2Q1UA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ and udp
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
350
structure length
336
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSGKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 127
structure length 336
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1uA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1uA02
3ADPA 3AOEC 1EUZA 4F3YA 4RQTA 3M6IA 5DCUA 1A71A 4P4LA 2WD7A 4IIVA 4B3JA 1LDGA 4UVGA 4HWKA 5U9CA 2QX7A 3ZNOA 3E9NA 3PYXA 1SB9A 2EGHA 2ZATA 4Z0TA 5K6AC 1EK5A 3PFFA 1PS9A 4FN4A 1M66A 4JJFA 4HNHA 4OXKA 3UHAA 5FYDA 4ALMA 3JYOA 1LDEA 3DHYA 3IP3A 1HWYA 3KZVA 3TRIA 2UUOA 5THKA 1U8FO 3R0IA 1ZSNA 3OM9A 3V1TC 1PX0A 1QV6A 3FSRA 1WLYA 4A73A 2VT3A 2NQTA 2W98A 2ZJ1A 3DBHA 1R0SA 2VRCA 3OH8A 3QRWA 2I3GA 4LRSB 1V3TA 1BW9A 4UREA 4BIIA 1H6DA 1DIBA 3GF4A 3KXDA 5I9NA 3AWDA 1TVEA 1DO8A 4NU5A 1MP0A 5GMOA 4YJHA 4WCDA 5JO9A 5CG1A 4A26A 1IPFA 1R4MB 3L6DA 4YACA 2NVUB 1V3UA 2NU9A 3RSHA 3WGGA 4D44A 1WZIA 2CMDA 4TKMA 1YKFA 3CZRA 3MCVA 4FJ1A 7ADHA 2IYPA 2ZB3A 4XIJA 3I9LA 4TRJA 2O3TA 3CSDA 4J9VA 2Q45A 1GEEA 4XJTA 5G4KA 2YQ5A 4BNXA 3FBGA 1SEVA 2JJYA 4AICA 1H5QA 1P1JA 3TWOA 5JDCC 4BO4A 3H5NA 4LSMA 1R12A 1DAOA 1O9BA 3O4RA 5CEJA 1F12A 3U62A 1MC5A 4H3VA 2OOSA 4FD3A 3PIIA 1P0FA 4TMFA 5DULA 2NLOA 4UUPA 1EQUA 4L76A 2EXXA 4CLRA 1AE1A 4DYDA 2OO5A 1U3VA 1I01A 2EP7A 4MKRA 1HLDA 1GUFA 2Q2QA 4WEOA 2OMEA 4M87A 3VAZA 4TVOA 3HB5X 5A04A 2B4RO 4ZQEA 3TZCA 1DFIA 4PG5A 1PJ3A 5A9SB 1SMKA 2AEJA 1LI4A 5L4NA 3WB9A 5BQFA 2Q49A 3OIGA 2Z5LA 3RUFA 1QKIA 2VTEA 2VCYA 4IPTA 1GPJA 3AFNA 2B83A 1ADFA 1MA0A 3WICA 1ENOA 1F17A 2CD9A 4L0QA 4UVHA 5JCJD 1DOHA 4CMGA 5IZ4A 2C7GA 1JU9A 2DBZA 1E3IA 5C37A 3RVDA 2VUTA 3W8FA 1ENYA 1FXSA 1IOLA 2DVMA 3Q11A 4TRNA 1IHYA 3NTOA 1EFKA 3RBVA 4BGUA 3FI9A 4ND5A 4NHEA 1D8AA 3P5SA 1Z74A 3F3SA 3UGKA 1XG5A 3JQBC 3ZNNA 3DBHB 2ZQZA 1YE3A 9LDBA 4L75A 3ZN2A 3IJRA 1HKUA 3PP8A 1CF2O 3ZU5A 2W2KB 2Y1OA 3E6AA 2LDXA 1UAYA 1H9AA 1Z6ZA 4XQCA 4R01A 3QP9A 2CZCA 1ISFA 1N2SA 4CMEC 2BH9A 2C82A 3F4BA 2QYSA 1RYEA 3ZU2A 3VZQA 3COSA 1N5DA 3CINA 1UDBA 1NVGA 2EKPA 3JQBA 4II3A 4MIEA 4WECA 5ER6A 1WWKA 1IULA 3GVPA 3WJAA 3ULKA 3UF0A 3HG7A 4YT2A 1MC4A 2E82A 5TGDA 3ZWAA 3AU9A 1VSUA 1XWFA 4LVCA 1I3LA 4J90A 1UJMA 4J1QA 4XGIA 1ZK0A 2D59A 1YDWA 2HMSA 3PEFA 2PA3A 2Z95A 3LF1A 3TQHA 4ALJA 1ZMTA 3SJ7A 5AXCA 3Q9NA 2VTDA 2PV7A 1MXHA 1GD1O 2X22A 5T6BA 3PYMA 3OA0A 2JD0A 1ADGA 3VH2A 2RAFA 4OIMA 4YAGA 4XYLA 3CE6A 2VZ0A 3OF2A 3PJGA 4E12A 1P1HA 2PZMA 2Q46A 3FNFA 3BHMA 1C0PA 3HDYA 3MJVA 1R16A 1NFFA 4BMNA 4CQMB 4NNJA 3INGA 1K89A 4PN3A 2DBRA 1KVQA 1VC2A 2O7SA 2GNAA 4G2NA 3WDSA 4D79A 5JO0A 2I3AA 3GDGA 4DPLA 3CXRA 3ETEA 1AXGA 3GMDA 1T4DA 5JXWA 2JHGA 1U1IA 1JVBA 1JQBA 1GUYA 1P3DA 3KSZO 4ND3A 4OH1A 1PS0A 2YJZA 5JY6A 2HMVA 3GVHA 3DOJA 3R3SA 5L53A 4YXFA 5T57A 3PTZA 4YJFB 3SC4A 1P1IA 3OQBA 1ADBA 2VWQA 2XXJA 2CDCA 4FIZA 4NJMA 3GUCA 1JN0A 4GH5A 1U28A 3GVCA 1NPDA 3RFVA 3GEGA 1TLTA 2HK9A 1NHWA 3EMKA 3INTA 3PWSA 2GN4A 4Z9YA 4M1QA 3AUSA 2BI8A 2B4QA 2FPIA 2ZCUA 4IS3A 2OFPA 1MXFA 1YB4A 2I5PO 8ADHA 4OM8A 3RFTA 5IAAA 4CQMD 4ZHSA 2VWPA 3Q6IA 5A5FA 4RDIA 3WGYA 2H9IA 4PG8A 3ZU3A 2OORA 4WJZA 3O8QB 3HDJA 1KC1A 1DC4A 4GLLA 3UCXA 3P7MA 4Q3CA 3EVNA 5L51A 3OQ1A 3ZWWA 3TJRA 1DHTA 4YT4A 1DFHA 1YO6A 3EW7A 1FJHA 1GADO 3U3XA 4N5MA 1B8VA 5HS6A 5G4LA 2NSDA 2J3KA 3QWFA 2RHCA 1IE3A 4PCVA 2HMTA 5EIOA 1ENZA 4YQZA 3NGLA 4CM5A 3GFGA 3LSYA 2AA3A 2VNAA 1UZLA 2FPGA 3FR7A 3JYPA 4Q3AA 4CM9D 1ZO8A 4YEDA 1O5IA 1WDKA 3NTQA 5AXDA 1BXGA 1JVSA 4L4SA 3WGOA 4YR9A 2LDBA 1PZFA 4J3FA 2CFCA 2AEMA 1XCBA 2HDHA 1Q7GA 5L4SA 1CQJA 1XQ6A 3FF4A 4HV4A 2UV8A 1ARZA 3IS3A 3KOUA 3CMMA 5KVQA 1GQQA 4KDEA 4XR9A 1T2AA 3K30A 3TZHA 1KOLA 1R0LA 2RCYA 1QYWA 2OP0A 2ZB4A 5DOVA 4JCOA 3RJ5A 2DC1A 3DONA 2V7PA 3I5MA 4NJMB 1GUZA 4A03A 1QXSA 2GGSA 2PZLA 3DXFA 4W9NA 3ROKA 3UCFA 1LSUA 1ZEMA 4MP3A 4XWYA 4P8RA 4GX0A 2X6TA 4UEJA 2O4CA 1XLTA 3DTYA 3VHRA 1JWBB 4DQXA 1NTOA 1U5CA 3A4VA 1DJNA 2IZ1A 1U4SA 4EUHA 5JS6A 3DOOA 2YY7A 2O23A 4IM7A 4A2CA 2X9NA 3GY0A 4L4RA 4CUZA 3BXXA 3AFMA 1LLQA 2NU7A 2O50A 1NR7A 1I30A 4ZQGA 3C1TA 3ZWMA 2ZTMA 2HCTA 5JPIA 4FC7A 3E8XA 2C29D 1C0IA 1ISMA 1HRDA 4CMBA 1X7GA 3BMNA 4IDAA 5L4LA 4I08A 4XB2A 3EZLA 2DBQA 1E1LA 3VDQA 1O0SA 3INRA 2QHXA 3OIFA 1QYCA 3PHHA 5I7SA 4I9NA 5EESA 2X9GA 1XEAA 1Z7BA 3OSUA 4EDFA 2VHYA 1DPGA 3K31A 4R3NA 3O38A 1NQAO 3BTUA 3VPGA 1T26A 2NACA 1KETA 1T2CA 3FWZA 3HHPA 4CMIB 1FK8A 3QVSA 3S2GA 1RM0A 5T5QA 2VN8A 3AM5A 1DLJA 4FBGA 1J5PA 1PJ4A 2J5RA 4GBJA 3RIHA 4XQ9A 4AG3A 5BNIA 4AJLA 4B4UA 2JL1A 1VKOA 2FSVA 4GL4A 1LSJA 5GZ3A 3WLEA 4Q9NA 4J43A 2J6IA 4BKQA 1I8TA 3W8EA 4J2OA 4DLAA 4E13A 4OXNA 3DMYA 4KUGA 3WBBA 2BMAA 1XHLA 4LW8A 3SXPA 3I9NA 2Y1FA 1JKJA 3BMNB 3TZQA 1UZMA 2HLPA 4UEOA 4YPOA 1PL6A 3NUGA 4U7WA 3S2FA 4NMHA 4U8GA 4UAGA 2BI7A 2P4QA 4BNGA 5GZ6A 1EZ4A 1YQXA 4MDHA 2BFOA 1X1EA 1XU9A 4MVJF 1SEPA 1YDEA 1P0CA 1Y5MA 2ZQYA 5H82A 4BGVA 1E5LA 3GT0A 1YWGO 4N5LA 3G1TA 3LU1A 4XEHA 3U5TA 2X9VA 4IDGA 3L6OO 2Y0EA 3MJTA 1UDCA 2QW8A 1JWAB 1PL7A 1N92A 1NVMB 1HE3A 1R66A 4JP3A 4WUVA 2ET6A 2Q2VA 3CIFA 3JQGA 3KYDA 3TPCA 1NFRA 4ALKA 3SBOA 4FFPA 4IXTA 2JD1A 5T64A 4IJKA 5EQFA 4CV1A 1PIWA 1ONPA 4XYBA 1OBFO 3PLNA 4JIGA 4ZQHA 3KV3O 3WFIA 5JFOA 4E5MA 3DAPA 3NT2A 4TZTA 5AYVA 3QVTA 2HKIA 4MVJH 1I2CA 2YW9A 5L9AA 1N7GA 3LLSA 4ALNA 4E5YA 2HMWA 5A9SA 1X14A 4RLSA 1UXIA 3ZW9A 4Z9XA 4DRYA 1RM5A 2PFGA 1I3KA 3M2TA 1Y7TA 3RU7A 3DL2A 1VJ1A 4CM7A 3TFOA 1YBAA 5HM8A 1LU9A 4AJOA 2Y05A 4JGBA 5T8KA 1GPDG 4MIOA 3ZHBA 4JLWA 4WKGA 4Y8VA 3VH1A 4Y6PA 3WJ7A 4O6VA 4CLRB 3C7DB 3PK0A 3PFWO 3D4NA 4CM8B 1A7KA 5K9ZA 3OP4A 4BS9A 5BSFA 1MGOA 1FDSA 2GZ3A 4K9DA 1HSZA 3GAFA 2PD6A 5CDUA 1H2BA 2V6MA 1YBMA 3DMTA 3JQAD 3MZ0A 2WMDA 1PJCA 3JD4A 3L9WA 2VNSA 2EGGA 1I0ZA 3FD8A 1T4BA 4P4GA 4PLCA 3Q9UA 5IF3A 3PHGA 4UUMA 8LDHA 3PZRA 4J1NA 1T24A 2YFHA 2PK3A 3B1JA 2FOIA 4QSMA 1FDTA 1J4AA 4B4WA 2PGDA 1ZCJA 1E7WA 3QJ5A 2CY0A 3UXYA 4CM1A 3ZV4A 1LXCA 1WP4A 4CM4A 4QO7A 5IN5A 4D0RA 3LF2A 2IXBA 4KP7A 1PWZA 3TF5A 1H9BA 2R2GA 4ZD6A 2RH8A 4ALLA 3FPCA 2X58A 2AHRA 4HADA 2FWMX 4Y9DA 1W0CA 3WIDA 5CDTA 4HXYA 1BWSA 1ZXLA 1YRLA 4YJFA 3RI3A 5FF9A 3ZWYA 1Y6JA 2RHRA 1V35A 1DJQA 4IDBA 9LDTA 3A28A 4IBOA 4D43A 2GCGA 2E37A 4S1VA 4DL9A 2NNLD 2AXQA 1KVUA 3KVOA 1PJBA 1OC2A 1R4NB 5JAQA 2X7HA 2QRJA 3BHJA 1ISHA 4KUHA 3HB4X 2QQ5A 5HTOA 1QYDA 4CLHA 4RV9A 3C7AA 4EUEA 3U09A 4H16A 1YL6A 1C0LA 1G0OA 4HUJA 4OJNA 5JCJA 4EGFA 1LUAA 1ZK4A 3H9EO 1IZ0A 1F14A 1GZ6A 4RVGA 4BOYA 4P22A 1YB5A 1PJTA 5COAA 3FCOA 3H6KA 2IYOA 2P5UA 4MO2A 4PG4A 2EWMA 3D4OA 4JN6B 2CVQA 2X0IA 5KJEA 2WYWA 4WLFA 1T2EA 2VOJA 3GN1A 2W2LD 2VUSA 3MJEA 4WNIA 2NVBA 4XA8A 1YS4A 5IFLA 2JHFA 3V1UA 4XX0A 2FP4A 3RKRA 3PI7A 4DBVO 3IJPA 4CUKA 4MJLA 3A1NA 4HFRA 1BSVA 1PSDA 2BGKA 1EQ2A 1LQTA 4K6CA 4BV9A 2P2SA 4I9HA 1C14A 3G79A 3BMCB 3MEQA 3C1AA 1ISJA 4B7UA 2A92A 4OXYA 4RPGA 2DAPA 1EVYA 1B16A 1SB8A 3ZWVA 3MOGA 4DWVA 4FFNA 1H0KA 3H9GA 4UVDA 4CMKA 4B7XA 1VL8A 3HZZA 1KIFA 5CDYA 2BLLA 1QMGA 5I8WA 1WW8A 3LT4A 3QLJA 4IIUA 4MP6A 5I9LA 6ADHA 3TDKA 4DLBA 1UP7A 2WE8A 1HDZA 4MIYA 4BNVA 3ONEA 3WFJA 1WDLA 3I1JA 1XSEA 5DDIP 4C7JA 3GHYA 5EPOA 4C7KA 4BNLA 3IDSA 5BSHA 3JQGB 1BXKA 3GAZA 3HFGA 3CKYA 4OKNA 1RJWA 1DC6A 1B14A 2B0JA 2Y0DA 1HE5A 1HDYA 3FRJA 3HJAA 4F6CA 4U0JA 1TT7A 5DCWA 4ZRMA 1HTBA 5KNLA 3C1OA 3W1VA 2BHLA 2QRKA 3JYNA 2WSBA 4RPHA 5TJ9A 1KBZA 2X0RA 3PJDA 3JQAA 4Q3EA 3IQDB 4YRDA 3Q3CA 5JDCA 5DBGA 1X7HA 4E3ZA 5TC4A 2O3QA 1ZK1A 4PLWA 3H8VA 3RQSA 3WWYA 5FEUA 3RBZA 2D1YA 4EJMA 1ZH8A 4KWHA 4D7AA 4LSWA 2BELA 3ZNQA 5TX7A 3VPXA 1D1TA 4GVXA 2IDZA 3I3OA 5IXYA 4WCFA 2NTJA 1ONOA 3E18A 2XOXA 4CR7A 2FZEA 2YDYA 1ZJYA 4KUEA 1ZK2A 3VZPA 1Y8QA 2X0NA 3C3XA 2OP1A 3PXXA 4AJ1A 4W82A 4B79A 1U2GA 4NBWA 1PEDA 2Y66A 1SAYA 4HNGA 4JJIA 2G76A 3ONDA 3GH3A 3UFXA 4I5EA 1E3LA 4YCAA 4FDAA 1YGYA 4BV8A 2P4HX 3VVBA 1F06A 1Y9EA 4J4TA 1CWUA 2R00A 4BNFA 4GKBA 1Z75A 4YRBA 2PD3A 5CFZA 1PGOA 5FFFA 3WQQA 3Q2IA 5L95A 4BO0A 4BKRA 4AJPA 3RUCA 3RC9A 1X7DA 2ZIZA 4XYMA 3EZYA 2EG9A 1GR0A 3BHIA 1HT0A 3EAGA 3RWBA 3AOGA 1ZBQA 4EYEA 1QLHA 4W4TA 3SVTA 1SZJG 4JBHA 3LYLA 4XB1A 2VYVD 3GNSA 3ZWCA 4E32A 3WMXA 4FOSA 4E5PA 3FNEA 4ZGWA 3NT4A 2I6TA 3IKTA 3WQSB 2PD4A 4YTEA 4KZPA 3KEQA 2AW5A 3UKOA 2IZZA 3ENNA 2P9GA 3NJ8A 4OL9A 3T4EA 4A7PA 3PYLA 5EMHA 1MFPA 1I3NA 2J3JA 3RU9A 2X8LA 1OOEA 5DP1A 5A3VA 4DIOA 2FY8A 1E3JA 3ETDA 1XELA 4YBZA 4DMLA 1DLIA 4HFNA 3ZH2A 1CETA 4HKTA 1TT5B 1YOVB 5JC1A 1P1RA 4FGSA 2CF6A 3CUKA 2UYYA 2X23A 4QFCA 1VE9A 2X1HA 3QY9A 3D0OA 1GL3A 2AQ8A 2EERA 4EITA 4NR0A 2UDPA 2YYYA 4J4BA 1M76A 3NX4A 3EYWA 4XDYA 4AL4A 4WGGA 4TKLA 3T7CA 4CLOB 2GSDA 5B4TA 5TNXA 2OUIA 1CDOA 1V6AA 2JFGA 2WD7B 3WGHA 3WG9A 3PVZA 2X5JO 3W6ZA 2QZZA 3IKVA 2IZ0A 2I67A 4QO8A 3NT5A 1M2WA 3KYCB 1FDUA 5F21A 2ZTUA 3NTRA 1DIHA 3H5RA 2GF2A 2HRBA 4RVDA 4JNKA 2DTDA 1Q1NA 1MB4A 3KYDB 4ZICA 5KVCA 3C8MA 3B20A 3I9JA 5B12A 3D5TA 4CLOA 3U49A 4CMJA 5IXSA 1EBUA 4MVJG 3CPSA 2IODA 5BSEA 4BKPA 1V9LA 4OSOA 1TA4A 2VYVA 3QQPA 4MVJD 4S3MA 4DREA 4L4XA 4X54A 3JQ9C 4JP2A 3DR3A 4HFJA 3LVFO 4YAKA 1QV7A 3RUHA 3NRCA 5CAEA 1SOVA 4BO3A 4ZRNA 4OHUA 2PR2A 1JA9A 2NV6A 4F46A 3V2GA 4P38A 4QQRA 4IUYA 1IPEA 2NTNA 4AVYA 4E6PA 1EE9A 1DSSG 2WD8A 5THQA 3OA2A 2DT5A 2HU2A 4EI2A 3OETA 5H83A 3ITKA 1ULUA 1UXKA 5TF4A 2UUPA 4GX1A 3AM3A 3DTTA 2HAEA 2GR9A 4XD2A 4EEZA 3K8ZA 2EJVA 1EUCA 1YBVA 4WLNA 1PU2A 4KMSA 1GEGA 4FFOA 1NQ5A 4RGBA 2YDXA 3H3JA 4OQYA 3IP1A 4L74A 4O59O 4XR4A 1R6DA 1GDHA 1ENPA 1XR3A 1C1XB 1IL0A 3H3FA 1LRLA 3ASUA 3B1FA 1ORRA 1ZFNA 3DZKA 1EBFA 5JMWA 2O2YA 3NJ4A 4R54A 1VPDA 2CDBA 4BHTA 3AK4A 5ENDA 1A4IA 4Q3BA 4BNYA 3N74A 4NDNE 5K0ZA 2B69A 1EFLA 5CDGA 4YAEA 4WASA 4GLOA 1TEHA 4R4JA 2IEDA 4UUNA 3UH1A 1UR5A 1EVIA 1A27A 4DVJA 3H65A 4OKIA 4I9UA 1U8XX 4GSKA 4HFMA 3RKUA 4G65A 3AI1A 2UAGA 1C1XA 1N1GA 1UXJA 3GDFA 1Y8RB 4IDFA 1SC6A 2XXBA 3C85A 4PVDA 3X2EA 5ILOA 1Y8QB 1ZK3A 1LRJA 3KLMX 4DA9A 3D3EA 5C7LO 2Y67A 4BNJA 1T25A 2FN7A 4XQEA 4J6FA 2WDZA 1HLPA 1LLDA 1OAAA 3LT2A 2XF8A 4Q3DA 5TT1A 4J0EA 5EINA 1Q2XA 1XU7A 2EP5A 3OJ0A 3VH3A 3L4BA 4PZCA 4I8XA 4Z0HO 5JAIA 3WGQA 4BVAA 1E3SA 2DPHA 3RFXA 3BMOB 3TOXA 3MWDB 4RJTA 3GVIA 2H1SA 3I6QA 2Y1GA 3DB2A 4K6FA 5FWNA 1DDOA 4XYGA 1K2WA 3OJLA 5BT9A 2QZ9A 1PZHA 2C2YA 2ZKLA 4ND4A 3UVEA 1W73A 4RDHA 3LZ6A 2B37A 4OO3A 1HE2A 3VPFA 4NBUA 1NQOA 1U3UA 4J7UA 2JFHA 3U4HA 4CMIA 3EY4A 1PQPA 4WNCA 5DN9A 2Q99A 4GWGA 4R1TA 5TQVA 2DU8A 3QV1A 4TWRA 1X0XA 3K9QO 3NKLA 5HWSA 3ZWPA 2PY6A 3WQRA 1JTVA 4RVSA 4BNKA 4CUJA 3W6UA 1ZMOA 4NFYA 4W99A 3RASA 3QVXA 1JAYA 2VRBA 2EIHA 4R3WA 4J49A 4YJDA 4BO9A 2B5VA 2GZ1A 2NM0A 5DNAA 4LN1A 3RROA 3EVTA 7MDHA 1VSVA 5HBRA 5EJ2A 2GLXA 5LDHA 2EJWA 3PQDA 3ROQA 4ND1A 3B1KA 3UW3A 4EJ0A 3BIOA 4R9SA 4GMFA 1U3WA 1HZZA 3ON5A 3DDNA 3AY7A 5DOZA 3JQEA 1GFSA 3OQ6A 4R68A 3UICA 4IDEA 3S2IA 2FSSA 4CV3A 2VT2A 3K2BA 3ETGA 1HSOA 2V6GA 2Q4BA 5KKAA 3K96A 4CMEA 2AQIA 4G5HA 2D4AA 2QRLA 2OZPA 3PDUA 1U7TA 1NVTA 4CLDA 4ZN6A 4TRRA 1P45A 4CM8A 3JQ6A 4KTVE 1LQUA 4IQ0A 2G82A 3TZ6A 5IZCC 3JSAA 1WPQA 1Z73A 4DUPA 2ZYGA 2NVWA 4PLHA 1M67A 4CM6A 1CJCA 2Q1SA 4MVJE 4CMAA 1XKQA 4AJIA 1WAMA 3DOCA 1H93A 1B15A 2GASA 1A4UA 3R1IA 3JYQA 4PVCA 4WOKA 2Y0CA 4LMRA 1E92A 3D64A 4WE3A 4H7PA 1YQDA 2NTVA 2ILTA 5C7IO 1HL3A 1MG0A 4W7IA 3K6JA 2EKLA 1UH5A 2OXIA 3PIDA 1BXGB 3H5AA 3WIEA 5HA5A 4DYVA 3FNHA 4CR8A 1ZW1A 3GZNB 4A0SA 1DRVA 4ZQFA 3BTSA 5JY1A 4NK5A 3I9MA 5EERA 3E1KA 3S55A 1O94A 3E5MA 3IMFA 4Z0PA 4BNIA 4J7CA 5JNLA 4DPMA 1QYVA 1BW9B 1EUDA 4O1MA 2P5YA 1PZGA 3PWZA 3I4CA 1O8CA 2C5AA 2I99A 2A9FA 1XDWA 3FNGA 4P4NA 3I52A 1OC4A 3IC5A 1K6XA 4GVLA 4OYRA 4JX8A 1BVUA 1QYXA 4OSPA 4IGFA 2HO5A 4MVJM 2F00A 3FBTA 4Z3DA 5T8KC 4RZIA 4DTIA 5IJZA 3B6ZA 2Q2WA 3QHAA 1EDZA 4G81A 4B3IA 4OOEA 1ZUD1 4DQVA 3CH6A 1NR1A 4BO1A 2BFAA 3FPLA 1NNUA 2GO1A 4IXWA 1EDOA 1LSOA 4WCFC 5JYEA 2PKRA 2O48X 3NV9A 2PGJA 1S6YA 2WM3A 4LMPA 4RO0A 1CQIA 2GYYA 2DKNA 3AI2A 4ID9A 4YAJA 1NFQA 3VKUA 4XKJA 1GTMA 4YA6A 5CHEA 1P33A 1GV0A 4MKXA 4E2WA 4M8SA 5F1KA 2Q1WA 4CM9A 2JAPA 1SPXA 2DPGA 3JQ8B 1DXYA 3DBRA 2ZTVA 4IGEA 1YB1A 2VOEA 3E48A 2YV2A 4BO2A 1HE4A 4I5DA 3L4BC 4J1SA 4ALIA 1N8KA 3JQFC 5DT9A 5I7VA 2A4KA 1QR6A 1ZZEA 1AXEA 1PGQA 4LGVA 3O03A 3KYBA 4Z3KA 2NADA 4CMCA 2HUNA 4BL5A 1CIVA 3LC2O 5JAZA 1I33A 2C07A 5JMPA 3HDHA 1DIAA 3FTPA 3W4KA 3BMQB 2CUKA 3QA9A 1IUKA 4UULA 1H6BA 1DAPA 4K1LA 5G0WA 4H15A 4WOJA 1PZEA 4R69A 4Y67A 5KWEA 4IINA 4D42A 1PGPA 3U4IA 5JDIA 3F6YA 1QG6A 3D7LA 4FJ0A 4CODB 3ZWNA 5JLAA 3H7AA 2J3HA 2PH5A 3PZBA 4L8VA 4U5QA 4UUOA 1DC5A 1LSSA 4IMPA 2VHZA 3P19A 5BR7A 2XAAA 3KB6A 4R16A 5AXAA 2VZ9A 3ENKA 2E4AA 1NWCA 3IUPA 1NXQA 1Q7BA 5L3ZA 1D3AA 1H94A 3Q2KA 1DB3A 4RZHA 3VZSA 2JCVA 2PGLA 3C7CB 1MUUA 3CEAA 3ICCA 3TNLA 4YT8A 1Q0LA 4R5MA 2HJRA 2O3SA 3LDHA 3QW2A 1HEUA 4MVJA 4QX6A 5A3JA 2JCXA 3I6IA 4GMGA 2EV9A 2Q4EA 3VC7A 4BKUA 5BSGA 1R4NA 4PG7A 3ZHXA 3W8DA 2YHUA 4YQYA 4D3DA 5IDWA 4GX2A 2ZB7A 1ZSVA 4BMSA 4PG6A 2HMUA 1UP4A 3TL3A 3ITDA 1AUPA 2W4QA 3LC7O 3L0DA 4JJGA 1I2ZA 3X2FA 2DTEA 3WYCA 2P9CA 4E31A 4QT0A 3DAGA 5A9RA 3BA1A 3VDRA 5G0TA 1KC3A 3KHUA 1PS8A 1VL0A 1F0YA 2IE0A 4M54A 3JQCA 4WLUA 5GY7A 4PZEA 1UAGA 3Q1LA 1UP6A 4KDFA 3QE3A 3OBBA 3ZU4A 5EQDA 1B8PA 1J49A 3D5QA 1I10A 5AOVA 2JKVA 2PKQO 3WNVA 5EN4A 4D0SA 1E0DA 1BGVA 3WYBA 3ANNA 3LC1O 3KUXA 4K26A 3I9OA 2EW2A 4NFHA 5TT0A 3TFQA 3ZDFA 3PHIA 3JQ9A 5F5LA 4CLXA 3U4DA 3EC7A 2E48A 2FR1A 1QP8A 4EJ6A 1ZIDA 3A14A 4RQUA 4YVFA 2B35A 5MGBA 3I83A 2NU6A 5JC8A 3I23A 2Y68A 2CSUA 3WNQA 4J1TA 3VTFA 2J5KA 5JCXA 1PJ2A 3GA0A 5U1PA 2Y1CA 1GYQA 4E2YA 2VQ3A 1FDVA 1HZJA 3DHNA 1B7GO 3KYCA 1X1TA 3PJEA 3ZI0A 2B36A 5CP8A 1EVJA 1AN9A 3VZRA 4AJJA 3QSGA 2GERA 5I7FA 5H81A 4AJHA 5FI5A 3IUSA 1KY5A 5ICMA 2FR8A 3BAZA 3P2YA 4CM4B 4OMUA 5F1OA 1ZJZA 1NP3A 2E6UX 2V65A 4B7CA 4DIBA 3KRTA 4GGPA 1M6HA 4AJNA 2DUWA 4FQ8A 1ZKMA 5KJCA 1K5HA 1RYDA 2ZTLA 4R51A 3VVCA 4FFRA 1KEWA 1LBEA 3G17A 5CPBA 1A5ZA 3NDJA 2HQ1A 3JCZA 1BVRA 3TZKA 1R37A 1U3TA 2BFMA 3NGXA 2QG4A 3WSWA 4XGKA 1AHHA 4PLTA 2VUUA 3FR8A 4PGFA 2SCUA 1ISIA 4CV2A 2F1KA 1HDOA 1YL5A 4XJSA 3K5PA 4GAEA 3JV7A 4J9UE 5JBIA 4YDRA 2VYND 1LC0A 2ZK7A 1VJ0A 1YQGA 5CPFA 4WPGA 3OJOA 4EBFA 2JD2A 3OJEA 4AJKA 4W7HA 2G5CA 3GG2A 2H63A 2WYUA 4DBZA 3DFUA 4EEXA 4WEQA 5KCZA 3D3WB 4E5NA 2GN9A 2P9EA 4MVJI 4Y6RA 1IHXA 1E1MA 1W4ZA 2HK8A 1EMDA 3AUAA 2PWZA 2FHSA 2C59A 3RD5A 1IY8A 3F1LA 1MLDA 5A03A 3BZUA 5KVSA 2G17A 4ZVVA 4XRRA 2C20A 4LISA 1KS9A 4ZQBA 1G1AA 3TSCA 4WLOA 2X86A 5ITWA 3S8MA 3ST7A 1YOVA 4D3FA 4FJ2A 4IDCA 5DBIA 1UZNA 1E3WB 5CEFA 2VHXA 3NDRA 5A1TA 1GZ4A 2PTGA 4U6SA 4J0FA 1MG5A 5CG2A 2YHIA 4LK3A 4OQZA 1YL7A 3EUWA 3GGOA 2AE2A 4JROA 1ISGA 1TB4A 1Z7EA 3GK3A 1KVTA 2W2LA 3EHEA 3UCEA 3ZHZA 4R1NA 3MJSA 1G0NA 4NPCA 3E03A 4RORA 3PPIA 3HN7A 1V0JA 2WYVA 4QECA 4RPKA 5C7OO 3PDJA 2BGLA 3ZHYA 4JBGA 3D1LA 3VTZA 3GFBA 4AFNA 3JD2A 1D7OA 3GN2A 1ID1A 4GX5A 5I8ZA 1PL8A 1PJQA 3DEYX 1B3BA 2X4GA 3GRPA 4E2XA 1ZVMA 1P31A 4N7RA 4CPDA 1IZ9A 2NVUA 3RC2A 3K2EA 4TROA 2TMGA 3PGXA 1WMBA 3GPDG 1NPYA 4ITUA 3SEFA 1L7EA 4RPLA 4BB5A 1SO8A 4B3HA 1BDBA 5TIIA 3ASVA 3QIVA 3HADA 1QRRA 5IDYA 2O3UA 4PLFA 3DZBA 3W4JA 4ZU3A 3VH4A 4BNZA 3PGJA 3PQFA 1HETA 1EE2A 2GN8A 2YFQA 1IB6A 3LK7A 3OFSA 1WZEA 5IZCA 4INAA 3DO5A 4TZKA 1NHGA 1H6AA 3D4PA 4PLPA 1OFGA 4QUKA 3GRKA 4WCFB 1XGKA 3M2PA 3AOEA 2I76A 4XCVA 2HSDA 1JKFA 1F8FA 4ZJUA 1B2LA 1UXGA 1HYEA 3ROMA 1E3EA 4OOFA 1RM3A 1HDCA 1V3VA 4IJVA 1O95A 1E6UA 1I3MA 1VM6A 2D3TA 4RF5A 2BFPA 4J91A 1RKXA 1YVEI 4FFLA 1UUFA 4PLGA 5TRTA 5B37A 2GRAA 5BNTA 1VLLA 5L7TA 1CERA 1Y9AA 4KQXA 2B4TO 3ZGYA 5C3MA 2J3IA 5TS3A 2P68A 4BNHA 1KEPA 4BQRA 4ILKA 3STHA 1T2DA 1PGJA 2Q50A 1H6CA 4J2HA 4KQWA 2WEKA 1SNYA 1T1SA 2O3JA 4N18A 5L40A 2EF1A 5K6AA 3AW9A 5HS4A 4R1SA 3WOHA 4EUFA 2ZB8A 2Y99A 1T1RA 4M49A 3KETA 2NU8A 4CJXA 3ZWOA 1TI7A 3WGZA 1A9YA 4N5NA 1PTJA 4I1IA 2HJSA 2YQ4A 4J4HA 2PZJA 4B4VA 1B3RA 3KM0A 1NPTO 1UXHA 5IDQA 1S7CA 2FPPA 3JQ8A 3L4SO 1CRWG 5IDXA 2PNFA 3WTBA 1K3TA 2NQ8A 1I32A 3GGPA 3GOHA 2W8ZA 1KVRA 2X5KO 1EVZA 3DZGA 1C1DB 3V2UA 3L6EA 5KOIA 1T2FA 2AQKA 3CTMA 1RPNA 1J6UA 1E7SA 1PWXA 2FRDA 4DLLA 3ZZNA 3OJFA 4GGOA 4BKOA 4GQAA 4QFDA 3RC7A 5A02A 2YV3A 2GN6A 1LC3A 2VYNA 5TLSA 1KVSA 1NM5A 2DFVA 1KEVA 1J0XO 4CM3A 3QWHA 2EW8A 3ORFA 4OGWA 4ZA2A 4B4OA 4B8WA 4IZIA 1F8GA 4FSHA 5FI3A 3WWZA 1WDMA 2PKQP 3DZJA 4HX5A 4CQMA 3GC6A 3E5RA 4IQ8A 4RL6A 5JSFA 2Y1DA 3O8QA 4DC0A 3A06A 4B8ZA 2ZJ0A 5I9MA 1TXGA 3EK2A 1XQ1A 2JFFA 1JDJA 4D3SA 3IOYA 3V2HA 1U5AA 3V1YA 3ZW8A 3BTOA 1E7MA 4N54A 5A4DA 1JKIA 3HE3A 1ULSA 3RCBA 5ENVA 1DIGA 1E5QA 4O63O 2FR0A 4F6LA 1H2HA 1HDXA 1Y1PA 2GPTA 2ZYDA 3ZWBA 3QWIA 1NASA 1VKNA 5LC1A 5LCXA 3SC6A 3ZV6A 2W90A 3N7UA 4II2A 1ZNQO 4D45A 3VPSA 5EL0A 1E3WA 3DBLA 2DFDA 1BHSA 4YB8A 3ADOA 2H5LA 4E21A 2FZWA 3VOSA 1FDWA 1V8BA 3OECA 5AXBA 3JQ7A 4C4OA 5DBFA 3WSVA 2ZCVA 4YWJA 5A06A 5KJFA 1P77A 1YJQA 1JW9B 4U6QA 3L77A 3L07A 1Q7CA 1U9JA 1D1SA 3HN2A 2NWQA 1D4FA 3ROPA 1HYGA 2AE1A 3RUIA 1O6ZA 3HFSA 3UOGA 3KO8A 1X15A 4NIMA 4BNTA 5F3RA 3WBFA 6LDHA 3H9JA 1E7RA 4W9NC 2CVZA 2H6EA 5ICSA 5JYDA 1GQYA 2J8ZA 3O9ZA 4M89A 4O0LA 2D5AA 3GPIA 4KWIA 3T7EA 1A9ZA 3Q0EA 4RLHA 3SX2A 1LDMA 3C24A 3AY6A 1GAEO 1PGNA 4PIVA 4E30A 3PRJA 2D8AA 4DGSA 4YYZA 3F5SA 2V6BA 3PQEA 4JBIA 4JK3A 3PHLA 3QVOA 4L73A 1X13A 3GZNA 2FMUA 1G6KA 1GQ2A 4AJ2A 3AY3A 1E77A 5F1PA 5BNFA 3G1UA 3GR6A 3WTCA 4CL8A 5T67A 4CR6A 4RVFA 3ZCXA 5JE8A 2BGMA 4J7XA 3CMCO 1I36A 4XIYA 1GV1A 1IYZA 3N58A 3KTDA 5L7YA 3ZNPA 3MJCA 2V6FA 2VWGA 1A7AA 4XRGA 4FPXA 2C0CA 2AMFA 5ER9A 5B4VA 5G0SA 3DAFA 2UVDA 3R6DA 3GEMA 3AU8A 4FFMA 4DIFA 3H2SA 1L1FA 3GDOA 5JAMA 4FS3A 3BMCA 2C7VA 4U0KA 2BRUA 2W2KA 4DC1A 1M75A 4CQLB 4IZHA 3I9KA 3E9QA 1HYHA 4BNNA 1LTHR 5G0UA 3G3EA 4DMMA 3ZWXA 1E6EA 4NFSA 1FMCA 1XIVA 3KSUA 4MVJP 3FHLA 3GGGA 1R15A 3F5QA 3JTMA 4YAIA 5DP2A 4HY3A 4EW6A 3E9MA 2YUTA 1BRMA 4FCCA 3DQPA 1E1KA 4PFJA 2OGUA 4BGIA 4M55A 3TOZA 4ND2A 3LQFA 4OAQA 5ITVA 4TRMA 2RH4A 3T4XA 4LCJA 1XA0A 3RAJA 3KEOA 3UAGA 2Z1NA 4GKVA 1B26A 1P1KA 3E82A 3GMSA 1E7YA 1P74A 2Q1UA 1MFZA 3RUDA 1LDNA 1B0AA 1SBYA 2X0JA 4WLEA 1RM4A 3JQAB 2DLDA 3M1AA 4TSKA 3UN1A 3GNTA 1VI2A 4XZ3A 3SJUA 1HDRA 3PJFA 3KSDO 1LLUA 2JCYA 1QORA 3DMTC 3HSKA 4A27A 1DRWA 4E2ZA 2VHVA 3JQDA 1BTOA 3DBRB 1R4MA 3OIDA 1A72A 3CZMA 4FC6A 3OEWA 2R6JA 3G0OA 1C3VA 1PR3A 3F4LA 4MPDA 1YONA 4RCVA 1SCUA 4PZDA 5KKCA 3MTGA 4RF3A 3MOIA 2C2XA 2O3RA 5G0VA 4YJGA 1JLLA 1ADCA 1GU7A 2OBNA 4NJOA 1Q0HA 2YV1A 5JW6A 5F5NA 3PHJA 1CEQA 3WYEA 4BUCA 3A9WA 4DQUA 4WK6A 1B8UA 1OMOA 2RIRA 3OHSX 3U9LA 2PH3A 4RVHA 1BDMA 3M1LA 3B70A 4MINA 5IG2A 3GG9A 1PQUA 2O2SA 1DC3A 4CMHA 4E33A 1YXMA 5A05A 2E49A 1NWHA 4R41A 4W6ZA 3AJRA 1JAXA 3BMOA 4HP8A 2DUUA 1GZ3A 4IMRA 1HXHA 2QYTA 4HBGA 4WLVA 1MX3A 4TQGA 2QIOA 1W8DA 1NAHA 5GZ1A 5U4QA 1PR9A 3NYWA 4J16A 4XYEA 5TJHA 2RBEA 4KTTE 3QWAA 1Q0QA 3U0BA 4I5FA 3V5NA 3NDIA 3EGOA 2D0IA 3DWFA 3LLVA 3SLGA 3BMQA 1K6IA 4NH4A 4R5HA 2BD0A 4QTZA 3R3JA 1NAIA 1DBVO 3BYZA 1U2DA 2DTXA 4BQPA 4FW8A 3HNPA 4Q3NA 2B5WA 2D2IA 1E7QA 4BNWA 1CYDA 4FR5A 3KBOA 3AI3A 2VZ8A 4BO5A 3WX0A 3F9IA 1YJ8A 5ILGA 1X0VA 3ANLA 3QWBA 4JXKA 3LT0A 1M6WA 2OBYA 3G49A 3RBXA 4LRTB 1R0KA 4GPD1 2P91A 4MP8A 1NBOA 1ML3A 4XGNA 3DBVO 3SLKA 4TVBA 3OMLA 4QEDA 4CLEA 3P2OA 2BF7A 1DFGA 2AEFA 5CEEA 1Y81A 3PLRA 4XQGA 5ADHA 4CV0A 3OEYA 3DBLB 5KTKA 2C5EA 4NBVA 2J5QA 2EHDA 5DZSA 2Z1MA 3HUDA 3WGTA 5KJ6A 4CQLA 5L7WA 3K92A 3IIEA 1KEUA 1OI7A 2CNBA 1LA2A 3L9XA 2WTBA 4MOWA 1Y5RA 5KIAA 1BXZA 2XPCA 1HDGO 3WS7A 1HF3A 2TMDA 4Z6KA 1NX6A 3ANMA 1PQWA 3VPHA 3HWRA 1LNQA 4NBRA 3F1KA 1P1FA 4GSLA 4ROSA 1N9GA 4PRKA 4IJWA 1UDAA 1C0KA 2G0TA 3V8BA 3EDMA 2A94A 2O7QA 4NK4A 3S2EA 4AJEA 4NBTA 1I2BA 1GCUA 4PLYA 3ICPA 3NAQA 4BO8A 4D46A 2AG5A 3JD0A 1W6UA 2HRZA 3GHHA 4M86A 3VKVA 4F45A 5LDGA 1YH3A 4L9RA 1P44A 2IRWA 1LDBA 3H9QA 2IXAA 3U4CA 4NG5A 1ZSYA 4RVUA 5KVVA 4BGEA 3WR5A 2NUAA 5I7EA 3I4FA 4E5KA 2AG8A 2OL4A 4E4YA 4IJUA 4Z9FA 1BG6A 1DEHA 4URFA 4R9RA 4KOAA 2POQX 2PZKA 3GNQA 4ONEA 2Q3EA 4Y6SA 1ZXBA 4NQZA 1C1DA 3IL2A 1N7HA 2WJPA 1PJSA 3JD1A 4FB5A 2DM6A 3FWNA 4AJ4A 2PLAA 4K28A 2EKQA 1MV8A 1I5RA 1EEHA 2WE7A 4LCEA 4DXHA 5A5EA 1DIRA 4UVEA 3WXBA 1P9LA 2EEZA 1E6WA 3AM4A 5G4KB 1FF9A 5A9TA 5MDHA 1LDYA 1LRKA 5AQ1A 3GUYA 4A5OA 4IDDA 1AHIA 3RUAA 4BMVA 5B1YA 1GYPA 2VRCD 2GZ2A 1TT5A 1SOWA 2OHXA 4QXMA 3KLPX 4DPKA 3HQ4O 3FN4A 3GEDA 4NU6A 2CF5A 3S1LA 3O26A 1DHRA 5C5IA 3LT1A 3DZIA 3AUUA 1VL6A 1N1EA 1Z82A 3GVXA 4YJHB 2Y93A 4D41A 1NQTA 1LLCA 3RJ9A 1LJ8A 5G2OA 2YZ7A 1GYRA 2X5OA 5CDSA 1Y8RA 4BO6A 4PLVA 2YHIB 3DZHA 3UUWA 2DBVO 1BMDA 3TL2A 3MJ4A 2Q1TA 4MKZA 1ZEJA 2AQHA 2VHWA 1NYTA 1O89A 4RF2A 1PJLA 3ABIA 4IY1A 1GY8A 3OICA 5DF1A 3WMWA 3NEPX 3MWEB 3H4VA 4NZ9A 2GDZA 1GCOA 1QLJA 5ES3A 4BB6A 4FOOA 3JQ7B 2IEBA 1AGNA 3FTNA 1WMAA 3AUTA 2CDAA 1DRUA 3PWKA 5DCYA 4Y98A 2I9PA 4CL3A 1I24A 1LX6A 2D5CA 2CVOA 4PRLA 5J23A 3D3WA 3DFZA 3IAHA 3ONFA 2Y1EA 1EK6A 1L7DA 2HK7A 1E1NA 2BKAA 2G1UA 1U4OA 3JQFA 4IQGA 5HRUA 1Z45A 4E0BA 4Q39A 4YJGB 2DQ4A 3W4IA 5B4UA 1XYGA 3ZV3A 3H9UA 4ESOA 1VJTA 1K6JA 4I5GA 2A35A 5IN4A 4NI5A 2WWRA 3WGIA 2R00C 2I65A 1U7HA 4R1UA 1K0UA 1ONNA 4IS2A 1WVGA 4UVIA 1KY4A 1KYQA 4LVUA 3H2ZA 4YRAA 5JDIC 4XDZA 4BNUA 4BO7A 2O4UX 1N9GB 3K73O 2GD1O 2I66A 3WLFA 1VRWA 3QVWA 5KJ1A 2VWHA 3DC2A 3JD3A 3RUEA 3HDQA 4GWKA 3JYLA 4PLZA 5AVOA 5TSDA 5L45A 3TN7A 2C54A 4EZBA 3GQVA 3GZ4A 2ZYAA 3MTJA 1OZAA 3GLQA 4RPJA 1KERA 3F47A 4UEKA 4GI2A 4YT5A 3DHEA 5COQA 3RC1A 2JAHA 5COBA 1WXDA 1WNTA 4A10A 4O5OA 1LEHA 1RWBA 1QSGA 2GUGA 3DZFA 3BTVA 4RF4A 3ZV5A 4JQCA 4BNMA 4FGWA 3F46A
chains in the Genus database with same CATH superfamily
3AOEC 1P0PA 3H8JA 3MVEA 5DCUA 3X1JA 4XARA 4L3VA 4BFSA 4QU8A 1B1CA 2OYSA 4HWKA 4AU1A 5U9CA 1QF7A 3HCEA 4ZCRA 3E9NA 3ZDRA 5FWXB 4JLMA 2EGHA 3H16A 2ZATA 1UQUA 4BX2A 4B32A 3SHFA 5I51A 3W9BA 1KEEB 4YCBA 1M66A 1NSYA 5C31A 2VUIB 4HNHA 1G5FA 3UHAA 5FYDA 1DAMA 4WZBA 3IP3A 4FOPA 1D09A 1Y4UA 3HRIA 1QCYA 4NZYA 5EMJA 3TRIA 4D4LA 5MN4A 1D5CA 3MINB 3GEEA 5AMXA 2VDWB 1ZSNA 2ATIA 5BOSB 1PX0A 2ES4A 2FPRA 4LY3A 3IDZA 3SY8A 4A73A 4YXWD 3N8DA 3WL5A 2NQTA 4CIBA 1JX6A 3ZD8A 2ZGVA 3K2IA 2I3GA 5F7ZA 3N9IA 3TO5A 4BIIA 4RCZA 1CFZA 5HKLA 3G9XA 4NU5A 1MP0A 2ID8A 3ESCA 3ANSA 2ZIUB 4A26A 1R4MB 1KDVA 3AVTA 1W2HA 3L6DA 3M81A 3BSSA 5H0IA 4GDMA 3PHBE 1W581 4N7JA 5IJ9A 4N03A 1UANA 3WJ1A 3PDWA 1ZJ5A 3WGGA 2ZJ2A 1WZIA 1OLSB 3HXPA 1EK1A 1XNRB 1Q15A 3AHCA 5LOVA 5JS2A 2XSZA 4XIJA 2Z4SA 3EQ6A 4GE0A 1YV9A 2ZR7A 4N0QA 3CSDA 4MW1A 3WK8A 2PWYA 5J2UF 4XJTA 1KP9A 2CB9A 1N4AA 4P0PB 2PZ8A 1SEVA 1GNPA 3BWBA 1V4NA 3DTVD 1AKNA 4LNHA 5TR9A 2HFKA 1FFCA 4CF6A 1PP4A 1DAOA 2TYSB 4MSUA 1IJKA 1F12A 3KYIB 3VR2D 2JI7A 3PGKA 1Y6QA 1K8QA 2C2GA 1MOSA 1J0AA 4PE5B 4DUGD 1Z2DA 2DYKA 3AFGA 4H3VA 4HHEA 3PI6A 4C6HA 1RWKA 16PKA 1F0PA 4FD3A 1Z7WA 4TTJA 1WSWA 1N2OA 3O1IC 4LJSA 4WKBA 2Z3ZA 4Y9SA 1TZ2A 4JC5A 3F6SA 1F20A 1FTNA 2F8MA 3E4DA 4R2JA 4CLRA 3FOFC 1AE1A 5KX5F 3IT1A 2AJDA 1NW9B 4FDUA 2Q8PA 3AL3A 1U3VA 3ZKWB 2FUKA 2B6NA 1Z7YA 2HCBA 2FJUA 1GUFA 1AMNA 3U4MA 1JS1X 4N9QA 2C4MA 3K6KA 3TVDA 4HNVA 3ROFA 1OXVA 2Z4RA 4EL5A 3N59A 1W5BA 3VR5D 3VTAA 3CO0S 5EHZA 1CEYA 2CEKA 2QM3A 4H1UA 4TQAA 3L01A 1EP3B 2CXXA 5CM9C 5AHXA 4F92B 3OIGA 3CGWA 3RUFA 4BUJA 4WA8A 5CH8A 2Q9AA 2CC2A 2B83A 5EGNA 4MW6A 5E9AA 2HJHA 1UBUS 5K09A 1UOOA 5KYYB 1SVUA 4UVHA 5JPDA 2UZAA 2B9EA 1KO8A 2ZRFA 4XSGA 4ZOLA 2FRDC 5AVVA 2IS1A 2VIIA 4MV5A 1YCHA 4ZI7F 5CVCA 3FJ1A 2Z8XA 3AHDA 3OQHA 2VUTA 4L8GA 4TXNA 4UTPA 4EKEA 2DUMA 4ZT5A 1ENYA 1TU0A 5FULA 5IC5A 1QF6A 1Q5PA 4AN0A 3THWB 2JIRA 4X1IB 4AT1A 2A8YA 4C4PA 1EFKA 2QL5A 2FZVA 1PR2A 3CX8A 4MQ4A 1JHUA 3FI9A 3V1NA 4HX9A 1F9AA 1VIDA 4ND5A 5AJTA 4KI7A 2VJDA 4B6EA 1KR5A 4P32A 3F3SA 1LFAA 3HN6A 3EUAA 1XG5A 1NMXA 3IBSA 3MFQA 4QWWA 4GPTA 3JQBC 2GNPA 2R62A 2R8BA 3A32A 4ZAYA 3FF1A 5F4BA 3GJ5A 1IN8A 1XHFA 4RHEA 4IIJF 3G5MA 2G70A 4F56A 5JYBA 4LFAB 3UMGA 2LDXA 1UAYA 1MZPA 4R01A 5CTAA 3IPAA 3KTFA 4JWTA 2VL7A 4CMEC 4ZV7A 2C3MA 1ZOOA 2C82A 3LBFA 3TEJA 5SV2A 3DGFC 3R3WA 3WAKA 1XRQA 5LXTB 4FGZA 3K0EA 1UDBA 1HO3A 1NVGA 4MITA 3GT4A 5BSTA 1XK7A 4MIEA 5ER6A 3ZLAA 5EWJB 2VPXA 1RHMA 3OOHA 1O5OA 2O5VA 1ZWKA 3H7IA 1VLZA 1JG7A 3OWOA 1IU9A 2Q2NA 1MJFA 1JA1A 1MC4A 2J9RA 3R0JA 1M83A 2FG5A 1VSUA 4LVCA 1L5NA 1QGUB 4J90A 3TEFA 1UJMA 2ZT7A 3TLCA 1IATA 1LZKA 1YDWA 2HMSA 5DRTA 4N82A 3WYFA 5A62A 2WFMA 5EGSA 2H07A 4LMAA 3TQHA 4KGXA 4HF7A 1OFVA 1C7QA 3KHSA 1IHUA 1ZMTA 1ORHA 3VYTB 1NE2A 4D0GA 5IEJA 1JUDA 5AJXA 5HQ3B 4RY0A 4Y1RA 1XMXA 2X22A 1GD1O 5FXMA 1DQNA 4EK9A 2YVAA 1NN0A 4MUEA 5C51B 1NVKA 1U3CA 1FNBA 2A84A 3KZXA 2XB2A 4KXWA 1CYEA 1H8HA 2JD0A 1ADGA 1SUIA 4KXNA 1HGXA 3VH2A 2GX6A 4H35A 1OU4A 4XDGA 5FLYA 3CE6A 2EF0A 4JY7A 1P1HA 4LXIA 4FYYA 4P6VF 5AHWA 5E3HA 4KREA 2NO1A 5KX5A 4JLDA 5EQTA 3MJVA 2E4VA 4FILA 5HMMA 3AHHA 1HT2E 1NFFA 2F6RA 2PGOA 2VP0A 3D7KA 4Y2JA 1VCNA 2PRYA 3CNNA 5AP9A 3OUZA 4PSAA 5K05A 4RGVA 1AO0A 1VJDA 1ZINA 2GNAA 3IDQA 4N1AA 1TIBA 2I3AA 4U7TB 5BW4A 5K2MA 1JZQA 3CXRA 3PPVA 5FL7A 3WAJA 1XTJA 3DDOA 3P2IA 4ZCPA 4EG6A 1KQ3A 2J0UB 1L1EA 1TZJA 4WY2A 3VR6D 1JVBA 1JQBA 4OH1A 3Q88A 4HJXA 5HSGA 1PS0A 5HCNA 4IUBS 5KQLA 1DAFA 1DG9A 3GU3A 1URPA 3BFJA 3DOJA 2CHGA 4BCBA 3MGBA 5B7QA 4YXFA 4PO8A 2A0XA 5T57A 4MRSA 1N6NA 1P1IA 1BC5A 1TLLA 3OQBA 4C6TA 2VWQA 1LPOA 2DR0A 4TKVB 4HSGA 4FIZA 4KE6A 1EUYA 2CKMA 1U28A 2VNKA 3GVCA 4N8DA 2R86A 1SU4A 4UM7A 1F4PA 5K0BA 1E1QA 2EL7A 1NHWA 4ROTA 2GN4A 1OAOA 4NMXB 2H52A 4Z9YA 4MQEA 4KGVA 3W5IA 1FQOA 1M0WA 2YKGA 1CUZA 2B4QA 2ZCUA 3L7BA 4KPUA 4IS3A 1US8B 2OFPA 4PYJA 2I5PO 2BEWA 4D9BA 8ADHA 1ZH6A 1MH9A 2AJLI 1RMQA 2ZBRA 3RFTA 2ZBFA 2Q1XA 2VWPA 1RMTA 2X41A 5DYYA 4EA8A 3ZU3A 2OORA 2YNMC 4WJZA 5JARA 4EUSA 1FSSA 4JVSB 2RAVA 1QANA 1HKHA 2VDRB 3LWZA 4GLLA 3ZW7A 3W6NA 3P7MA 4FDLA 4KO1S 3PE6A 5DXJA 5JHHB 4D3XA 1I7PA 2HY7A 3TJRA 3U60B 5AKZA 3W5DA 3D8SA 1NVWQ 3QXSA 4H6WA 3U3XA 1L8XA 4JC0A 4N5MA 4XM0A 3Q7TA 1OGYA 2OC4A 5G4LA 4QE3A 4GOND 2I78A 3E3NA 2QPOA 3SSAA 4B6PA 1NMZA 1ENZA 3ICVA 3L0BA 3AFIA 1K5PA 2OOKA 3DV2A 3MUEA 5ESXA 3RIEA 1T29A 1FQKA 4ZOLB 3FVTA 3V46A 3LMKA 4X92A 3GL9A 3NFYA 4YEDA 1L8OA 3NTQA 5GJCA 4TWJA 2Z56A 4IHKA 2X1VA 1DBRA 1SVMA 3WGOA 3REFA 1K7SN 5AVTA 4J3FA 2V3CC 2HDHA 2JBWA 1XCBA 3AP3A 3NR2A 4PF1A 2Q7OE 2WTMA 1XQ6A 3FF4A 1TU4A 5DHPA 1JSRA 1TQ8A 1ARZA 2OPBA 1PNOA 1KEEA 3CMMA 1EM8A 3TCNA 3M9WA 1GQQA 4KDEA 2P1DA 2ZRCA 5CYPA 3TK1A 3K30A 3QKIA 4RZSA 1WB9A 1JP7A 1N8TA 3CLUC 1GPWB 1S4MA 2OP0A 2VJKA 2ZB4A 2G83A 3EIQA 4GOXA 2D74A 3BCRA 3KSBC 2V7PA 1FUYB 2DPXA 3I5MA 4KYVA 3KU4A 2PZLA 4PZ0A 3I09A 1LSUA 5ALOA 4MP3A 2GWRA 2FSFA 3KKLA 4GX0A 1SC3A 4UEJA 3K9CA 1DKLA 1L5KA 3RVBA 4BMYA 4MUXA 1QFMA 2YJ5A 4DQXA 1U5CA 2QSZA 1K8ZB 2Z43A 1BAPA 1YC5A 3IPCA 1HL7A 2IZ1A 1U4SA 2COKA 3ZBPA 1B76A 1CRLA 1XDBA 5TMPA 2BEJA 5JS6A 4BQSA 2PUHA 2X9NA 2MYPA 3TIGA 4L4RA 1W46A 1JQ5A 2I80A 3QVUA 3VR0A 3NHJA 4DV1B 2JH8A 1I30A 2QR3A 2ACKA 5KYTA 3FWYA 4FT4A 2ZTMA 3G0IA 1LJUA 4L07A 1U9ZA 5EIBC 3S6JA 4UM5A 1JNYA 1CJSA 1YHZA 3R76A 3C0KA 1C0IA 1ISMA 4MA5A 1HRDA 3L1HA 5JBQA 3BMNA 3ZJTA 5SZIA 4I2NA 5K8VA 4I08A 3QUSA 4AMUA 1QB7A 4NONA 1E1LA 1FYDA 3INRA 3LDUA 2HYDA 1F60A 2QHXA 3OIFA 4LOAA 4M0DA 5F1YA 4GFDA 1G42A 1NQWA 2GZAA 2WF5A 1WR8A 3HABA 3HVHA 3W8RA 3ZGZA 1ZRSA 2QD3A 5EESA 5F2OA 1UZUA 5KNCD 4IJSA 2BRUC 2X9GA 3EG9B 2IWHA 1A8QA 2OUKA 2IBMA 1X1SA 3HEBA 4I3GA 3H2IA 3KQTA 4ZO8A 1GG8A 5GWXA 2PKWA 5KPDA 2ZAGA 1GFWA 4MKIA 5AI9A 1Z2NX 1HFEL 1FE8A 4C87A 3R9XA 2BFEB 3L1VA 3MPUA 1L9KA 5D3MB 1G6OA 4C9BA 4JI4B 2OT3B 1E1DA 1L1QA 1QH8A 1KETA 3FWZA 4ZARA 1RJFA 1MU0A 3HHPA 1SUFA 3S2GA 4IG9A 4CETA 2DCMA 3WL4A 4FBGA 1U1GA 1PJ4A 1PJRA 3RIHA 4I4CA 4WBNF 3DL7A 1E0KA 2XB6A 4B4UA 2JL1A 3FUTA 1E6KA 2VUHB 5GZ3A 3TEMA 4J43A 3W8EA 2X8WA 4HDRB 4HXEB 2OVBA 3D8HA 4IUDS 1ZMXA 1QWSA 3HVUA 4OXNA 1KO5A 3WBBA 2JGRA 4ZOQI 1X70A 4O3MA 1X8XA 4WH0A 1G9SA 4Y2HA 1VGQA 3UC5A 3D8TA 2HSEA 4BATA 3AKDA 1P2BA 1ZVKA 1FVHA 4EFMA 1P0IA 3DC7A 4OQXA 1C8BA 1KAGA 2BI7A 2JDIA 3H6HA 4GLBA 4MPRA 4OM7A 2TMYA 2XZPA 5DISB 3ZTWA 4YRKA 1TAUA 4OFXA 4LHSA 2JGNA 1TAHA 1XU9A 2YS6A 1P0CA 1EUDB 4XXHA 4ZOAA 4CGZA 3GQBA 3H5LA 4HQRA 4BGVA 3GT0A 1KO1A 2C78A 4XEHA 1KHTA 1NKSA 2GESA 2C2ZA 4PYIA 4EM6A 5HFNA 1KYZA 4DCPA 1QDLB 2R7KA 1JWAB 1UMDA 2O8BB 3M6XA 4CHTA 1PL7A 2W00A 3WKBA 1R66A 2OCLA 4KHPB 1IQ0A 2ZBPA 4YREA 3KYDA 1T5BA 1ELOA 3HKBA 1P1CA 1E79A 5T64A 4IXTA 4IJKA 1QB8A 4QDZA 3ZJVA 4H7IA 1H4QA 5KREA 4PX5A 3U7EB 5K4HA 3I8XA 4QOJA 4MYSA 2FAXA 4ZQHA 1XCJA 5FOSA 4UATA 4KE9A 2FK7A 3DAPA 3NT2A 4PZLA 3ZZ0A 4G5RA 1X1BA 3QVTA 1ZUWA 5AYVA 2HKIA 4NE9A 4Q4HA 3ER6A 3TLZA 3U4AA 2DF8A 1EB9A 2AYXA 3ZHSA 2OQRA 2JJ8A 1K27A 4B3DA 1I7QB 3ZDCA 2Q2OA 5AW4A 4WWHA 1M7HA 1X2BA 1C9EA 1GLVA 4X8MA 1E32A 4IOKA 4Z9XA 2PFGA 3S29A 4D9KA 3VR4A 2IHJA 3RU7A 2VF8A 1UJ4A 3GA7A 4MW4A 2GN0A 4U2KA 4CM7A 5HM8A 4TT3A 3VR3D 2Y05A 3EQ8A 4JGBA 4MICA 4MIOA 3TOSA 5K8TA 3QELA 1SVWA 4JLWA 4OFZA 3AETA 4WKGA 4Y8VA 4O6VA 4Y0VA 1HQCA 2PZAA 2WIAA 3PFWO 5K6TA 1D6SA 3T3MB 3MT0A 3PPWA 1MGOA 3NHRA 4P4UA 5CD9A 1BJKA 2BC9A 2GZ3A 3E0QA 4K9DA 1HSZA 3NWJA 3OTHA 4HGPA 2PD6A 4K9LA 2I9KA 3IOEA 3DMTA 3MZ0A 2JBAB 3MAAC 5F33A 2VNSA 5E6RA 1GQRA 3OMWA 1QHYA 4PLCA 3ZZUA 3UIEA 4B31A 1S1MA 1U2PA 4GO1A 4UUMA 2LCFA 2E5FA 3LGSA 1P0MA 4DIUA 3HKCA 2YFHA 2PK3A 4KPGA 3B1JA 4QSMA 1FDTA 1J4AA 1YC2A 5BR1A 2YJGA 5TEVA 3QJ5A 3CLHA 2GETA 4B87A 1O4VA 1LXCA 3ZV4A 4CM4A 4D0RA 1UM9A 4OB6A 4YDQA 3IVGA 2G4VA 3WRXA 3TF5A 4BQNA 1H9CA 3PRKE 1J2JA 4GRIA 3E2IA 4XSHA 3TKYA 2XYPA 1Z38A 4OREX 1SM4A 2FWMX 2VSFA 4JB8A 3K9LA 3FOZA 5D7BA 3WIDA 3KZOA 2PQ6A 4BRZA 3K9NA 1K9VF 3TLEA 1ZXLA 4Q18A 5EEGA 1XPOA 4L6AA 3GRCA 4JLAA 1Y6JA 2RHRA 2P75A 4IDBA 1T8WA 3A28A 4B1FA 1Z9BA 1AKTA 2AI2A 1F2UA 3W8NA 2ORVA 2JFBA 3IMEA 4DL9A 1RBMA 2XWBF 5K2OA 4V0OA 3RVJA 3L4KA 1OYWA 3AVXA 4G4SP 2JLBA 3RPEA 3X44A 1R4NB 4WY8A 2X7HA 4DCTA 4G1MB 4KUHA 5ES4B 1OT3A 3OZVA 4TYMA 4ZYZA 2QTHA 1Z6AA 4Y2GA 1PYOA 3PXCX 4ZPXA 1C0LA 1YA6A 2BZGA 4HUJA 4EGFA 4ZV4A 1LUAA 5GAJA 5KYXA 1L5QA 4JUAA 4MK4A 3UKDA 2D0OB 3MTQA 4RVGA 3T7RA 3GRAA 1L7AA 1KPIA 1PJTA 3TTVA 3FCOA 2AUMA 2A5FA 4V0NA 4MO2A 1UT5A 2EWMA 2RD2A 1VSQA 1KYYA 3LXMA 2K6GA 4LYAA 3C6KA 5H4GA 2HFJA 1T0BA 5ALTA 3TQQA 1V6CA 2NZYA 4IDNA 4OQLA 4BECA 1G21E 3G5TA 2AC4A 5IT9A 1UPUA 1P4SA 1XB2A 1I7NA 3W6PA 1FBTA 1NJGA 5ALVA 4DBLE 2CLKB 4LNUA 2H29A 5TQ2A 3IERA 4ETWA 4XX1A 3CLVA 2EGUA 1USIA 4EG5A 2AX4A 2JHFA 2VEDA 5CA1A 3PI7A 3E7PA 1MABB 2W4IA 2VR1A 3H84A 3OKCA 4MJLA 4CUKA 1XTTA 4MRMA 2BHNA 3UJ3X 1K4KA 3KSMA 2BGKA 5TQ0A 1SOAA 5BXYA 4JEMA 1ULAA 4BV9A 1KPHA 1BFDA 1IC6A 1U2ZA 2CNWA 3CC8A 3PIRA 1C14A 5TDHA 3RVOA 3FUXA 3G79A 4HVAA 5FP0A 4EI8A 1KDZA 4EX7A 4G9BA 3EODA 2OECA 5DSTA 3MEQA 5CGZA 5EWMB 1ULZA 721PA 5BMVF 2XR1A 7REQA 4OXYA 1G8MA 4ZHQF 5ARDA 3RR2A 1EVYA 3KAQA 2J4FA 4DWVA 2XTNA 4CMKA 1BYUA 1RLIA 3HZZA 1SKQA 2XTAA 2BLLA 1QMGA 1WW8A 3LT4A 3QLJA 3QV2A 1WP9A 4IIUA 4MP6A 4BIMA 2V03A 2OCGA 1DUVG 1L4BA 2GF0A 3DHWC 4GZLA 4MIYA 4BNVA 5LWQA 3IGFA 3ONEA 2J9FB 1C9YA 2XE4A 3OE5A 5DDIP 5JWHA 4C7KA 1EP1B 4WXRA 2R8XA 5IVKA 2ZWVA 2GCEA 4WADA 5BSHA 1E8MA 3CNLA 5GONB 1B41A 1IY0A 2H2DA 2XYGA 1J90A 3HPQA 3P45A 4LXTA 2Y0DA 4OKNA 4X7PA 4EHLA 4GZ6A 2ON6A 3N86A 2BKEA 3NMUF 1VTKA 1HDYA 1GPBA 1WKBA 3FRJA 2YCBA 2DRIA 1L5WA 1TMYA 1HTBA 1UBOS 2BHLA 3IV9A 2AMVA 2QRKA 5FAKA 3A9RA 4RPHA 1E96A 2O1WA 1PNRA 2QL9A 1ESDA 3K8YA 3PJDA 3THXA 3IQDB 3Q3CA 4FTWA 4O3FA 5DBGA 1JJ7A 4JIMA 3NTUA 2O3QA 3KHTA 4EY6A 2O54A 3H8VA 1U2GC 2ZRMA 2QN6A 2Z3VA 1WCIB 4PZPA 5FEUA 1RTTA 1E2HA 2I1LA 2E18A 1RQ2A 5EZYA 4MGHA 1H42A 1CT9A 2GN2A 2OAP1 2GWHA 3ZNQA 3WYAA 3LOPA 4ZMRA 4NXNB 4GVXA 3P20A 4OG2A 2H4JA 4KV7A 1WE2A 2PE5A 5AUNB 2XQGA 4G5YA 3P4UA 1Y6GA 4D9JA 3HWX1 4TKVA 1ZLXA 1ZJYA 1ZK2A 1MJ5A 1Y8QA 4AJ1A 2OP1A 2ZEJA 3PXXA 4RHYA 1K06A 5I7OA 3R4CA 2DGDA 4EVSA 1PEDA 4KVGA 4L8YA 1V96A 3GBSA 4OHFA 5G53C 1SAYA 4UTVA 3AL0C 1PR0A 3CRZA 4UU1A 1O94D 2Z98A 4D82A 3VNSA 3N2YA 4QG7A 2J9FA 1RAFA 2QL6A 2IYWA 4PYRA 4ER6A 4MMYB 5FTKA 4FDAA 1YGYA 4LC9A 3VVBA 1Y9EA 4R2HA 2RGEA 2R00A 4AO6A 1Z75A 2P2LA 4YRBA 2F48A 5CFZA 1PGOA 2XD4A 2GT1A 1V25A 4P0QB 4HLCA 5FFFA 2ZIEA 1OQAA 1NVVR 2P77A 3WQQA 4OP1A 2ZYUX 4BO0A 3ONWA 5FBWB 2TECE 1XXHB 2IUTA 3RUCA 1X7DA 4ZJPA 4FX2A 3SI7A 4MPJA 3W9UA 4P3YA 4OK5A 2QMHA 4LDZA 1HT0A 4S05A 3EAGA 2IQIA 2WJ6A 1ZBQA 3AOGA 2IL1A 5SYNA 1POXA 2X0FA 3RWBA 2I54A 3UHJA 1W25A 2VYVD 3ND9A 4PSCA 2XB9A 3ZWCA 4PY2A 8GPBA 4UFNA 1TUEA 4FOSA 3NT4A 3ZBTA 1OF1A 3IKTA 4M76B 1PDWA 4DZRA 3KQVA 2JKZA 2QD1A 1BN6A 4KZPA 4UTXA 3KEQA 1GPUA 1QVRA 4JBWA 1KJYA 5F35A 2V7BA 3MWLA 4KG7A 1DX4A 1DCMA 2J5BA 1QDUA 2F2TA 2L82A 3NJ8A 3O8NA 4ID3A 4OHVA 5E2IA 4BTEA 3PYLA 1WQ3A 1CW2B 4MJ7A 5GJVC 1MFPA 1T6BY 2B25A 1I3NA 4NAHA 2WBLC 4TVKA 3V7FA 5CVJA 3RU9A 2R0QC 2R6CA 3LCCA 4FE3A 5DP1A 3O95A 1Y3DE 5A3VA 3UAYA 4ZZ1A 4F9TA 2FY8A 1CCWA 4O2BF 3FPJA 4YBZA 4D25A 4DMLA 1MF7A 1YIAA 3NTVA 3SQDA 1BHQ1 1MEJA 1OWPA 3U6BA 1W9MA 5JC1A 3KPJA 4GMHA 1MRSA 3WISA 1V5FA 3L7JA 2YIJA 3OFVA 3MWGA 4RFSA 4ZO6A 2GILA 2X1HA 3HP4A 1OXMA 5C9ZA 1I1NA 4YAWA 5ECGC 5EE9A 5LD2B 1JLSA 2J45A 4MS4B 2OMKA 2YYYA 2Y71A 4J4BA 1M76A 3S0JA 4KX5A 3ET4A 3FETA 4QBIA 4XDYA 2H9YA 3AB3A 1SVKA 2AV6A 5EFZA 2I91A 4MIKA 3BWXA 3SHVA 4PQEA 3QBEA 4ZCIA 5BN3A 1CDOA 1V6AA 1M8FA 2JI4A 2JFGA 5F64A 5LYYA 1ATZA 1TYZA 3BIJA 5FADA 2ZM5A 3HM2A 4MRAA 2X5JO 3KUKA 2QZZA 1KYIA 4COOA 5B4TA 1I2MA 2ORYA 1EESA 2NYUA 3MUFA 3BJEA 1KMHA 2I67A 3DVAB 3LUGA 3VTKA 3QE0A 1FDUA 1N4DA 4R71A 2GF2A 1PT5A 3KWFA 1EHYA 4RVDA 2BF4A 2DTDA 2PRZA 4QDUA 3WIUA 1JR3D 4EIWA 3D0RA 5LM3A 4R40A 1EYZA 1CUUA 2CUNA 2PKCA 1KGSA 3PCXA 4NOJA 2CUTA 3U49A 4CMJA 2VF4X 4F96A 4XQ0A 3PNKA 3H42B 2JGLA 3EPPA 4LYDA 5IXSA 1EBUA 3TLBA 4HEHA 2WHEA 4MS4A 3NBMA 1H8ED 3RS7A 4OSOA 3HVRA 5JATA 3OC0A 2ZJFA 5K01A 2PPLA 4I2VA 1T8RA 4V0QA 3FE2A 4YCCA 4CFSA 1JLHA 1D03A 1OYOA 1H0SA 3MF4A 1LTQA 2REQA 2RHMA 4JP2A 4S1WA 1QV7A 3RUHA 3ZV7A 3NRCA 1LVGA 3WZLA 4CFYA 1K7YA 3O4JA 1C3EA 4CIYA 4OHUA 1II8A 1X7ZB 3EAFA 2W2NA 4P38A 2GD6A 1OX4B 2D2VA 2NTNA 4G09A 4IUYA 2EEPA 2P9BA 4R2LA 1VCHA 2QJOA 1SIBE 2OZLB 2RI0A 2YYZA 5D01A 2ORWA 3G6KA 4GZ3A 5THQA 1E2IA 4EMBA 3LY9A 1L7NA 5CIQA 3OETA 3OZDA 4N7BA 1SA0A 1ULUA 3QVMA 4Q6WA 5TF4A 4GX1A 1SUCA 2QI9F 3DTTA 1LZLA 2HAEA 3OQMA 3EWAA 1ND5A 3K8ZA 2QW0X 1YBVA 3ADBA 5COBA 1GEGA 3SE7A 3M4NA 1JIXA 2QX4A 4JEUA 4OQYA 3IP1A 4L74A 1ZCFA 3JZIA 3DYBA 1XR3A 1ENPA 4RNDB 5TY0A 3VHQA 1NW3A 1IL0A 1QZ3A 4CWAA 2QTLA 2OENG 3L46A 3LZCA 4B6FA 2F59A 2BWJA 3LPAA 1XDUA 3GJ0A 1U02A 3NYRA 4KACA 1G63A 1PAUA 3IR5A 2CDBA 4ENUA 3T3OA 2NN3C 2G40A 4I3FA 1T2NA 3I72A 2Q3DA 5I9BA 1BE1A 3TSAA 3MUOA 4PW0A 3DE2X 5IKMA 2D5IA 3N74A 3YASA 2AYZA 1N6HA 1P73A 4NDNE 5ALNA 4HDQB 4B5LA 2V3WA 2L69A 4IV5A 2IGTA 4CKXA 2CXRA 1SCBA 4WXHA 2QRNA 3EDCA 4R4JA 5T6MA 2XVAA 5GINE 3UH1A 3RHSA 1UR5A 2EKBA 1H2RS 2UVPA 1A27A 3F6EX 1GCGA 3PXBA 5CJPA 3RSFA 1TVKB 2PRIA 3K1TA 3UK1A 2J0QA 1S4QA 4U7DA 4F1KA 4HFMA 4YMTA 2B30A 5LP6C 3DOFA 4G65A 1EHIA 4AIIA 2G9VA 4MV6A 3DMPA 4BE4A 3BF8A 1C1XA 3GDFA 1DG3A 4P35A 4BV8A 2ODNA 3JWIA 2GPYA 4WFQA 5TMDA 3T5CA 5JALA 5ILOA 1MORA 1Y8QB 4HTFB 4B34A 2KBEA 3LFHA 4XOUA 1WHTB 1R5BA 2JFOA 2XEDA 3OZRA 2ZVDA 3EA5A 3WMFA 4B3RB 2ZXFA 1L4FA 3NEAA 4DA9A 1ILWA 2O7NA 5DGHA 3RV3A 4MB6A 1T25A 2RHWA 1LFDB 1KI8A 1LLDA 2GMWA 2XF8A 3BEDA 4HDCA 4EFDA 2O57A 3OJ0A 4M1EA 5EPEA 4KPEC 3T9AA 3PFCA 3BORA 2YFYA 4PZCA 4Z0HO 3QU7A 5JAIA 2ID7A 4CXMA 1CY0A 4AXBA 1J5EB 3WGQA 4TV9B 3B82A 3SBEA 2GZDA 4X90A 3TTXA 3SQLA 2DPHA 1Z22A 3MWDB 3P9XA 2WMOB 1TX4B 4QYXA 3A6PC 4RH3A 3W5VA 4OYHA 4YMLA 2VPTA 3DB1A 3I1IA 4M1ZA 2BMFA 3ZS9A 2A57A 3MELA 1CHNA 1CJMA 2HI0A 4KO4S 4R05A 5FO0A 5BT9A 5SZKB 3AESA 3R9WA 1PZHA 2C2YA 2ZKLA 2ZTHA 3UVEA 1W73A 2Q27A 4ESVA 1DS6A 4OO3A 3I0NA 2HZ7A 3QEKA 1LGYA 2CJFA 4NBUA 1CZNA 4RGQA 3GJ4A 3PNVA 1P39A 3IYLW 4CKCA 1G9XA 1S9HA 3U4HA 2IU3A 4BVKA 4YC7A 3DEJA 1QUFA 1JFFA 2DZDA 2A5YB 3LW7A 3CNOA 4KIGA 4M98A 3TKLA 5KNDD 5K5EA 1A4RA 5DGTA 2EBUA 1C3XA 5GVSA 4TWRA 1M1NB 2LCQA 3T3EA 2ZRDA 5DTIA 1JE0A 1XKLA 2PY6A 5HWSA 5B1SA 1ABBA 5FPPA 3BAFA 3ZWKA 1V1RA 1E18A 4BNKA 1T9AA 4NFYA 3RRZA 2XE7A 2VFAA 1R8JA 1R8SA 3RASA 1TQ6A 1YOBA 3ZY6A 2IV3A 1L4YA 4L02A 2Z5FA 3N2GA 5D3QA 2W6NA 3RWOA 3JYHA 3LGAA 1RAEA 2CW5A 4W1SA 3VNAA 2WJIA 1IIRA 3GUZA 2GZ1A 3WV5A 3Q3JB 4BO9A 4ZK2A 1Z3IX 3FVQA 2NM0A 3GJTA 1D7AA 1USGA 3RROA 1Z4LA 3AF4A 3AZPA 1JMVA 4LXYA 5EJ2A 4A6PA 1HG0A 2Y27A 5ITSA 5LDHA 4ATNA 3SQXA 5LQJA 1CDZA 4TGLA 1E62A 2GCPA 4L8WB 4ND1A 4I46A 1E99A 1E1YA 5AI4A 4MMZB 3BIOA 2OXTA 5DV9A 3K0FA 4CF4A 2GA9A 3PVCA 6GPBA 5EJ4A 1SZCA 4IFEA 4BC1A 4V38A 3S2IA 2WKPA 2GTHA 2EKDA 2HSZA 2VT2A 1KK0A 5KKAA 4DHEA 4BRUA 1YR7A 3K96A 3KTAA 2CT8A 1EHCA 1P75A 1YS6A 2GHRA 4O8ZA 4B84A 4DWJA 4HDMB 5ALJA 4LX0A 3UJNA 1MX9A 1AK9A 2OZPA 1NJ5A 2PZEA 4Q1CA 4V39A 1NVTA 1X74A 2HHAA 1SC1A 4TRRA 2QPTA 2N1BA 4UBIA 3JQ6A 1AUXA 3DV0B 3OZXA 4UW9A 3RNOA 1NONA 3MMNA 4E22A 5AKKA 1PNQA 2AXPA 4MDEA 2G82A 2ZAYA 4RY9A 1PF7E 1XFDA 1M2VB 2C9ZA 3BZBA 3D54D 1ACMA 3EYAA 4IDPA 5IZCC 4AF7A 1Z73A 2FN3A 3O1HB 5C5EA 1J8VA 2Q3BA 2NVWA 4UDOA 1M67A 4BEBA 4MJXA 2Q1SA 5TMEA 1BWPA 3T3GA 4E7OA 1IQRA 5KYXB 1XKQA 1JL3A 1OH6A 1WAMA 3WKDA 1H93A 5C32A 1GPAA 1GAQA 1E4VA 1JPUA 1UBTS 2B1QA 1JHPA 2KB0A 2N0SA 3OCJA 4GT1A 4URZR 3UWKA 3NI2A 3AR6A 1D8TA 3DO6A 3X0DA 3PNOA 1OXKB 4K87A 1CNEA 3ROXA 3ISJA 4A0FA 2VZEA 1YQDA 3HRHA 3UZUA 1TW3A 4OGGA 3JAWB 2AGVA 3S5UA 3THRA 4H7JA 3HO1A 1C9KA 2EX0A 1DU4A 3DW1X 4Z9AA 4HOYA 4A6EA 2LD4A 3WIEA 3PD0A 5HA5A 1Z56C 2IP4A 3HKBB 3DOHA 4FI3F 1VYTA 3AW8A 4LEIA 4ZDKA 2H1FA 4XVRA 4NOMA 4EW3A 1FYXA 2D6FA 5IJWA 3LBIA 4MRRA 1QFXA 1AQYA 3LKVA 3NRBA 5BYKA 3WK6A 3E1KA 3IAAA 3IRUA 3V8NA 3BQ9A 4HATA 4COKA 1QO0D 3CU5A 4ZYXA 2XLCA 3IMFA 1L5ZA 1NULA 1BXRA 3LFTA 4KVZA 3HU2A 3IPYA 5F7XA 4M83A 4EYQA 3I12A 1O87A 4IDUB 3P0FA 5LU9A 3AFHA 1EUDA 1NXWA 1EWTA 4LE1A 4Q3KA 4Z54A 2K5UA 5PNTA 1QG0A 2PLNA 3EJWA 2A58A 1IB0A 4B85A 4FHEA 2BTQA 2WHYA 1WS6A 1UBLS 3IQXA 4NNOA 1DWQA 3S99A 3PWZA 2HB6A 4D9GA 2FU5C 5HVNA 2C5AA 5E2BA 2A9FA 4M1YA 2JI9A 3C5CA 4HCJA 4LWZA 1T91A 2P6PA 2Q3LA 3AR4A 4YS6A 1O94C 1ZD8A 1K6XA 1T5LA 3P52A 1CZUA 2NXWA 1ZCZA 1T2VA 2ZRQA 5DNVA 3LX6A 3RM3A 4IGFA 1QJ4A 5T8KC 1FXWA 4UXHA 3EXAA 3R7DA 3AEQA 2BMDA 2WFZA 4PYQA 2GFIA 4C7OA 3IDFA 3N6RA 4OOEA 4JI7B 2D1RA 3VR3A 1G2PA 3I6MA 2BMJA 1NNUA 3B52X 2QXYA 2X2OA 2G5TA 4WCFC 4ZODA 5FRDA 2IS6A 1HE1C 2PKRA 1N6KA 2O48X 3NV9A 4H7DA 5E1MA 2IPMA 4LMPA 3G0CA 2GYYA 3L8FA 4JQSA 2BE7A 2XUHA 2PUGA 2FMKA 3HSYA 4YAJA 1NFQA 4I1UA 3LL7A 4XIIA 3R5SA 5CHEA 5IKPA 4MKXA 1GL9B 4FYVA 4NCJA 5F1KA 4D9IA 4EKNB 1E98A 3QU9A 1XTSA 2L17A 3LV8A 2YRWA 1SPXA 3KZKA 4L4UA 4CCYA 1VI5A 5H5JA 4CCAA 1DXYA 2YWFA 1LBTA 1XA4A 3D6UA 3PR2B 2PWBA 2E9SA 4GLFA 4MO9A 4TMYA 3KDAA 5AVKA 3TYXA 3MQ2A 4IGEA 2VOEA 4KVAA 3ZKAA 4XVHA 3IEIA 3EZNA 2CMKA 3QI7A 4I5DA 5EP2A 5B1HA 3WDMA 5D6OA 4OHCA 3JQFC 3VSEA 3W2FA 2A4KA 2MWMA 1QR6A 1ZZEA 2IS2A 2AKAB 4W63A 3R6WA 3O74A 4LHXA 4JASB 1FYFA 1CRQA 1G66A 1WVIA 3IOCA 3SYRA 4KLAA 2HUNA 4L9AA 2C5LA 3UA3A 4BL5A 1CIVA 1I33A 4BMZA 3AUFA 3OPMA 3SIPA 2ZE5A 4PO3X 4ARBA 4CQJA 3REGA 1TM4E 4HGYA 5I9IA 2ORIA 2QQEA 3HJBA 2OM6A 2ZRPA 4R69A 3PXAA 1QZTA 2EYUA 3T9BA 5JDIA 3D7LA 1T9GS 3WRWA 4P4SB 5IH3A 4Q9LA 3ZWNA 3NM5A 1DC5A 1LSSA 4YRNA 3DE7X 1Q7TA 3QFSA 4ZANA 1JA0A 3ED5A 4NL4H 1B8OA 1BHO1 1RWOA 2XAAA 1GUDA 3DAYA 3GX1A 3OP1A 4O5AA 4UMVA 1OJLA 3CKLA 1NWCA 1W4BA 2I3ZA 1Q7BA 3IKMB 3JAKB 4NCIA 1RWPA 1XTUA 2GBIA 5L3ZA 4DNFA 2IBSA 3GFPA 3RSQA 1DB3A 1VIAA 2HL6A 2R1VA 5K6RA 4BX9A 1RYFA 2H65A 2RHJA 5EHXA 1U2DC 1JYEA 1QHHB 3EC2A 3LLUA 1TMGE 3I30X 1Q0LA 3MBIA 3WLAA 5IYZA 1EFHA 2HJRA 5LYJF 1HEUA 2AFIB 3C8UA 5ALYA 5LUBA 4U9IS 2HF8A 4JXJA 4RSRA 2V6IA 4GMGA 4M9UA 3MK31 2EV9A 1L5RA 2Q4EA 4BTLA 2XNCA 2NW6A 2PS0A 1XCLA 3NDPA 3S3TA 2CE7A 5JAHA 5GADl 4D8UA 5IDWA 4I1OA 1Q83A 1W1WA 2OHGA 1Z25A 2ZB7A 1ZSVA 2CLHB 4FZVA 3BRSA 1NMEA 2HMUA 1M0TA 3G5LA 3H83A 3ITDA 3MCAA 4C78A 3R7WA 5F9FA 1AY0A 1TIPA 3B60A 1UFQA 3QXHA 4U7FA 3X2FA 1YR6A 2DTEA 2FP4B 5KCMA 4QT0A 5A9RA 4C3OB 1RACA 3OOJA 1JHZA 4ISBA 4ZDWA 4ZZIA 3A2KA 1PS8A 1F0YA 4YCNA 4WBXC 2VAXA 2WTNA 5B7GA 4RMIA 1Z29A 1SU7A 1GUBA 5LP6B 1NN5A 1I4WA 1B8PA 4ZMBA 1QHFA 3USZA 1I10A 2GVZC 4ZZ0A 4HNUA 3LK6A 3ZCSA 1GO2A 5DHFA 1E0DA 1JWLA 3WWEA 2VP3A 3LRPA 3WYBA 2PR7A 4YJ3A 2VH2A 3ORRA 3BGVA 5KBYA 4BB9A 3IAS6 2GAAA 1Y4ZA 4JCCA 5ABPA 1IG3A 2BEWB 3ZDFA 5FTWA 3Q4GA 4ZVQA 5TT1A 1F8YA 2WSSD 1MR3F 3QLTA 4HWTA 1PR1A 3BJZA 3WWDA 1YS7A 3L0ZA 4EJ6A 5BSMA 1TUIA 2QK4A 4YVFA 4Z5XA 5MGBA 2NU6A 2G5PA 3I23A 4BVEA 5H9WA 1J99A 1G8KA 1JEJA 3NBAA 2A0WA 3DUWA 4L2IA 3VTFA 1WSBA 4G85A 2P0EA 3GA0A 2XVMA 1GYQA 3JPWA 1FDVA 1NZDA 1E9DA 2RBGA 1PKEA 3ZHUA 2ZBUA 2MSNA 1X1TA 2QXTA 3PJEA 1M54A 2YN4A 1OPRA 2APJA 4V1CI 5CJ2A 4ZYVA 2UXDB 1FUKA 4H2DA 3VZRA 1BS2A 3COWA 3DEIA 3TRFA 4UCXA 3STYA 4Q4CA 2VXCA 2YRFA 5H81A 3SP1A 3D4IA 3RJTA 4M1WA 1JG3A 2ZVPX 5DN6A 4OI0A 1KYTA 1O7JA 1IZZA 1P7ZA 4ND6A 4JB0A 2V65A 1DQSA 1DV2A 3LW8A 1M6HA 4GGPA 4EG7A 5KNBA 1ZD3A 1SXHA 1ZKMA 2IYTA 4RYLA 5KJCA 2JZOA 3DLHA 1RYDA 4JD5A 5A4KA 2E2WA 2Z30A 1VHDA 4OUDB 2VT7A 4PXYA 1OZ0A 4RFLA 1VKRA 3T35A 1H3NA 1CHDA 3JCZA 1HE8B 1IVYA 1E59A 4WMLA 3TZKA 2BFMA