2Q1UA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ and udp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
350
structure length
336
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSGKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 127
structure length 336
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1uA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1uA02
3BMNB 2ZB7A 3ONEA 5DULA 2XXJA 5U4QA 2E37A 3D3WB 1GUZA 3KEQA 1YL7A 3ROQA 3K30A 3E9QA 4CLOB 2O23A 1GFSA 3D5QA 3QA9A 4KDFA 2GASA 3IP3A 4P22A 3VTFA 4E5NA 3RKUA 3WXBA 4BKOA 4E0BA 1T4DA 3HDHA 2VQ3A 5L40A 5TSDA 1AXEA 2WWRA 5L95A 2VYND 1UXGA 3JQAD 2BHLA 3VDQA 4BGVA 3KLMX 1OMOA 1HLDA 1M2WA 4DRYA 1N2SA 4AJOA 5EESA 1N1GA 3W8EA 4HADA 2J5QA 1GV1A 3HHPA 2OL4A 1QORA 1V9LA 4J1SA 1B14A 1LSUA 4WCDA 4OKIA 3KYDA 3GN2A 2Q2VA 1P1RA 2EF1A 3W8DA 1ZUD1 1EEHA 4W7IA 1PTJA 5CPFA 5HS6A 2WD7A 3RC9A 2X86A 4DQXA 3O03A 4NU5A 4CMAA 4ID9A 4IBOA 3UAGA 5L3ZA 3HQ4O 4H15A 1CYDA 2X8LA 3FCOA 3WG9A 3H9QA 4I9NA 1A72A 4CLXA 1QG6A 3HDJA 2IODA 1PJ2A 4NG5A 3JQ7A 3H5AA 4JIGA 5JDIA 2WDZA 1U1IA 1XCBA 4Q39A 4WLFA 1CQJA 2HJSA 3R0IA 4BQRA 4WLOA 1PGOA 2BGMA 4L0QA 5TLSA 3KM0A 1YB5A 2AW5A 3CZMA 3GNTA 1CWUA 4J1QA 3OJLA 1E0DA 3X2EA 3WGZA 4FFRA 4BUCA 5AYVA 4BNVA 2B4RO 4NBRA 4BQPA 2CD9A 4AJHA 4RPLA 3RROA 3G49A 3ZZNA 2RHRA 2V6MA 2VWQA 5A06A 5IJZA 2HCTA 1EQUA 5JSFA 2Q1UA 3GVPA 1V3TA 4BO4A 4ZD6A 5KIAA 2O50A 3P2YA 4PLYA 2JD1A 4IGFA 1HDOA 4LW8A 4QTZA 1HLPA 3SJ7A 2OP0A 3JQ9A 3K96A 3FWNA 5C7IO 1XG5A 3H9UA 1J5PA 3GQVA 1P1IA 3GDFA 1IZ9A 1DFGA 2EIHA 3ETEA 3PJDA 1DJQA 2OXIA 5ICSA 4MKXA 4MKZA 4Y98A 4IMRA 3V2UA 1R0KA 1Q7BA 3QV1A 1W8DA 1QLJA 2YYYA 3DR3A 4E2XA 3FHLA 3KLPX 1WAMA 5CDTA 3UN1A 1HL3A 2X0RA 3MTJA 2H9IA 4W9NC 2GYYA 5F1OA 3A06A 4EEZA 2NTJA 4CM7A 4DYDA 4EGFA 1U7TA 4B4WA 5KJCA 2QHXA 1P1KA 1YGYA 1IZ0A 3D5TA 3Q9NA 3EVTA 3IAHA 5JCJD 3NRCA 1T2EA 3ROPA 2EP5A 5JDIC 4LCJA 2HAEA 1NYTA 3L6DA 2HLPA 4I9HA 4L75A 3PPIA 4PCVA 4U0JA 3S55A 2DU8A 2R00C 3AUSA 4PFJA 2W2KA 4FPXA 1H93A 1EQ2A 2F00A 2YY7A 4JBHA 1WMAA 1GV0A 1YL5A 2CMDA 2D5AA 5F5LA 3GGPA 3DZFA 4JNKA 3DMTC 3LT1A 4LMRA 1NFRA 4OL9A 4OSPA 4RF4A 3INTA 3H2SA 3KO8A 3DBLB 4OIMA 2X5OA 2WD8A 4J6FA 4GAEA 1HYEA 4ALKA 3LT4A 1TB4A 4ZJUA 3DDNA 4GGPA 1I10A 4R1NA 4WLVA 3D3EA 4RZIA 2QYTA 1OBFO 4IJVA 1ZNQO 3MJVA 3MOGA 4YQYA 2BI7A 3RJ9A 2PV7A 4PIVA 2BFOA 1M76A 3GDOA 3ON5A 3K6JA 2OO5A 3ITKA 1H2HA 4NK5A 4UUPA 2DT5A 1QYXA 2O3QA 4CQMB 2NQTA 4OQZA 2TMDA 1E1LA 2JFFA 1PJBA 4B79A 1EFKA 3I3OA 1NHGA 1R4NA 4E33A 3L6OO 3LU1A 2YDXA 2ZJ0A 4XD2A 3U4HA 1X0VA 1IPFA 3PYLA 3RJ5A 1XU7A 1M67A 4JN6B 1B16A 4HBGA 2BH9A 2HMUA 5B1YA 2B4QA 2CUKA 4XKJA 4BGIA 2LDXA 3KBOA 4II2A 3NX4A 3BMOB 1JTVA 2V6FA 3OEYA 3OF2A 3MZ0A 1WZIA 4J49A 1NWCA 5KJ1A 5DZSA 3GGOA 5TQVA 1GY8A 3VKVA 1JVBA 3BMOA 4CM8A 3QHAA 2W4QA 1AHIA 3IS3A 4RF5A 1IULA 3V2HA 2O2SA 1F06A 3KYBA 5IZ4A 4EBFA 3ZWVA 3G3EA 4D3DA 2X0NA 2GLXA 1PGJA 4YCAA 1ENYA 4H16A 1NVTA 2HO5A 3HADA 5HWSA 2C7VA 3Q2KA 4RVUA 3BMCB 4J0FA 2GN8A 1ZZEA 5KVQA 5TF4A 1B8VA 1U3VA 4BB6A 2VYNA 1YB1A 1ADCA 5FEUA 5HM8A 3ANLA 3VDRA 5H83A 1MB4A 4BOYA 1ZSYA 1EE9A 3WSVA 2IZ0A 2DPHA 3IDSA 1JAYA 1BXKA 2X0JA 3OH8A 4L4RA 1KVSA 4M1QA 4PLZA 2P5YA 3FWZA 2WJPA 4RLHA 4MIYA 3GVHA 1ORRA 1F8GA 3DZKA 4RL6A 3WQSB 2FSVA 4XDZA 3QWHA 3GT0A 5JW6A 2QRKA 1HDYA 1TT5B 3EUWA 1DO8A 4Q9NA 1WXDA 4DWVA 1JA9A 2GN9A 4W4TA 2UVDA 2BGLA 4CM6A 5I7FA 5K9ZA 3IUPA 1GQQA 1R12A 3LK7A 1KERA 2P4HX 4UVIA 3I9KA 2DC1A 2VYVA 1XIVA 4FN4A 3PK0A 4NBTA 4QXMA 4CODB 4GKBA 4ITUA 8LDHA 4BS9A 4E3ZA 2VUTA 2E6UX 3WNVA 4DYVA 4K9DA 3KSZO 4EZBA 2EP7A 3JQEA 4IINA 3BHMA 4RJTA 1P1HA 3RD5A 1HSOA 3AI2A 3NTQA 4IIUA 3ENKA 3QWIA 3ZU5A 3JQ8A 2V6GA 2G1UA 3CXRA 2ZCVA 3EC7A 3FF4A 3TZCA 2OZPA 3ADPA 4INAA 4B8WA 1EDZA 4PGFA 5I9NA 4ALIA 4ONEA 3WNQA 3HN7A 4AL4A 1P1FA 1SB9A 2IZ1A 5TGDA 3PFFA 4DUPA 3DBHB 5KKAA 2Y68A 4YWJA 2AA3A 2G82A 2YV1A 2FR0A 2EW8A 2FR8A 2BFAA 2VRBA 4BO7A 3CINA 1BW9B 3L4BA 1PS0A 2IXAA 2QYSA 3S2FA 4DL9A 2NTNA 2EXXA 1ZKMA 2X9VA 2Z5LA 3KTDA 3WGGA 1M6WA 2PZJA 1WLYA 2QG4A 4WNCA 4B7XA 5G0SA 2Q1TA 3TZ6A 1G0NA 3GVIA 4CQMA 3ADOA 4I9UA 3SX2A 2YFHA 3E8XA 3RVDA 3LT2A 3PLNA 5IDQA 3TOXA 3U9LA 1LDYA 4OMUA 3LSYA 3WJ7A 1DAPA 5JAIA 2PGDA 4ALMA 3JQGB 4O6VA 4J1NA 1XDWA 3T7EA 3F4BA 1H9AA 3DO5A 4FIZA 1VL8A 2NVWA 4UEJA 3GMSA 3ZW9A 1QSGA 1QR6A 1HE2A 2AEFA 2GPTA 5AQ1A 4XWYA 1NR1A 4XQ9A 3ZV4A 3GVXA 2Y05A 2A4KA 1IPEA 3KRTA 3VC7A 5I9LA 1Y8QB 2EGHA 3WIEA 3W4KA 4BMVA 1DIGA 1BXGB 1ENZA 1GZ4A 2HRBA 5LDHA 4C7JA 3GVCA 3HDQA 3GNQA 1AUPA 3IUSA 3OIGA 4PZEA 3OM9A 4UVHA 1N9GB 4P4NA 4W7HA 1SOVA 3TJRA 5BQFA 2HMSA 1VPDA 3DHEA 4XA8A 3TZKA 4BMNA 4CQMD 3I23A 3FNFA 3PYMA 1F12A 4G2NA 2C59A 2HK8A 2JCYA 3LLSA 4BNWA 2BF7A 4D3SA 1T2DA 4NR0A 3RWBA 3ICCA 3ZHBA 1Z75A 1I2ZA 1RWBA 2JFHA 4UVEA 5EPOA 4Z0HO 3WTBA 4GPD1 5B4TA 1KY5A 3MEQA 1GYQA 2B37A 1E3LA 2D4AA 4E5KA 5F3RA 4IXTA 4FC7A 3ZGYA 4MINA 1WPQA 3OEWA 3PIDA 4CMBA 3HB5X 3U4IA 2FOIA 1XEAA 4MVJM 3CEAA 1LBEA 4DPLA 3GHYA 5DCWA 3D4OA 1E1KA 4YJHA 1LC0A 2NU6A 3ENNA 3IKVA 2Y1DA 2X0IA 3JSAA 5JY1A 2O48X 1YQXA 2YZ7A 4FGWA 4YA6A 4EYEA 3WLFA 4AJ4A 5L51A 1PZEA 4Q3EA 3ZI0A 1GADO 2VNAA 2I65A 1IOLA 1YDWA 4DC0A 3IOYA 3PLRA 3ZW8A 4QQRA 4ZRMA 4FGSA 1H6AA 2O4CA 3K92A 3W4IA 1QRRA 2LDBA 5CDYA 1T4BA 1N7GA 5LCXA 2YFQA 2AMFA 1VE9A 2NVUB 3EY4A 1OZAA 1LEHA 1T1RA 2EKPA 2P9CA 4QUKA 4U0KA 4BNGA 5IXSA 4EITA 3UKOA 4CMGA 5JCJA 4MVJG 5TJHA 3JV7A 4IDFA 4E4YA 2D59A 5G4LA 1R4MB 4BNKA 3FPLA 4KUEA 5F5NA 3RUFA 3QQPA 4HUJA 3VZPA 3T4XA 4BB5A 1YWGO 5JC8A 5C3MA 4W82A 4DLBA 4KQXA 5KCZA 4KQWA 5BSEA 2P9EA 3JYOA 3JQAB 3WOHA 2C82A 1H6BA 2Y66A 1FK8A 4JP2A 4WJZA 1HF3A 1F8FA 5GMOA 1P31A 5G2OA 3TFOA 1RM3A 2PH5A 1I3MA 1Q2XA 3H65A 1HE5A 2W8ZA 5ER9A 1DSSG 3B70A 4BNXA 4D46A 4DPMA 4DREA 4UEOA 1I32A 3QJ5A 4MDHA 4JJFA 5AXAA 2C0CA 1UDAA 1S6YA 1NVGA 2RAFA 2Y1FA 4A10A 1R6DA 1O94A 1QMGA 4CM9D 3VPSA 3GEMA 3IQDB 3BHIA 3PQDA 2JFGA 2EV9A 5IXYA 4KP7A 3K2EA 4ILKA 3KEOA 3DEYX 4WLEA 1DRVA 3U0BA 1MG0A 5DT9A 4A27A 3ZWCA 3KXDA 1LLUA 1IYZA 2P2SA 5FYDA 1PGQA 5BSGA 4WCFC 4RORA 4MIOA 3UOGA 4CV0A 5I7EA 4TMFA 4GKVA 3QVWA 4CR7A 5GY7A 2PWZA 1NPYA 5JE8A 3MJ4A 2DKNA 1MX3A 1BG6A 2VYVD 1JVSA 2FR1A 4TRRA 4Q3CA 4RQTA 4AJKA 4L74A 1V6AA 1UR5A 1O89A 1WWKA 4ND3A 4YT4A 3ZWYA 3F4LA 4Z0PA 1DHRA 2DM6A 1XU9A 3PYXA 2BGKA 1PJSA 4IJUA 3N7UA 2FWMX 1AE1A 3DAFA 3DC2A 5U9CA 5I7VA 3L9XA 1LLDA 1KETA 5AXDA 1TXGA 3KHUA 2B4TO 3GZ4A 4UREA 2FRDA 5CPBA 3HFSA 4HXYA 5A4DA 3NDRA 5ENDA 4FQ8A 1GUFA 4K6FA 3ETGA 4TSKA 4NBVA 3KSUA 3AU9A 1NM5A 4IZIA 1FXSA 4GMGA 3BTOA 1Q0QA 1ISIA 4M86A 4BNZA 4I08A 3UUWA 3OQ1A 2NSDA 4D41A 2X9NA 4JQCA 3DAGA 4GGOA 2E48A 4CM4B 4PLPA 3IJPA 5FI5A 4B4VA 4F3YA 4J43A 4YQZA 1I8TA 4QFDA 2C07A 2Y1EA 3RKRA 3S2IA 5A5FA 2F1KA 3H9EO 1GPDG 2JHGA 3NT2A 1VJTA 3EK2A 3PFWO 3AFMA 5IF3A 2O4UX 1C3VA 4BNJA 2XXBA 4NBWA 1KBZA 2Q1SA 3I9NA 4R4JA 1R4NB 2BFPA 4EDFA 4CLHA 4F6LA 2P4QA 2VHWA 4YAJA 5HTOA 1AXGA 3RBXA 1HSZA 2WEKA 5TNXA 1NXQA 2EHDA 2FMUA 5CEFA 2H63A 1PJ4A 1U3UA 4XX0A 4J9VA 4AG3A 2ZQZA 4BO1A 1B0AA 4AJ1A 3L77A 1TLTA 4IJWA 1PEDA 3BTVA 3RFVA 4YJGB 5JCXA 1VKOA 3O38A 2HU2A 3UF0A 4E5PA 1UZNA 5JYDA 4QFCA 3M2TA 3Q2IA 1MG5A 1ZMOA 3M1AA 1KEVA 1VJ1A 2PY6A 4CMIB 3I1JA 3OMLA 4HFMA 3GEGA 3CMMA 3AWDA 5TC4A 1ZEMA 1P44A 3F3SA 4IS3A 3GRKA 4ZQGA 2ZYGA 3A4VA 2ZYDA 4YJFB 5G4KB 1QP8A 3PGJA 5CDSA 3JD0A 1MV8A 1Y6JA 3LLVA 1MFZA 2YV2A 1J0XO 3RC1A 4M54A 3DB2A 3SBOA 2PZMA 3FTNA 5AOVA 1A9YA 4U7WA 2OHXA 2RBEA 3UH1A 3JQ9C 1NFQA 5ER6A 3BAZA 1H2BA 1KVUA 1KYQA 1NQOA 2JAHA 2VRCA 1SC6A 5IN5A 4IXWA 5T67A 1R16A 1ULUA 3QSGA 5KJFA 4GVXA 4ND1A 2EW2A 3EGOA 5I7SA 5I8WA 3DFUA 2DQ4A 1VLLA 4KWIA 1MA0A 2QIOA 4NMHA 5FF9A 2ZTUA 2RHCA 1GCOA 4HX5A 1VKNA 1DOHA 3JYQA 6LDHA 2OUIA 4CMHA 5A9RA 4YRAA 1E5QA 5C7OO 4MOWA 2TMGA 2B5WA 1CRWG 4PLWA 1BXZA 2C20A 3G79A 4EUHA 2OGUA 1YJQA 4Z6KA 1C0LA 3UVEA 3MJEA 1OFGA 2E82A 4TKLA 4XDYA 2YHIB 3H9JA 3ANNA 2DLDA 4IY1A 3BA1A 3C1AA 3C7AA 5J23A 4J4HA 4XQGA 1MXHA 1PWXA 1ZO8A 3G17A 2DVMA 3N74A 1VC2A 4OQYA 2GGSA 3S1LA 8ADHA 4OKNA 1U2DA 3ZHZA 3GNSA 1PSDA 2Y0EA 3V2GA 2OFPA 1DIHA 1T2FA 5JS6A 4LGVA 4L4SA 3D3WA 4I1IA 3U4CA 1HXHA 4RCVA 4H7PA 5ES3A 2X9GA 2O7QA 3F46A 3TL3A 3CUKA 3K73O 4CV2A 3FPCA 4B3JA 3H2ZA 2UV8A 4PVCA 3LVFO 3TRIA 5MDHA 3V1UA 2O3RA 2NUAA 2CF6A 5G0TA 3QVOA 2JJYA 1W0CA 3EHEA 2ZKLA 1T26A 2J3JA 3DFZA 4XEHA 1TT7A 4ZQHA 2VZ0A 5THQA 4LK3A 3TZHA 1LSOA 1PGPA 1EDOA 4MKRA 1GEEA 3F1LA 3PHJA 1ZJZA 2GD1O 4JK3A 4NFHA 4WEOA 5HRUA 5JXWA 2GRAA 5JY6A 1E92A 1Z73A 1I3NA 1IHYA 2IEDA 4EJ0A 1CJCA 4NZ9A 3ORFA 4CM9A 4NIMA 2Y0CA 4JLWA 4B7UA 2VUUA 3GN1A 1E7WA 4K1LA 5EL0A 2I66A 4KDEA 3GHHA 4YR9A 5DOVA 1DJNA 3OHSX 2ZTMA 2AG8A 1DLJA 4H3VA 4YXFA 3I4CA 3BMQA 2WD7B 2ZK7A 3GFBA 1JAXA 2HSDA 5TX7A 2IYPA 3WICA 3PHIA 4RPKA 3STHA 4Q3AA 4QO7A 2QZ9A 1LQUA 2Y1GA 2EJVA 4GWGA 3W1VA 3DBHA 1NNUA 4UUOA 4P4GA 4AFNA 3QW2A 4Y6RA 3PP8A 1OC4A 4OGWA 1PS9A 1P74A 1P0CA 4WOJA 3D64A 1SO8A 3GZNB 4RF2A 2NVUA 2IRWA 5JO9A 3E6AA 1NX6A 4YRDA 1HKUA 4EI2A 1JN0A 1KC1A 1ISHA 5L53A 4BO5A 4N5NA 3VKUA 3LF1A 3MWEB 3RU7A 2W2KB 3EAGA 3RUHA 2ZB3A 1NQTA 5CEEA 1CF2O 2PA3A 4XYEA 3MJTA 5JAMA 1T25A 1UDBA 3PXXA 1LSSA 3VPFA 4IQ8A 5GZ6A 3I9MA 2RH4A 4ZA2A 4BO0A 1KIFA 4FJ1A 5KJEA 1EBFA 2CDAA 1MP0A 3H3JA 3TQHA 5K0ZA 3E82A 1MC4A 3I9LA 4BNMA 5ITWA 4PLCA 2W98A 4R5MA 2FSSA 1CQIA 3K9QO 3LT0A 4BO6A 2YQ5A 1HETA 4W9NA 2GNAA 1KEUA 1T2CA 2IYOA 1E1MA 4AICA 2VWHA 3A9WA 2R2GA 3W6ZA 4XYGA 3F6YA 1GAEO 1EK5A 3QRWA 1SAYA 3D0OA 4LMPA 1HDGO 1ZSNA 2WYWA 1ADFA 3ZDFA 4U8GA 3C1OA 1D1TA 1YO6A 3PGXA 1T24A 3E48A 2QW8A 3NDJA 4PLTA 5LC1A 1M6HA 3PQEA 3ZWAA 1NAHA 2FPPA 4PG4A 1DC3A 3DQPA 4CM3A 1D3AA 1N9GA 4A0SA 4DPKA 2J5KA 2FZEA 4TRNA 3DZJA 3GG9A 3GPIA 1NASA 4RVGA 4YVFA 2HQ1A 3T7CA 3FNHA 1SNYA 1A5ZA 2YDYA 3GUYA 1XA0A 1C1XB 3H5NA 1X1EA 4TQGA 4I8XA 3ZV3A 5DCYA 5DBFA 2NADA 3VPXA 2VCYA 1YONA 1SEPA 1F0YA 4JROA 3P19A 1PZFA 4N5MA 3IL2A 4MVJD 1DIAA 5A9SB 4O63O 4GSLA 2C54A 2J5RA 3WGIA 4MJLA 3SVTA 3GA0A 2OOSA 2YQ4A 3C85A 1VJ0A 4OXYA 2CF5A 4FS3A 4CM4A 5AXCA 1U2GA 3P5SA 3F5SA 4A5OA 2CVZA 2FPIA 2QX7A 2O7SA 2J3KA 2CFCA 1ENPA 2ZTLA 4J1TA 3DTTA 4DGSA 1LNQA 3GK3A 2OMEA 1QYVA 4KUGA 3FR8A 1ZW1A 5C7LO 1NQAO 4YAKA 1E1NA 1NPTO 3HJAA 4LN1A 3WDSA 3AK4A 1PS8A 2DAPA 1A27A 5IAAA 3WIDA 2BFMA 5B37A 4IMPA 4CMEC 1LSJA 4L4XA 3SLGA 4A03A 1LLQA 3F47A 3PWSA 1H5QA 2PKQO 3TPCA 4GLLA 2ZATA 1E3WA 1B26A 1BHSA 3KB6A 1Z7EA 3BIOA 3GZNA 1Z82A 3CMCO 4A2CA 1YJ8A 3EDMA 3Q6IA 1RYEA 3AY3A 2CDBA 4XB1A 2OORA 4ZQFA 4WNIA 2WYUA 2B0JA 2EKQA 4GX5A 4IIVA 5BT9A 2EKLA 1UZMA 5FWNA 1HRDA 1PX0A 1ISGA 4ZU3A 3F9IA 4DIBA 3CKYA 3O26A 4RZHA 3WTCA 1PIWA 2VRCD 2G0TA 5JYEA 3AJRA 2VTDA 3JD3A 3K31A 4FJ0A 1YVEI 1KOLA 2PD3A 3AUAA 1GQ2A 2DFVA 5JFOA 2NV6A 3KOUA 2AG5A 4URFA 1OC2A 2PH3A 2HK7A 4HNHA 2JCXA 1ZH8A 4DTIA 3GUCA 3KZVA 3E9MA 1VL6A 2I9PA 4CQLA 1E7QA 4RLSA 2UUOA 5CDUA 4J2HA 3C24A 1AHHA 3AU8A 4Y6PA 2Y1CA 1DFHA 1WVGA 1EVIA 2CY0A 1YBMA 4AJJA 4Z9FA 4AJ2A 4A7PA 4DIOA 5L9AA 5G0WA 1UP7A 5TT1A 3RU9A 5IDXA 2XOXA 2W2LD 1ZFNA 4D42A 3FN4A 3BMCA 2X5KO 3PHGA 1GTMA 1LRLA 3WFIA 1GL3A 2UUPA 4BO8A 5KOIA 1RJWA 3Q0EA 4FC6A 1DB3A 1PR9A 1Y9AA 3QIVA 4NU6A 1ISJA 4IGEA 5JPIA 1HZZA 4LVCA 4IZHA 2G17A 3QVXA 4BIIA 3HWRA 1Y1PA 3JQ7B 4Y67A 2X5JO 4I5DA 1BSVA 1Z6ZA 1R4MA 2EERA 3I9OA 1GQYA 2EEZA 9LDBA 2V65A 4BNYA 2A35A 3RASA 1NFFA 1GUYA 2NTVA 4E2ZA 5A03A 1XYGA 2VNSA 1I33A 4JP3A 4GL4A 3GAFA 1UDCA 4M49A 4R69A 1TVEA 1BDMA 1EVZA 4NFSA 1O5IA 4Y6SA 1DC5A 1C1DB 4J0EA 4ZVVA 2AE2A 2GZ2A 1X1TA 1SMKA 1JW9B 2Z1MA 4IQGA 3PEFA 5FI3A 4LRTB 2NWQA 3L4SO 4XIJA 4FCCA 3H5RA 1PZGA 3PDUA 2DTDA 3PHHA 5IN4A 4RQUA 1O6ZA 1ZXLA 1U8XX 3PVZA 2Q49A 5KWEA 1B2LA 2GUGA 1H94A 1QYDA 3WBBA 3JQBA 3MJSA 4AJPA 3HUDA 4I5GA 3I5MA 4PRKA 1SBYA 1K3TA 4GWKA 3PJEA 1EK6A 5ADHA 4ESOA 1DRWA 4AJLA 2Y99A 3E9NA 3MCVA 1U8FO 4M89A 1IE3A 3VHRA 3V1TC 4RPGA 1LDEA 1E3JA 5CP8A 1WMBA 4XJSA 3GFGA 3JQGA 4R3WA 1HEUA 1BGVA 3JYLA 2C29D 1MXFA 2X6TA 1L1FA 3L4BC 1A7KA 4YJGA 4R68A 2C5EA 4GH5A 5CEJA 2CVQA 3TSCA 4XR9A 1ZJYA 3T4EA 1ML3A 2GN6A 3FNEA 4DIFA 1K2WA 1Q0HA 3WMWA 4FB5A 3UHAA 1UXKA 1H0KA 2VZ8A 4XQEA 3L0DA 4XB2A 1D8AA 4LISA 4RF3A 4Q3DA 3GRPA 4ZHSA 2NNLD 5GZ1A 2YHUA 1DDOA 3R3SA 2VT2A 4E32A 3F5QA 4P38A 1U3WA 1LC3A 3DMYA 5T8KC 2NU7A 1JQBA 1BVRA 3SEFA 3TN7A 3Q3CA 1ONPA 4YAIA 1NP3A 3TWOA 3Q11A 2A92A 3NV9A 3DBLA 1XGKA 5DCUA 3NJ4A 4FW8A 4E2YA 1ENOA 1G0OA 2CSUA 4BV9A 2PZKA 3DONA 4CJXA 1I0ZA 2CNBA 5B4UA 4CV1A 5KNLA 2A94A 5F1KA 4II3A 1NR7A 3C7CB 4YPOA 2HMWA 2FN7A 3JQAA 1A4IA 1HE3A 1P3DA 4JBGA 1K6XA 2Q99A 1UZLA 4RGBA 1B15A 1EUZA 1N1EA 3ZV6A 3BTSA 4JXKA 4XYMA 4J90A 3NTRA 3S2EA 1DRUA 1TEHA 4I5FA 1I5RA 1PQPA 1UUFA 3NJ8A 1YS4A 3FRJA 3WQQA 4MP3A 4HV4A 1I30A 1YH3A 3GDGA 5T64A 1CIVA 4PLGA 3PZRA 1SOWA 4AJNA 1PQUA 3I6IA 1S7CA 1ONNA 2VOJA 2X4GA 4KZPA 1A4UA 1EFLA 2NLOA 5TT0A 2D0IA 1UJMA 3CTMA 3C7DB 4FD3A 4XGNA 5JDCC 1LDBA 4OYRA 1OAAA 1KVTA 2X58A 4YBZA 3HB4X 4D0RA 2DBVO 1PJCA 4NFYA 2XAAA 4PLFA 1MUUA 3VPGA 3ROKA 1R0SA 2Q3EA 2X1HA 4CR8A 4F46A 5ITVA 3VOSA 4R1UA 2YV3A 1FF9A 5EQDA 2Q50A 3PTZA 2OBNA 3QLJA 2PKRA 5CHEA 3QWBA 4PG5A 4RVDA 1V0JA 3NGXA 5COQA 3DHYA 3PDJA 3LYLA 2B36A 5U1PA 1A7AA 1NVMB 4MO2A 1NPDA 3DZHA 2ILTA 1LU9A 2GCGA 4M87A 1ISMA 1SPXA 5L45A 1DHTA 1QKIA 1ZMTA 2J3HA 4BO2A 4UUNA 5DNAA 3OA2A 4FFPA 3M2PA 3ZNNA 5L7TA 1GPJA 1T2AA 4BNUA 4MVJA 3E1KA 5B12A 4AVYA 4EW6A 1HWYA 1UXHA 1WW8A 4IS2A 3CIFA 4QO8A 4B4OA 3H4VA 1MFPA 2PK3A 3QY9A 4TRMA 1YBVA 3TZQA 1PGNA 1ZIDA 4R54A 3E03A 1X7HA 2HMTA 1D4FA 3B6ZA 2VHVA 3SLKA 4DLAA 4PN3A 4D44A 4ZGWA 3I52A 4HP8A 3OSUA 1YOVA 4IDAA 4K26A 5EERA 2HUNA 3IKTA 2DBRA 3ZHYA 1YQDA 1ONOA 4JCOA 3COSA 4GSKA 1Z7BA 1J6UA 4XQCA 1V35A 5GZ3A 1LA2A 2FP4A 1YOVB 3FSRA 4R51A 4LVUA 4TVOA 3KYDB 4TVBA 3VVBA 1UP6A 2HK9A 3VTZA 2DTXA 4BNFA 4EUEA 4YT5A 2PD4A 4CUKA 3DZIA 3AY7A 4ROSA 2PNFA 1KVQA 2Q1WA 4GVLA 4BNTA 4HY3A 3LQFA 2P91A 4DBVO 3RI3A 2XPCA 1QV6A 4IDCA 4J3FA 4B8ZA 1EVJA 1P45A 1R15A 1B8UA 4L9RA 4WK6A 3RC7A 4ALNA 3I6QA 4BKRA 4PLHA 2D8AA 3FBTA 3U5TA 2W2LA 1V8BA 4WCFB 1Y9EA 3JYNA 1HDXA 4TZKA 5F1PA 3WGOA 4S1VA 3ZWWA 2PGLA 2UAGA 3TOZA 4CM8B 4F45A 4PZCA 4UULA 5DN9A 2W90A 5DP1A 1UAYA 2H6EA 1MLDA 2J8ZA 4DQVA 3TF5A 4DLLA 3CZRA 3PHLA 2RIRA 4XYBA 1W4ZA 3WWZA 1M66A 1ADGA 1JKFA 1FDVA 2BI8A 2I3AA 2O3SA 2WM3A 5JMWA 1L7DA 4A26A 1I24A 1U4OA 3PI7A 5CFZA 4CM5A 2DPGA 4IUYA 5BSHA 2GERA 3AOEA 4XRGA 1I01A 2R00A 3BYZA 3E5MA 5KJ6A 1UXJA 4FOOA 2B69A 3PWZA 3IC5A 4OOEA 5A1TA 1DXYA 3QVTA 1O9BA 1VM6A 4TROA 3VH4A 3RIHA 2NVBA 1IUKA 4UVGA 1BXGA 4AJIA 3AW9A 4XCVA 2BKAA 2AQ8A 4GX0A 1LDMA 1LXCA 3W6UA 4J7CA 2YJZA 3OICA 1GYRA 3NEPX 1B3BA 4EJ6A 2ZJ1A 3GPDG 3ANMA 2H5LA 1R37A 4U5QA 1YRLA 5HBRA 5F21A 3OJEA 1A9ZA 4LCEA 3DXFA 4NHEA 3BHJA 3JCZA 4CMJA 1XKQA 3H3FA 1LDNA 3LC1O 3AM4A 3WGTA 1D1SA 1PU2A 4BMSA 2BLLA 2DUWA 1TA4A 4MIEA 3PRJA 2D2IA 1B7GO 1U5CA 1DLIA 3ULKA 3BMNA 4IPTA 1KS9A 5JDCA 2A9FA 1LX6A 3BXXA 2JKVA 3JD2A 4LRSB 3I9JA 1XQ1A 9LDTA 4UUMA 3FD8A 1BW9A 3HSKA 3MTGA 4OHUA 4HKTA 3HZZA 1SB8A 3OJ0A 4FJ2A 1V3VA 3O8QB 4MVJF 3ZU3A 5ILOA 3C8MA 1P33A 4YACA 5B4VA 1E3IA 1OI7A 3Q9UA 1HDRA 4ALLA 3JQ8B 4QECA 5K6AA 2Y1OA 3SC6A 4G65A 1E7MA 5CDGA 3IJRA 4MVJP 4YJHB 2ZQYA 1I2BA 3WS7A 5TS3A 3DMTA 3B1JA 5L7YA 3AOGA 3MJCA 3D7LA 3WMXA 2JAPA 3OIFA 3U4DA 3OP4A 1NAIA 4DA9A 1Q7GA 1X0XA 3RBVA 4FBGA 4BO3A 1JKIA 4O1MA 4RDHA 3WWYA 5A05A 1RM5A 4XJTA 4J7XA 1MGOA 3G1UA 4BNLA 3WB9A 5BR7A 5KVCA 3AOEC 1DPGA 3VVCA 4IJKA 2RCYA 1ARZA 4MVJH 4WASA 4WKGA 1Z74A 3VZSA 5C37A 1VI2A 2FPGA 2NU8A 3VZRA 4R3NA 3QWFA 3SC4A 4RDIA 5T6BA 5THKA 3JQFC 2YW9A 2O3UA 5KTKA 3OA0A 4Q3NA 3BZUA 3V5NA 5A3VA 1I3LA 3QP9A 3QVSA 3ZWNA 3TDKA 2WYVA 2G5CA 4ZRNA 2EWMA 1RM0A 3RFXA 4WCFA 1PJ3A 1A71A 2UDPA 2OP1A 3NTOA 3QWAA 3ZWPA 5KVVA 5JC1A 5DP2A 4I5EA 4AJEA 3WGQA 2IXBA 3VPHA 4CMCA 4ZQBA 1UXIA 5T5QA 5JBIA 4E31A 1PJTA 4DC1A 4CV3A 1C0KA 2GR9A 3FR7A 1UH5A 4OM8A 4MP6A 1XHLA 1MC5A 3U62A 4ZQEA 5L4LA 2NQ8A 4M55A 4FSHA 3D4NA 1Y5RA 4ALJA 1LUAA 1XLTA 1DBVO 4O59O 4D43A 3FI9A 4OSOA 1RPNA 4C7KA 1VRWA 2VTEA 4WOKA 1YXMA 3ONDA 4PZDA 4NH4A 3PJGA 2YHIA 1I2CA 4G5HA 1CETA 1AGNA 2O3JA 4YB8A 4D3FA 1QLHA 4C4OA 1U4SA 4B7CA 3L9WA 1PJQA 3GF4A 4G81A 3FNGA 2D1YA 1P9LA 2AE1A 3DBVO 3G0OA 4NK4A 2IEBA 3GC6A 3JQ6A 3WBFA 4BL5A 3FBGA 3HN2A 3ZNQA 3O9ZA 1GCUA 1DIRA 1LQTA 3U09A 4N54A 2Z95A 2EG9A 2PD6A 4F6CA 4OOFA 5DOZA 3A14A 3PZBA 4CR6A 3OFSA 4ZICA 5L4NA 4J16A 2P68A 1JKJA 1YL6A 3MOIA 5TIIA 4TRJA 4R16A 4XGIA 4CLOA 1EMDA 3V8BA 4GLOA 4HNGA 1Y5MA 3QE3A 3PQFA 5EINA 2VWPA 1X13A 4NDNE 4BO9A 1JU9A 4BNIA 4YJDA 3E18A 4KWHA 1OOEA 4ND2A 4B4UA 1N7HA 1E3EA 3JYPA 3ZN2A 3O8QA 2P9GA 4BNNA 2AQHA 4DMMA 1XR3A 4OH1A 4XGKA 3JQDA 3H6KA 4XYLA 1H6CA 4GMFA 3KETA 3OECA 3RCBA 5LDGA 5BNFA 1NWHA 4CMEA 1GZ6A 4L8VA 3JQFA 2CDCA 3KV3O 4N7RA 4PG6A 4EUFA 3WGYA 3INRA 2BMAA 3GLQA 3NAQA 4CUZA 2AQIA 2EGGA 2DFDA 3H7AA 3PJFA 1ULSA 1JWAB 3ROMA 2FY8A 1ZBQA 4BNHA 1KEWA 3ASVA 1HYGA 4J9UE 4YAEA 4Z9XA 4NJOA 4HFRA 4WEQA 3VH1A 2I76A 1W6UA 4A73A 2VWGA 2B35A 2DBZA 4R1TA 1EVYA 1VSVA 4OJNA 5BSFA 1T1SA 4BGEA 3DBRA 4UEKA 1X7DA 4Z9YA 5EMHA 3U49A 1FDSA 2Q2QA 5COBA 1Q1NA 1GDHA 2WMDA 1ZVMA 3AM3A 3M1LA 4GX2A 1AN9A 4KTVE 4W6ZA 5G0UA 3K5PA 3NT5A 1E7SA 4IDGA 2BD0A 5ICMA 4YRBA 3OIDA 3P2OA 5IG2A 4E21A 1HYHA 1BDBA 3RAJA 3JQCA 1YKFA 3AI1A 2WE8A 5IDYA 4ZN6A 1WDLA 3AY6A 3VH3A 1PZHA 1RM4A 3EZLA 1GEGA 4J4BA 5JAZA 3WGHA 4D79A 4FFNA 3RUAA 1J49A 1DAOA 1FDUA 1P0FA 4IDEA 1D7OA 4IDDA 1U3TA 1Y8RA 4BV8A 2AEMA 3RBZA 1ISFA 1UP4A 4YJFA 2ZYAA 4XRRA 3JQBC 3ZU2A 1C0IA 2NU9A 3NKLA 3S2GA 2PR2A 1NBOA 2VHXA 1BMDA 2R6JA 1ZXBA 4CMIA 3L6EA 4O5OA 4CUJA 4J91A 4JJGA 4JX8A 3WSWA 3UCXA 1GR0A 1HE4A 4MP8A 2HKIA 3KVOA 2ZB4A 2PKQP 5T8KA 3KUXA 1NQ5A 4YAGA 1P77A 5G0VA 3WJAA 1Q7CA 5COAA 4ND5A 5A9SA 1EBUA 3ITDA 2BELA 1PL6A 4RVSA 5A3JA 2ZIZA 4CL3A 3O4RA 5G4KA 7MDHA 1VL0A 2B5VA 1K6IA 2EJWA 3C3XA 2GN4A 5EN4A 4RPJA 2JL1A 1J4AA 4E12A 3OBBA 2XF8A 2PGJA 3DOCA 2GSDA 4FOSA 4J2OA 1JWBB 1K5HA 1LLCA 5JLAA 7ADHA 3P7MA 4RPHA 3RUDA 3INGA 3WYBA 3HG7A 3SXPA 2VT3A 1IL0A 4GI2A 2GZ1A 2Q45A 4FDAA 3KYCB 4IQ0A 3TL2A 1G6KA 1DC4A 3NUGA 1YE3A 5L7WA 3PIIA 4CLEA 4JBIA 1ADBA 1CEQA 2Q4BA 4Z3KA 3HNPA 4M8SA 4RVHA 3WYEA 3VAZA 4NNJA 2DTEA 3CSDA 4LSWA 3D4PA 2CZCA 1CDOA 4DMLA 3ZNOA 3LC7O 5ILGA 3B1FA 4Z3DA 1DFIA 3WFJA 1K0UA 1V3UA 1EZ4A 4RV9A 1O8CA 2B83A 3GEDA 4FFOA 4NPCA 2GF2A 3A1NA 5IDWA 5L4SA 2BRUA 1BTOA 2AEJA 4EJMA 3B20A 5BNTA 2D5CA 4ND4A 1Y7TA 1SZJG 5IZCC 2SCUA 1HTBA 4J4TA 4MVJE 5DDIP 3DOJA 1RYDA 4KTTE 3ICPA 3OETA 3TNLA 2HMVA 4XZ3A 4E30A 5FFFA 1IHXA 3H9GA 2Q2WA 3RUEA 5C5IA 1DC6A 1ZK0A 4PRLA 4DQUA 3GOHA 3ZCXA 2OBYA 5CAEA 3B1KA 1QYWA 5DF1A 4JJIA 3UXYA 3WR5A 3ZWBA 5IFLA 5EJ2A 1FMCA 5A5EA 2AXQA 1O95A 4L73A 1E6WA 1JLLA 1WDKA 3ASUA 3DL2A 3ZH2A 4YT8A 3BMQB 4BGUA 5JO0A 4OXNA 2IE0A 4KOAA 5EQFA 4YDRA 1SEVA 3AM5A 3CH6A 1BVUA 2V7PA 3DHNA 1FDWA 5I8ZA 3GR6A 2Q46A 3HFGA 1O0SA 3M6IA 2C2XA 2ZCUA 1KY4A 1HT0A 5A02A 2P5UA 3GH3A 2PLAA 2GO1A 4P4LA 2D3TA 4PG7A 4MPDA 3UGKA 3K2BA 3GMDA 4FFLA 3G1TA 4WECA 3U3XA 4S3MA 2HJRA 3PWKA 4UAGA 1Y8QA 2I5PO 5DBGA 2UYYA 1LRKA 4D0SA 1E6EA 1LI4A 3IMFA 4E2WA 3GG2A 1YQGA 3LZ6A 3TFQA 3R3JA 3ZU4A 3NYWA 4QT0A 2PZLA 1L7EA 4TWRA 3ZHXA 4N18A 1E77A 2O2YA 4XR4A 1ZSVA 3GAZA 4CMKA 3V1YA 4CLRB 2IZZA 4YEDA 2E4AA 3ZWOA 3WYCA 5KVSA 5H82A 2VOEA 4WGGA 1TI7A 4D45A 2C7GA 2QQ5A 4E5YA 1F14A 3FTPA 4N5LA 1PQWA 3JTMA 2H1SA 1G1AA 2FZWA 1PJLA 4CLRA 1IB6A 4RO0A 3ST7A 1PR3A 2I6TA 3RC2A 2I3GA 5I9MA 3L07A 4NJMA 1F17A 3DAPA 4TZTA 3UW3A 2VN8A 3GY0A 1HDZA 2C5AA 4B3IA 1C1DA 4RVFA 1PL8A 1PWZA 2X7HA 1GD1O 3D1LA 1Z45A 1WZEA 4YT2A 1U7HA 4LSMA 4Y8VA 2CVOA 4R1SA 4E6PA 1ZK2A 5A9TA 1XWFA 3WX0A 3W4JA 3HDYA 1WNTA 1DEHA 1I3KA 2JD2A 1FJHA 5KKCA 1X15A 4KUHA 3CE6A 2IDZA 5MGBA 3HE3A 1LTHR 1E7YA 2JD0A 5T57A 2V6BA 2HDHA 3E5RA 3C1TA 3UCFA 3WLEA 3ABIA 4D7AA 5BNIA 2POQX 2Y93A 2E49A 1C1XA 2PTGA 4B3HA 4EEXA 3A28A 3BTUA 1B3RA 1TT5A 2Y67A 1E3SA 4WLUA 4HFNA 5HA5A 1UAGA 1XELA 3I83A 4E5MA 3AUUA 1GZ3A 3WQRA 4R5HA 5K6AC 2DBQA 3K8ZA 3W8FA 1N5DA 3GGGA 4NQZA 3ZNPA 3EZYA 4PLVA 1P1JA 1XSEA 1Y81A 4R01A 1N8KA 3AUTA 3LC2O 1ZCJA 3OJFA 4O0LA 2PFGA 1KC3A 2FHSA 3VH2A 3DZGA 4GX1A 4BKPA 4BVAA 1K89A 1RKXA 4U6QA 1YBAA 3I4FA 1C14A 3DOOA 3LDHA 1GYPA 3S8MA 1DIBA 1GU7A 1BWSA 1QV7A 1KEPA 1E6UA 1QXSA 4OAQA 2ZTVA 4KMSA 4WE3A 1HZJA 4DBZA 1R0LA 1NTOA 2RH8A 2VUSA 5AXBA 3RFTA 4YYZA 3JD4A 1HDCA 6ADHA 3EW7A 1EUDA 4DVJA 2AQKA 1E5LA 3R6DA 5TRTA 2NACA 3N58A 1VSUA 1EE2A 4K6CA 1Q0LA 3AI3A 1LRJA 4R9RA 4WLNA 5JAQA 2GDZA 1M75A 5H81A 2JHFA 1BRMA 2WE7A 3OQBA 2VHYA 4P8RA 3IP1A 1LDGA 1XQ6A 2VZ9A 2WSBA 4NI5A 1CERA 3RUIA 1ID1A 2YUTA 1C0PA 1U28A 2DUUA 2WTBA 2JCVA 3CPSA 1K6JA 4CLDA 4GQAA 2AHRA 3IIEA 3UICA 3VZQA 3Q1LA 1IY8A 4DXHA 1X7GA 5AVOA 3LF2A 4BHTA 4J7UA 3EMKA 4FR5A 2I67A 3OJOA 2G76A 4BKUA 5CG1A 1FDTA 1NHWA 3SJUA 1N92A 1ZK1A 1PL7A 2GZ3A 4UVDA 4OO3A 3KYCA 4X54A 2J6IA 1H9BA 1B8PA 2ZB8A 1H6DA 3X2FA 4PVDA 3ZWXA 1SCUA 4Y9DA 4U6SA 4QX6A 1U9JA 2NM0A 1I36A 1U5AA 3KSDO 3AFNA 2HRZA 5DBIA 5JMPA 4CPDA 3EYWA 2C2YA 4QEDA 1ZEJA 1X14A 3ONFA 4R41A 4IM7A 1YDEA 1R66A 1WP4A 2QRJA 4NJMB 2Y0DA 3NDIA 1Y8RB 4YTEA 3F1KA 1KVRA 1WDMA 4IDBA 2QRLA 2I99A 4QSMA 4R9SA 3ZWMA 4CM1A 4JGBA 3DWFA 3RQSA 3UFXA 4CQLB 3R1IA 3MWDB 4NBUA 2X23A 3ZV5A 2Z1NA 1YB4A 5TJ9A 5CG2A 4CL8A 5HS4A 1ZK4A 1W73A 3JD1A 2VHZA 2Q4EA 3NT4A 4K28A 2X22A 1LJ8A 3ETDA 1EUCA 2O3TA 4XIYA 4WUVA 4HWKA 4Z0TA 4FFMA 4L76A 5EIOA 1JDJA 1ZK3A 4GBJA 3DTYA 1E7RA 3RSHA 4PG8A 5IZCA 3RUCA 3H8VA 4Q3BA 4BKQA 5ENVA 3UCEA 4E13A 3DZBA 5JNLA 1QYCA 5A04A 4WPGA 2J3IA 3NGLA 3EVNA 3OQ6A 4OXKA 3DBRB 4TKMA 4MVJI 2ET6A 4HFJA 4W99A 1E3WB 2QZZA
chains in the Genus database with same CATH superfamily
2IPNA 5FBWB 2ZRGA 3E7XA 3C4QA 4X66B 1RP1A 4NOKA 5CURA 3TSWA 2H5JA 3ONEA 3UMFA 1TUGA 2QY9A 1HQCA 3MA0A 4JZYA 1GFSA 2CL0X 2GAIA 2LV8A 2GASA 4KDFA 4KR9A 3WXBA 4E0BA 1T4DA 3IBYA 3DGFC 3WLAA 1MORA 2IPXA 2H4ZA 3MYYA 1AXEA 4KN5A 4NFLA 5T4FA 5CHYA 3LKBA 5DIFA 1RFLA 4DSOA 3EW9A 2CXXA 2H52A 4OHFA 2X5XA 3DZCA 4V2IA 1OMOA 2DLCX 4C3OB 5EESA 3FPEA 2VDMB 4LHWA 3W8EA 1KRXA 1W36C 2J5QA 1A96A 1I6WA 4DGQA 4ZOQI 3HHPA 1QORA 1A9XB 1V9LA 4UBKA 1FMTA 1O6BA 4EY6A 1MOZA 2COKA 4MJ3A 1KAGA 5ALPA 1G5TA 1JALA 3KDAA 1QHSA 1VBKA 3ETCA 2X19A 3IJEB 3R3ZA 4EX6A 5AESA 4K0KB 2AKAB 1P1RA 5DN6A 1Z0ZA 1A50B 3HB7A 3NORA 1U94A 1PFKA 4BPRA 5EUCA 1ORHA 3LQ1A 1PTJA 1PO7A 5IJ0A 5HS6A 5DGTA 3RC9A 2I9KA 1G9TA 3FMVA 5K0LA 2X86A 1Z4QA 2CL5A 2OTCA 1G2QA 3CC8A 3VU8A 3O03A 4NU5A 1A95A 1DJOA 4QOEA 1LF5A 5KSPA 2JDID 3HCEA 1E2HA 1RDFA 5DGIA 2ZGVA 4H15A 3OLQA 2QIPA 1CYDA 2X8LA 4XW2A 3ICEA 3CNHA 5CLLA 1ABEA 2A57A 2VJYA 1QG6A 1O77A 1MO2A 3D1VA 4AG6A 3H1AA 1PJ2A 4EMUA 4S35A 1GGNA 4JUIA 2PANA 2WDZA 3IFSA 4XD7A 3V2IA 1I4DD 1V4NA 2BSAA 4LYYA 4TZ6A 2RK3A 5DWQA 1CQJA 3DLAA 3ANYB 2HJSA 4FCWA 3R0IA 4AECA 2A86A 2BGMA 1U1CA 4L0QA 2FN8A 5D87A 1JZSA 3O7WA 1HQKA 1YB5A 3GNTA 3MWEA 3WIUA 4DCUA 4J1QA 3OJLA 2ZSKA 3WGZA 4BUCA 3VZCA 5FWXA 5AYVA 2GB4A 4I1UA 1P5JA 2CD9A 1Q91A 2X2FA 2F48A 3F5MA 2IYWA 1REQB 5DT2A 3AVUA 4TT3D 4AZ0B 5IVKA 1RMTA 3AHHA 4CVNA 3HBLA 4NYIQ 3U4QB 2SHKA 3DEFA 2LTAA 1GKUB 1V3TA 1JRLA 1FDRA 2HDNB 3CLSD 3GVPA 2H59A 4L4UA 4KVAA 1R64A 4MLPA 5D2CA 5F76A 2O50A 2BJVA 4PLYA 4I8DA 4Q12A 2CD7A 1E2JA 1HDOA 1SKYE 3M5PA 3SF8B 4PBRA 4QTZA 4DN6A 1JJVA 2P2CA 5C7IO 2WV9A 4J75A 1YNSA 3AJEA 1AMOA 4OQMA 4WY8A 3V34A 3GDFA 1IZ9A 1NUQA 4N4AA 4S0ZA 2OXRA 2EIHA 3ETEA 3PJDA 1DJQA 4BN0A 4R2JA 3ICOA 4HYYA 4NATA 3KZXA 4D4GA 5CTJA 4MKZA 5DPMA 4IMRA 4LHYA 2O8VA 3NIGB 2I03A 2IHJA 4FB4A 5CAEB 3AP2A 4DSAA 2VNIA 4IDOA 1QLJA 2YYYA 1VKZA 2W4MA 3R0VA 1JFFB 5E7MA 5FP0A 3PB3A 3IMGA 4E2XA 3EQZA 3O1IC 1FZTA 3VI4B 5CDTA 3KP1A 1HL3A 1A4XA 2X0RA 2LWIA 4W9NC 2GYYA 5LXTF 2N9UA 2HY7A 3A06A 3R6TA 2W2NA 4I1SA 2XD9A 3W8NA 2QM3A 4EEZA 5JZMA 3B7PA 4H1WA 5LFAA 2ANBA 4K9RA 2NTJA 1U1DA 4D26A 2CMFA 4GEKA 421PA 1Z5GA 3EPLA 4Q37A 1OFIA 2AOTA 2QHXA 4CGZA 2ATEA 2VO1A 3UUGA 3Q9NA 4R8KA 3CM0A 4S1NA 4UFNA 5BYJA 1T2EA 3EQ6A 2HAEA 1JDZA 3DE5X 2IT1A 1SURA 3QUSA 2WB2A 1SVNA 3GLGA 1PP4A 3H5VA 3N2KA 1K5DA 5CXUA 4L75A 1J07A 2E5LB 3FX2A 1Q14A 1AUOA 3VOTA 1O97D 1FUIA 2FW8A 2F00A 3CE9A 4JBHA 1TM7E 2NNWB 2MINA 5F5LA 2PNJA 3X2SA 3OQOA 4TWIA 4DCCA 3DZFA 3VJKA 4AZWA 1NFRA 4UNRA 3M0EA 3KO8A 1X42A 2Y9PB 1LPBB 3DBLB 1XVVA 4MQEB 3ZI4A 3ORQA 1YZVA 1KHHA 3DKKA 3E0QA 2WD8A 1P60A 4GAEA 1KZYC 4ALKA 3ELDA 1XPOA 4LZNA 5BPFA 4TMZA 1FZQA 3EVAA 1XXHB 1MHTA 4ZJUA 1IJBA 1W0KA 5AKKA 4WLVA 4R1NA 3SY8A 1Y4AE 3I01A 3U7HB 1V5IA 4RZIA 3P1JA 3TW6A 2GESA 4C89A 1OBFO 3FVTA 4RCZA 3WL6A 1YUNA 1ZNQO 2BI7A 1CULC 5P8WA 2XT9A 1HOTA 2WIGA 1RBYA 3PF9A 3SZOA 2AYZA 3OM1A 1M76A 3JVDA 4P82A 4EEKA 3K6JA 1SC4A 3ITKA 1H2HA 2BWJA 3D7NA 4R0VA 3DR5A 3VR1A 4YLYA 3MUEA 4XLTA 2CWWA 3L0YA 4OQZA 2WHXA 1UPCA 2TMDA 1E1LA 3K9HA 2WWIA 2JFFA 3N5CA 1PJBA 2QG9A 3OFNA 1UXOA 3AVTA 5IX8A 3GA5A 1E1QD 4F4IA 3PQ8A 4W5HA 4EG6A 1GZ5A 1J8QA 3LU1A 3N8DA 2YDXA 1I4OA 2EKBA 4HDKB 4UHJA 4XD2A 2BFCA 4DA8A 4QYSA 1W36D 1X0VA 3JWJA 3PYLA 4RHFA 2ECKA 5C8DA 3VXKA 3PEYA 3RVKA 4EZEA 2HMUA 2I2AA 4QTTB 2CUKA 4BGIA 2I1QA 1IUOA 2NYRA 2O0KA 2V3WA 4HK4A 4QA9A 3UWMA 3BMOB 1YJAA 1IMOA 1TYDE 4IRUB 5HUJA 1CVIA 1WD7A 3GX1A 3P9RA 1SKMA 1Z13A 1WZIA 4RQBA 4HX9A 4IH1A 1NWCA 5KJ1A 3VNVA 2IZ6A 3RVRA 3GGOA 2VBGA 1LV8A 1Z38A 3N2LA 3PXBA 3U80A 2A9QA 3BMOA 5SY6A 1T9CA 4CM8A 3EUFA 3B5IA 2W4QA 3L06A 1F06A 1KL7A 1VBNA 1ZH0A 4E4TA 4CDNA 6REQB 3ZWVA 2FF7A 5AW8A 3G0HA 2BMFA 4YCAA 4YUXA 1U65A 4HB2A 2G1PA 2M6LA 3SF0A 3Q12A 2XLBA 4X8MA 5CJPA 3HADA 3SHOA 5HWSA 2C7VA 1I4TD 1XTUA 3WOVA 1P7CA 4F9FA 3DT9A 3IP8A 5K01A 3FKSD 3LCMA 5I4IA 2GN8A 2R7NA 1T15A 3QELB 4QBKA 1ZZEA 1YJXA 5TF4A 4EA8A 5ALNA 1T3ZA 1ECGA 3OG9A 3VO1A 1QRUA 3FYSA 1YQUA 3GOQA 2EARA 1ADCA 5FEUA 2VHEA 1KJQA 4UCFA 4F5ZA 2V0CA 3OVMA 3VDRA 4EHIA 2ZJ7A 3TE7A 4E5UA 5I01A 1ZSYA 2J41A 4YCNA 3PNKA 4BXOB 2IZ0A 1XTPA 3IDSA 5B3JA 2X0JA 4ZK2A 2PX8A 4TS1A 2CHUA 3SQDA 4M1QA 4PLZA 1M0EA 1NJ6A 1YNOA 2O2CA 1V16B 3QXGA 1NBMA 3GVHA 1ORRA 2GHTA 1F8GA 3ILYA 4MIYA 5CH8A 4RL6A 4TSFA 4EB0A 1NJ2A 1NRJB 2XCLA 3BS4A 1WY5A 4C07A 3FHOA 2VDOB 1Z8NA 2CYCA 5FTJA 3L84A 1H1LA 3S3TA 1UWCA 1XHEA 2G80A 1QGZA 4Q9NA 1OX5A 5ARDA 2GKGA 3AETA 4ZPJA 4IMIB 5EJIA 2UVDA 5I7FA 5GVRA 4AWBA 1KAEA 2Q3MA 3UMJA 5K9ZA 2RGRA 1WV1A 4ZRDA 1VOTA 3I5YA 4EG7A 3HXTA 4GC5A 5L3QB 2GXSA 1NXOA 2B7LA 1YRWA 2P4HX 4B6QA 3AR2A 4FMDF 1N6KA 4KMMA 2X42A 4R1LA 5EZQA 1BJKA 5AW5A 3UJAA 5K0FA 2FXIA 1N32B 2Q7OE 3IQWA 1YDMA 1XIVA 2C3OA 4NBTA 5DYGA 1OI4A 3SIXA 1GPLA 5LB4A 2BM8A 4YX9A 3OZIA 3ZGNA 1AO0A 1Z35A 3WNVA 4DYVA 4ZIRA 1DBIA 5LBIA 4IINA 2G83A 3BHMA 4G1BA 4QGHA 4RJTA 3MUOA 3AI2A 1NM5C 4IIUA 3GL9A 2A9VA 3ENKA 2BY4A 2QT9A 3ZWKA 1UBOS 3R44A 4MJ7A 2NGRA 3Q3VA 3EC7A 4F71A 2OZPA 3ADPA 3E9RA 4INAA 3GGCA 3LP8A 5FBZA 2AB0A 4QICA 4ITVA 3ZY4A 2ZS9A 5I9NA 3U3KA 3GCXA 4YJ2A 3Q3HA 5I51A 2QNIA 3ILXA 1AQIA 3B6EA 3HN7A 1P1FA 1IWPB 2WAAA 3RVOA 3LPNA 1XCGB 5ELMA 3PFFA 5TGDA 3QENA 5FL7A 1RD4A 2I4MA 2R8OA 5SZIA 4RY0A 4X93A 2QK4A 4FFBB 2AA3A 4EGSA 3JX9A 5LXTB 3ZJVA 2FR0A 2EW8A 4HDNA 3OX2A 2FR8A 4LE2A 1XZGA 2YJ4A 2C4HA 4FKZA 3T34A 1PS0A 4KGVA 1BH6A 3STXA 3WHPA 4DL9A 3DBIA 3UGTA 3OX4A 1DELA 5K20A 2Z5LA 3WGGA 5EEGA 2WQ7A 5CRIA 5HIIA 4BMYA 3G0CA 3CRMA 3TVYA 3UK7A 4DIDA 3CO5A 5LIRA 4Q9HA 4B7XA 1F4VA 1NATA 1UKYA 3MD9A 4KFRA 4OMDA 4IDPA 4ND8B 1JQDA 2HA6A 1GL7A 4CQMA 4WBNB 5JHGB 4QOIA 3SX2A 2YFHA 3T1TA 1Y4UA 4Q7KA 4UFPA 3RYIB 3L0ZA 2YXEA 3U9LA 3DGEC 1MIHA 3D8NA 3OZXA 3UW1A 4MS4A 4NQRA 5H4HA 4ALMA 3TZBA 3F4BA 4BMZA 3TQTA 2D13A 4X00A 1E2DA 2P2DA 3GIWA 4JDUA 1GTVA 2QM0A 4KAAA 1QR6A 1J0CA 3JARB 2P5TB 1NY5A 1NR1A 3OY2A 3ZV4A 3A9RA 5BW5A 5I9LA 2BEJA 4F72A 3W4KA 4GIBA 1ENZA 1GZ4A 2HRBA 3F6CA 5LDHA 2OM2A 1ZNWA 4C7JA 3K0SA 4WTOA 4P7KA 4U9IS 1FRFS 3IUSA 5F7JA 3OM9A 1TVKA 4Y2TA 1CDDA 2CJXA 5HFJA 4PV7A 3FJOA 1MOPA 2FPMA 1KGDA 1QIHA 2AG0A 2ON6A 4PONA 1N8SA 3QG5A 2IYNA 4Y9UA 4WUTA 1OZHA 1Y6ZA 3CZ4A 1WO8A 3GJ3A 1E2NA 3TZKA 1N5KA 1WXHA 4E5VA 4M0PA 4LRWA 3O2SB 2HNAA 3SJBA 5B1EA 1AB5A 5F2NA 1Q0PA 2NUTA 4PF1A 2Q3FA 4MTLA 4QE3A 3LLSA 1C2YA 3F6SA 2NUAB 4ETWA 2JGAA 1S9HA 1Z75A 3WISA 2F9MA 2XNDA 4K9MA 4P81A 3UT0A 4H3SA 4Z0HO 3WMRA 5DGCA 1NRWA 3AERB 3OCYA 4B40A 4GR4A 3P9ZA 1KY5A 1TK3A 2PMEA 3RR2A 3IAEA 1GYQA 5JSKA 5K5EA 3NWPA 1NBWB 4MWCA 5B2ZA 1QHNA 4M60A 3PIDA 3M4JA 3PD7A 2FUG1 5DTJA 4AY4A 1ZM3A 3HB5X 2FOIA 3U4IA 1T36B 1TQDA 3B6MA 3OKCA 4MVJM 2C9CA 3GFPA 2BCJQ 4P83A 5I5GA 3KE8A 1B1AA 1NBME 4PIPA 2H4FA 3V8RA 4DPLA 2QR3A 4JC5A 1Z4NA 4JI1B 5K8VA 4AO6A 3WA7A 2XOEA 4B6EA 3JVEA 3NHLA 2NU6A 3IKVA 3K3PA 4B6SA 1PUXA 1H1LB 2M9MA 2W71A 3I1YA 3W04A 4PAMA 4ND7A 3K72B 1P7WA 2O48X 2YZ7A 2Z3WA 1YMQA 4FGWA 2GTHA 4KAXA 1OGJA 2Y76A 1O54A 4KVZA 3X1YA 3DO6A 4Q3EA 1MX9A 2GEFA 1Z2DA 4B82A 3HXKA 2HLHA 1C9EA 1ODLA 1YDWA 2HHJA 3O4HA 3IOYA 3PLRA 4GI1A 4K7JA 1F0KA 3CGGA 4EG0A 1CQWA 3BJZA 3WB2A 2CHVA 1RLMA 1FMFA 4HVLA 4J7AA 2FZ5A 1A9SA 16PKA 1H2YA 2HB6A 2BBTA 2LDBA 2WJWA 2BM9A 3AZPA 4M98A 5DSTA 5LCXA 2YFQA 5I3CA 2VH1A 3GRVA 3KR0A 5LOVF 4W5RA 3EULA 4RNDB 3H8WA 3AY0A 2XODA 1T1RA 2BZGA 2CUZA 2I2WA 4GPIB 4KQEA 3VC3A 3UKOA 1PZXA 5JCJA 4G5XA 3ROGA 4HPXB 2E4VA 4L8LA 4E4YA 1J56A 1O3YA 2HUPA 2IDMA 5G4LA 1T2VA 5KU1A 4I6GA 1R4MB 3HYSA 4BNKA 2CHEA 3CO0S 4JT2A 1W19A 1Z5UA 4HUJA 4HWOA 1QGUB 2IITA 3IVCA 4XM0A 5SICE 3U3JA 3WO0A 1BEEA 1YWGO 3OUZA 5JC8A 5C3MA 4MYDA 4HLUA 3L40A 3EF3A 4QM6A 4DLBA 2FPUA 2WF6A 1ZOLA 3TQSA 1G2OA 2WUGA 3BB3A 1WVMA 3JYOA 4BV3A 1OAKA 2VP2A 3K7EA 3NHRA 3LQQA 4AMGA 4IIHA 4S0XA 3CUTA 5LMUB 1PFUA 5CYPA 1QKJA 4JV5B 3L0PA 1ISRA 3DCJA 1P31A 1RBZA 3HCWA 5G2OA 4RTJA 2DHEA 1I3MA 5ITZA 3KLNA 4JWTA 4DHEA 2ZR7A 3ZY6A 3ZIAA 2PIDA 1FFXB 4DPMA 2O8EA 1FVXA 3AJAA 3D6MA 4DREA 1I32A 2JLQA 3QJ5A 4MDHA 4CE6A 2C0CA 2XKJE 2E89A 1DG9A 4KYUA 2AXEA 4XWAA 2GXAA 1NVGA 1Y33E 2RAFA 4A10A 2WTEA 3R7DA 4MV4A 1R6DA 5GM2A 4CM9D 4F9TA 3GEMA 2DYKA 3IQDB 3KTFA 2M1XA 1N2JA 4CEJA 4RTKA 3DG9A 1V5WA 4JEUA 5HCIA 3FOCA 3DEYX 5ADWA 1DRVA 3CSSA 3P26A 3G2OA 4PYMA 4CCYA 3BRQA 3NETA 1RI2A 5A4IS 5A0FA 2I4NA 4KOEC 3KXDA 1DPFA 3I58A 4U1RA 5FTLA 4EPVA 1G9SA 2P2SA 3FCAA 4GWLA 1PGQA 1Z0KA 4I50F 4TKUA 4WCFC 1TJ5A 5FYDA 3ABSB 1VP3A 4JASB 3A6EA 2VDVE 1RLOA 1Z07A 2QI9F 4QBTA 1BE6A 1ND5A 1O97C 3VKFA 2PWZA 4W5JA 1FDIA 1KI1A 2JJ1D 1MEOA 1Y37A 2B4YA 3T9EA 4BJHB 3VTAA 1BG6A 1DXQA 2ZWIA 5EJ6A 2W6CX 1NOJA 2WVGA 4TRRA 1VKJA 2JRLA 2KYRA 3ELBA 4Q3CA 4RQTA 5B5SA 1EFPB 2C9BA 5CLHA 3FCEA 2HJGA 3HZRA 5FTNA 3SYNA 3EJWA 1NVAA 2OHVA 1XU9A 5IT0A 1NJ1A 1L7XA 3DAFA 1AE1A 4YUWA 4PZ9A 1F4LA 5I7VA 4JLNA 4L6AA 3DTVD 4LF4B 1Y3BE 2H4HA 1OWLA 5AXDA 1CEEA 5ED0A 1TXGA 4F4DA 1R0RE 1KYXA 1T3HA 4DWWA 2F1OA 4YXWD 4BMDA 4DCNA 1EGQA 2W2PA 1ZD4A 4P4TA 4EBBA 2IWHA 1A2QA 4K6FA 3ETGA 4X94A 1EFUA 4C1BA 1CZOA 3GJTA 4IZIA 4B45A 1GQSA 2CJWB 5IAJA 3UANA 3BTOA 3ZGVA 2AVDA 5CDFE 1NBHA 1ISIA 1KEEB 2PKEA 3QI2A 2RCNA 2G7MC 4ZJZA 3FCYA 1G20A 2YIJA 3RV4A 2X9NA 4JQCA 1KSFX 3OURA 2E48A 4DRXB 3QXHA 3IAFA 4B4VA 4Z2AA 1O5TA 2AH5A 2O9JA 3CG0A 5BMVA 4ZMRA 1XZCA 2B4AA 2QX8A 2ZTSA 1YJCA 3I09A 4CZ2A 2C88A 5BPHA 2C0QA 2WNSA 5BW6B 2BMDA 4A6PA 4PQEA 3WNZA 1VSBA 3GUVA 4BTEA 4ZCPA 5CFNA 1A5TA 2RGNA 3A26A 1TMGE 1I2DA 2IYRA 2OCLA 1DXHA 3M81A 3ELYA 2X8WA 3DV9A 2PUGA 1AXRA 4IH4A 3CEJA 2UZ1B 3KAQA 4YUZA 1OIVA 3FWPA 1IQPA 3ZQUA 1A69A 1FC0A 4BNJA 4FWTA 2AGVA 5HHTA 3IEXA 2Q1SA 4BCCA 4CL2A 621PA 3K9FC 4QWMA 4BMXA 4EDFA 2C58A 4YBRA 1CUCA 2H9AA 5BYBA 3VDXA 1KEEA 1LW6E 2VT7A 3HSSA 3VHQA 1F9EA 4YAJA 5AVYA 2XHZA 5HTOA 2WOOA 4B7AA 2FMXA 4OAPA 1SCKA 2ICAA 1KKLA 5FV4A 2WUVA 2EHDA 3I73A 5TNXA 3M4XA 3MXTA 1PJ4A 1Z8HA 4BLPA 4J9VA 2BFDA 2OV3A 3ZHRA 1WEKA 1QZZA 1R9GA 2VG8A 3I53A 3MTBA 3WLNA 4RS3A 2C77A 5JJKA 4F7DA 3GQBA 2QLTA 3PDIA 2HZBA 1FJGB 3PU6A 3UF0A 5C8VA 2O2GA 1SUIA 3QJGA 3Q2IA 2ZIGA 1FJXA 4UFOA 1CUJA 2PY6A 3E7FA 4TS4A 3GDHA 1FQKA 1G8SA 2IP2A 4JOBA 2AFHB 2XQVA 4MAMA 2GN2A 4KXQA 4M9RA 3CMMA 2VQFB 2HT1A 4OHPA 3I39X 4JJZA 4HWRA 3RHZA 3GRKA 2P9FA 3LGAA 4IOMA 3V8EA 3JWHA 4BDSA 3A4VA 3BB4A 2DWQA 3NMUF 5ECWA 3PX2A 1N6PA 1CUSA 5G4KB 1E2IA 1QP8A 2ZXFA 1JV2B 4FGJA 4CMBA 4M8IA 4EARA 4UNIA 1UEIA 3RVBA 4X41A 3SBOA 4KR7A 4UE6A 1A9YA 4YRNA 4OF4A 1W9HA 4IXMA 2C7PA 3ZZTA 1J9ZA 3ZPXA 4ER7A 2V58A 5ER6A 1KVUA 2B1RA 4QTXA 1WUHS 1CR0A 1IBCA 2VJCA 3DDCA 5LOVA 1SC6A 1VG1A 1G3QA 5IN5A 4TVKA 1E2PA 1EM8A 1PVDA 4IXWA 4J94A 4LZOA 4MTCA 1UPBA 4I1PA 1R16A 2XMQA 4DJJA 1QQBA 3FMPB 3T7DA 1W581 1CC1S 1P17A 4ND1A 2EW2A 4DT1A 1C81A 4L9WA 2AIRA 2DQ4A 2ODNA 5I8WA 4QBIA 5FF9A 4NMHA 2F3TA 1Z6TA 1GCOA 2CLHB 4HX5A 4IX9A 1Z2AA 3AB7A 1OLUB 3LT5A 1G64A 4GBGA 2CMGA 2HHHB 2TMGA 1CRWG 1UJCA 2OO5C 2WTUA 1USGA 1YJQA 2E82A 1YS1X 3EMBA 5FPHA 2Q5QA 4OHZA 4Q3KA 3WI7A 4D6XA 1BH2A 4NDAA 2QGFA 2E4XA 1N7JA 1C3JA 2DLDA 2VZEA 3TTYA 3KQOA 4N1AA 1RTTA 5K8JB 3AHJA 3DKRA 4RKRA 4BKMA 5JI3E 2XUAA 4X61A 3C1AA 3P9SA 2EFYA 4L2IB 3IILA 3EQ7A 2SKDA 1T9AA 4XQGA 1N6RA 2J9YB 4BQOA 3N70A 1LPPA 2NO4A 3IIJA 4IILA 4DQLA 4R83A 1Y98A 5K3SA 4OKNA 5I47A 3EIQA 3PC2A 1C8LA 2XKBA 1VCOA 3GNSA 1AGPA 1PSDA 1XCJA 2GXQA 2Y0EA 1XAHA 1WL8A 3R5JA 2PCLA 3MMPA 4ZVRA 5ALFA 5E6SB 2Q4OA 3TTUA 1HXHA 3BJEA 5DIZA 3NBZC 2BAGA 3QWIA 4Q01A 1TTTA 3DUFA 2PGXA 2QL6A 1AQNA 3TRIA 3DW1X 3LVFO 1UOOA 4PVCA 3VR5H 4DV0B 3V1UA 1QHHB 2O3RA 1XP8A 2ZVQX 4I2NA 3VSBA 1U7OA 1W0CA 2ZKLA 1T26A 4XEHA 1YIDA 3CKLA 2OXTA 3V8PA 6PFKA 4FOPA 2G1KA 4PO8A 4REQB 1IMJA 2E4YA 4MKRA 3Q15C 5HRUA 3DDZX 1KE2A 2OK8A 5A3SA 5JXWA 2V6IA 2AFIB 2EZUA 3THWB 3FDZA 2XD4A 4R31A 4EJ0A 2ZE8A 4NZ9A 2UZ1A 4UQOA 4F6RB 1A9TA 1CB0A 1YVRA 1RQNA 2FI1A 2NTYC 2GOYA 2PL9A 4PGHA 1NUTA 4JLWA 4B7UA 2ATVA 3SHFA 4F1KA 3GN1A 4EL5A 5BVGA 3LNCA 3R7WB 3S81A 4K1LA 4Z7JA 1YAJA 4YMWA 3ICQB 1O95C 4ZANA 3THWA 4RVNA 1DJNA 1JGTA 1N6OA 2ZTMA 3OHSX 2AG8A 4ZQIA 2ZU0C 5HIMA 3L7KA 4H3VA 3G88A 1TTHA 3NPMA 4Q3OA 5KNCA 1EB9A 3QE0A 4CT0A 2WMOB 1WUIS 4AO7A 5K0BA 2EJUA 3PC8C 4P2BA 3WKDA 4NOLA 1JAXA 2HSDA 2IYPA 3N7AA 1E62A 3PITA 4LBWA 1FPQA 2H7CA 2P6NA 3PNYA 4W1SA 5TEVA 4HNTA 1XRPA 4G09A 4RPKA 2VKTA 1OFUX 4YP7A 4QO7A 2C2BA 2P2GA 1LQUA 3BB1A 3F6RA 3K0FA 2Y1GA 4UKDA 4MRRA 4YAOA 4BQQA 2O14A 3DBHA 3T0FA 4AUNA 1NNUA 1TF7A 1YQTA 3F67A 1MC8A 4JVLA 4NENB 4Y6RA 4KKVA 3ND6A 2VDKB 3AHDA 2EWVA 2JASA 1RJDA 1NUPA 2H0AA 3IAAA 4OGWA 1I14A 3T8YA 3V1NA 4ENQA 5LJIA 2Z2YA 4LYHA 4X62B 3CQ9A 3EVZA 3Q7SA 4RF2A 1ACJA 4H1VA 5K4AA 3R8CA 1IEVA 2QLNA 3DW3X 2J46A 1AK2A 5TS2A 4KHPB 3I12A 3PLAE 1JN0A 2R7AA 2XUFA 3QUBA 3DD5A 5EP4A 4E5DA 5IRCD 4L5JA 5L53A 2RDMA 3LF1A 3KSBC 3KE9A 3RU7A 3RS2A 2M98A 1XFDA 2C3YA 2PRSA 4I3GA 3RUHA 4C0HA 2ZB3A 5BWLA 1V9SA 5I5EA 5CEEA 3DKVA 4D4LA 1ORIA 5BN4A 1SOUA 1TA0A 4MDYA 3T9AA 2C9MA 2WNHA 3L7IA 3LW8A 5GZ6A 2ODBA 4UOZA 5FA5A 3MT7A 4LHVA 2VA9A 2UYGA 4WZ6A 1DTSA 3C8ZA 1YGPA 3UJHA 2VJBA 4IGAA 3DDOA 4FJ1A 5HQ3B 1GT91 4HNSA 4PHTA 5DYWA 3OEEA 5K0TA 2OAP1 5DX0A 4YRZA 3H3JA 1T3SA 3E81A 5CX1A 3QBVA 3TQHA 2JBAA 2C98A 2ZIVB 3E82A 3FZGA 3LVRE 3I9LA 4XUDA 5FA6A 5ITWA 2W98A 5K2OA 2P1ZA 1MO6A 2FSSA 4MA5A 1ZMBA 1T5LA 2LR0A 1I4EB 5GONF 2GNAA 3KOWA 5G41A 1KEUA 1JDSA 4LI3X 3VDNB 2IYOA 3QEMB 3QVGA 1W30A 5B1IA 3EASA 1TK2A 2V7EA 4P0TA 3RIEA 4C0XA 1VKHA 4EO4A 7REQA 3BCUA 2VH5R 2JVKA 1EK5A 2XIQA 4UNNA 2DQSA 5IKXA 1CZLA 1R6UA 1HDGO 2ECOA 2WYWA 3UHFA 4B43A 2G5GX 2RAPA 2ZUCA 3ZLTA 4US0R 4EZIA 3ZDFA 4ARAA 2YVQA 3HACA 5AK3A 4K9LA 3LLMA 4Z53A 5IAKA 4MUFA 3WWPA 5A6VA 4LXHA 5TQ0B 3GFRA 4XI9A 4KGDA 1NAHA 2C95A 2O8DA 3PC7A 1WM1A 3DQPA 1ZJ6A 4PG4A 4HN4B 4CN9A 1H0SA 4PQYA 4A0SA 1FSSA 2NSLA 2V7QA 4YFYA 1T9KA 3LPAA 4HGRA 1W4BA 3VR4H 3V8QA 3ZY2A 1TRKA 2H2AA 1C7RA 3DZJA 4ZJPA 1ODKA 4O1IA 3GG9A 5CM9C 3COWA 5FFMA 5EJEA 4YVFA 3T7CA 2KLHA 1K08A 2A8YA 2FSHA 3AIOA 3KL2A 2FCRA 1XA0A 2QE6A 3GUYA 2PSHA 4MULA 1GPUA 3HFRA 4LQ4A 3WL3A 3H5NA 3CPHA 3ZV3A 4ER6A 2GZHA 3OCJA 3VISA 1F0YA 1THZA 3RT7A 2OORC 3P19A 1PZFA 4JROA 3IL2A 4G0QA 2H00A 3OQIA 3SZGA 5LMZA 3Q2OA 3ELUA 3WRYA 4YP5A 1RRFA 1TM5E 3SJCA 1FYXA 3FLAA 2DXIA 2V3VA 3EPPA 5JAPA 1FUYB 2QD1A 4YRJA 5JAUA 1VLHA 4DXAA 2AD5A 4IIFA 5JJBA 1JTEA 2HHLA 3W9UA 2CLSA 2R6DA 5B2FA 3K5HA 4QJ4A 3P5SA 4KEAA 1AMUA 2C1XA 4RL4A 2O7SA 3MT8A 4FVTA 1V6SA 1RLUA 3GBSA 3RC3A 5H9WA 1ENPA 3UT5A 2J9ZB 4FN5A 3RUFA 2W11A 4KLZA 4BLWA 1R9NA 4DLSA 4OD0A 1C3OB 5GIPE 1YFZA 2JIZA 2PPLA 4JKYA 1U6IA 1P18A 1PSZA 3D7RA 3GFSA 5BWMA 2B2XA 2VFAA 4KUGA 3KB2A 1ZW1A 4GMDA 2Z98A 4LKRA 1NQAO 2N3ZA 3QMVA 2MMGA 4WAUA 4DDUA 4J0HA 1NPTO 4LN1A 1W2HA 1PS8A 3CB2A 4RYDA 3WIDA 4G1CA 4YIKA 1O58A 1LSJA 2NPFA 3U2QA 1XPJA 3SLGA 3WMFA 2IXGA 3PWSA 4JI6B 4A2WA 4G0OA 4X8HA 4YY3B 1SR8A 3H99A 2XAUA 3BIOA 1HQYE 2ADOA 1WBJB 2VAVA 4FILA 1VXRA 4BBZA 1M5RA 1P7VA 4C0KA 1Q7TA 1YJ8A 1MR3F 3X1WA 5AI6A 1RYEA 3AY3A 5KX5B 5EIBC 4O2AF 1H05A 1NXPA 4WNIA 4WK2B 2Q6VA 1QTRA 2JGJA 2EKLA 1GFZA 4NG4A 5FJJA 3SZUA 4DIBA 4RZHA 2OV4A 1PDWA 4JYZA 2VRCD 3ASZA 3TIIA 1M1NA 1UZUA 2VTDA 3OZ7A 2FK7A 1W87A 3U61B 1AQYA 1OTHA 4FJ0A 4JJAA 5AKGA 5EHXA 5M7EA 4D25A 1P5FA 2PD3A 1CJSA 4A8JA 1KZGB 1YC5A 1ZUWA 2NV6A 2OECA 2WP8J 3THSA 3KOUA 1W2WB 4AUKA 4R9UC 1PBTA 2P1RA 2XB4A 1NT4A 4PZAA 1P6UA 4DQ0A 1HGXA 1R5OA 2XE6A 5AJUA 4XASA 5JCZA 4DTIA 4BFSA 5ES4B 3AF4A 1O08A 4RLSA 3UJ7A 5DM1A 1I1QB 2NZ8A 4J2HA 5KOJB 4LBZA 7MHTA 1BROA 4NHOA 3O8CA 3SYTA 3HR8A 3AU8A 4Y6PA 1RQGA 4X6LA 1P4JA 3VX4A 4F85A 4RTQA 5AKYA 1JJAA 1JIQA 1YBMA 4AJJA 5ABPA 4JUBA 2IW3A 1UP7A 1BA3A 3RU9A 5JCOA 1QCZA 4V0NA 3VC2A 4E5SA 1ZFNA 1FNSA 1O96B 1XLTC 2PFSA 3I92A 4L6IA 5CLIA 1OH5A 4HHEA 4OI1A 4JODA 2DUMA 2ZULA 3UJ9A 3ZDZB 4J0CA 4TXJA 3WFIA 2R44A 4Q00A 2FSFA 1G8HA 3H2JA 4GE3A 1NF9A 3FWYA 3RIGA 7YASA 2QRGA 3O8NA 4PBTA 4B3DA 1K8QA 1ODIA 2I7VA 3JZMA 1HO3A 4ZT3A 3QVXA 4BV2A 3OQMA 3ADBA 3I3SR 1BE1A 1XE3A 1R4AA 2WSYB 3AVOA 1Y1PA 2XZDA 3OZRA 1NN5A 4C0JA 3UMYA 1TU4A 2GYUA 4NOMA 3B12A 3PJRA 1IQ0A 3GEBA 4CTMA 3D31A 4DDMA 3WFZA 1TIBA 3KFLA 2GM4A 3J7TA 1E69A 1Z6ZA 5JD3A 3RNLA 3F6EX 1R4MA 4ZODA 2VDWA 3H5TA 4F1JA 2EEZA 5FCDA 4XARA 3A2KA 3X43A 1ZW6A 4X3OA 3S5JA 3JQQA 4FCVA 4E2ZA 1XYGA 1O7JA 4K9QA 1YVUA 2YOHA 3FCSB 3GAFA 1OYVA 1TVEA 3R6LA 4JVSB 4NFSA 4Y6SA 3TB6A 3TLGB 4RWZA 2ZI6A 5BWCA 1ZG3A 3A4IA 3BMXA 4U2DA 1AO3A 4J0EA 5J5AA 4ZVVA 1KDYA 3SF8A 4DFDA 5I7HA 2GZ2A 2AEEA 1SMKA 3PC6A 3DOEA 1WP9A 1JIXA 2Z1MA 3KHTA 1U2GC 3W79A 1MB2A 3QMMA 3BE5A 2Z2IA 3QKSA 4LOKA 1BN6A 2DPYA 1P7YA 1WMDA 2NZWA 1BKSB 2P27A 1TW2A 3EQ2A 4F5YA 4CG1A 4RQUA 1O6ZA 1U8XX 2BONA 1B2LA 3CJQA 1H94A 3BD9A 3MWGA 5LMNB 4AJPA 1USVA 4I4TF 2ZT5A 4L27A 3FIJA 3I5MA 1SBYA 4BBAA 5JTUA 3QEJA 2IGBA 4P7FA 5FB3A 1JHDA 2M6KA 2JHCA 2NPIA 4LKOA 3WK9A 5ADHA 3C3BA 5JATA 3RRZA 3LJKA 3G8CA 5CYOA 3RSLA 5IHXA 2XWJI 3ZJ5A 1LDEA 2PIAA 1XMOB 4TUYF 1OAOC 1OZGA 3JQGA 4GLBA 4P35A 4R3WA 5E4JA 3JYLA 1MXFA 1IXZA 1RXIA 1L1FA 4F8EA 1WKVA 4JQOA 4Z51A 2P6RA 4YJGA 3D7SA 4M9SA 4R68A 2YH2A 4G1UC 2CVQA 2QPLA 2OGSA 3OWXA 4G0ZA 4X45A 4K5QA 3V1KA 1KQ3A 1W5EA 2R87A 5B57C 3RTAA 1ML3A 1T2NA 3KJNA 1NY6A 2P40A 5CLGA 2PHZA 3AVVA 1QC5B 1MU0A 1RMQA 3VNQA 2CC2A 2Q8NA 5LA6F 4CF5A 3J80A 3KT3A 2LP4Y 4JJEA 4X44A 3UHAA 5IVPA 4D0GA 2BKEA 2G04A 4MUAA 4XB2A 4LISA 4RF3A 1NZFA 4I19A 3ZCUA 4BVJA 2XHEA 3BCRA 2YHUA 2VT2A 1X1RA 1XZ8A 5T4BA 3TUZC 2Z09A 4P38A 4XUCA 1VLQA 4L50A 1U3WA 4DILA 1NL3A 4DLRA 3EEYA 3DMYA 4OUKX 5T8KC 4RTSA 1QK5A 1M5TA 2F8LA 2FXVA 3FVWA 1Z06A 3SEFA 2R1TB 2CLDX 1RJGA 3BILA 3Q3CA 4US1R 1DQNA 4WKOA 2JEYA 5AI8A 4YAIA 3B3FA 1NP7A 2PRYA 2V9PA 3NV9A 4FT2A 3E9YA 2IEIA 3AYZB 4D96A 4DLXA 5DV9A 2GM5A 4CIXA 4E2YA 2QPTA 3FDIA 4EKIA 1H0HA 4D4MA 2V4MA 4LY0A 2CNLA 5BVHA 2CNBA 3C6XA 1SU6A 3IQGX 4RJJA 5KNLA 2WWTA 2FOLA 3IV9A 3O82A 5E4TA 1UC5B 5FOSA 3T3PB 5JV5A 5F1KA 1V8FA 3MB8A 1NR7A 3C7CB 5KNBH 2FN7A 4CNBA 5UKDA 2QJFA 3TQCA 3OIVA 1IZZA 1P3DA 1RADA 2OILA 2Q27A 1K6XA 4PCAA 1VJDA 3M6AA 1CR6A 1XTZA 5FTWA 3PC4A 4RGBA 5K3AA 3STTA 1O0BA 1ZAYA 5FULA 1RXWA 3F3KA 3IR6A 1QBKC 3QLTA 4IFTA 4ZOBA 4AYXA 1WXIA 3OTQA 1TEHA 1ZGHA 1UUFA 4E07A 5JQGA 3OZEA 2J9XB 2Y1KA 5EE1A 4EK9A 4UDXX 2GXUA 4PLGA 1VA4A 4DNPA 3CPEA 1SOWA 3KT8A 1PQUA 1S7CA 2JS7A 2VEDA 1T4CB 2PXHA 3FFAA 3NC1C 2J30A 4M1EA 1R6TA 1UT8A 4BYMA 1C8KA 2IEGA 1G8JA 1UJMA 3BKXA 3C7DB 3EDCA 5JR3A 2XRMA 2XJ4A 2PX3A 3SMQA 3KQMA 4OYRA 3B9PA 1MC1A 2PL5A 3IOBA 3HB4X 4GM4A 1ZA2A 5F51A 4Z4IA 5JT1A 2CUTA 1HEIA 4D0RA 4GL2A 3F71A 1YMUA 4CNQA 1C1HA 4NFYA 4PLFA 1Q5PA 2B30A 4MS1A 3NBAA 4NYIR 5ALSA 4ZEXA 3OFKA 1V6CA 4BP9A 3P32A 4ZI2A 1R0SA 1JA0A 4F46A 4DG8A 1Q19A 1PT7A 1H2WA 2AN9A 1FF9A 13PKA 1IZ7A 2Q50A 2VATA 2OBNA 2ZRAA 4H1HA 3IGFA 1C3EA 1G5RA 1M2FA 2PKRA 3L7LA 1U5BA 3F3MA 3QWBA 4IO0A 5AI5A 4RVDA 4CN8A 4J0DA 2B36A 5AH0A 4N8SA 2X4DA 5AR1A 2WU4A 4POAA 3MSXA 4C01A 3ZK7A 4I3FA 1OX4A 3LS2A 4G84A 2ILTA 2ORWA 4C6TB 1JLLB 3FRHA 2BKLA 3ENWA 4RIEA 3TFWA 1USKA 1XNGA 4M1WA 2F2TA 4RELA 1OY1A 2OGTA 3ELWA 3GLVA 4UUNA 5DNAA 2CB0A 2V9CA 3ENZA 3OA2A 1E5VA 2CFRA 4LTDA 4ND6A 4U2BA 1VIAA 3HWSA 2LIVA 5EY5B 3HXLA 3FFXA 3HYRA 1GPJA 1EWRA 4ZVLA 1J21A 1DAKA 3E1KA 3RDPA 4ADSG 2WYIA 3ACDA 1L3BA 1ZVJA 3QE4A 3T5DA 5CFOA 3CIFA 1UMCB 4QO8A 3U7GA 2O54A 4GYKA 3EZNA 5JADA 1D6SA 3P0EA 4K03A 3AR9A 1IAVA 4TRMA 3OQVA 3CRVA 1TAQA 1EG2A 1PGNA 4ZHQB 2CCKA 4LDZA 4N6NA 3E03A 3HI4A 5D8DA 3O4FA 1D4FA 3B6ZA 3H75A 1IUNA 1QK3A 3PNBA 3I52A 4BJ5A 2BEWB 4HDRB 4RS4A 2DCUA 2AF3C 5JALA 2ZUFA 3COSA 5IJXA