CH 1NUGA 4IOIA 5BZDB 5MEOB 2J1KA 2XZZA 1EO7A 3FZUD 1U91B 2X9WA 3DV6A 5D5MB 4YZFE 5E6IB 5TFSL 4U1MB 5EULV 3TZVC 4OZHE 5JHDE 3MUY1 5D7JB 3LY6A 4MDJB 4R2GD 1ZVSB 1SVZA 1TCRA 2NR6D 5I2IB 3CUPA 3Q6GH 4CMHC 3HI6L 4OLZH 1NDGA 2CIKA 4U7KA 4XVJH 3I9GL 4LKCB 4MQ7A 4OLXH 4YHPB 3UAJD 4PG9A 4UU9B 4A2LA 1D9KA 3SJVA 1I1AC 1ZLSH 3RU8H 1AHWB 4OFDA 4Z7WA 3P30L 3IDNB 4R0LA 1QHPA 3IYLW 2JJVA 4LCUB 5EIVA 3OKOA 4CVXA 2ZUXA 2ICWB 2DLFL 1KCRL 5KSBA 3D69A 1R5VA 1IKNA 3MCG1 5JTWA 4BSWA 1CXLA 4ORGA 3KYOA 3IDMA 1FVEB 3RVUD 2CK0L 2H9GA 2V7NA 4LQFH 4KK6C 1FZOB 2JB5H 4G6KL 3FHQA 1AD0A 3OF6A 1MEXH 5IB3B 3FO9A 4LF3A 4TNVK 4NN6B 1YQVH 4PJIE 1DDHB 3CLEH 4LHUB 4OZGF 5HI3C 4JY5H 4EVNB 4GRLD 4YDKL 5BMFL 4YHZH 2H6PB 5EBGA 2EECA 2P7TB 3P3YA 4OBSA 4WTXA 4EDWL 1JN6A 1YPZF 4YHLH 4ODHH 5TF1H 3GMQB 1EZVX 4HUKB 4TUKL 5IROA 1NGZB 2A6KA 3I6GB 2W65A 1MIMH 4JZJB 4NWTH 2PYEA 4Y4FD 1A6ZA 4Z7VF 4ELME 3UJJH 1X9QA 1GOGA 1MFDL 3QUKB 4LIQL 1CD1B 4NFDA 3RNQB 4MXVF 4FQ2H 4QXGL 3EHBD 3GSWB 3W39B 1FPTH 1CVSC 2HN7A 3FFCA 1AXSB 3OJDB 2WAHA 3AS3A 4YGVB 1EVTC 3G5XA 3Q3GA 1PVHA 3MRCB 4BK5A 3G04A 2IPUK 5CD3A 1WSST 3VRIB 5CS7A 2DMCA 5KS9F 1ZT4A 3WIHA 5F9WB 1ZXQA 4P5MB 4IRSB 4PJ7E 3PV7A 1A6UL 4JPVL 3LQZB 3P2TA 2AJYL 5E8PB 1B6DA 3WXVH 3FN0H 1C1EH 5DLML 3U7YH 1MCEA 5K9KA 4QOKE 4UDUB 4WFFD 5CBEB 2F54E 4LU5L 3HUJB 4NUGL 3D48R 2VABA 2G9HA 3PQYD 3RVVC 1UWGH 1KIPB 2YBRA 3F7YA 2XZAL 2W0PA 4GH7B 3WD5L 3QXUA 3OXSB 1U8HA 3Q5TA 1NJ9A 5H8DA 3DUSB 3ULUH 1T20B 1RZ8B 5IMMA 3BWAB 1WZLA 1DR9A 4XAKE 5C2BL 4MNGB 4P2RE 1TJGH 3LKRA 1FN4B 1GGBL 3MYJB 2DIBA 5T3ZH 3PP3H 4HS6B 5DK2B 4MQTB 1WCQA 4MNQE 3VXUA 2BNRB 2R69L 4R4FL 1Y6NR 3FQWB 3S34H 3JVGA 4RMSA 5KAQG 4HKJA 1F4HA 4BH7A 5C09D 1XR9A 1CFVL 1AR1C 4OIIH 3MRNB 3PF2A 1OP5H 2YKLL 1NC2D 4LVEA 4WGVB 3J8F7 1MCOH 5JNYA 5DRWA 5HVFB 3EFDH 3I02A 1BEYH 4HV8A 2ESVB 1DL7H 3K8KA 3QWOA 4OJFH 5CKAA 1JNHA 1INDH 2CH8A 3T0AA 2AK1H 5ESVB 3O6FB 5BV7C 5GRWA 5B39G 5J13B 2Y5TB 1IM9D 4WWKC 1OQOA 3WIHL 2VLRB 2CRZA 5D7SL 3GNML 1CICA 4NZTH 5EU4B 5JXAH 3DYOA 3R8BB 4JFDB 1BBDH 4OAWA 5T5NF 4TNWF 1UKTA 3MLPA 3ILQC 1EFXD 3KLAB 3NCYS 3VXOB 1LK2A 5HYSA 4OCXL 4KK9D 5EO1B 3PP4H 4NHUB 1FNLA 4ODWA 3OB0H 2K1MA 1PKQE 3MLUL 1MQKH 1KEML 3L3DB 4WHTB 3BT2L 3BRGC 1U36A 3LN9A 1FNAA 3ZL4L 2W38A 3ULVD 4P5TB 1UZ6F 2FGZA 3LKNA 4YDJA 4NO5A 4NNXA 4KROC 3X11B 3ZHKA 3R1GH 4MAYD 2VQ1B 4G9FA 2FYYA 4L5FL 1OAYL 1BAFH 5HI4D 3SGEH 4LFHG 4JKWA 3BGMA 3NTCH 5F96L 8CGTA 4JO4L 2HP4A 3QDJD 2HTKC 4HGWB 3QIBD 4LSVH 3UYRL 1WBXA 4HUNB 1H3PH 2D0HA 2WV3A 3F12B 2AV1A 2F53B 4KJQD 1XF2B 4JAMA 1MRDL 1VFOA 4Y5XC 4GKNB 2GSIA 5ADOH 3TO2A 1F02I 4NRYA 4AL8H 2VDRL 3ZKXC 5HYJB 4HFUL 1LE5B 2MWCA 2VN7A 4NC1E 1LEGA 4QTIL 3UZVB 1KNOB 1C5CH 4UB0H 3S96A 3OGOE 4YFDB 1QSEA 3QA3B 4RBPH 1CGXA 1JF1B 5ISZA 5DQ9B 1NLBH 3QYCA 2XQYG 1W72A 1UWEH 4IBLT 2YA2A 1YEHH 2YC1B 3KPRD 2OTUB 1A7PL 4MA1C 3FRUA 3ARUA 3BD4A 3P4OB 4G6AC 4J4PC 3O2DA 4UV7H 2YSSA 3BIAX 1OAUH 3AS1A 3RWHA 4RIRA 4Z7OF 4XVUD 4Y88A 4CNIA 4GLRI 4ZAKB 2N56A 4P4KA 3GJFH 1KN4H 4ZOCA 5HYEA 1P7KB 2PYFA 1T4KB 1MSPA 4PJ8D 1S9WB 1Q9LA 2VZTA 1JWMA 1QKZL 4XNZB 3BMWA 3TN0B 5A1AA 3OKNB 5GSRB 4EKXA 2CJUL 4ISVB 4GXVH 1T66C 1CVRA 3DO3A 5DQJB 1TJHH 4KDTA 3V6BR 5EO0A 4FZEH 1JGEB 4HS3B 3HC4H 2BY3A 3Q48A 2FSEA 2X4OB 5I75B 5LVEA 4HPYH 4KVNL 4LCCC 3O2VL 4I0KA 5ELIA 5TH2A 3V6ZA 5B8CA 5BQ7A 1RZGB 1OM3H 1UGNA 4FA8A 3QZWG 3V4VL 1QA9A 4I8DA 1E4JA 4JN2A 5CLTA 5L2KA 1LWRA 1J88A 1K3ZA 1JNNL 3BMVA 4AJ0A 1RMFH 5KVGL 1S7XA 1MRCL 3K80A 5EZJA 1FDLH 3EYUL 2HKFL 4G5ZL 5ICZB 4F57H 2BNRE 2C9AA 1RPQA 3DIFA 1N0LA 2AKRB 1BVKA 5F6HJ 3C2SA 2PTTB 3QFDB 2WZPD 3S5LG 5IR1A 4I5BA 2LE9A 1ZT7A 1MAML 4GUPB 2P8LB 4GW1A 4JPWH 1FZMA 5E8DH 5CGMA 4LKXA 2EXWC 1W72L 4U4BA 2P5WA 3T4YA 2CR3A 3BN3B 2VDQL 2CMRL 2LFGA 3B9KD 5BOPA 5F7YC 1J8HD 4M61B 4O2EB 2ZCKL 3KYMB 4XRCB 2Y7QA 1BQLH 3P11H 2G2RB 2UY6A 5C8JB 1KJMB 1EJOH 2V2WB 3O2DL 4H0HB 3RDTB 3MRHA 5AEAA 1KG0B 4JE4B 5FYKL 3CCHA 5BXFB 2LU7A 2FNBA 2DKUA 1UXWA 3LQAH 5GGTA 5HI3D 1OGAE 4X98A 1NCBL 5FA3B 1W8OA 4JFDE 4PJGA 2FIKB 4OLVL 1E4XI 4EN3C 5EU7E 2K7QA 3RIFF 1FL5A 3WXWL 3DX8A 4EOWH 2NW2A 5IFHL 3AREB 1B0RB 4Y19A 4LGPB 2HKHH 4X4XA 5IVXB 4FTVD 3P40A 3Q6FB 4NKMA 3WN5A 5DTFA 4GOSA 4G80B 1TZIA 5E6IC 4K9EL 4XCNA 2W07A 3REVB 4OI7A 2HJLA 1Z2KA 5D7JC 3CFDA 5GSVA 4HG4J 3O3BB 3F7VB 3VXMA 2A9NL 1T3FB 4KHTH 4AENA 5GISL 1DSFH 1H0DA 3BKYH 2FEEI 4LLWA 5EZLA 1LDPL 1Z9OA 4U6HB 1RZFL 1B90A 4WUUB 4F7PB 2J4WL 1MHEA 5I16A 5HVWA 4Q9QH 5KW9H 1W0VB 5KVEH 3MOAL 3LPGA 2L7JA 1N6QL 3RWCB 4NM8H 1IAIH 1QBLL 1YEIL 3O11A 1MWAH 1VKXB 2OJZL 5FA4A 1SJEA 3AGVA 2F53E 2VSDA 1F11A 3MV7A 1CZ8H 4X6CA 3UTTE 1A9EA 4MXQC 3QCVH 4HT1H 3GO1H 2RQ8A 4UINL 3F7QA 4U1HB 5IV2A 1QLEH 1F4XL 5I1JL 5KJRL 1AGCA 1S8DB 5GGTL 1D9KD 1FRGH 1Z0NA 1IM9B 1J0JA 3MV01 5C0AD 3LDBB 2Q8BH 1QPPA 4NN6C 4KKLD 1HNFA 5HGBA 2AJXL 2DIAA 2WINA 1I8LA 3VH8A 4PJCA 1BQSA 3D5OF 1A4KB 4ZUWB 4NQVA 1CGYA 1KBGH 1SJHB 5AD0B 4DOHE 1MCPH 2KL6A 2ZJSH 4HKBB 4NC1C 1OT1A 1JWSA 1JGLL 3FOLB 2ZUTA 3OAZK 3VI3E 2P8MA 5CHNB 4JZJC 25C8L 3O6LH 2ORBH 3HPJB 4HIJB 3NMEA 4PGEA 3CX5J 2FR4A 3VXQB 1P4LA 3OF6D 2D7TH 4ODUA 1CIDA 2FX8L 3Q1SL 2YUXA 2A77L 1D7FA 3QEQA 3CLFL 4UDTA 3BPCA 2DQGL 1ZA3A 3JV4B 5SWQA 1U3HB 3INUH 4LLQB 5KG9A 4FQLH 3GI9H 5EBMB 4LQ1A 2BOCA 5D2LA 3T0VA 3CVHA 5DC0A 3T2NL 3VCLB 1AO7B 2DB8A 1C16B 3BQUA 1FIEA 1UEMA 4HFWB 5F9WC 4IRSC 3VWJA 4FABL 5FCUL 2OBGA 4ZDHB 1Z3GL 3NBNA 4NRZA 2PYED 5JW4M 3N0PB 1MWAB 5ICYB 4M6NL 4LOUC 3BIKB 3VFMA 4L29B 3PGFL 1YMHA 1JGDA 2D31B 1S7TA 3KGRA 4GSDL 1Y18B 1OAXL 4OGYH 3FFCD 5C08B 3THML 3AROA 3JV0A 3S35H 4P9ML 4H88H 4PJFB 4I48A 4MQSB 1NCDL 2CUHA 3GK8H 1QYGL 1X4XA 4QGTA 1F6AA 2R4SH 1BZQK 5JOFB 3PWLA 5F7LB 3WNPA 4M5YL 5F9JA 2A9ML 2RBLA 2VE6B 2R2BA 3FQNA 1CDYA 4OGZA 4OLYL 5DMIL 4LVHC 5TFSH 1X44A 3VGHA 4XXDA 1JTOA 3H8NA 4OD1L 4UOW0 1M71A 1BGXL 4NWUL 3PDOA 3T2OA 2FX7L 2VKXA 4CVWA 5E1AA 1PEWA 3VD9A 5L8KB 4X4YA 4XWOD 5HDLA 1OSPL 4QO1A 4RFEA 3N06B 2YPLE 3I9GH 3KNBB 5CJ8A 1URLA 4U2YA 3UMTA 4LRIC 5CIPH 3E8UL 4PLOB 5FK9A 3G6DL 1YZZA 5FM5M 3SJVD 2M2DA 3K8MA 4PJ8B 4PGJA 2DWEB 5LKNA 2DRUA 3HZMA 3P30H 1FL6B 5IVXE 2Y25A 3O6FC 4LPYA 3CVHL 3P4MA 4U6VL 3E3QE 2YRZA 5ECJE 1RI8A 4JGUA 4RFNB 4QRSA 2DLFH 3SHSA 1KCRH 2J6EA 4RWYL 3DRQA 1BX2B 1SYSB 5MEQB 2NXZB 4QY8A 4WI7A 3FQRB 1FGNL 4G9DA 5KBNC 1ZT1A 2JKXA 4L1DA 5EC1A 2L7UA 3B9AA 2CK0H 3EO1A 5EU7C 3JWNC 4FQXB 4Z76A 2H3NB 5EBWB 4X6DE 4G6KH 4Z7NF 1R3KB 2GAZA 3PWUA 4U3XA 1CG9B 4XBEL 1KOAA 1MCWW 4IRJB 4W81A 2QKIA 1F8TH 4CDGC 3RTQC 3FT3A 5HHQB 4NQSA 4N9OB 4N8VG 1ORQA 4YDKH 5BMFH 2QQNL 4PJBF 2VAAB 3ULUC 4EDWH 1S7UA 1BFOA 3DWTA 4U05A 4YXKL 2JELL 4TUKH 1KGCD 4O00A 4P5TC 4HMEA 3M17A 5SX4I 1K8DA 4KJYB 3O4LA 1CFQA 5DF0A 3L3HB 5J8OA 1UKSA 2H2PD 3C8DA 1R5IA 1MFDH 1J8HB 4LIQH 4QRUB 4QXGH 5A16B 5DFTA 4HWZA 3PE9A 2B20A 1O0VA 5HHMD 5MI0B 4D8PB 4KUCD 2ADIA 3QPXL 3VFOB 1HCFX 4HK3J 3RGVD 5CIPB 4GBXA 3EDJA 5D9SA 5CGYC 3CSPA 5H2BB 2MSPA 5JO5A 2NY4B 5DEFA 1A6UH 4JPVH 3LIZL 3TA3B 1BFVH 2AJYH 4S1DC 3NIGE 4Q97A 5IBUB 2XWBB 3RPKA 4XAKD 1L0YA 2V5RA 1X5XA 5DLMH 5HPMA 3S3JA 1JE6A 4YHOL 3FQTA 2J6EL 5C3TA 3VWKB 3DHJA 4GKSA 4KI5F 1MLBB 1QO3A 3VJ6B 1MCIA 4LU5H 4NUGH 2R9HD 3MLTA 2XZAH 1G7JB 4XB8A 3WD5H 5I19L 1XGTA 2CLZB 3ORJA 5F93C 3Q2CA 2C7UB 4KTEL 4JDZB 4KZEL 1HQRB 5C2BH 3UDWC 1XF1A 4M62L 4NHCL 3TIDB 1GGBH 3SO3B 4O5LL 1AO7E 1Y6MR 2HJFA 4ZAKC 2R69H 4R4FH 1X5KA 1QSED 2V17L 1YYML 3PWPA 1A6PA 5ISZD 4IOIB 1F90L 3DV6B 4XNZC 3V2AR 2VLMD 1NMBL 3QEHB 5DJCA 3TN0C 3NPZB 1IGTB 2YKLH 2WQRA 1KLGB 5C08E 4F9LA 3KXFA 4PJFE 3CH1A 1TCRB 4S1QL 2XKSA 3TT3L 5FYKD 1TVHB 3RL1A 2QR0A 3SE4C 1NDGB 4U6YA 4P4KD 4PG9B 3G5ZA 4W70A 3SJVB 3ARXA 3SEPA 5D7SH 2R2HA 3FN9A 3GNMH 2GHWB 1IKFL 4RMTA 5ACMA 4KKAD 1OB1A 4QWWC 5CJQL 1JHTA 2X1WL 5AZEL 5DJ8A 2UVFA 4JVPA 2W60B 3C5SA 1XIWB 2VDLL 4QF1A 3ARFA 3OKOB 5KSBB 3D69B 4OF5A 3JSSA 2R23A 5CMAA 1R5VB 4OCXH 4TNWK 2BNUA 4Y0GA 4BSWB 4I2XE 4M7ZB 4MS8D 5DC4B 4JZOB 2VO5A 1TFHA 3BISA 5JORA 5FGRA 5L2KD 1KEMH 3MRQA 2BSRA 1AD0B 3OAYH 5CSGA 3FO9B 3HAEB 2V5SA 4S2SA 2JJTA 1LO5A 3ZL4H 3RDTC 3DXAE 4JFZH 4YBHA 2CIIA 2NYYD 4JLRA 2G60L 1D5ZA 4L5FH 1OAYH 3T3MF 2AERT 4Y16B 1LO4L 2HFFA 2VWEE 2VL5B 1J1PL 3DVFA 1T0NA 5F96H 2W65B 4JO4H 3MRFA 4UQ3B 4OZGA 1G7LB 1A6ZB 3AREC 5SWSA 3UYRH 3V8OA 1NC4B 1U8OB 2QLVB 4ODTL 1YPZA 3E3QC 1ZMYA 3SKUD 2HN7B 1MRDH 3RY6C 3MO1A 4PP1C 1D5BA 4OCYL 3F7RA 2VDRH 4HFUH 3ARBA 3G5XB 3P9WB 4HUVA 2CO6B 4Z7VA 4QTIH 1NAKL 4F7CA 4MJIB 4PP2A 1MREL 4X9GA 1J5OL 3KYKH 4R26L 3WL9B 3QHFL 2X10A 1DLFL 1WV7T 4NZUH 4Y19D 4YDLB 1A7PH 3LKOA 4BZ1L 3IDJA 5KS9A 1EIBA 5K9KB 1F4WL 3MLSL 2XOTA 3T0XA 5I18L 3DJ9A 3MRKB 1J86A 3CVIL 1MRFL 1P5VA 3IF1A 2QTEA 1XAUA 4B41A 5KN5B 1IE5A 4Y4KD 2VJXA 2VABB 2G9HB 4XNUL 2ATKB 2X4SA 3FKUS 2YBRB 2XXMB 3QXDA 4Y4HC 4DJMA 3O81A 3VXMD 3CDCA 1NJ9B 4OZFA 1WLHA 1QFWI 1LO3H 4X7TA 5DRXA 3H42L 2BMKB 1B4JL 4UTBL 1KCUL 2OJEA 1QKZH 4PRDA 4KV5E 4MWFA 5E0QA 3MRIA 5B3NA 3LQAC 1H5BA 2VDOL 4NO0B 3VXUB 2AK4A 2GY7B 2CJUH 4W4OC 1GAFL 4NFBA 2FJHB 1ZLUK 1SBBA 2H1PL 1A7QL 3LDBC 5F6HI 4HKJB 4BH7B 4R90L 2F15A 1XR9B 2WSKA 5B4MD 4KVNH 3O2VH 4AM0B 1G6VK 5DHYA 1R24B 1FL3A 3V4VH 5DRWB 2HLFD 1SM3H 4HV8B 1WAAF 4QT5A 1JNNH 5KVGH 3OKEB 1MRCH 2GSGA 5DI8B 5HTSA 4BELD 3EYUH 1JNHB 2HKFH 4G5ZH 3D6GA 5IEHA 2CPCA 1BIHA 1GCFA 2ICEA 4PJDE 1I3GL 4JM2A 4QXWA 1MAMH 1MVUA 2D4DA 4ZTOL 5HVHB 2N7BA 1CICB 2DLEA 4LLDA 5D1QA 4HMCA 1OTSC 1U3HC 1W72H 2EYSA 2YD8A 1U8MB 3EW3B 4XCYA 4LIQE 5I76A 1AC0A 2VDQH 2IBZX 2CMRH 1CU4L 4ONHB 4Z7UA 3ARWA 4NUJB 2ZCKH 4JRYB 4X83A 4LRNL 5F3BB 2I26N 1PGRB 5KTEH 1KB5A 3K8LA 1WK0A 5K59E 5E6ZA 3O2DH 4WU7A 1MHHA 4ODWB 5C0GA 3QQ3A 4BSVA 2Y07L 5FYKH 3V7MA 1AGBB 2D9CA 4KMLB 2NNAA 3H9HA 1AIFB 3TF7C 5JZ7C 1NCBH 2X1OA 1GGCL 2BVPB 4TULL 4POUB 5JUEL 4OLVH 3GM8A 3QG6A 5EH1A 4Z7QF 4YDJB 4NNXB 4NO5B 3WXWH 5DGQA 5IFHH 4G9FB 5IW6A 3BQUD 4ZPVB 3MBXL 3FQXA 3VWJD 5I8EA 3GGWB 1CBVL 3RIFK 3EYSL 2XACC 2WLZA 4OQ1A 3T77A 2J12B 2W1NA 3EGSB 2PCPA 1MI5B 1DZBA 4K9EH 5CEYA 5FOBA 1KCLA 1UACL 1A6VL 5CZKA 5DA0B 2VLLB 1WFNA 2A9NH 3G6JF 1BBJB 3S36L 3OZ9L 4BFIA 5GISH 4JAMB 3IJSB 1AE6L 2GSIB 5GRVK 3TVMA 3ROLA 4HD9A 4XNQA 1LDPH 2ZSVB 1HOCA 4XP6L 1RZFH 3R0NA 3DO7A 1LEGB 5IGXL 3RWJA 1FSKB 2J4WH 3WFHA 5GQBA 3S96B 5IT2L 1UZ8A 5ACZA 2XTLA 3OGCA 4JFQA 3MOAH 1L6ZA 3VMPA 2MMXA 4MLSA 1N6QH 3OKDB 1D5IL 1W72B 4B7IA 4U1NB 3QDMA 1D6EB 4O2CB 1MIEL 1QBLH 1VESA 1YEIH 2JIXB 5ITFA 4PLJD 4XNMA 4RFNC 4DGIH 4PJAE 5A2FA 2ZP0T 3SKJH 1A9BA 2H26B 2NXZC 2NY6D 1KB5L 3SGJA 4UINH 2F8XC 3RWHB 2VWEC 1F4XH 5I1JH 3TFKD 5KJRH 2FD6L 4CNIB 3GSOA 4FQXC 5GGTH 4MJIE 4LLMA 4UUJA 3ZT7A 4QHNB 2PYFB 4C59B 4NNYA 3VDCA 4IRJC 4X4ZA 2HYMA 4UIKL 1Q9LB 5DJ2A 2AJXH 2O61A 4ONGL 1BQHB 3MFFB 1WZKA 2Q3ZA 1JGLH 2FSEB 4N1EA 2MQ3A 4I77L 3V6ZB 5B8CB 25C8H 2B1HL 4NQEE 3VGAB 3NAAL 4N1HB 3CDFA 2BVUA 4JRXD 4WHYG 5JW4N 5B38G 3GIVA 4JN2B 5IFAL 2OXGA 2IPKA 2EYRB 1S7XB 2FX8H 2WQ8A 2A77H 3LS5L 5INCA 3CLFH 5MI0C 2Q3AA 5GS1C 2DQGH 3JTTB 2FEDD 3CDGA 4MB3A 3QDGB 1BVKB 3QNXA 1SEBA 3QWRA 3T2NH 4I5BB 1ZT7B 4LCYA 1RHHA 4RA0C 5HD8D 1VADA 2EEDA 1F3DJ 4FABH 5FCUH 2Q7YA 4NBXB 3L7EB 1FZMB 2NY4C 2ENSA 1Z3GH 3UZEA 2XY2A 3TA3C 1FZJA 4N9GB 2P5WB 3V5HA 4M6NH 2DLTA 3PGFH 4R96A 1UJTA 2E8YA 4NKOB 4WW1A 2Y7QB 5I6XB 2XN9B 3VWKC 5D5MF 4GSDH 1OCWL 1I85C 1OAXH 5LAXB 4LP5A 3S4SG 3MRHB 3TO4B 4O4YL 4P9MH 5E9DB 1MH5A 1A7NL 2C1OB 4RNRA 5F3HA 3X17A 3R8QA 1NCDH 1JI1A 1QYGH 4XGZA 3K1DA 1UXWB 4Z77A 4NRXB 1CTNA 4X98B 4YPGA 4ZOBA 4HIEA 3PL6A 4M5YH 2YPLD 4PJGB 2A9MH 1QFOA 5F70A 3GZKA 3SO3C 4OLYH 1XF4B 1FG9C 5TDNA 5DMIH 3DX8B 2DQEH 4JRYE 5FGCB 1XGQA 5HDBF 4OD1H 4U0QB 1BGXH 4NWUH 3SOBL 2FX7H 2VZVA 4YX2H 2XG5A 1TZIB 3TYFA 2XFXA 5D6CA 1OSPH 3GIZL 1RK1A 3IETA 5C0DA 3CFDB 5GSVB 1ITBB 5IHLB 5J0BA 1GGUA 4AENB 4XTRD 2ZUWA 3E8UH 3G6DH 2YPVL 3BP6B 3ARGA 5C0BA 1H0DB 4YXHL 3TBVA 4LLWB 5EZLB 4EQ3A 5B39B 2YEZB 4NPYA 3FTGB 4LASL 2FO4A 3CVHH 4YWGL 5I16B 4U6VH 1BJ8A 5D8JL 4EI5A 3F5WB 2NR6C 3CZFA 5K9OB 4RWYH 5J12B 1JUFA 3KPSA 1MI5E 5F72S 5T1KA 1FGNH 1JYXA 4LPVA 4QTHA 3O11B 3C8KA 3ZSTA 1CQKA 1XIWC 3F65A 2OS7A 3MSPA 3D18A 3MV7B 4X6CB 4XMLL 3KXFD 1A9EB 4KQ4L 3NIDE 1P7QA 4XBEH 2A6DA 1X4ZA 2DOCA 4M7ZC 4F3FA 5IV2B 4LEOA 2PXYA 3G9AB 4ENEC 3N1QC 4OT1L 2QQNH 5I1GH 1CL7I 3QO0A 4XC3H 1I75A 1H3TA 3BI9X 4YXKH 2JELH 3PHOB 5HI5D 2WINB 1T7ZA 3VH8B 2X41A 2HFEA 3X14A 3ZKMC 1UM4L 1LQSR 2CRYA 3ARFD 5JA8B 4Y16C 4JR9L 4UT6L 1S5HA 5CEZD 4J23A 1MCCA 4WEUD 5IROC 2IG2L 1TITA 4WTZA 4KJWC 1WBYA 4XC1L 3H3PL 2P45B 4PGEB 5EUOB 3QPXH 3U79A 5HHXH 1P4LB 1U8QA 4ODUB 1YUHB 3GDBA 5FDYA 2VDPH 3RKDD 4CUCA 3BHBA 3QEQB 2IBGA 4UDTB 2H8PA 3BPCB 3LIZH 5SWQB 4PBVC 5KG9B 3QQ4A 1VEPA 4RRPA 3ECBB 3I75A 1CWVA 2BOCB 2QADB 3C6SA 3CVHB 3ILPA 5D2LB 1YC7A 4F7TB 5FV2A 3QXAA 4YHOH 4Y1AA 2J6EH 2UV3A 1X6NA 3TNMA 3ZE2F 4NRZB 3O6KL 3BH9A 4X80L 3T0DA 4U31A 4YDLC 3AXLA 3G6AA 5SWSD 3VFMB 5I19H 4NM4L 5JXEA 4X6EA 5FYKU 4TQEL 4Z6AT 4WDIA 4KH2A 4KTEH 2ADJA 4ZFOA 4KZEH 3D39A 4M62H 4NHCH 5IJKC 3D3VB 4KVCL 3QDGE 4H5SA 3BH8A 4I48B 4O5LH 1JNJA 4CVUA 1OTTD 2AXHA 1F6AB 1RUQL 5I9QB 3PWLB 3SKNB 4DTGH 3ISWA 1AGFA 2V17H 1YYMH 3D25B 2P5WE 3DLQR 5DFVC 5J1TC 1F90H 5HDOA 2R2BB 2K3TA 5D1XD 1NMBH 3V0VA 4K71B 1HKFA 2XN9E 3HC0A 4L4TD 1CK0L 4CKVX 4GXUN 1E4XL 1OY3B 4WFEE 4Y2DD 4XNXL 2GTWA 5E9DE 4KTYA 3QH3B 3C5ZB 4S1QH 4WCYL 1EUTA 3TT3H 3UO1L 4X4YB 3MUZ1 1EXUA 3OAZH 3IT8D 5GRUL 4OGXL 4RFEB 3HCVB 3VFTA 1EVUA 1JF6A 1B0GA 5IP4A 1RJYA 4PJGE 3HNTL 4N0UB 5FK9B 1MQ8A 1AGDB 4XI5D 3HTLX 4J7RA 1IKFH 4UBDC 5C0CD 3D0VB 5FGCE 5CJQH 2IC2A 5AZEH 3HE6A 3BKJL 4KK8C 1DUYA 3MUGA 3P4MB 2AK4D 4I13B 3SCMD 1UFUA 2VDLH 2FEEL 4QRSB 5D2NE 3DRQB 3BGFB 5HVHC 5AAMA 1CICC 3DXAD 4G9DB 1JFQL 3K3QA 3EZJB 1ORSA 1ZT1B 1KSRA 5GGUB 3U30B 5CSZA 1K8IA 3B9DA 5CZXC 5EC1B 3EO1B 3C9NA 3U83A 1QSFA 4Z76B 4QHMA 1NANH 4N5EC 1EV2E 3PWUB 2XTJD 4KKNA 4B53A 4ZFOL 2QKIB 5H35A 3FT3B 4NQSB 2CDGB 1ORQB 4NBYB 2Z8RA 4XH2B 2SEBA 3QRGL 3P9MB 4JM2D 1U95A 1G7IA 3KYNB 5AZ2L 2G5RA 2G60H 3MLXL 1ND0B 2ED9A 3CSYB 2JCCA 1LO4H 4Z0BL 2EIDA 3C6LD 2F8VA 1J1PH 5FYLD 5CAYB 3WJLC 5F7WC 2NW3B 5IB1B 1V5JA 5EPMA 3GB7A 3O4LB 2MTPA 3WIIL 3X13A 4KGJA 4PJBA 3H9SA 1R5IB 4XBPA 1HH6B 3JV6B 4QHUB 4ODTH 2D7NA 4FQQA 3RVWD 1NAMB 1P4BL 4OCYH 3GKWL 1U6AH 2ADIB 4FFWC 3QBTB 3SO5A 5AYQA 2VYRE 4I0PA 3MV9E 5IEKA 4GBXB 4FXKA 4ZUSA 3FAXA 5D9SB 5LCVL 4NSKB 1KPVA 2WWMC 4N8CH 1MREH 3OBAA 4P4RA 2Q76A 1FFPA 3MLZH 1J5OH 4X6FB 2HT2D 2BCKB 4R26H 3QHFH 1DLFH 4NKDA 1FSKC 5C07A 5J3HC 4E0RA 1NFDB 2FL5A 4JY4B 5E1HB 2Q6WB 4ETQB 4RX4D 4X6BA 3FQTB 3MLSH 5D7LD 5I18H 4HWUA 1WTLA 3W81A 4OLWL 3UROR 1QO3B 1QRNA 3CVIH 5EIQA 2NXYC 4JCMA 5EUOE 1CN4A 4WI3A 3U0TA 4XNUH 4HXBL 1CXIA 2E7CA 2A74A 3MLTB 1GVIA 1C5BL 2HVKA 4AQ1B 1XGTB 3QEQE 1BJ1H 3NFPB 2BRRL 4LSPL 1KIQB 3H42H 3TVMD 4M6MH 1G6RA 1X4YA 2QHLA 5D2LE 1B4JH 1UG9A 1S78C 4UTBH 4OTXL 1KCUH 4OD3L 3TT1L 5C0FA 1G7QB 3KPPA 1ETZB 2HJFB 3CMOL 2VDOH 4Z0XA 5IB5A 1CXFA 1T21A 4P46A 2H1PH 3QEGH 1A7QH 4XPAL 3PWPB 4KRMB 4R90H 4APQD 1U9KA 3L1OL 2C3WA 1WEJL 5DJCB 2CDFA 1LEKB 3ARPA 3N1PC 1JPSL 1W0YT 4Q9RL 3ZE0E 2ZG2A 1KENL 3D3VE 3KXFB 4OFYA 3GSQA 5B8CC 1NCWL 1C7TA 3VGAC 2QR0B 1MCQA 4HWNA 3U36A 5MERA 3G5ZB 1I3GH 1KIUA 5TDOA 2VXQL 4DZ8A 4LHQB 3DVGB 4ZTOH 5HBBA 2R2HB 2GI7A 3FT4A 3GSUA 2RFXA 1OB1B 4JQVA 3PWJA 5DJ8B 2GY5A 3RPIA 1UB5A 1CU4H 1AD9A 3C5SB 4Q58C 2DM7A 4QF1B 2DQDL 3ARFB 2X4QB 5INDA 4LRNH 2R23B 4PD4J 1JPGB 2BNUB 4KC3B 3HZYB 2Y07H 5CINL 3ZYOA 4RAUB 3HPLA 3KPOB 5JORB 4N0UE 2YZ8A 2GYSA 2BSRB 1XGRA 2AEQL 4OZFH 5I6XC 4CW1A 4F8QA 4K7FA 1GGCH 4R6UA 4TULH 1LO5B 1G6RL 5JUEH 3TO4C 2DJ4A 1INEL 4HJGA 4CGTA 2UWEF 2CIIB 4P48A 1FC2D 3ES6A 3MBXH 2G5BB 3B9EA 3BP4A 1KEGL 4J3TA 1YY9D 1CBVH 2HFFB 3EYSH 4QXUL 3KLDA 4OCRL 1T0NB 2FDBP 1MELA 1L7TH 4JG1L 1L7IL 4OZGB 5CKGA 4E42A 3TGXA 4U33A 1UACH 1BD2A 2JJSC 3AS0A 1A6VH 1DUZA 1YPZB 2ICWJ 3S36H 3OZ9H 3LN4A 5FKAA 3BDXA 2PN5A 4P23C 4KFZC 5D2NC 5KOVC 1X5JA 1RUKH 2A6JB 2DI8A 1SBSL 3ARBB 4YO0A 1OF2B 1R3LB 4HUVB 4Z7VB 1CYGA 5IGXH 3GBNL 3IS1X 1DBBL 3PL6D 4UNUA 1EAJA 1ES0A 3E2HB 4P2CG 1IFHL 1QPXA 4PP2B 1HIML 5D7KD 4ETYA 1Y6KR 3EUUA 4PRHA 2XRAL 3O4LE 1RIHL 1D5IH 1J1XL 1MIEH 2R0WH 3VXPA 3LKOB 5F7NC 5DVKA 5IM7B 5KS9B 1T80A 3KWWA 5J12C 4GFTB 3CX2A 1GC1L 5HYIA 1KB5H 4XMKL 3ZDYE 4JFOB 1BVLB 3VFVB 4PIRF 3V0AC 2X4SB 2N1KA 3HNSL 2EIZA 4YK4B 3QXDB 2FD6H 1IGYA 2GJ6D 2HJKA 3T0BA 4V2CB 3GM0A 4K55A 4OZFB 3MNVA 5C0BD 1MF2L 4JG0L 5L7XL 4N8VB 1C5DA 4K94L 4UIKH 5CJOL 2AJVL 4HG4K 4YC2B 1I7TB 1NFDE 2OJEB 1A7OL 4ONGH 4PRDB 4XHJC 3MRIB 3E6HA 1QFWM 3LB6C 1H5BB 5DZNA 2VIRA 3S5LA 4EI5D 3FCTB 3MV8E 4K3JL 4XXCA 4BM7A 1JV5A 3DMMA 5J6GA 3ZTJH 3FT2A 1YMME 1YEDA 4I77H 4X99B 3ULVF 5DHYB 1WTGT 2B1HH 1FL3B 5JPNA 3NAAH 3CDYA 4Q9BA 4PREA 3CPLA 4OZIF 3DBXB 3BXNA 1HH9A 3L5WA 5E2WL 1OSZA 1P7QD 4XB7A 5IFAH 3L5JA 4DUVA 2GSGB 3ALWA 3LS5H 1FGVL 1G7HA 4LL9A 1X5ZA 3TP4A 1UEYA 4JFHE 2JLLA 4CU6A 3TIEB 5BRZE 15C8L 1MVUB 2XPGA 2R15A 3D2UB 1LO0L 1CTOA 5IF0A 5F7UA 4LLDB 5E8NB 5D1QB 3W9EA 2E7HA 3BVNA 2EYSB 4NQUA 4XCYB 5I1AA 1R3HA 2QADC 5I76B 5FKPB 3EAKA 1DQML 1T89C 4JZNA 3VFUB 3OB8A 4PRPA 4ZOEA 1OCWH 5F6IB 4WU7B 1MHHB 5C0GB 4BSVB 3QQ3B 4O4YH 5TE6L 4LHUG 3ULSA 2AJZB 3CC5B 1N8ZA 2HVJA 4G6FB 2Q86B 3L3KB 2NNAB 3IJHA 1WWAX 3EYOA 3STLA 2VDNL 2EDRA 4WO4B 4H1LB 2VXVL 4NGHL 5HXMA 3DRTA 3QIWD 3B2UC 5AWNL 2HG5A 4PGZA 2GQHA 4PJXF 5I9QC 4Y1AD 5A2JH 4WEMB 5IHZA 3SOBH 1S9YB 4OF6A 1YN6B 1T6WA 1TTFA 3KR3L 3T77B 1ZLUH 2QEJA 2PCPB 3TC9A 1VFAA 2I24N 4GRWF 4K71C 3O2WL 5JXED 3W5MA 2AXGA 4FFWD 1ZANH 4OKDA 3RUGF 4PBXA 4PRIA 4LBEB 1CE1L 1JTPA 1Q9WA 2D4FA 2YPVH 4K07A 5C86A 3D39D 2VH5L 3S7GA 4YXHH 1NBQA 3C5ZC 1DN2A 1YEFL 1AP2B 3ROLB 1HOCB 5KANG 2IALA 3DO7B 1LEIB 4WNQA 3RWJB 1A21A 3WFHB 4CADB 5IBLC 1UZ8B 5D8JH 3G6JA 1OL0A 3WIFB 3OGCB 4JFQB 1WBZB 3QDMB 5KZCD 1I8MB 4XP4L 2HTLD 5F89A 3V9FA 5ERWA 4H8WL 1II4E 4MD4A 4XMLH 4K7PY 5E8OA 3BGFC 4KQ4H 3DVNB 3T0EA 1N4XL 2C26A 2EXYD 3UZQA 5L2JA 3L3JA 2EH7L 2EZ0D 4WV1B 4OT1H 4H0GA 4LLMB 4NQDE 4NNYB 4PB9L 2HT4D 4M7JL 2ICCA 3O3EA 3MCLL 4V1DD 4YHKL 4PG2A 4PJ9A 3HE6D 1J11A 2NY0D 1QFWL 1K4CA 1UM4H 5E5MA 4ZS7H 4DK6A 4L9LC 2VLJB 1XH3B 4JR9H 4UT6H 3UBXI 3RZWA 4JFYA 1A47A 4F8TA 2IG2H 5I66A 2E6PA 3MXVL 3BD3A 2X70A 2OQJB 3PWVA 1DEDA 4XC1H 1QSFD 3H3PH 2IPKB 3RA7L 2GCYA 4YNYB 5HHOD 1P9MA 5BS0A 2FZ3A 1Q0YL 3DI3B 5INCB 1JGVL 2Y6SD 3QFJA 4MJ6A 3TBSB 3CDGB 4PRNB 5FFLA 3QNXB 4OF7A 3MREB 1SEBB 4GBXC 1RHHB 1DBML 1TZHB 1S7WA 4YGAB 2GKIA 2Q7YB 4Z8FL 3PWNA 4NJ9L 3DGGA 3WS6A 3O6KH 4X80H 3JUZA 5FGBA 1XGPB 3UYOD 1PG7X 1RZJL 5C71A 3FB8A 4NM4H 2FIRT 4R96B 1FFRA 4TQEH 4OI9A 4D3CL 5JW3L 4TUJA 5DRNB 3U48A 5T1DL 4B50A 3SKMB 5DJXA 4W68A 3H3KA 2EC9U 2I25N 4KVCH 1MH5B 4RNRB 5F3HB 5GGVY 4XGZB 4LLAA 5F7KC 4F7EB 4HIEB 3C8HA 5EZIL 1FZKB 3PL6B 1PQZB 5IQ9A 1MY5A 2OZ4A 3QUXA 3HG1E 2GFBB 4UZGA 1LNUA 5C07D 4LCWB 3UPCA 1MFAL 2VZUA 2UZIL 1CK0H 2I07A 1WT5A 5MEPA 5F1IB 4Z7WF 1S7SA 1F3RB 1AFVL 4XNXH 3O8XD 4WCYH 3UO1H 3TYFB 2XFXB 1BZ7A 5GRUH 3FHAA 5GS0L 2ZNXA 4OGXH 3BFOA 1RK1B 1I9EA 4QRPD 1KJVA 1PEZA 3HI1A 5GRZA 5A2IH 2NY5L 1T5XA 3N1FC 2XKUA 3HNTH 3QNZA 3ARGB 4HIIA 3T1FA 4MVBD 2NX5A 3TBVB 4IMKC 1J10A 3HN3A 4X9FA 2D3VA 3D85A 3BKJH 4IS6A 2FO4B 1JP5A 4JRWA 1UH3A 2ZOLA 5I1IL 4EI5B 1FAKT 5TPWL 5DUBA 2X4TB 3KPSB 1UZ6E 1YEJL 1TCMA 5T1KB 3VA2C 1JFQH 5EU6A 1OGTB 1ZV5A 4QTHB 5E8EB 5E6YA 3C8KB 4YBQC 4AH2A 3TV3L 4P99A 1AKJA 2GK0B 4BK4A 3RJDA 1CT8B 1JNLL 1U8JA 4ZSOA 4OFYD 3DGCR 2XKNB 2CDEA 4F3FB 3QQ9C 2PXYB 2WBWB 3I84A 1WFOA 3QRGH