2Q1UA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ and udp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
350
structure length
336
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSGKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
total genus 127
structure length 336
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1uA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1uA02
4I1IA 1O94A 3E03A 1I10A 4ND4A 3D3WB 4E4YA 4EGFA 5JDCA 3JYQA 4IIUA 4XGIA 5A02A 4GX5A 2RIRA 4IS3A 3V2UA 3W4KA 3WYBA 4DXHA 3ZV5A 4QUKA 4M1QA 5U4QA 2WD7B 2ZIZA 4DA9A 4E3ZA 1YS4A 4B8WA 1GZ3A 5JPIA 2CFCA 5KVSA 4AJJA 3VKUA 4YJHB 4JJGA 3QWHA 1HWYA 1GR0A 2AMFA 3Q11A 3GMSA 3FWZA 1RPNA 3FNFA 4JBGA 3UGKA 5T67A 3EY4A 2CDCA 2Y99A 1JAXA 1PU2A 3E1KA 4JJIA 3TSCA 4RVUA 1BG6A 4DRYA 2BKAA 3H3FA 1PR3A 3JQBA 4NFSA 1OOEA 4YJHA 4QQRA 1H9BA 1HYGA 4IGEA 3JQAD 1LDMA 4DLBA 3GY0A 3TL2A 4IJVA 2UUOA 3KB6A 4GMFA 4LISA 3EVNA 5TJHA 3DAPA 2D1YA 1SAYA 4ZN6A 1Z82A 2RHCA 2QX7A 3QVOA 1YWGO 3D5QA 3GR6A 1E1MA 2AG8A 1I2CA 2EV9A 1R4MB 1GPDG 1LLDA 4NQZA 1I01A 4WLVA 2O4CA 3AFNA 1QR6A 4Z0PA 1E6EA 3GLQA 4M8SA 3SVTA 1NVGA 1SZJG 1VKNA 6ADHA 4YA6A 5JMPA 3RD5A 1H6AA 2DUWA 4NPCA 1C1DA 3F4BA 4UUOA 2Y1FA 2NU8A 4CV0A 3KTDA 3PWKA 4ZVVA 2G76A 5B12A 3HWRA 1DIHA 1U5CA 3EHEA 3KBOA 5H83A 1JN0A 1PX0A 4L73A 1LLCA 4UEKA 4J6FA 2QHXA 3NGLA 1QG6A 1KETA 3ONDA 3WNVA 5L4LA 1EZ4A 2C20A 4GAEA 1U3TA 3TN7A 2X4GA 4FPXA 1U2GA 4E5KA 2ET6A 5KKCA 1PWZA 3QVWA 1I36A 1IHXA 3OA2A 3PPIA 2GGSA 1HZJA 3GNSA 3GNQA 4NMHA 4Y67A 1O95A 5EQFA 3GVIA 4NHEA 3EMKA 2C7GA 1BDBA 3D5TA 5DULA 3RAJA 5A05A 3RUCA 1VL0A 2QW8A 2X6TA 3ULKA 1MG0A 1R0KA 4FS3A 4RPKA 2CSUA 2D0IA 3BHMA 3DR3A 3ANMA 3QVSA 3SC4A 4ND3A 1HETA 1DC6A 3GH3A 3IAHA 1QRRA 2I9PA 4MDHA 5KVQA 3RC2A 4B3HA 4GI2A 3K2BA 2AG5A 1ZW1A 4JN6B 2HAEA 1MFZA 2Q2VA 4EDFA 1IB6A 4TWRA 1GCOA 3GDFA 4CM1A 3RWBA 1ADGA 3R6DA 1PJ2A 3JQ9A 5BSHA 1JU9A 3O8QA 4RZHA 4H15A 2VTEA 2W8ZA 4IQ8A 2JAPA 1SCUA 4TROA 1EUDA 1KVQA 3WJ7A 4CUZA 3OQ1A 4TRRA 3GNTA 2F00A 2PGJA 4II3A 1KVSA 4AJPA 4YJFA 4GVLA 4Z3KA 1SMKA 1P1JA 4IJKA 4CR7A 4DIOA 1NASA 2JHGA 1LDNA 4Q9NA 2JD0A 4R51A 2IXAA 4BKPA 1EVZA 2B37A 3PFFA 3K73O 3Q9UA 3RU7A 3I23A 1H0KA 1OZAA 3PYMA 3PQDA 4XYEA 4BMNA 1LU9A 1R4NB 3ANNA 4Z9YA 2P5UA 1PWXA 3AOEC 2ZATA 4NDNE 4CR8A 4PLZA 3FI9A 3I4FA 3W8DA 4BO4A 1HSZA 5A06A 2JFGA 1EUZA 4HFJA 2A9FA 1PR9A 1UR5A 1XELA 4UUMA 4XA8A 1CERA 3N74A 1RM3A 1LQTA 3EAGA 1K89A 1R4NA 1KEWA 4HUJA 4D0SA 5TC4A 1T4BA 1F8GA 2OBYA 4BNNA 4PG8A 1LSOA 3FTNA 4DQXA 1WDKA 5CP8A 4YAJA 4PZDA 5HM8A 1YVEI 1H2HA 1YRLA 1KY5A 5AOVA 3BZUA 3H9JA 1J0XO 4BNMA 4A26A 2H6EA 4Q3CA 4YB8A 3IP1A 3AM4A 3IC5A 3ONEA 3VDQA 1W4ZA 4MIYA 4NIMA 2I65A 3HQ4O 2NTVA 5THKA 2VWQA 4BNFA 3W8FA 4W6ZA 3CSDA 5BNIA 5DP1A 5AVOA 3AI1A 5KTKA 1DAOA 4J2OA 3C24A 3TNLA 5A5EA 2DVMA 3KO8A 3NT2A 3OEYA 4DYVA 3GQVA 1KIFA 3DFUA 3F3SA 5JC8A 1U7HA 1MXHA 3WXBA 1JAYA 2P9CA 3NT5A 3HB4X 2C2YA 3HUDA 3MJTA 2WYWA 4GH5A 3E9MA 5TRTA 1CF2O 1ADFA 1K2WA 2HJSA 4OQYA 3DBRA 1R6DA 3UCEA 3FCOA 3DEYX 3A9WA 3G79A 3TPCA 2NQ8A 4A27A 4XB1A 3V2GA 3QA9A 1UJMA 3PDUA 1R37A 4LRTB 5HBRA 5CG2A 1XCBA 4U7WA 4CLEA 3DC2A 4L0QA 1ISHA 5AYVA 1E7YA 2O3QA 3BXXA 3SEFA 3MJ4A 1JKIA 3KSDO 1PGQA 4TZKA 3DFZA 3K92A 3GEGA 1EE2A 4JJFA 5JCJA 1E7QA 5IN5A 2Y1OA 4QT0A 3PZBA 4OL9A 1R66A 3JD3A 2UUPA 3K2EA 3WQRA 5J23A 1MUUA 1B15A 1L7DA 3I9KA 1RJWA 3ETGA 3TF5A 3L77A 4G65A 3WFJA 3PRJA 2EKLA 4MVJG 3E9NA 4HADA 5DCWA 2VHWA 3GGOA 4PGFA 4AG3A 4BO0A 3RBXA 1O0SA 3OIGA 1Y8RB 2J6IA 3PJEA 3PTZA 4ZGWA 3AUSA 4XX0A 1N9GB 2EWMA 3RROA 1LC3A 3UUWA 3ZWBA 2Y0CA 3HDYA 5DDIP 5AQ1A 1PJBA 4KWHA 3O26A 5CEJA 5A3JA 4J7UA 1HXHA 3BTVA 5ILGA 1C3VA 4JXKA 4W82A 4ZU3A 1VC2A 1C0LA 3RCBA 3K31A 1Y5RA 2GR9A 4S1VA 1N5DA 1LSUA 2AA3A 3Q2KA 4TRMA 4TVOA 4WCDA 4G5HA 2DC1A 3D4OA 3ENNA 3HZZA 5TSDA 3Q9NA 4XD2A 4U6SA 5KWEA 1ZMTA 3DZJA 4MKZA 2Y66A 3EC7A 4A2CA 4Y6PA 2OOSA 1T1SA 5JNLA 5LC1A 1LEHA 1DIRA 1Q0LA 2DFVA 3M2PA 4Y98A 4YACA 2QG4A 1M66A 2HRBA 2Q99A 5I8ZA 3WGGA 4CMIA 1GEGA 3N58A 1BGVA 1RWBA 4TVBA 5I9MA 4YAIA 1VRWA 4U0KA 2X5JO 4PLGA 4GPD1 2JFFA 2YHIB 1XHLA 5I8WA 4U8GA 3KEOA 3DZKA 5AXAA 5EIOA 4RDHA 3JQEA 3NX4A 3UOGA 2CF5A 1YOVB 1XG5A 1HRDA 3U4DA 2PKRA 1ONNA 2OMEA 2ZCVA 2DTEA 2JD1A 4QO7A 5EMHA 3ANLA 3A28A 3L4SO 1E1NA 4BB6A 4BKQA 3NTRA 2Q45A 3F9IA 3RC9A 1LDEA 2YHIA 2A4KA 2UDPA 2BF7A 5DCYA 3EDMA 2PKQO 2WTBA 4WK6A 3RKUA 3RQSA 4OKIA 1YJQA 2X1HA 4MIOA 2RH4A 1YOVA 4WGGA 3S2GA 5DBFA 3U09A 4MVJM 3ZHZA 5HS6A 4B7CA 1VM6A 4OAQA 3I6IA 3RFVA 5CPFA 1I5RA 1Y8QA 4BNZA 4BQRA 4NJOA 4PLFA 1CDOA 1NM5A 2ZYDA 3FPLA 1Z45A 4EYEA 2NQTA 3WGYA 2PGLA 1NFQA 3TOXA 1PZGA 3H5NA 5DT9A 4DPLA 3KLMX 1YB5A 2P4QA 4FJ2A 3C1OA 3NEPX 1XQ1A 5EJ2A 4RORA 2A35A 2I67A 3ABIA 5JAMA 4XRRA 4IJUA 1KVTA 4NBTA 1XQ6A 4EJ0A 1PEDA 2CDBA 3WQQA 4FC6A 1O5IA 2X0NA 4F45A 2FP4A 1X1EA 3LF2A 4L9RA 3P2YA 4WCFC 1T2DA 1KY4A 3RJ5A 3W6ZA 4KDEA 4W4TA 3GRKA 2EGHA 4FCCA 3ZNNA 2Z1NA 2WDZA 4A10A 1AGNA 3HSKA 4I08A 5ILOA 4LN1A 1LLQA 4WLNA 1ZXLA 1Y5MA 3LYLA 4I9HA 3DBLB 4FOOA 4GSKA 4N5MA 2PTGA 4JX8A 4PLVA 1C0KA 2NU9A 3EYWA 3UVEA 3JYOA 4XB2A 4YQZA 4UVHA 2RCYA 1NPDA 5G0WA 4GX1A 2B0JA 2UAGA 2C29D 4W7HA 4J9VA 1LQUA 2Z1MA 2IZ0A 1UP7A 2X5OA 3F1KA 3IDSA 3PWSA 2AE2A 1CIVA 3CH6A 4BO6A 1ISGA 2NVUB 3CKYA 4E32A 3ZU5A 1IZ9A 1WMAA 4DVJA 5H81A 2VUTA 1ULSA 3G0OA 4QFDA 4BGUA 2DU8A 4AJ4A 1KVUA 2PR2A 5A1TA 1AXEA 5EINA 3U0BA 3D7LA 1PZFA 1TT7A 4JK3A 1E7RA 1YJ8A 3WGHA 2NVUA 3M6IA 4Y9DA 1K5HA 1UP6A 3KOUA 4LK3A 2G1UA 1PJQA 3FF4A 3WGOA 3EW7A 3NKLA 3LC1O 4ILKA 3LT4A 4BNKA 4FGWA 1TT5B 5C5IA 3RUIA 3E18A 3B6ZA 4CM9A 1UDAA 3ZV3A 3EVTA 4IPTA 4ALJA 3DONA 1NHWA 2CVQA 2OORA 1A27A 1HLDA 3A1NA 2JAHA 2PGDA 3E8XA 1P31A 1B8UA 4W99A 2BLLA 4AJHA 4CL3A 1EUCA 5ICSA 2BFOA 3GN2A 1IUKA 1LUAA 5COBA 2QIOA 4JROA 4BNVA 3FTPA 2J3KA 2W90A 2HUNA 4R1NA 4MVJH 4XGKA 2BGLA 2XOXA 4AJIA 3HN7A 2YDXA 1V3VA 4HKTA 4J1QA 4PCVA 4CUJA 3I3OA 2A94A 2O2YA 2GCGA 3V1TC 1A9YA 2IE0A 3OBBA 3OJLA 4RZIA 5H82A 1HZZA 4G81A 4CLRB 5G0SA 1BTOA 4IMPA 4GBJA 3DTYA 3GT0A 4U0JA 4JCOA 2GZ1A 1DB3A 2VT2A 1W73A 1YBMA 4CM7A 3HNPA 3IKTA 5C7IO 3C7CB 5L53A 1GUYA 2C07A 1EEHA 2OFPA 4R1UA 4CR6A 4EBFA 5KNLA 2EHDA 2FMUA 1EE9A 5L95A 2NU6A 1IHYA 1C0PA 1E3IA 4RVDA 4Z3DA 4CMGA 4CLRA 4F3YA 1KC3A 5C3MA 2Q4EA 2QQ5A 4WLFA 4DMMA 3SXPA 1X7DA 1NAHA 1BXGB 3MJCA 1B0AA 3IOYA 3LLSA 1DHTA 5DN9A 4OYRA 1HDXA 1ZKMA 5AXCA 5G4KA 1L7EA 1UXKA 4BNYA 4IY1A 4CM9D 2BFMA 1I30A 3SJUA 1D3AA 3JYLA 3PQEA 4N54A 3ZWCA 3L9WA 3CEAA 4J16A 4CLXA 5CFZA 1V3UA 1U2DA 1BXGA 3K8ZA 3PQFA 3OJFA 3OFSA 3HB5X 4FFNA 3P2OA 4JNKA 4MKXA 1S6YA 3WICA 4PG5A 3INGA 1LLUA 3H5RA 4W9NA 5EPOA 1NWCA 1P9LA 2VZ0A 5ADHA 3LT2A 3G17A 1UDCA 3AI3A 4B4WA 4R5MA 1P74A 2BGKA 4BGVA 4J4HA 3QWBA 1WW8A 3AY3A 1SEVA 4PLWA 4WUVA 1IE3A 2BMAA 3QP9A 5TX7A 1EK5A 4XWYA 3W4JA 3I5MA 1H5QA 3RU9A 3NRCA 1MG5A 4QECA 5KKAA 1RKXA 1A4IA 2FSSA 2Y67A 1OC4A 1LXCA 1UAGA 3G1UA 4GQAA 4E5YA 1LX6A 1QYVA 4UVEA 3VPFA 4AICA 3IMFA 2B35A 1TEHA 3GG9A 1D8AA 3W8EA 4R9RA 5JFOA 2OHXA 2VQ3A 1ZEJA 4N5LA 4CMBA 1UDBA 4M87A 4OKNA 2EP5A 3VAZA 4RF3A 3WLFA 5EN4A 4ALIA 3I9JA 4AL4A 5HRUA 3AUTA 3GZ4A 1IZ0A 1ZO8A 3I9LA 2TMDA 1T2CA 4KQXA 1C1XA 3AM3A 1NWHA 1QYXA 3H6KA 3DOJA 5T57A 4GLOA 1JA9A 3S55A 1VSVA 3LF1A 1EDZA 4XQEA 5F3RA 1NQTA 4YRDA 4Q3DA 3PHGA 3S2EA 1PQPA 4BGIA 1Y81A 2FN7A 5FI5A 3ZN2A 4ALLA 4J4BA 3O38A 3PHHA 3DMTC 5JYDA 1VKOA 3A4VA 1H2BA 3ROMA 3W4IA 1PS9A 1NVTA 1PL6A 3VH3A 3NYWA 5BR7A 2BI8A 1KEVA 3FNGA 1ENZA 2D2IA 2YJZA 4FW8A 3PVZA 5JY6A 3OMLA 3D3WA 2JCYA 5FFFA 2HMWA 2ZB7A 2QZ9A 3ZWNA 5JYEA 5T5QA 2Y0DA 4FFLA 1OI7A 4DTIA 1E6WA 4P8RA 1EVJA 1DPGA 2WD7A 3E5MA 3KUXA 4J91A 4K6FA 2X9NA 4XJTA 4CM6A 1WMBA 1YDWA 4J2HA 4BO9A 3EUWA 1N92A 4OHUA 4XCVA 4CLHA 3MOIA 4YRAA 2ZTLA 4J90A 3UCFA 3U3XA 5KVVA 5BNTA 5A9SB 1KERA 4J1TA 3UFXA 4CL8A 1CJCA 3OETA 5IDWA 3GFBA 4MP8A 1ENYA 3ZU2A 4XQGA 3VC7A 1HLPA 4OOFA 4GMGA 4PLHA 3AK4A 4IDBA 5ER9A 3JV7A 1NVMB 3IUPA 1QYCA 4II2A 4Z6KA 5K0ZA 3GGPA 1H93A 3WYEA 5A9SA 1WPQA 1GFSA 4BNHA 4JLWA 1DRUA 3CMMA 1OMOA 1R4MA 2BGMA 4J49A 4FGSA 4YJDA 5ICMA 3ZCXA 5F1OA 4FDAA 4YT2A 2HCTA 5GZ1A 3ADOA 3NV9A 3INRA 4E5NA 4GKVA 3MJVA 3F4LA 4BQPA 4FOSA 3WSVA 3OF2A 1FDSA 1PQWA 3DTTA 2EG9A 2VUSA 1N8KA 1LA2A 3OICA 4CM4B 1YL5A 1LJ8A 1E92A 3QWFA 1NAIA 3ZHXA 4CMEC 1C0IA 2ZQZA 1U9JA 3BHIA 1QMGA 2V6BA 9LDTA 5LDGA 4NR0A 2PKQP 2R00C 3KZVA 3UICA 1YL7A 3ASUA 1DRVA 4B4UA 1N2SA 2DBZA 1XU7A 4LMPA 1KEPA 4XZ3A 2GN8A 5DNAA 3WLEA 2HMUA 4D0RA 1SOVA 4B4OA 4G2NA 5THQA 1MC4A 3ZWPA 5JBIA 3QHAA 1HE5A 3V1UA 5L45A 4OSOA 3GPDG 4R54A 5HA5A 4YYZA 2YFQA 2H1SA 3BMQB 3QY9A 1E5QA 1G0OA 4OH1A 2E6UX 3TZ6A 1WP4A 2AXQA 4O1MA 3AY7A 7ADHA 5T64A 3PP8A 4ONEA 1Y9AA 4EEXA 1XA0A 4R5HA 3H9UA 2GLXA 3ROKA 3VPXA 4P22A 3B20A 1X14A 3QWAA 2V6GA 3JSAA 1I3NA 3BMQA 3SBOA 3KM0A 3O03A 3WTCA 1NFFA 5C37A 4H16A 1P1HA 2BI7A 3DZGA 4J4TA 4KTVE 1EVIA 5ENDA 2CDAA 2Q1UA 1IPEA 5CG1A 2CZCA 1ZSNA 4D43A 1ZEMA 3ZWWA 3LDHA 1P3DA 3AU8A 1H6DA 1Y6JA 3FR7A 2UVDA 4I5DA 4KDFA 3ROQA 1XYGA 2DPGA 3TOZA 2WE7A 1E7MA 4MP3A 5IZ4A 1VE9A 2NV6A 2O3SA 4JP3A 3RUAA 3RUDA 2Q2WA 5G2OA 2AQKA 3C85A 3DAFA 2F1KA 2WJPA 2FRDA 3LVFO 4ND2A 1H9AA 2E48A 1HDRA 1W8DA 1RM4A 2POQX 1SO8A 4KZPA 4J3FA 2PD6A 2XXBA 3H9GA 1QSGA 4BGEA 3GPIA 4OMUA 3PIIA 4INAA 2VRBA 1CQIA 1QP8A 4WLUA 1QORA 5JXWA 5L7WA 5MDHA 1I33A 4XEHA 2PZJA 2IXBA 4DWVA 2ZYAA 4E21A 4NZ9A 5KJ6A 4WEQA 4ALNA 2GZ3A 5KVCA 2IYPA 5COQA 4LVCA 4O5OA 3U4HA 4D45A 4R69A 1P77A 2W2LA 3ON5A 1T1RA 3VH4A 2JD2A 1I3MA 2B5VA 4RPHA 4WASA 5GMOA 2RBEA 3K96A 4CMCA 3RJ9A 1GCUA 3ETDA 2BFAA 3Q2IA 2CVOA 5IFLA 5U9CA 4IDEA 2I76A 1H6CA 4HNHA 3GN1A 3HDHA 4E5MA 4EJ6A 3KXDA 4PZCA 2YUTA 3JQFA 1VSUA 5IZCC 5KJFA 2P91A 5CPBA 3GHHA 4N5NA 3JQ7B 4GSLA 1BWSA 3DWFA 4NJMB 4YTEA 2BRUA 1MX3A 1HE3A 5HTOA 4DMLA 2A92A 2G17A 3KHUA 3NDIA 3ZHYA 1JTVA 3Q6IA 2LDBA 1CRWG 1G1AA 3M1AA 3NTOA 4XKJA 1HL3A 4DUPA 2C0CA 2YQ4A 4LRSB 2YDYA 1ADCA 4RLSA 4IM7A 4DLLA 3JQ7A 2P9EA 4BKRA 1S7CA 3KYBA 4MJLA 2G0TA 4E2YA 1BXKA 4BKUA 1KYQA 1Q7CA 2GRAA 4D42A 4BKOA 4IDFA 1WVGA 3GVHA 3PIDA 4B79A 3AU9A 3HG7A 2HMVA 3KEQA 3QSGA 2X0JA 3OQBA 4K28A 1SOWA 3CUKA 3JCZA 3WYCA 4YRBA 5JAQA 3DZFA 1E77A 4MO2A 3UW3A 4UUPA 2O4UX 4CQMB 4EI2A 2J8ZA 2WWRA 4D41A 1FDWA 2SCUA 2Q1TA 2OGUA 5F5NA 4BV8A 1UXGA 1T25A 5DBGA 2W2LD 5FF9A 1F17A 2D3TA 4UVGA 3MJEA 2P2SA 2AEMA 4A0SA 4WE3A 2PV7A 5TLSA 4PLCA 3RKRA 3JQGB 1ONOA 4MVJE 5FEUA 1XU9A 4ZD6A 3AW9A 5AXDA 2W2KB 4YPOA 4BMVA 1WZEA 2VZ8A 4PG4A 3P5SA 1Y8RA 3WQSB 1JLLA 1GQQA 4ZQGA 4YXFA 3GG2A 2PFGA 1A9ZA 1BW9B 1BSVA 1N9GA 4OOEA 2Y05A 3VZPA 3CZRA 2Q4BA 5JE8A 1LSSA 2HQ1A 4NH4A 1PJ4A 2B83A 3IKVA 4H3VA 4PFJA 3DDNA 1PGJA 3WIDA 3WIEA 4A5OA 5JDIC 4Q39A 3GDOA 3D4PA 1Z75A 2V6FA 1LDYA 3OECA 3DZHA 4X54A 1GY8A 1HDYA 1UZLA 3AFMA 2NUAA 1I3LA 4XJSA 5JCJD 1FJHA 2DM6A 2Y1DA 1ISFA 3PK0A 5DOVA 2VRCA 4KTTE 3IS3A 1LTHR 1A72A 4R9SA 2RAFA 4YJGB 1PS8A 3R3JA 1VJ1A 3ZV4A 1ZBQA 2X0IA 2EEZA 1WXDA 4WCFB 1HDGO 1KS9A 4LSMA 4CM8B 4NBUA 3H65A 2O3RA 4RF2A 1T24A 3VHRA 2D5AA 1P0CA 2EXXA 4D79A 3GVPA 2CMDA 3TWOA 2R6JA 5ER6A 4FJ0A 1U5AA 2VT3A 1NNUA 1JW9B 1K6IA 1NQAO 4L4RA 4Q3NA 3WGTA 2ZTMA 5L3ZA 3RIHA 1U4SA 4R3NA 2C7VA 4XYMA 4E2XA 1YGYA 5L40A 3NJ4A 3CE6A 1DSSG 4MPDA 3TL3A 3GF4A 1X0XA 1PZHA 2QYTA 1BVUA 3L4BA 1ZJYA 1X0VA 2CY0A 3D64A 4ZICA 2O48X 2GERA 4RPLA 4A03A 2IZ1A 2NNLD 2AEFA 1E7SA 1MFPA 2EIHA 3OJ0A 1AUPA 2GZ2A 3LC7O 1HTBA 1H6BA 1DJNA 4ZQBA 4NK5A 2ZB3A 3UXYA 3ZWXA 1E3WB 2B4TO 2PZKA 3AOGA 3OQ6A 2X7HA 4NK4A 3CPSA 3TFOA 2VN8A 1NYTA 3OIDA 4RLHA 3L6DA 4CM3A 1I2ZA 1I0ZA 4EEZA 2HKIA 4NFYA 2ZCUA 1ZK1A 3W1VA 5G0VA 4YVFA 3CINA 3VDRA 2LDXA 4UVDA 3F1LA 4WECA 1X13A 1GYQA 2EW8A 2Q1SA 1Q2XA 1CETA 2CD9A 3VOSA 3CZMA 3OA0A 2VRCD 1YONA 3CXRA 1T26A 4DQVA 3DOCA 3ONFA 1TA4A 3FD8A 4L76A 4NI5A 1P0FA 3E5RA 9LDBA 3BTSA 4JBHA 1D1SA 4LVUA 2J3IA 3PGXA 4IBOA 1E3SA 4BL5A 2I66A 1HF3A 3S2FA 3L0DA 1B26A 2PWZA 4LSWA 1PTJA 1QYWA 5I9NA 5IG2A 1B7GO 4LCEA 1M75A 1XDWA 3QV1A 5T8KC 4WKGA 1U28A 4BNUA 4AJLA 2EJVA 2C2XA 3K30A 3NDJA 4K6CA 3A14A 3S8MA 4JBIA 3DBLA 5DBIA 2FOIA 1B3RA 1KC1A 5TT0A 2JCXA 3Q0EA 3ADPA 1O89A 4B7UA 3VZSA 4B3JA 3FN4A 4P4GA 1B3BA 3BTUA 4WLEA 2BH9A 3U62A 1KOLA 1DHRA 1R15A 4B7XA 2AW5A 3BMOB 1E5LA 1KBZA 5CEFA 4CMJA 3MZ0A 4N18A 3ZWYA 5GZ6A 3TDKA 4LCJA 3L6EA 3RUFA 5B4VA 4I5GA 1LI4A 1JVSA 1NQOA 2PH5A 4RPGA 4MVJI 3AJRA 2PNFA 3PGJA 2GD1O 3I9OA 5ENVA 2GASA 2CUKA 2J5KA 3FRJA 1UUFA 2GPTA 2Q3EA 5B37A 4C7JA 5IXSA 1U3UA 1R0SA 4ROSA 4WPGA 3GRPA 1DLJA 3WG9A 3DZBA 4R68A 3W6UA 2GN6A 5I7SA 4HP8A 1LDBA 1ZMOA 5TS3A 1QV6A 4IDGA 4U6QA 5JAZA 1B8VA 3PYLA 2C54A 1TT5A 1GAEO 1V9LA 4CV2A 1DJQA 5EERA 3ENKA 2YW9A 3I4CA 3ITKA 1AE1A 2NADA 1IL0A 1M2WA 2VWHA 1RM5A 5IDQA 4GKBA 3ITDA 2FSVA 1UP4A 4EZBA 4RQUA 2GNAA 2GSDA 1ZUD1 1HDOA 1LC0A 5F1PA 4L4XA 4WJZA 4W7IA 3OJOA 1YQGA 1HDZA 1EQUA 2D8AA 5G0TA 1PGPA 4UEJA 4P4LA 2OUIA 5KJCA 3G3EA 4BMSA 3Q1LA 1Z7BA 1P1KA 2P9GA 1ENOA 1SBYA 1X7HA 1ZK0A 1EK6A 1F14A 2OZPA 4XIYA 4UVIA 4WOJA 3LC2O 2AE1A 4L75A 1U8XX 1DIAA 3E48A 3TFQA 1MLDA 4RF5A 3WNQA 1TXGA 1ZSVA 1DIBA 1GQ2A 4OO3A 4PVCA 4AJEA 4TKMA 5I7EA 5IN4A 3SC6A 1M67A 4XR4A 1XLTA 3STHA 1WWKA 1GV1A 2YV2A 3NAQA 4XDYA 4FFPA 1UH5A 2IEBA 2VWPA 4NBRA 5KJ1A 5TIIA 3VPSA 4AVYA 5I9LA 1P1IA 2VUUA 3HDJA 4GX2A 2VHXA 1FDVA 2FY8A 3HHPA 2J3JA 4HXYA 4JP2A 4MIEA 3JD4A 4CPDA 4XQCA 8ADHA 4DLAA 1DRWA 4OQZA 4JQCA 4XYLA 5DZSA 3FWNA 1PS0A 3H4VA 4R3WA 1LDGA 1O8CA 1A7KA 4TRJA 3P7MA 1PL8A 1LNQA 2YV1A 4D44A 1HEUA 1F12A 3QLJA 2ZJ0A 2YHUA 3A06A 2JHFA 3RFTA 1IULA 2YV3A 5B4TA 2P5YA 4DIFA 3NGXA 3TZQA 1DLIA 2VOEA 3MTJA 3ZZNA 4RL6A 1B8PA 1IY8A 5I7FA 4ID9A 3UKOA 1ZZEA 3VH2A 4WNIA 2XXJA 2C5EA 4FC7A 2JL1A 1DC5A 3RUHA 5B1YA 2H63A 4OXYA 2X8LA 3DMTA 1VI2A 4BO8A 4CODB 4GLLA 5CDSA 5K6AC 4GWGA 4RV9A 4J1SA 4E0BA 2B69A 4D7AA 3R3SA 1M76A 2X22A 2WYUA 3PFWO 3DBVO 4BNGA 4EITA 2Q2QA 1H94A 1GU7A 3AI2A 4J1NA 1JVBA 1DDOA 2PD3A 1GPJA 1AXGA 1B16A 2IYOA 4LGVA 4O63O 2ZTVA 4D3DA 4WOKA 3GA0A 1ID1A 4IJWA 1O6ZA 4Q3EA 1X7GA 2PY6A 3BMCB 3TZHA 5L4NA 3GAZA 4DC0A 4YT8A 3SJ7A 5BSGA 2NACA 1LSJA 1DBVO 1EBUA 1K0UA 3JYPA 4BOYA 5HWSA 7MDHA 4E2ZA 3H5AA 1NFRA 1T4DA 4M49A 1D7OA 3SX2A 1BRMA 1SB9A 3BMCA 4MVJF 1DFIA 3TQHA 4NNJA 1HSOA 3PJDA 4HFMA 1SNYA 1QXSA 2O7QA 3CIFA 3E6AA 2IZZA 1YKFA 3R0IA 3ZWAA 2EJWA 2ZJ1A 4MINA 5TT1A 1NPYA 4D46A 4TKLA 1UAYA 3FPCA 1UXHA 3B70A 2UV8A 4M89A 2CF6A 4B8ZA 2DLDA 2HRZA 2H5LA 5JAIA 1ZXBA 2H9IA 4FSHA 2ZK7A 4WEOA 4AFNA 1OAAA 2HJRA 1ADBA 1EFKA 1SEPA 5C7LO 3IUSA 3ZNQA 5GZ3A 1PZEA 4ZRMA 1PJLA 3ORFA 1JKFA 4RCVA 4RVFA 2XPCA 4YDRA 2XAAA 3FSRA 1ISJA 3JYNA 3WJAA 5BNFA 3QQPA 2OP1A 3ZH2A 4CMEA 4UEOA 3DO5A 4I5EA 3S2IA 3MWEB 2D59A 2CNBA 1A71A 1CYDA 2R2GA 2AHRA 3H9EO 2R00A 3JQDA 2NLOA 3H9QA 5FWNA 1K3TA 1YB4A 3H7AA 2IRWA 3FHLA 4YAKA 2FPIA 2X0RA 3NUGA 4K9DA 4CLDA 4CV3A 1HE4A 2FWMX 2Y1GA 3T4EA 3PLRA 3VZQA 3NJ8A 4XYBA 1XEAA 1FF9A 4L4SA 3WX0A 1R12A 4BUCA 3UHAA 1DIGA 1Z6ZA 4XGNA 5F1KA 3ZGYA 1C1DB 4DGSA 2VHVA 2OL4A 2B36A 3VPGA 1YO6A 3DQPA 2GN4A 2W4QA 3PLNA 1QYDA 1CEQA 5JDCC 2PD4A 2I3AA 3IJPA 5A4DA 3T7EA 3I9MA 2DBVO 2Y93A 2EGGA 1GZ6A 3TRIA 1JWBB 4C7KA 4BO2A 1I3KA 3U49A 2I6TA 4I9NA 2AQHA 2VHZA 4RF4A 3I83A 3UN1A 1PSDA 4A73A 3L07A 2B5WA 5JSFA 2NSDA 5TGDA 3IJRA 3ZI0A 5JW6A 4DBVO 1GZ4A 4DQUA 3I6QA 1ZK4A 3NT4A 3RC7A 5JC1A 1NTOA 2X9VA 3AUUA 3BTOA 1JQBA 5A3VA 1B2LA 5DF1A 1AHIA 1XWFA 3GVCA 4YBZA 3PWZA 4DL9A 4Q3BA 4R4JA 5KIAA 2OBNA 4NU6A 1YE3A 1NBOA 3JQBC 2FR1A 1Z74A 4CM4A 2Q50A 2DUUA 1FDUA 3INTA 3VVBA 4XQ9A 3AOEA 3RBVA 2WM3A 5IJZA 3SLKA 4F6LA 4IXWA 2XF8A 1ZK2A 5ITVA 1OBFO 3F6YA 5U1PA 3C7AA 1XR3A 3KYCB 3PDJA 4GGPA 2Q49A 4K1LA 2IODA 4TQGA 2X9GA 2DBQA 3AM5A 3BIOA 2JKVA 1ISIA 3RSHA 2HK8A 1GDHA 3O8QB 5DCUA 3U4IA 1OFGA 1GV0A 5B4UA 1LRLA 3E82A 1ULUA 3MOGA 1V6AA 3KYCA 1T2EA 1GYPA 5TQVA 2Z5LA 2YFHA 4YEDA 4YJFB 1WLYA 2D5CA 4P4NA 4BO7A 3ZU4A 5EQDA 1DAPA 2VYNA 3GZNB 1YDEA 5EESA 1X15A 3D0OA 4RVSA 1DC3A 4KOAA 2PLAA 2DKNA 3KETA 5L51A 2NWQA 4RPJA 1E1KA 3F5SA 3V8BA 3RI3A 1T2AA 2O3UA 4QO8A 3HFGA 4AJKA 1E3EA 3CTMA 1RM0A 2EF1A 1E6UA 2AQ8A 2FZWA 3GZNA 5IZCA 1I24A 1P45A 4MVJA 4A7PA 5TJ9A 4CLOB 1TB4A 1VL8A 1ZVMA 3QJ5A 4PN3A 3G49A 1F0YA 4BNTA 3RVDA 1XSEA 4OXKA 4BHTA 3WOHA 2HLPA 3GAFA 4O59O 3K9QO 4Z9XA 1CWUA 2RH8A 2GYYA 4ZQHA 3WSWA 4RVHA 2NM0A 3F47A 4GVXA 4DC1A 2G82A 3T4XA 4CLOA 4BO1A 1DEHA 3JQ9C 5K9ZA 5BSFA 2NU7A 1A4UA 2E82A 3GEMA 1EQ2A 5CEEA 3FNHA 1E7WA 1DFHA 1AN9A 2HMTA 2PZLA 1GYRA 5T6BA 1Q0QA 3EGOA 2V7PA 1EFLA 3PJFA 3CMCO 3O9ZA 1DFGA 3AWDA 4UREA 1ONPA 3KSUA 4ZA2A 4EW6A 3LT0A 3WGIA 2WE8A 3ZWVA 4KUGA 3ZW8A 1OC2A 3HN2A 1MXFA 1ZK3A 1PJTA 2NVBA 1BMDA 1DO8A 4XIJA 1WNTA 4O6VA 1P1RA 1W6UA 2VYND 3GUCA 4I8XA 4L74A 4I9UA 1LRJA 1JDJA 4DREA 4UULA 4Z0TA 4QEDA 1D1TA 3NTQA 1WDMA 3ZWMA 1ML3A 2ZKLA 1YXMA 3TZCA 4IQ0A 2QYSA 3DBRB 3FNEA 3FR8A 2J5QA 3JD0A 1B14A 5CDTA 3IL2A 1GUFA 3RUEA 2GDZA 2G5CA 3L6OO 4TZTA 2FHSA 4P38A 4NJMA 1DOHA 3JQ6A 4XDZA 4LMRA 3QW2A 4YQYA 5DP2A 3FBTA 4MVJD 1NR7A 3PHIA 2GUGA 4BNLA 4E13A 4Y8VA 3RBZA 4JGBA 3GMDA 4LW8A 5JDIA 1RYEA 1K6XA 3S1LA 5A9TA 4PVDA 1MB4A 1Q1NA 3DBHB 4KUHA 1UZMA 1GADO 3GUYA 4QSMA 2JFHA 1YQXA 2D4AA 2DBRA 3T7CA 4BVAA 3K5PA 4J0FA 3VTZA 4URFA 5FYDA 2O3TA 3PZRA 1QLHA 1P1FA 3ICPA 4S3MA 3V1YA 5KJEA 1QLJA 5JCXA 1NXQA 3DBHA 4CQMA 1WAMA 2WSBA 3H3JA 4PG6A 5G4LA 1LBEA 3N7UA 4OJNA 5IDYA 5TF4A 2FR8A 1FK8A 4CMHA 2BELA 3WWYA 4ITUA 4IZHA 4J0EA 3WTBA 3JQFC 4IDCA 3FBGA 4ALMA 4BNXA 3BMNB 1N7GA 3JQGA 4EUFA 2DT5A 4R41A 4M86A 2TMGA 3AY6A 2QZZA 2W2KA 3EZYA 3SLGA 4PLTA 2I3GA 2W98A 4BIIA 4KWIA 3DAGA 1U1IA 1BW9A 4GL4A 1EMDA 1ZJZA 4Z0HO 1D4FA 1NX6A 3JQCA 4TRNA 2BD0A 1HKUA 4XYGA 3BMNA 4B4VA 1UXJA 4IZIA 1Z73A 5JMWA 3VH1A 3RC1A 1U4OA 3WGZA 3DHYA 3WS7A 2HK7A 3WFIA 5EL0A 4FN4A 1U3VA 3V5NA 4YAGA 3LLVA 4PRKA 4BNWA 1F06A 3COSA 4R16A 3ZV6A 2RHRA 3LT1A 2OO5A 3HJAA 1JWAB 4J7XA 4ND1A 3EK2A 2V6MA 1GL3A 4IIVA 3MWDB 3WDSA 4CMIB 5ITWA 5JY1A 2VNSA 2VOJA 3PXXA 1V0JA 2B4RO 3KYDB 4KMSA 4YT5A 4IDDA 4E2WA 1L1FA 2VZ9A 3NDRA 2X23A 1Q7GA 4ESOA 3V2HA 4YJGA 4R1SA 1LRKA 4FB5A 4O0LA 4JIGA 5LDHA 3MTGA 5AXBA 4PLYA 4WCFA 4PLPA 5CAEA 4CQMD 3KYDA 2JJYA 4OSPA 3TZKA 1F8FA 4CM8A 1IYZA 1BXZA 3C3XA 4M54A 5GY7A 2X5KO 1C14A 3LZ6A 1X1TA 4B3IA 8LDHA 1XGKA 1BHSA 2P68A 4OM8A 3ZNPA 3UH1A 4RGBA 3X2FA 2O3JA 3ZNOA 2NTNA 3PHLA 5T8KA 3U9LA 4PG7A 3OSUA 4CJXA 4FQ8A 4IINA 1PGNA 1FMCA 2C59A 2O23A 3BA1A 1Y8QB 3JTMA 2YQ5A 2EW2A 1KEUA 3D1LA 4IS2A 1GUZA 3E9QA 5IXYA 4EUEA 1PJSA 4GGOA 4BB5A 1NR1A 3WGQA 1DXYA 4TSKA 3GDGA 3OIFA 4HWKA 4PRLA 3R1IA 1E3WA 2DTDA 4YWJA 2OXIA 4GWKA 4QFCA 4E5PA 1ZH8A 3WMXA 1Q7BA 1YH3A 1PQUA 4D3SA 2ILTA 4OGWA 5L7TA 3ETEA 2EERA 4RQTA 1I8TA 1YBVA 3HDQA 4C4OA 4IMRA 3M1LA 3ST7A 4NBVA 3C1AA 3B1JA 1T2FA 2HU2A 3WB9A 4DPMA 1GD1O 5IAAA 1XKQA 2WYVA 1SB8A 3WMWA 5BSEA 2BHLA 5JS6A 1TLTA 2E4AA 4TMFA 3M2TA 5DOZA 4H7PA 3DZIA 1E3JA 5F21A 4FJ1A 4I5FA 1ORRA 3GC6A 4IGFA 3ROPA 2YYYA 4EUHA 4DIBA 1QV7A 1MA0A 2I5PO 5G0UA 4YCAA 4IXTA 3RFXA 2ZTUA 1VL6A 3DXFA 2YY7A 1U3WA 3MEQA 4CQLB 4DPKA 3PEFA 2Y0EA 1ZSYA 2FPGA 4D3FA 1NHGA 1YL6A 2VWGA 2DAPA 3L4BC 1Y7TA 4HBGA 3IIEA 1PJCA 4E6PA 1I2BA 3I52A 3L9XA 4PZEA 3KVOA 2UYYA 1DC4A 1BDMA 3PI7A 3U4CA 4AJOA 3GFGA 4M55A 5JLAA 3WR5A 3B1FA 3DL2A 4OXNA 4QTZA 1E3LA 2DQ4A 2PZMA 2DPHA 3WBBA 4CQLA 3O4RA 4HV4A 1NP3A 3QRWA 4XR9A 4Y6SA 1EVYA 5C7OO 1RYDA 3F46A 1IOLA 5F5LA 1JKJA 2QRKA 1E1LA 4KP7A 2VYVA 4J7CA 1HT0A 1I32A 4KQWA 4RJTA 3LSYA 3RASA 3LK7A 4FFOA 1P44A 1FXSA 4KUEA 3GEDA 3TJRA 2GO1A 3HADA 4GX0A 3UF0A 4IDAA 2O50A 5A03A 3PJGA 1PL7A 3IQDB 3BMOA 4YAEA 1EBFA 2J3HA 4IUYA 4Z9FA 2WEKA 2HK9A 3UAGA 3OM9A 2VTDA 3OHSX 4AJ1A 2AEJA 2HO5A 5IF3A 4E33A 1WDLA 2DFDA 1Y9EA 2GF2A 3DHNA 2ZYGA 4J9UE 4BNIA 2VNAA 3AUAA 3LU1A 5A04A 5CDGA 2B4QA 1VJTA 6LDHA 2WMDA 1GTMA 1MP0A 4F6CA 1VPDA 1N7HA 2NVWA 2Y68A 3H2SA 3QVXA 3WWZA 1TI7A 3MJSA 5L7YA 4CUKA 1HDCA 1VLLA 1O9BA 5CDYA 1W0CA 3PHJA 4FD3A 2QRJA 4BO5A 3U5TA 1V35A 3EZLA 2YZ7A 1PGOA 1VJ0A 2I99A 4IQGA 4HNGA 2BFPA 4K26A 5BT9A 5KCZA 3WBFA 4OIMA 1CQJA 4ZQEA 1GEEA 4ND5A 2PK3A 5ES3A 3OH8A 1NPTO 1N1EA 3ASVA 1V3TA 2E49A 1SPXA 2AQIA 1J5PA 2Y1CA 4MP6A 3DHEA 3KSZO 3OEWA 1MC5A 3ICCA 1A5ZA 2ZQYA 2VYVD 1FDTA 4MOWA 5KOIA 2X86A 1KVRA 1WZIA 3D4NA 4E12A 2E37A 3Q3CA 4UUNA 4MVJP 2PA3A 5K6AA 1IPFA 3JQ8B 4RVGA 2C5AA 1U7TA 3I1JA 2OP0A 2EKPA 2GN9A 3QVTA 4PIVA 5G4KB 1J4AA 4ZHSA 4CV1A 5MGBA 3H8VA 4NU5A 1ZCJA 4Y6RA 3QWIA 3ZDFA 5L4SA 3P19A 4AJNA 1J49A 4DBZA 4EJMA 4WNCA 1EDOA 1ISMA 3I9NA 3C1TA 3GK3A 3KV3O 3PYXA 3C8MA 4BV9A 4NFHA 3DB2A 2QRLA 4FFRA 3H2ZA 4U5QA 4QX6A 2Q46A 1M6WA 3JQ8A 3QIVA 3KLPX 4R01A 3JD2A 3VPHA 4CMKA 1TVEA 3VTFA 4XRGA 3VVCA 2J5RA 4WLOA 2Q1WA 4HFRA 4DYDA 4YR9A 2CVZA 1R0LA 3HFSA 1HE2A 2FR0A 2O2SA 3OJEA 2EKQA 4QXMA 3OP4A 1MGOA 2DTXA 2ZB8A 1ZNQO 3DOOA 1BVRA 2WD8A 5BQFA 1V8BA 2HDHA 4NBWA 3ZU3A 4E31A 5CHEA 3LQFA 3VZRA 3UCXA 4BS9A 4ZJUA 3GVXA 4BNJA 1K6JA 2HMSA 4RDIA 4FR5A 3VKVA 1NQ5A 3C7DB 3B1KA 3QE3A 4HX5A 1UXIA 3JQAB 4R1TA 3ZW9A 3F5QA 3HE3A 2JCVA 1P33A 4ZQFA 3KRTA 5CDUA 2X58A 3MCVA 4FFMA 4MKRA 1YBAA 4AJ2A 1G0NA 3GGGA 4FBGA 3ZWOA 4BO3A 1QKIA 2EP7A 1YB1A 2V65A 1PIWA 3GHYA 1G6KA 3IP3A 5FI3A 4CMAA 1ARZA 1AHHA 3DMYA 4HY3A 2P4HX 3ZHBA 4L8VA 1M6HA 3JQAA 1ZIDA 3BYZA 2ZB4A 4NG5A 4CM5A 2FPPA 1Q0HA 4FIZA 5L9AA 1YQDA 5A5FA 4HFNA 1C1XB 2IEDA 1A7AA 5HS4A 4YT4A 1Z7EA 1ENPA 1SC6A 3BAZA 1J6UA 1GQYA 3GOHA 4J43A 3BHJA 1HYHA 5JO0A 2VCYA 1Y1PA 2O7SA 2VHYA 5LCXA 4W9NC 4RO0A 5JO9A 1R16A 4E30A 5A9RA 4N7RA 4UAGA 5TNXA 2NTJA 5I7VA 1U8FO 4Q3AA 3K6JA 3X2EA 1N1GA 3D3EA 1UZNA 1MV8A 2Y1EA 2FZEA 5COAA 4ALKA 1PJ3A 1XIVA 1HYEA 2C82A 3G1TA 3JD1A 2HSDA 4ZRNA 1E0DA 2Z95A 4F46A 5IDXA 1ZFNA 2IDZA 2PH3A
chains in the Genus database with same CATH superfamily
3EVFA 1ZVKA 9MHTA 5HW0A 4QGSA 1NVDA 1NKTA 1X70A 2HTEA 1E9BA 4D9FA 4F91B 3EXG1 5JVDB 5DGCA 1RQ7A 4IJQA 3MCTA 1JDVA 3DKRA 3R3YA 4LJ6A 3BH0A 4ZYZA 5CMLA 2XEXA 4RD6A 1I0IA 5A02A 4GX5A 2RIRA 2IQ5A 3W4KA 1AQUA 5IMSA 5KU1A 5U4QA 2WD7B 4HN4B 1LBQA 1YS4A 1GZ3A 1N8TA 1C7EA 5JPIA 1N6LA 2KMLA 5ITVA 1EWRA 5FJIA 2IF2A 4DB4A 3GARA 1IXZA 1CDDA 2JGNA 3Q11A 3UJCA 1QWSA 1RPNA 1JL3A 3FNFA 1P1BA 2Q5CA 3UGKA 2JF0A 5IW8A 2P9FA 3EY4A 2Y99A 3S0JA 4UHHA 2C03A 2WHQA 3V8QA 1NW3A 1BG6A 3L7NA 1E6MA 3U81A 4DRYA 1UJBA 1WS6A 1OBOA 1PR3A 3LFUA 1N8NA 5G40A 5U4XA 1D2RA 2AN1A 1H9BA 4K9NA 1H8HD 3MTIA 3JQAD 4IGEA 1LDMA 3WLLA 5AKZA 2H5EA 4BQQA 3HBFA 4LZLA 3OPMA 2UUOA 3INYA 1RMQA 1J8DA 4GMFA 5KCMA 3RIXA 3SE7A 3W90A 4TKVA 5CB6A 5IVPA 1KI2A 1OGJA 3EFBA 3IFSA 1KKMA 2YC2C 4P2GA 3DAPA 5FUXA 1SAYA 3I6YA 2NU8B 3QVOA 4I50A 3R7FA 2Q21A 3CB4A 1DP4A 1FX0B 4PNZA 5GV8A 2TRSB 5DTJA 2EV9A 1LLDA 1W36D 3PNPA 1Q77A 3QVLA 1ZOPA 2O4CA 4Z0PA 4HAIA 1A04A 1JQAA 1OHHD 1ORIA 2PUHA 4DLPA 3GLQA 4M8SA 1VCIA 4ZTZB 3SVTA 1IPHA 1C1YA 3HCBA 1NVGA 4Y2HA 3DXXA 2XMBA 4R0VA 4YA6A 4KIUA 5JMPA 3DO8A 2NU8A 1C1DA 4BFSA 4CTKA 1Z18A 4JUDX 3MTBA 5JU6A 1RRFA 2X6RA 1FX0A 5JZOA 1L7NA 3R44A 3ECAA 3G8YA 4J0IA 2YHBA 1U5CA 4PCLA 3KBOA 2ENWA 2Q5JA 4MUEA 1VIVA 3H84A 4HJRA 5AHXA 4Z2AA 4ZOLF 3ILXA 3OM8A 4LSZA 3TECE 3NGLA 2FUKA 4LUCA 1IJEA 1YR7A 3OOWA 3ONDA 3R3WA 4P53A 4UEWA 4XEUA 3WNVA 5L4LA 3QLTA 2UUAB 4RANA 5FR2A 3E61A 2C20A 4LYAA 1VSBA 4E5KA 2ET6A 3IIIA 3OJXA 1G8GA 5GJCA 3QVWA 2FPMA 1TQ6A 3PPIA 2GGSA 1HZJA 3ND5A 3K8OE 1OGIA 5D6NA 3GNQA 4EPRA 3L4JA 1WNFA 2FN4A 1TO1E 1YFKA 3FFBA 4NHEA 1S3SA 3LRXA 3PCTA 1QIEA 5DTMA 3E22B 5D1HA 1BDBA 2H0AA 2F1JA 3RAJA 1QOZA 1CRZA 1U0TA 2BGUA 2QW8A 3FOBA 3IEVA 1R0KA 3MAGA 1UJCA 5TDHA 1FNDA 2I1VB 2CSUA 1TF2A 2YUIA 2R87A 1JHZA 3QVSA 4MPPA 1WF3A 1HETA 1VIDA 4COOA 2G0AA 1GGNA 2F43B 2XUIA 4IJMA 2NP6A 2PL3A 1L3IA 4NARA 4HQ0A 5J4KA 3O84A 3E22A 2BPOA 1MFZA 3HHEA 4EDFA 2XSZD 3F8TA 2ZKIA 3SWWA 4X8HA 4O4JB 2I4OA 3G8CA 5IYZB 3UMFA 3C3EA 1Z17A 1EJBA 3R6DA 1ZL2A 1DBRA 3I42A 3SEAA 4B7ZA 1QAQA 4PPQA 1JU9A 3EDOA 4I1VA 4RZHA 4OREX 1ZS9A 1KIAA 3G2MA 2W8ZA 1H2XA 2VAPA 1OLOA 2JAPA 2H59A 3GWZA 5IC6A 5EIHA 4FYIA 3SIRA 4TRRA 1OXVA 2W43A 1RPJA 4E08A 2FMFA 1KVSA 5EY5B 4AJPA 5FTJA 2VVTA 4EBBA 4GVLA 3LHSA 2WWVD 4WACA 5B7GA 4Z3KA 1YQQA 1HYBA 1SMKA 1P1JA 2ZRGA 1W2WB 3O8NA 4IJKA 4PCUA 1PLKA 5A5GA 4GGMX 1NASA 1TO2E 2BDTA 2R5WA 1LDNA 4Q9NA 1YBFA 2HADA 4CT5A 1MBZA 2JD0A 1ZHOA 4RKFA 4WJLA 2ZP1A 4WADA 2QVLA 5ALWA 3PFFA 1TQ4A 1SCBA 2QL5A 3DLTA 3H2BA 3OEHD 2IU0A 1UOEA 1E5VA 2W7TA 5AW7A 2G3YA 1CVIA 1OZAA 3ESRA 1T9KA 2JJ1D 4OJTA 1N2CB 1KFCB 2A9VA 4C6HA 1R4NB 4NTZA 1WB5A 3I2KA 2PTHA 3P0RA 5LYJA 5EP2A 2P5UA 1R6TA 2ZATA 4F1WA 3ZZMA 4PLZA 1Z16A 4NYMR 1KSGA 3MOSA 3SJBA 3USCS 3B3FA 3QJYA 5LU8A 4FHCA 2A9FA 4Q03A 2P65A 4MZDA 1K8XB 1UR5A 2G4LA 4UUMA 3GLIB 2EYUA 2QRQA 3VSAA 2CV0A 1W94A 1RM3A 1PN3A 1LQTA 1AGYA 1IY2A 3EAGA 4L3OA 3MRSA 4PR3A 1RXWA 1VHTA 1R4NA 1KEWA 4MWBA 2MSWA 4D0SA 5AI4A 5TC4A 5CFLA 1OBHA 1BEUB 4X84A 4KREA 2OBYA 7ABPA 1XDBA 3S4YA 2ZDGA 3PCXA 3FTNA 2GEKA 4LEIA 5K9ZA 4OLBA 2VSYA 5CP8A 4YAJA 4PZDA 3S68A 4DE5A 5F64A 1P39A 2YJ3A 4ID3A 3RVRA 1KY5A 4GRAA 3T9DA 2Q6IA 3H9JA 2O57A 1J0XO 2F3QA 4BNMA 4A26A 2H6EA 4C0HA 3IP1A 2UYGA 3IC5A 3OQIB 9GPBA 1G8AA 4M99A 3PFGA 1ESZA 5DYGA 1R1DA 3VDQA 1EFDN 3HQ4O 2BJWA 2Z09A 1F2VA 2A7XA 3UAVA 1HC7A 3E5HA 3DDWA 3QVKA 4BNFA 4X0EA 5JISA 2VK8A 4KN8A 4JELA 2OT3B 2WU8A 3UWSA 3TTVA 2WZQA 4QDKA 2IYXA 3BCSA 1VHDA 4HNUA 1RBQA 2DPXA 4X7PA 3RGGA 3WKEA 1DOAA 5KTKA 4ENQA 2UYOA 1UK7A 2WNSA 3TNLA 3A1UA 1G7CA 3Q3EA 3DXYA 3Q8XB 5AFSA 5LJLA 4HR7A 4DYVA 1IM2A 1U9IC 1KIFA 5JC8A 4CN8A 1P61B 3WXBA 3K0AA 4LKOA 3GZJA 3F3YA 3H11B 4QGAA 4HDSB 3HUDA 1RIFA 3OX3A 2WQ6A 1YJ5A 3A4YA 2JA2A 4HB2A 3A6FA 3KEGA 4D6XA 1V8FA 4EI8A 4JJEA 2IPMA 3FCOA 3TPCA 3FCSB 5TMEA 5IDVA 1FTQA 1UJMA 4LRTB 1JWLA 1M34E 3OTQA 3EY9A 3GLFE 1NMXA 2W71A 2ZZKA 2PJUA 4N65A 1WUKS 4L0QA 4GMXA 1ISHA 2PXXA 2QY9A 1E7YA 4ARCA 2E55A 3SEFA 1JH8A 4D2IA 1P72A 5AJWA 3OZXA 4TZKA 3WYAA 5CXQA 3A6DA 5F1YA 2EW1A 1EE2A 5HKKA 3DWIA 1U0GA 2FUCA 4JJFA 5JCJA 3RIYA 3RS0A 4QT0A 2B8WA 1EPUA 3PZBA 3LOUA 1R66A 4OJMX 5K3CA 2N75A 1Z0IA 2G04A 4X3OA 4AZ3B 3EQZA 5J23A 3TCNA 4NMMA 3I64A 3I9KA 1U3CA 2WIGA 4YRPA 1O96A 4CEIB 1EGVB 1ZGBA 4O8CA 3L77A 1COZA 3EF1A 5BWBA 1DKPA 2DFLA 2HNBA 3PRJA 4MGZR 4C06A 4OY3A 2VHWA 4LY9A 4YUVA 1Q74A 4DV2B 1E9DA 3RVOA 2CV1A 3IQEA 3OIGA 2FW0A 1KZ1A 1JLLB 3AB8A 3QKTA 4AZ3A 2AFHB 3JQPA 4OXXA 1F8XA 5KYNA 4ZGWA 4RTOA 1EB9A 1PFVA 4H4EA 3ZGZA 2EWMA 2FAXA 4BVLA 4CEIA 5F77A 2ZI3A 1B74A 2QL6A 3QUQA 4IDOA 1V1RA 2AK2A 1YRYE 2VK4A 1AS0A 3OAAA 3HDYA 1A7UA 2W83A 3M4XA 4IG9A 1CR4A 5DDIP 5AQ1A 3K0SA 4TS4A 2YN4A 1YI0A 4KWHA 1X1SA 1BQEA 3O26A 4O2AA 1RI1A 1G4UR 2QRZA 3MLAA 4KDCA 1O7JA 4WQMA 3VGPA 5J63A 3GU3A 4TLLB 3GJRA 1C7ZA 2JLBA 1DO2A 1TUEA 3L0ZA 1H4QA 2AFHA 2C84A 3PX7A 4RW0A 3I2HA 1C3VA 1MQSA 4R8MA 4S12A 4N76A 2YOGA 4PQYA 3RCBA 1IRXA 2C3OA 3K31A 1JGTA 2EOAA 2GR9A 4X20B 4D3YA 2JJQA 4S1VA 1N5DA 1A5SB 3ZIUA 4TMYA 4PICA 4FCVA 3Q2KA 4TRMA 1KH3A 3D4OA 1P2GA 1MIOA 2RHOA 3AJEA 3W1EA 1ADYA 3EC2A 3PT9A 5H0IA 1FUEA 2O2ZA 3ENNA 3Q9NA 4BLVA 1RCFA 3MGBA 1L5HB 4XD2A 2FW6A 4U6SA 3KEMA 2JVIA 3AF0A 1YJCA 2Y66A 3E70C 4LYDA 2WFLA 3EC7A 4X20A 2OBLA 2JG3A 1OW3B 2QUKA 4N8DA 3RHFA 2EBHX 1CXZA 5JNLA 3WGUA 1FYXA 3SZRA 4URHA 1XD9A 1KBOA 2A30A 4RPIA 4DRXB 1O5OA 1ZC3A 5HSGA 3EPRA 2Q99A 1E3DA 2XWPA 3KEFA 2M32A 1BGVA 4LHVA 4KQGA 1L5HA 3NHLA 3OTIA 2LIVA 4JVSB 5IEBA 1R50A 3MBOA 5I9MA 1VRWA 4YAIA 3GCXA 3GLVA 5KQLA 2X5JO 2PT7A 2QXUA 4DQDA 4YV1A 1SU8A 4GMKA 2JFFA 1XHLA 2B1JA 5I8WA 5CLJA 1ND6A 1O6BA 3KVYA 2P1RA 2CYAA 1M8PA 1XXLA 1RRVA 2PYDA 5EIOA 2E89A 4K9KA 2OENG 4RDHA 3TAUA 4D80A 1W7AA 3NVKI 1YOVB 3CRW1 3B6IA 3CBGA 2EJUA 5FBVB 2OMEA 2ZCVA 2IV2X 4ECAA 4IIHA 2EWVA 3RVQA 1XTUA 3A28A 3L4SO 5LLSA 1WXFA 1K8ZB 3NTRA 1Y3HA 4BKQA 3F9IA 5AI6A 3CNLA 1I3OA 3RC9A 4BAZA 4O2BA 1NBEA 3PEVA 2ZQ5A 3BERA 2PHZA 1SZCA 1XVVA 4MV1A 2R2AA 2WTBA 3LLMA 2PT6A 2VDKB 3UTDA 5KYYB 4E51A 3DW3X 2X1HA 1ZKDA 1FFBA 2GN2A 4XSHA 3C6YA 1YOVA 5AW1A 4WGGA 5MN5A 1SU7A 1EXVA 4B7CA 1C9MA 4MRVA 5CPFA 3QU2A 2NXJA 3FYSA 3T7IA 5AJTA 3EUAA 4H1UA 4Y2RA 4WFIA 4BNZA 3DMFA 1FB5A 2IHVA 2M1ZA 2JGDA 4LHWA 4PO1A 1S01A 1Y33E 4XD7A 3V7FA 4WBNB 2ZOSA 1L5NA 3FPLA 3HXMA 1Z45A 3MHPA 4AKTA 1KOJA 1N8SA 1CUHA 1C2YA 1E63A 1NZDA 2IKQA 2H9YA 2NQTA 2PGLA 2PM8A 3HCDA 3W04A 1G3RA 4RYLA 3WGYA 3SPXA 4ZTBA 3D8RA 1PZGA 2XE6A 3DXZA 4RD2A 4DPLA 1M0EA 1BMFD 3NVDA 2EYQA 1YB5A 2P4QA 1JHVA 1UINA 2WUDA 2PX3A 3LYAA 3KYIB 3C1OA 1NG9A 1EXWA 3QOFA 4LGCA 4CWAA 5AW5A 1CZNA 1OROA 3NDBB 2A35A 3TI7A 4XRRA 4DS3A 4WBNA 2AJLI 1XQ6A 1BGWA 1ZH4A 4KGDA 3GUVA 3WZLA 4PBSA 3NOXA 1QR2A 2FEKA 2RGAA 3TTWA 1QP7A 2EG5A 2G8NA 4PQEA 3GP5A 1NU6A 2M98A 3A10A 3LUAA 4B09A 5CU7A 3M6FA 4W4TA 4P83A 4QVKA 2JRLA 1CEYA 1GR1A 2BKEA 1NIJA 1Z6YA 1N4AA 1TD1A 3LFHA 5JFGA 1UC5B 1LVHA 4NESA 3VZDA 4GBMA 4LN1A 1LLQA 2BBSA 1ZXLA 1MJ5A 3R5SA 4KE6A 3DBLB 4N5MA 4QOIA 4B4KA 4K81B 1C0KA 3BFXA 3DQZA 4PLVA 4X91A 3EYWA 3AP1A 4XB2A 2WZBA 4QQKA 1GGKA 5CLLA 3W6UA 3RQIA 5G0WA 3JASB 4D1YA 3D59A 1MTOA 3PR1A 4POOA 2B0JA 2C29D 2AMLA 2IIBA 4J9VA 2YVUA 1R8SA 3W5BA 1R4AA 3GEIA 3HZOA 1M1UA 3DVQX 5A62A 1CUYA 1PEKE 4FUQA 4OHRA 4TS3A 4B6EA 3RS8A 4ZZ1A 2OV2A 4NENB 2OKGA 1AN0A 2OZLB 1LTQA 4X1YA 1OZFA 3VSCA 2VNIA 1KBQA 4IGIA 3G0OA 3HYRA 3QFFA 4AF6A 3JASA 4BGUA 4F3TA 1KVUA 2J41A 2HBZA 4PYMA 5FBHA 5AK4A 3WLJA 1FP6A 3EGIA 3T1NA 3OCZA 2C3UA 4QT4A 3O73A 1SK8A 3TIVA 5KNDA 1C50A 1DWUA 1YJ8A 1INLA 3KKNA 3LPDA 1PG2A 1TEZA 1QDEA 2E87A 2OZLA 2XZLA 1UP6A 3V00A 4Z4GA 1I80A 4Y2YA 2H4HA 3AHDA 2XA1A 3RVJA 2QLLA 1QGYA 3NKLA 3UK6A 1CNMA 1LQ2A 3FYUC 3B52X 2J67A 1JDTA 5TY0A 4MJ7A 2ID9A 1XZAA 2W2VA 3L7KA 3ZV3A 2GHRA 3TBFA 4CG2A 5C5EA 2YMQA 4P4TA 5JZ9A 3L7AA 4N03A 3M6XA 1A27A 1N3YA 4HNSA 1U28C 1XTKA 3E8XA 3EZ7A 3RIGA 4K9OA 4U9HS 4CIXA 1UMBA 1CUDA 3MS7A 3GN2A 1FTNA 1IUKA 1QHYA 1W2HA 1ZM7A 5COBA 4TV8B 4ARZB 3C3DA 1PJ8A 2OHJA 2Q5HA 2W90A 2YRFA 2MJLA 2ZR8A 3R6TA 4R81A 2YX1A 3U4QB 3K1AB 2F1OA 4DC9A 4Z1MD 1IDN1 4MVJH 4AD8A 1QDLB 2DHDA 2XOXA 3SNHA 1VIMA 3H5TA 2IT1A 2ST1A 3ETNA 5M34A 2Z98A 1P75A 3GFVA 3PPXA 4HKTA 1JA1A 4DJEC 2OKCA 1REQA 1YCFA 1BU5A 3ZUGA 1P2FA 4D9CA 2OWDA 2O2YA 2EX1A 2IE0A 5A3SA 2H54A 5DMHA 5DM0A 3R5FA 3OBBA 3BWXA 1EHCA 3LX5A 2Q7XA 2FQYA 4TV8A 3HKBB 2EARA 5EWMA 5H82A 3HFJA 3KC2A 2QTAA 1U0EA 3FJ1A 4PSVA 3UY4A 4CLRB 4GBJA 2WJJA 2V0NA 2GZ1A 4JCOA 2C5FA 3MT9A 5AKJA 2VT2A 3WL8A 5KOHA 3RS9A 1NVVR 4ZYWA 4D99A 5C7IO 3C7CB 3EZXA 2CKMA 4D4IA 4R7ZA 5SYNA 4CR6A 5EWLB 2FWJA 3KQHA 1MB3A 1QIGA 4JGGA 4H0FA 1DCFA 3GYGA 3H2HA 1EE9A 3FYTA 4UPVA 3RJZA 4RZQA 1T5SA 3HKBA 2G07A 4AXBA 5JNWA 3GT7A 4TLEA 1IHYA 1C0PA 1VJ5A 3K0CC 4CLRA 4IJ6A 4YMWA 1GA4A 2Q6LA 3CPEA 3MUEA 2QD4A 4U1RA 4WLFA 3VU1A 4DMMA 2LCIA 1Y3BE 4COKA 1HORA 2R8RA 1BXGB 4UU0A 3WGJA 1B0AA 1FUYB 1YSCA 2POCA 2Z58A 5MHTA 1KPHA 4LX0A 1ZKMA 3TW4A 4DSOA 4WZAE 1M33A 3DULA 4PBTA 4ETNA 3SJUA 1UDXA 3PQEA 4N54A 2D2VA 2QA5A 4W1QA 1TM7E 3CEAA 3LUPA 4J16A 4A6XA 1NXVA 1KDPA 3ZWCA 3GJYA 5CFZA 1RC1A 2C9MA 1NXOA 1U2DA 3KL2A 4I8DA 1BXGA 2XNKA 3K8ZA 3P45A 1Y1TA 1Z2AA 3OJFA 4GZMA 3P2OA 4LBZA 2NZ8A 3AR4A 3K7EA 4BU0A 2JFOA 3LWDA 3WSTA 3IBGA 3INGA 4IXNA 4R2IA 3SBXA 3WK6A 5H3LA 3AX6A 2JJ8A 3L18A 4CIVA 3BL5A 4JGIA 1UDCA 5EMNA 1TUIA 2F3UA 3AI3A 3N5KA 3NPAA 4R5MA 2BGKA 4J4HA 4JOQA 4GLFA 3W9YA 4CFYA 2ZR0A 3AY3A 3BQNB 2O05A 3FZEA 2QROA 1XZBA 3N6VA 3AHJA 3BWBA 3VPDA 3E4DA 5A71A 4H1HA 1MW8X 3HP7A 3HI4A 2AKYA 2MU1A 5FV7A 2IKSA 3JZMA 4X71A 4PLWA 1OU0A 3MERA 1WETA 3QY0A 1LVGA 1OFUA 3LGXA 4LE1A 2ZRFA 4Q3LA 5TX7A 3K6RA 2AS0A 4K6KA 1Q1EA 1Z3IX 2CLFB 3I04A 3PUJA 3NRCA 4AO6A 1XLTC 4QECA 5KKAA 2FSSA 3AEKB 3WWEA 1G2IA 3KTAA 5DHFA 3SX4A 1XMQB 2P6OA 1UBJS 1Q21A 2AIRA 1E2NA 1T4CB 1SXJB 4IHAA 3K6KA 3OUUA 1P2TA 2H51A 2PS0A 4AICA 3U4MA 5KSYA 1Z4KA 2B35A 2DUMA 3N76A 3FPSA 3G2IA 3W8EA 1C9EA 3BRWD 4HGOA 5EZ6B 5JFOA 2OHXA 1KY2A 4FNGA 4MPJA 3V7NA 1XDGA 3LDGA 5EXPA 1XMOB 4J07A 2WUGA 4CTJA 2C99A 4M87A 3D5EA 3AM1A 1K7YA 4JI6B 3C3KA 5EN4A 4F2DA 1T4CA 4AL4A 7REQA 1EDBA 1QVAA 1FW8A 2G1AA 3EZNA 1XDZA 1ZO8A 2X8BA 4GPBA 5HGXA 1XZHA 1MEEA 4KQXA 3WAJA 4Q4CA 2Z5GA 1CUSA 4QLBA 3QBJA 4X44A 3TW8B 2F48A 1F0NA 2X1MA 4FSDA 3TSYA 4AZ0B 2NXEA 5BQPA 5DYIA 1EDZA 3X1JA 4L5YA 3ZE0B 4G37A 4PPFA 3IA7A 4ZI7A 1C3XA 1PQPA 1T1EA 2CUZA 1GPWB 3LQ4A 3QPCA 3V55A 4J4BA 1UL1X 1NW5A 3BUSA 3KUDA 3O38A 7AT1A 4YJ3F 5JYDA 1ZCAA 2H08A 3LX4A 2ODNA 4H7JA 1RYFA 1TZBA 3W4IA 1PS9A 1AZTA 1NVTA 1PL6A 1TMGE 1QS0B 2JGMA 1U80A 1M8KA 2OUKA 4MCHA 3VHXA 4B87A 5BR7A 1KEVA 1XJQA 3I2IA 5DYYA 1RHQA 1Z56C 4HAOA 1GFWA 3PVZA 1EBBA 5E7MA 3D3WA 1BS1A 3HLTA 4OXIA 4N0PA 3A9UA 1G5HA 4EPXA 3M6MD 4MVXA 3KX2A 3SHFA 5AW4A 2CXXA 4GPEA 4B2LA 1JEJA 3NHBA 3KUXA 4YMSA 2X9NA 1HFJA 4KBYA 1SXJC 3ZVLA 1WMBA 2V7BA 4V39A 1X3LA 1M0WA 2J9ZB 3QV2A 4KQHA 1R6AA 4G5SA 4OHUA 4BCCA 3CPJB 3O2SB 2QJOA 2IYYA 3FETA 3N07A 3I72A 4BZWA 1K5DA 1P29A 1Y6FA 3U3XA 4H7DA 4AIIA 3A1VA 1CLUA 1HTWA 2NZUG 2WJHA 5DCLA 4P2BA 4PHTA 1RSZA 1R00A 3FDXA 4MUMA 4ANFA 4HTFA 3GW8A 3PNYA 4M83A 4XH9B 5FAKA 1CJCA 1M2FA 3MS4A 1JSXA 2R96A 4HGNA 5FORA 4DJ5X 3AQ4A 3DA8A 4RZSA 3PXEA 2C3PA 2G9QA 1IHDA 3VC7A 1HLPA 4YUZA 4PO3X 2ONCA 3DYVA 2H31A 2NZWA 3LKZA 4IDBA 5GP1A 1NVMB 1RWPA 3PX2A 3GGPA 4OIFA 3REQB 3WYEA 4GG1A 3PDIA 3W34A 1GNRA 1GFSA 2V7VA 1A4XA 3CMMA 1FXWF 5HOQA 3L4KA 2BGMA 3HLKA 5LMUB 2H52A 1YQTA 3EZFA 3G9UA 4DLSA 6NULA 2VPQA 2XX3A 2FZCA 1TZJA 3KJNA 2JH8A 3S8EA 2P77A 3HYCA 3F4LA 3FTDA 2BFCA 2QNIA 3CURA 4FOSA 4HAXA 5TQ2A 3REQA 1T0HB 4V0SA 4YJ2A 1L7BA 1T6ZA 1ZIOA 2WJIA 4M46A 3TMYA 4HEA1 4Q1DA 3TD6A 4PHGA 3VR4H 2ZYWX 3EWAA 1LA2A 2JCSA 4X92A 4HWRA 4HWTA 3T06B 3LBAA 4O4LB 1ULAA 2Z8XA 3O83A 1LJ8A 2OM2A 2WWWA 1NAIA 4MNTA 5DTRA 3RSZA 4PHHA 4R1LA 4D98A 2ZQZA 5ARCA 1U9JA 3KXIA 1LPSA 4JP1A 5BOVA 5LDGA 3NEJA 2DWPA 3Q4GA 3RWMB 3WA7A 2R00C 1G63A 3KZVA 2HFJA 3UICA 5C9ZA 4O25A 3NC0C 2HH9A 1FSPA 1DRVA 4B4UA 1R18A 1CJTC 1KZGB 3IRVA 4CGYA 2A14A 4UTZA 4XZ3A 5DNAA 4UOZA 1IJFA 2HMUA 2JIRA 4OJQA 2XUGA 3PA6A 4G2NA 1T3SA 5BSUA 5THQA 5HJEA 4N3CA 5K8CA 3DNFA 5EVJA 2QUZA 2ZRLA 3LY8A 3QHAA 4O4LA 4QUAA 3WIVA 4NAVA 1NOJA 3S40A 1ILWA 1JHRA 1VHWA 3M5WA 2PRYA 4WN9A 5HA5A 4C3ZA 1OA0A 5BPFA 2YFQA 1TJ5A 3PDWA 4I0WB 1PZMA 1E5QA 1G0OA 3AB3A 4P7FA 1WXGA 3Q88A 1UK8A 3ZE6A 4O1MA 4Z4EA 2BTEA 3BM5A 3QTBA 1Z4JA 4JWTA 3W77A 4KODA 2ZT7A 4ONEA 2W6IA 4IWYA 2ZWOA 5ALYA 5IF9A 4I99A 3ED1A 4CL0A 2YY5A 3AZQA 3L3BA 1CHDA 4MI1A 2HWYA 4BTEA 1P19A 3FUTA 3LBYA 3VXKA 3KM0A 3WTCA 4DIKA 3HO8A 2EFYA 1G2QA 5LZ7A 1E98A 1OT5A 1OY1A 2DUNA 2GT1A 3BF7A 4H16A 4J4TA 3DZGA 5DEIA 4QUDA 1SY7A 5ENDA 1X1RA 2NT3A 2Q1UA 8GPBA 3VNQA 1WD5A 1Z7GA 3L8DA 1W5AA 2CZCA 1V5FA 4N8EA 1ZEMA 3RJMA 3LDHA 4WW0A 4DKXA 1ABBA 1ZH0A 3AU8A 1H6DA 3V80A 4R2HA 5J43A 4V0KA 2WQ7A 4JI3B 4I5DA 3IPXA 3VV2A 4EX6A 1E7MA 4BQIA 1NX9A 3PNOA 5C0OE 4B34A 3RUAA 1N5OX 4NXMB 1AQIA 1QFZA 4RU1A 4TYMA 5ALRA 3BB3A 1R5BA 4Z49A 1RM4A 1SO8A 2CNWD 2H07A 4JR0A 2BJHA 2PD6A 4RK1A 3FPKA 5FYQA 1PEYA 1QSGA 5ALHA 4BGEA 4WKBA 4Z4QA 4D9EA 3K15A 1ZUWA 2QDKA 2DY0A 3BMXA 3CLRC 5JXWA 4L4YA 2UZ4A 4DWVA 3H1FA 5E2IA 1O0BA 2ZYAA 1EUQA 4YR7A 3GQBA 1NG1A 3D2CA 1EGMB 4KMRA 1T5IA 4MCAA 4IFTA 1HG0A 2IYPA 4NDAA 2QTZA 1G1MA 5COQA 3F7TA 3R6WA 4HRAA 3Q5DA 3FYCA 5GQSA 1I5EA 1GTL1 1NJ5A 3VU3A 1ECCA 1SCJA 3BBPA 1VG8A 1N6OA 4R69A 1T8RA 4D45A 3I9V6 4N7MA 4ZEVA 2JD2A 5AHWA 5TARA 4RPHA 1GLGA 1NVAA 1P0PA 1P6XA 4MQLA 3DEAA 3Q2OA 5FUYA 3K96A 3MBIA 3QBVA 1G8HA 3AVUA 2R6CA 3RJ9A 3ETDA 2PG3A 5DXJA 4KIWA 1WZNA 5IFLA 3P9ZA 2H2DA 3L79A 4GPTA 1RYHA 5U9CA 4F4CA 1H6CA 1BCRA 1YMQA 3RV4A 3OU6A 3ZCTA 4B43A 4E5MA 5CURA 4BMCA 2WWFA 3KXDA 4BB0A 3SYRA 3CUSA 5IZCC 2VJMB 5CPBA 2IX3A 3JQ7B 3Q8MA 1FNMA 2JI8A 4GSLA 4HAVA 3COJA 1P91A 1OX6A 1JKMA 1E94E 2PH1A 2AN4A 5ENZA 1PUIA 1CRPA 5HTOA 1ID8A 4ARSA 2A92A 1PSWA 2CBGA 2WMNB 3KZ1E 3NDIA 3OKFA 1ZICA 4KI7A 3EJ6A 1G1AA 4XKJA 3NTOA 4AZVA 5DGXA 3T3MB 3P4YA 2WKWA 1SVLA 1ESEA 4IM7A 4QDUA 3JQ7A 4IRUB 4Q9LA 1SXPA 4OLAA 3KYBA 4DR6B 4IIJA 4MJLA 3R74A 4HB0A 3DCIA 3CH5A 3A36A 1KYQA 3FH0A 5IJ9B 5JJLA 1NLYA 1Q7CA 4TMTA 2IF0A 1B8OA 4B79A 4L5JA 1NW9B 1EP1B 8OHMA 1VL5A 3ELYA 2MSEB 4R6WA 4IIFA 1UAAA 4L27A 1SOWA 3SN6A 4YRBA 4J3NA 5BW6B 1NA5A 3HPRA 3DZFA 1KPGA 4CQMB 1SIWA 1FYWA 2GETA 3Q7TA 5TPWB 4F45A 4YECA 4D8WA 2WWRA 1PDVA 2F8MA 4JKYA 4D41A 2OGUA 4JBWA 4BV8A 1UXGA 2XBUA 5DIZA 1T25A 4P3NA 4QGFA 5DBGA 2CHFA 2G7MC 4UASA 2EZUA 3ELWA 4ICIA 4A0SA 4MS3B 3RSQA 2PV7A 5TLSA 3G7NA 4PU0A 3ZK9A 4PLCA 1QGAA 3RKRA 1PV4A 2WF7A 4DV6B 4MWZA 1GJRA 2W2KB 3OU7A 1RWXA 3EIWA 1C8KA 1GQSA 2SHKA 3YASA 5JBNA 1SIBE 3PC4A 3WQSB 1YR1A 4YXFA 4BVGA 2ZIGA 3V4FA 5CVUA 2VTBB 3GFSA 1NOIA 1BSVA 1BW9B 1V96A 1N9GA 2G9UA 3G9QA 2ZI4A 3TNYA 4OOEA 3VZPA 3QG1A 1RJGA 4MS3A 1XPRA 1PI3A 5K3AA 4MW5A 4MH0R 3P20A 1N9KA 2GHQA 1YT5A 4ZDWA 1AU9A 2GM3A 1N57A 3SQNA 2B83A 2WVAA 3IKVA 4H3VA 4I1YA 3TNFA 3C7KA 1U99A 4A5OA 2VTBA 2P9HA 2XJ4A 3TKLA 1JLHA 3GDOA 1N3IA 3D4PA 4LJAA 2A84A 3EMVA 3OECA 4NEGA 1YB6A 3UA3A 4Z9AA 4RUKA 3Q1KA 4X54A 4BJ1A 1GY8A 2VPIA 1UZLA 1F2UB 2WY2D 3K0EA 1JA0A 5JCJD 1FJHA 2DM6A 1KKUA 1W4AA 2VRCA 1FVOA 4QOGA 2BLNA 1A72A 3WBKA 3CTPA 5HK9A 4DLXA 4R9SA 1GZSA 1SBHA 1WKBA 3PEEA 3R3JA 4UXHA 5CCDA 4DUGD 4M1EA 4U00A 3TTTA 1JUDA 2FP3A 4DSAA 1NZJA 3BG5A 5LOVF 3RB8A 1U1DA 2IOYA 5HQTA 4X65B 1W0KD 2BCGY 1USWA 5CAEB 1BWRA 1KS9A 4LSMA 2FR8C 4OQQA 4F38A 3A58B 5GAJA 3E35A 1ZPDA 2O3RA 4JY7A 2HDNB 4TGLA 2Y2UA 2D5AA 3P9XA 1YRBA 2CMDA 4FGLA 3TCKA 4F72A 5ER6A 4FJ0A 4IOJA 1JW9B 1OAOA 1XZNA 2C5BA 4Q3NA 4MGKR 3WGTA 3FOZA 5BVGB 1XMIA 1YGYA 1OA1A 1Z38A 2JIOA 3NJ4A 4M37A 3UHPA 3O3MB 4FIDA 2PMEA 3VJLA 3ABQB 1W0JA 2XT6A 2C2MA 3GF4A 4MX8A 1GCGA 3HFRA 4TMZA 4Y0AA 3RYHB 1SQGA 2VP3A 2F8SA 1X0VA 3BIJA 1JMKC 1MAVA 2Z57A 5DN6D 4W6QA 3P5BA 4KXQA 3MELA 4I3FA 1VLMA 5KDOA 4CF3A 2YWGA 2AEFA 1R0RE 3TXXA 1O97D 1E7SA 2FFAA 4L6AA 5BVGA 2FEOA 2GZ2A 4K8RB 4J0KA 3FWKA 2WU1A 4HYEA 4EO9A 3FTFA 2WAAA 4IQ4A 4KLZA 5CIQA 4FOTA 3IKLA 1LNZA 2FCAA 3H19A 4HGQA 3RYHA 2JLWA 1T9HA 1GL6A 1P7WA 2WWYA 3TFOA 5J4LA 3LUBA 3N2IA 2W22A 2ZWAA 4HEJA 2GWRA 3KPWA 3L6DA 1SUAA 1VJRA 4NFYA 3W1VA 3DD1A 4LMBA 5JHGB 3REFA 1Y1QA 2LDXA 4JEUA 3WISA 3IPAA 1J0EA 3F1LA 1X13A 4KE8A 1Q2XA 4WZ6A 1YCHA 5AVSA 4J0QA 4KCGA 5K3SA 3MTEA 5JS2A 5JD5A 4JENA 4AYXA 3O2NA 3GCWA 3FD8A 1UC4B 1UZAA 2RGWA 3GDHA 2VPPA 3V4ZA 4UBLA 2GTPA 3M3HA 3BTSA 1E9AA 1S2MA 4KU4A 4HRYA 4B9AA 4LVUA 5THXA 2XGMA 1JIJA 5JH7F 1KYZA 4CCYA 3G6KA 2I1WA 4K9QA 5D3ZA 2ONZA 3PGXA 3S27A 1E3SA 1WJGA 4M9CA 1HF3A 1NMQA 1RDFA 1BKDR 2I80A 2XVMA 3Q3HA 3L0DA 3RGWS 3E3AA 4LSWA 2RGUA 4MUBA 4IHKA 5P8WA 3DLIA 1IEQA 1DT3A 3F8SA 5I9NA 3GJ7A 5DWDA 4EUKA 2X7JA 4LCEA 4GFDA 2BFNA 4AECA 1HDEA 2ANCA 2DX7A 3JYHA 2AN3A 4REQA 4BNUA 1XZLA 4AJLA 3ONVA 4WBSA 4HQKA 1LH0A 4PNHA 3Q98A 3RH0A 4RJIA 4GDFA 1RZUA 1LI5A 3SQDA 2ETVA 2CHVA 5K0JA 2Z0MA 2FOIA 3GCGA 1KC1A 4BJHB 5TT0A 2E3JA 2I03A 3ES9A 1YFZA 2WWGA 2ACEA 1J5EB 5D7NA 3ADPA 1VZ3A 3OWXA 4ATNA 2V59A 1D2GA 2A0WA 2GM5A 3FN4A 4MVWA 3BTUA 4WLEA 4HDKA 4EVIA 5DLQC 1DHRA 4UTVA 2ZETA 3NIWA 3HO6A 2A0XA 3BCUA 4XD7D 3SS9X 1E2JA 2XQGA 3KL4A 4G0XA 4MQFB 3MZ0A 3UV7A 5CEFA 2QU8A 1G59A 3T3IA 3ETHA 1MZPA 2F59A 3IX7A 4Q3OA 5B4VA 2G9NA 5J5CA 4N39A 4DCMA 3D0RA 4UTOA 5C8ZA 4TTTS 1Z6QA 1FMTA 2AMVA 3ML1A 4AO8A 4AUNA 4CKEB 2P2CA 3PE6A 3NI2A 5B36A 3PGJA 2PNFA 1U1CA 2GD1O 2ZPTX 2GASA 3CYFA 3ESDA 2CUKA 3CJQA 3I9OA 4K9PA 5DRYA 2YMLA 3FRJA 5B37A 3NANA 5AESA 4H1VA 3EXEB 1TYZA 3JTEA 3GRPA 2DWOA 2ZT8A 4R68A 4F0JA 2PMCA 1E1DA 3OD1A 5E7QA 2WQZA 1ZMOA 3HRKA 4Q4DA 5LIRA 4KPUB 3D6MA 4S35A 4CKEA 3OPYB 2FB9A 5F3WB 4I4TF 3A70A 4Y2UA 3HC7A 1L5LA 1KJNA 3ANXA 1W1UA 4OJKA 3ZDBA 2ZRMA 1T43A 5JJCA 5DHSA 4LF4B 2P75A 2P9JA 4AW9A 3EXEA 5DM2A 1L4UA 2QPLA 1CJBA 2NADA 4Y1RA 3VUFA 2Y9MB 1RM5A 2IW3A 1UP4A 5IBPA 4C29A 2RSLA 5K3OA 4M7RA 4RQUA 4BVEA 2LUOA 3U44B 2COEA 4YXWA 7MHTA 3UYLA 1VPTA 1PKEA 2Y1KA 3OPYA 2CLIB 1KK3A 3QG5A 1XNHA 3RYCB 4N48A 4P7BA 4NS4A 2PRSA 4FEAA 1YQGA 2CMFA 1CUCA 1E9RA 3KB1A 4GP6A 1ST2A 5F4ZA 5PNTA 3ZGVA 3A4LA 4UEJA 1XL0A 3MMPA 2MOKA 1TE2A 3ZGNA 3LE8A 4CXMA 3OURA 4A2WA 2VYCA 1E3QA 3L7JA 2LCFA 5HFAA 3QBTA 2QAGB 3CEJA 4OU4A 1KFBB 3JQQA 3ZUPA 4AG5A 4MR8A 4JL6A 4ERNA 3U44A 2P9GA 3S8YA 5AVJA 1V41E 3IBCA 1ENOA 1SBYA 4MQEA 1X7HA 4JBLA 5GJBA 1UK6A 4DMFA 2QSUA 5J3JA 3IHKA 4G67A 4XIYA 4M9XA 1C3JA 5KC9A 2AE1A 4L75A 1U8XX 1DIAA 5JLJA 4RF5A 3V4PB 4B74A 2ZUUA 1A2QA 1GT91 1GOTA 1TL7C 3G7UA 4MICA 4KMOA 5BV1A 3HJGA 4Z53A 4I50F 4TKMA 1G60A 1O87A 2HM7A 5AD1A 3STHA 1LBIA 1YI8A 4JYMA 4IJSA 5CK4A 3HACA 1YVPA 3EMBA 4C2AA 1VTKA 1AA9A 1JVNA 2P8SA 1GUBA 5AHKA 3SDBA 2J48A 4MV4A 1QJ4A 4XJVA 1QFXA 5TIIA 3ABRB 3HMKA 4IJ5A 3X1YA 1U0OC 1DAHA 2JANA 1M5UA 1UZUA 2BSXA 3KXLA 2EDAA 3LPNA 3EE6A 1MDBA 3KKKA 4CIBA 2OORC 4MI3A 3JD4A 5AVZA 2Q3DA 1DRWA 1V5EA 4Z3OA 4JQCA 1STOA 1YV9A 3FWNA 3PR3A 4NBNA 4P08A 3H4VA 1GPMA 1LDGA 1KI7A 1Z5UA 2UZIR 2WF9A 3NNSA 3RABA 3TRFA 3ORRA 3T3EA 3P7MA 3TUZC 4D44A 1UOPA 2WKQA 5LJIA 5E1BA 1G16A 1F12A 1HEUA 1OWOA 1D5WA 1R5OA 1W19A 3B2QA 3BWYA 3B2NA 3DTNA 3N05A 3HL4A 4LWOA 1JQJC 4NQRA 3QHQA 3NOOA 5B4TA 2D7DA 3C4JA 5EHGA 2XYGA 4V02A 3SBDA 4OYYA 1DLIA 2XB2A 2VOEA 2GPBA 1IHUA 2DH5A 4ER0A 4GEGA 3OZDA 4C6TB 1B8PA 2GAJA 4B6RA 5EJIA 3UKOA 2Q6OA 5BMVF 4JHLA 4BJ3A 1KF0A 2QAGC 1MX9A 1I4DD 2XKAA 2IDJA 4LZOA 4XPZA 4ZVPA 4P0PB 4AMGA 1ZIPA 3DMTA 3WJ1A 1VI2A 2IZ7A 3BGSA 4DR5B 4C4AA 1KS2A 2R7AA 2XBMA 1GTZA