2Q1ZB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
185
Chain Sequence
b'TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RpoE, ECF SigE
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 36
structure length 185
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2q1zB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1zB02
1XRUA 5I0SA 1IPJA 3RYKA 2MPFA 2GAUA 4IESA 5FLIA 4FBFA 3GBFA 5CADA 4IEVA 1ZZ7A 1PMIA 5I8TA 1ZZ8A 1OFNA 3LZZA 3N4MA 4HN1A 1X8MA 2CAVA 5I8SA 2XLGA 4B29A 3CJXA 4PIYA 3G7DA 4HZFA 3B02A 3M3IA 3OGJA 1NYWA 3TNPB 5I0UA 4EWEA 1RC6A 3R6SA 5KHIA 4QMAA 4NVPA 4R8HA 4QM8A 2BNNA 4LUMA 4KL1A 4WZCA 4MGZE 4PJYA 4MUVA 4OFGA 5LRRA 4CYDA 1LR5A 4XF4A 1I5ZA 3NL1A 4XFIA 1ZRRA 2Q0AA 1ZZCA 1FI2A 3M70A 1O7FA 3ZDSA 1J58A 4H7LA 4YSFA 3LWCA 1J3QA 4LTAA 1O5UA 4FT8A 4AXOA 2PAEA 3HQXA 3BALA 3E97A 5AVPA 2PQQA 1PM7A 3KGZA 3RYPA 5BY5A 3S7EA 5D1IA 3ELNA 2Q4SA 4LULA 5FQ0A 2Z2SB 2XKPA 1X8EA 1ZVFA 2XLAA 4HVRA 5K8SA 2UY9A 3NVCA 4Q0VA 1NE4A 4DINB 5E16A 4ZU4A 2QNKA 4AQ2A 4OLLA 5BPXA 5E1RA 2ZKLA 3D0JA 5J48A 3E6CC 3CF6E 5LRSA 4Q0UA 1ZRDA 1UPIA 1CAUA 2PYTA 4L2NA 3FFQA 4HN0A 4I0BA 4Q0PA 4WBBA 5JSRA 4UXAA 3KCCA 2QDRA 3PNAA 1J59A 1O3SA 3RNSA 4XETA 4R52A 3OD0A 4XFBA 5I0RA 1XE7A 5EZWA 1YFUA 2OYZA 3EBRA 4EV0A 5HI0A 4XF1A 4F7ZA 4JV4A 5CU1A 4YNIA 3E5UA 1GQHA 4Z07A 4KWLA 2D40A 2XGXA 2OPKA 3IWZA 2QCSB 3FWEA 1O5LA 2KXLA 3LA3A 3UKNA 4E2SA 4JTOA 3KGLA 1NZCA 4HMZA 1RUNA 4X6QB 1SFNA 3FX3A 3CLPA 3IBMA 3ST7A 2PAMA 1H1IA 1CX4A 2CAUA 2GC2A 4HLTA 4IEWA 1YHFA 4XF9A 4AQ6A 5F1RA 2IXKA 5BUVA 4BIFA 4LEJA 3QACA 1G6NA 4MX3A 1ZRFA 3NW4A 4O9GA 3H1YA 2DCTA 1VJ2A 2PHLA 4JTNA 2V09A 5LEKA 3U10A 2IXCA 4XF3A 1ZRCA 3L2HA 1CGPA 1CAXA 3LAGA 3NKTA 2CGPA 4LA3A 1J3PA 2O1QA 2XL9A 2ETEA 2VQAA 4HSLA 4D7SA 1UCXA 1CAVA 3BU7A 1DZRA 1X7NA 3KMHA 1Y9QA 4YYOA 1FT9A 3HIFA 4XFCA 3C3VA 4HBNA 3WW3A 3DV8A 4P9GA 4XFAA 1ZREA 2PTMA 4KWKA 5T3NA 3VHRA 1YWKA 3D82A 1XE8A 4JVAA 3GYDA 5I0TA 3RZZA 2E9QA 2OZJA 3DKWA 1YFYA 3CO2A 4KWJA 4IEOA 3H7JA 3H8UA 4IETA 1QWRA 5JSOA 2H0VA 2GU9A 4LUKA 4MGYE 4LLOA 2GC3A 4UBGA 1LB2A 4F8AA 4Z82A 3IIAA 1Q43A 3UKVA 1CAXB 3H1MA 5C6CA 2HJIA 5JAXA 4O9EA 3H1WA 4I3PA 4J1XA 1DZTA 3U0ZA 5FCCA 3E5QA 5J3UA 2CV6A 3IDBB 5FLJA 3E6DA 4LA2A 3LOIA 4I0AA 2QVSB 2FQPA 3HT1A 3SHRA 3OCPA 3RDIA 2UY8A 1H1MA 2XKOA 4IEQA 5KBFA 3MPBA 1O3TA 4XF0A 1Q5OA 3H7YA 4IEXA 2MNGA 2GC1A 3EJKA 4BHPA 3EHKA 4I2OA 1QXJA 3O14A 2BGCA 5KHHA 3PVBB 1YUDA 1GQGA 2I45A 3JZVA 3ETQA 4A2UA 2IC1A 1WGPA 4KU7A 2BYVE 4FAGA 5LEJA 4GULA 3OTFA 3H50A 3S7IA 2ET7A 2N7GA 1V70A 5KHJA 4HVOA 3WW1A 2ATFA 3RPQA 4MGIE 5FQ0B 1EY2A 4MZUA 1ZX5A 4FAHA 1J3RA 2BEOA 4ONUA 2OA2A 1VR3A 4MH0E 2BNOA 3I54A 4X6RB 3SCFA 5JR7B 1CAWA 5BXXA 3WW4A 4RD7A 2B5HA 3SCGA 4AVBA 4EROA 3CL1A 5I91A 4I01A 2IXJA 3HT2A 2K9ZA 3FZ3A 1CAUB 1LRHA 3EQEA 4J1WA 4YRDA 2UYBA 1OI6A 1YLLA 3H3UA 4ZU7A 2Q30A 4Q29A 4D7TA 1VP6A 5FLHA 5J7MA 2GZWA 2H6CA 4XFFA 4UBHA 1LKNA 2UYAA 3S0MA 2EA7A 4IEYA 4EWDA 4KU8A 4XFGA 2OZ6A 1J1LA 4IEPA 3EO6A 5I8YA 3ACLA 3SCHA 3CEWA 2EAAA 2IXHA 2WC2A 1O3RA 4TLFA 3QOPA 1CAWB 4E2QA 2VPVA 2PHDA 4N9IA 1RGSA 1OMIA 1UW8A 4MGKE 1DGWA 3ROUA 2HKXA 2H6BA 2P17A 3LA7A 2VECA 4IERA 1RTVA 2XLFA 1YFXA 3ES1A 3PLQA 2Y0OA 3MZHA 3WW2A 1NXMA 2GH2A 1RL3A 1YFWA 3USSA 3E5XA 4EWAA 4PIXA 4QGMA 5I93A 1SQ4A 3BPZA 3BB6A 1L3JA 3H3ZA 4NQWB 2GC0A 1Q3EA 2O8QA 3IDCB 4Q0SA 3ES4A 1CAVB 1TQ5A 4I09A 1Y3TA 2MHFA 1I6XA 3LA2A 3I59A 4ZU5A 3UKTA 1UD1A 4K8FA 5CVRA 3MYXA 4XFHA 1EPZA 1ZNPA 1QXRA 2IXLA 3FHIB 2PFWA 1NE6A 2EVXA 2ZCWA 4QGLA 3HUGB 4QXKA 4E2GA 1ZZBA 2IXIA 4HVQA 1ZZ9A 2B9UA 1RUOA 1JUHA 1QY4A 2F4PA 1WA4A 1UIKA 4META 2C0ZA 5FPXA 3MDPA 4Q0QA 1EP0A 5EFUA 4XEZA 3NSTA 3U11A 4MV2A 4IEUA 1IPKA 1HW5A 5BV6A 4QGNA 1UIJA 3DN7A 2B8MA 2WFPA 3I7DA 2XL7A 3E6BA 3KSCA 1WLTA 3I59B 2Q1ZB 4AVCA 1O3QA 4BH9A 1X82A 3RYRA 1FXZA 1O4TA 2BNMA 3FE5A 4PIZA 4BYYA 2D5FA 4IEZA 2PA7A 2QJVA 2PAKA 3NJZA 5KHGA 4QX5A 3DL3A 1EYBA 1SEFA 2XHKA 1OD5A 3SXWA 1DGRA 4I02A 3D0SA 4AVAA 3FJSA 2ET1A 4HSJA 3H9AA 5C8WA 1ZZ6A 2FMYA 5FDBA 5JSPA 2D5HA 4WVZA 3BCWA 2Z69A 4N9HA 4QM9A 5KHKA 3SMHA 4L11A 2K0GA 2D93A 4YARA 3OF1A 5JCTA 4ORFA 3TNQA 1U12A 5FPZA
chains in the Genus database with same CATH superfamily
4PF1A 1P8JA 3B73A 1GZWA 1VBB3 2JIGA 3KT4A 1ZZ8A 3MVPA 2DJNA 2VVFA 2VZ3A 3J81Z 1R58A 4INDA 4NVPA 4I6ZA 1Z1DA 1LGCA 1MIJA 4LUMA 1GBGA 4OUMA 1L7QA 1BVP1 1SLAA 4N90A 1I5ZA 2IPQX 4YFWA 3TO6A 1FTTA 3DFGA 1ZZCA 4HONA 3UETA 2DVGA 2FD5A 3LWCA 4XZUG 1E3OC 4KA4A 5CZKA 2R7FA 4XJZA 4BK4A 1IG3A 1RYYA 2A6EF 4OIQF 1N1VA 2F2EA 4LULA 4LBMA 1ZVFA 3WUCA 2AH2A 5IYBJ 3K4NA 5K8SA 4F83A 2KDOA 3C7JA 1I3HA 2DMPA 1FBUA 3ME2A 3A02A 1IXCA 3K4LA 3TP3A 1D2QA 1YQ8A 3OOXA 3ZPYA 3Q8BA 4O3MA 3MIDA 3NEUA 3S1MJ 1T0FC 1ZG1A 3K6GA 3ZMSA 2ZXQA 1JKPC 3NAPC 1SLTA 3AB0A 1V5GA 3OBAA 4WXHA 1I27A 3VYUB 2PHUA 1QBJA 4XF1A 1IAWA 1ULCA 4AHZA 3T5XA 1BI1A 5D2AA 1YC61 3LIGA 2OPKA 1FV3A 4DZGA 4CCNA 2ZSHB 2EIGA 1HN0A 3M3EA 3P3NA 3EYYA 4CICA 1AWCA 2DYCA 2ZBKA 3ACHA 3RJRA 5JLWA 1YHFA 4ISRA 1W7PD 4HSRA 1RESA 2LBFB 3PUSA 1T6GC 4MX3A 1AXKA 3NW4A 5JLVA 1S8NA 1UG2A 3I97A 1KQ8A 2P81A 1QHHD 2DA6A 3AMPA 4NIAA 2RM23 4Y22A 4AE2A 4UAPA 5GAGJ 5F1JA 2XIGA 4CPBD 4BDZA 4M3CF 5L3GA 3U1KA 4ZS2A 2JE7A 5FUIA 3C3VA 4GXLA 2EXJA 2W52A 5T3NA 4Y13A 2A7AA 1SC7A 1PVC2 2OPWA 3VFZA 5FKLA 1QQP3 3BT9A 1RUC3 5LGTA 2HWB2 1IN4A 2X6WA 2WNUA 2GU9A 4NOTA 4IHWA 2GC3A 1N3QA 4UBGA 3CUOA 2WV1A 5KC6A 4Z82A 1TQPA 3CC7I 4M00A 5A6ZA 2YFUA 5EGOA 2RV9A 4M72A 4IE4A 2EQRA 5J3UA 5CA6A 3VDCA 1YE9A 2FZ1A 3WZ1A 4I0AA 2RS11 1H1MA 3KQ4B 5ICFA 4ON0A 5C5UA 1JUPA 3HYIA 2XROA 1QXJA 4XMIA 2BGCA 3IP4B 2XG3A 1RVF2 3KVAA 1IZ1A 4W6WA 3HGGA 4CEWC 4A2UA 3A01B 3MIFA 5TRDA 1G9DA 2YROA 2N7GA 1AJOA 5ACA3 3ECHA 2VCAA 4ZHNA 4COWA 1OA3A 2ACJA 1NHAA 1NH3A 1A6QA 1RMU2 2KRCA 4PSWA 4YG0A 4CTEA 3GLLA 2RDPA 3FMRA 3FBNB 1DGRN 2NVQJ 1AXYA 3MICA 5KXDA 1CAUB 1ETVA 4J1WA 3OBTA 3ZO0B 5M5XJ 4Q4W2 3K69A 3GZNB 2M0CA 2Q30A 4LBQB 3QU6A 2KISA 1ND3B 3U21A 3ALQA 5T50A 4Q1RA 5ICCA 5T5PA 1MMAA 5JVGF 3HD8B 1JS9A 1QZZA 3A21A 4B43A 2FOWA 4M73A 1JYVA 4W4ZA 2L5QA 3VDDC 2M45A 3T30A 2ID3A 5C9AA 3OJBA 4AGRA 2BBAA 1QF3A 3H3VK 4MGKE 4C3IJ 3CHXA 4XRMA 5FZOB 1PGW2 1DLCA 1ND3C 2XLFA 3UR3C 1E3HA 4Q4Y3 3N9OA 3HJRA 5FOJB 1LEAA 4M6VA 3WG7H 3LPFA 4EWAA 3AZZA 5ABJA 3O1OA 4EM1A 2W95A 3WF2A 5FPAA 1UYXA 5B1AH 1TQ5A 3JR9A 2AXTC 3F23A 4OI1A 2V26A 1H4GA 4NMIA 3NWTA 3AYAA 4RAFA 3RZHA 2D6PA 5DAPA 4JRAA 3TN92 2PX9A 4OUEA 4A7YA 2E33A 4QGLA 2ZAHA 3AXDA 2VAUA 2ARXA 4YZ3A 2ZHNA 1UCRA 4P9XA 3MV11 2UURA 1WFXA 3VDBA 1Z78A 1UU6A 1JE8A 1W0TA 3AFKA 1JYCA 4G94A 4DB5A 2HQ5A 5JMCA 3ZMVA 3WDYA 4YVSA 5FP3A 1LJ9A 2UXXA 4G8XA 4XRSG 1QJY1 5FLXK 3POGA 3A23A 4AWXB 2DPDA 4UVAA 4Z2YA 5L9BA 4V2VA 3VD4A 3D0SA 4YM0A 1F9KA 1QXPA 5C8WA 3CMYA 1CWPA 2ZZJA 1UY0A 2LD5A 3AZYA 1FOWA 1DHKB 3GMEA 2K9QA 2F48A 5FMDA 2A6HF 3DBHB 3NJYA 5I0SA 3RZLA 2BHYA 4DYCA 1RUE1 2YC0A 2GQQA 2GAUA 2YY1A 2Q1FA 1OA2A 1GV9A 2XBO1 3N4MA 1R4MB 4ZY9A 3CDLA 4IGOA 4F3QA 1D0ZA 1A5JA 5FPVA 3N36A 3TNPB 3AFGA 3R6SA 1B6AA 5KHIA 3D6EA 2RS53 1LKXA 3G1LA 2Z9OA 4XHXA 4DMIA 3ZPLA 4CSWA 4XF4A 3N9MA 4KNCA 1T6BX 2VCCA 2K4JA 5SV8A 2EF6A 2ZXWH 1JXNA 4DPNA 2AQFA 4JX6A 4DW6A 3RG0A 1NCRA 4YZ2A 5AVPA 2GNMA 2W9XA 1ENQA 1U5TB 4FSJA 5KCMA 2PJRA 3BPVA 5L3CA 3ELNA 2RM22 3AM2A 5HBAA 4MSVA 4PLNA 3FLRA 4JGYC 5EZGA 2DF7A 1Y4WA 3CF6E 4C9YA 1CX1A 3I2IA 3ZMOA 2JICA 4DXZA 2P5LC 3SH4A 2IGKA 1ZELA 1KJRA 4AZZA 1O3SA 3A0NA 1S6LA 4AEMA 5EYYA 4HF2A 4HT1T 4GXOA 1WJBA 3FZVA 4BEHB 4XIKA 3OD4A 5LGUA 4E6KG 2HWD2 4YNIA 5TJJA 1Z05A 2OD5A 4KWLA 3LA3A 4FASD 3JD73 3VHNA 2MD5A 4LHKA 4C0BA 5IVYA 2Q8CA 1RUNA 1DQ5A 4XN3A 1OQEA 3VSLA 2PAMA 1Q8PA 1OF3A 1WKMA 1D5VA 4QPQA 2XSJC 3WHUA 5KWRA 1W6MB 1NG0A 3ZMUA 4WM8A 1TL8A 4XIOA 2IVIB 4AL9A 2Q8DA 4RGKA 3VZLA 4E7KA 4E7JA 1OVPA 1OFSA 3BR0A 1RUD3 2D43A 3TAYA 4TTGA 2G19A 5FZIA 1HLVA 1B8IA 2XONA 3TEWA 5JXHA 2XJTA 2L01A 1RHI1 1XYNA 1DZRA 3ZOIA 1OLME 4RHV1 4YW5A 2MABA 1Y9QA 2LS6A 5CG8A 1MQTA 3DKQA 1LU2A 4KWKA 4YG2F 1LDJA 4Q4X1 5I0TA 4P55A 4BXXJ 4QB6A 3HSEA 3H7JA 1OCPA 3EPZA 2A3SA 2MEV1 2DOFA 4MXWB 4CDWC 4OINF 2C9KA 2R7OA 2JG8B 5JAXA 1MS1A 3A7QA 2Y30A 2WS93 1FC3A 3LOIA 2E7XA 4AWDA 1E57A 4DYQA 2K9NA 3G73A 4UY8I 3O14A 1XCVA 5DDJ1 1JZ5A 2OC6A 4ASMB 2ZMEB 4YM1A 5DAWA 2HYGD 2WAEA 5F5IA 2JE9A 2G9GA 4GULA 3BODA 5APAA 4MTEA 3L1PA 3ZN0A 2B7YA 4YIFA 2HNHA 1IG7A 1YEWA 4CDQB 2QWWA 5KHJA 2N8GA 4XORA 2PHWA 3BR2A 1PMJX 4MHUA 3QP5A 3T4VA 5FQ0B 4WVMB 1QH6A 3IT8A 1H2KA 1R6RA 5FKOA 2XUEA 3K4JA 1HF0A 3KM5A 2V4VA 1IXRC 3KYLA 2VCBA 3HT2A 1DCSA 1ASJ2 1Y0UA 1CJDA 3MWMA 2Q8KA 3VV1A 1RXFA 1W0PA 3S1QJ 2UYBA 4ZU7A 4Y5TA 4CDQC 3H0DA 1FEXA 5FO8B 2GH8A 1R082 1DPUA 1Y7BA 2EZHA 1W8UA 4RAYA 3QODA 4EWDA 4KU8A 1N77A 3SFZA 5E79C 2TUNA 4NN0A 5LGNA 3SCHA 1UMZA 1O3RA 1LFUP 5SV5A 2A3YA 1LENA 2XVGA 1YQAA 3K10A 2O8OA 2JTVA 3LE0A 4LK0F 1RINA 1S0EA 4UF0A 3PURA 1EKEA 1COV3 2BXZA 4XL9A 5G04L 1LGBA 1I1GA 3MZHA 4IV3B 1YI7A 2GH2A 1MSFC 3AKZA 5FKCA 4FPOB 2XPUA 3HNMA 1L3JA 3H3ZA 4LORA 5F39A 5IK5A 4A3CJ 5DUKA 4ZYEA 3WTVC 1H6YA 2JX9A 2BV4A 4PGHA 3HGYA 3VPRA 3VYRB 2W1SA 4LB5A 1ACCA 5CFCA 5CYYA 1G7YA 2VXDA 3TQNA 1UXZA 5C8CC 2JWTA 1R64A 3POEA 4AK3A 4PDWC 1WH7A 1ULGA 4M3CA 4YRVA 3DBRB 3ZLIA 4HVQA 5JOWA 1PUEE 3BTCA 2HH9A 5F3IA 5L3DA 4QKBA 3WDTA 3TEDA 2VMGA 4TXWA 4HQEA 4MV2A 2J5OA 4QGNA 4F3JA 4A6EA 1UN1A 1BIBA 1LVKA 4FE4A 3SZPA 4TZDA 1VLNA 3RPUA 1H8TB 1NQDA 4JHTA 1HB1A 3E7LA 4B47A 1QJU1 3IPVB 3DPRC 1J9IA 1W6NB 4PIZA 1UYYA 4YGEA 4BYYA 3I53A 1XX5A 2PMUA 2P4EA 5CB7A 5DN2A 3I4IA 4OUSA 2JENA 4MGRA 2E7AA 5EWSA 1U9NA 3H9AA 2R4GA 2JDKA 2MH9A 4OULA 3PSFA 2BWAA 1HBXG 3BGAA 4JOMA 4KGGA 1RUI3 4Y1VA 1FOKA 4MFDA 4EZHA 3ATGA 1IPJA 2GA2A 1IV8A 3BR1A 4F91B 1FV2A 5IWFA 3ILNA 1GUUA 1D8JA 5M0TA 3MAJA 2P0WA 2XLGA 4B29A 5CYVA 5J47A 4AVSA 5DD4A 4E8DA 2IW5A 3Q0WA 4BL0B 1NOVA 4R9CA 2VUCA 3OIPA 4MUVA 2JQ7A 4WV8A 4E4SA 3V8KA 1WMDA 3VBHC 1POQA 2RVAA 3W9AA 5F2WA 3CC2I 2X05A 5LA2A 2Q0AA 3O1MA 1UU4A 3VBOB 1FI2A 1Y8RB 4D6SA 1WMFA 3FXQA 4CDXA 2JRTA 1ZKGA 4ZZLA 1S7EA 1B72B 1O5UA 3GF2A 4Z1VA 1KDKA 1SZBA 1SAXA 5LB6A 2FDFA 2HWC2 1RUD2 4AOCA 1AYM2 3HPNA 4PJNA 1QHDA 4A0YA 1P7JA 4ZJZA 5C4WA 3ABTA 4A3XA 1G8XA 3TYJA 1WD3A 2XR4A 5FO9B 4ZU4A 2MSYA 3VBOC 4IUGA 1OISA 4L5JA 4B1LA 4XKWA 1W8FA 4AQ2A 3BTIA 1YIJI 2ZB9A 3HEFA 3G6JB 3D0JA 2STTA 3ZMZA 3ZR6A 3ZN1A 1XPXA 1OBNA 4NAOA 1SCRA 1VQ6I 3BP8A 3GYHX 2VPLA 2H8RA 2NVXJ 3RNSA 3RMYA 4DIQA 4R52A 2R6QA 4OCTA 2VKDA 5FK8A 4BJTA 1ENXA 3C2BA 1YFUA 1DGWX 2QE3A 1B35C 1H30A 4EV0A 2CS3A 1C0WA 5IVCA 4D6RA 4Z07A 3USUB 3ZN6B 2D40A 2XV4S 4QPGB 2RDSA 2V5DA 4XRSA 2WS92 2JDMA 4HMZA 4FPKA 4YZ5A 5DCMB 2P2KA 1F5TA 3KV6A 4YG6A 4PI0A 2EFQA 2ZMNA 2JJ7A 5LLQA 4A0XA 2R0FA 3BQYA 1W5TA 3ZFGA 2DCTA 4URTA 1AX1A 4QPGC 3J9SA 2NS8A 2CGOA 1OFCX 1G9AA 2A61A 2ZXHA 4V2FA 2VXZA 5JOXA 5FWJA 4PQQA 1FMWA 2KQRA 3WTTC 5HCHA 1AR91 3OYBA 2YC4A 4MGTA 2EIDA 3U4XA 3D4KA 4HLXA 2QA4I 2WO7A 4D8MA 3GJBA 2XPJA 2DDBA 2QQVA 3MF6A 4ITCA 1HDDC 5L9VA 2BOLA 1VBA1 2O5RA 3BLYA 3EDPA 1NG7A 4XSXF 3PFYA 4QPIC 2R5YA 2IRFG 2BV6A 4PUSA 4OHZA 3UKVA 1IW7F 3H8XA 4I99C 1MS0A 3HWJA 5C5TA 3H8OA 3LWFA 4DY5A 1AL23 1WHUA 1PP7U 1MMNA 4D5CA 4XOGA 5T5OA 2B63J 3ASOH 3ZQFA 1AUYA 2R7EB 5A1FA 5CFDB 1QO0D 3JZVA 3BOQA 3LEGA 3H5NA 4YELA 3JRCA 2VMCA 4ZPIA 4OAYA 4N53A 2HPIA 4U0WA 4JGZC 4AI3A 3LOBA 4Y1UA 5K1YA 3K0LA 2GDFA 2VZSA 3C7EA 2F17A 1J3RA 3CCUI 3ISPA 2WZR1 4AEDA 1ZK8A 3KS7A 3AP5A 5BOXA 1VNDA 5GALA 5FMOL 1VAKA 2RN7A 4YM2A 4II3A 3PMSA 3I56I 3WTUC 2XVKA 2BU9A 2BDRA 1YLLA 1I3AA 2VQTA 4Q29A 3VBUB 1GICA 1I1EA 2NVYJ 2MG4A 1J84A 4NJ4A 5DMYA 4XJUA 5C70A 2EA7A 3GM8A 1TC3C 1W6QB 3A1YA 4NQWA 4HPKA 2QZ8A 1SFEA 1UZCA 1ULFA 1VE0A 3OG2A 2FNPA 4WM7B 1H8AC 1ZBA3 3Q9VA 1D4M1 3T1BA 2XDVA 4KQ7A 5BNOC 4PF5A 1RTVA 1O4ZA 4YW6A 4OHWA 1UOGA 1VQNI 3OUIA 2VY0A 3PU3A 1RUJ3 5DD8A 1VBD1 3CIHA 3T2PA 1W7PB 1RIOH 4HDUA 2YHJA 5E20A 3KEQA 3U1DA 3DPUA 3I3LA 4WM7C 4B1MA 2CGNA 2LY9A 2ID4A 4RQPA 1LJ7A 2QQLA 2OQ7A 2YBPA 5HV0A 2EK5A 4PQ9A 3DECA 1POV0 1YFHA 2F4OB 3THDA 4XACA 4DEVA 1X1AA 4OQ8A 3HUGB 2JKXA 4LBNA 4YZ4A 1QY4A 2F6BA 2LKSA 4PK4A 4CYCB 1X50A 2VTXA 4LQRA 3MFCA 5EFUA 2OAZA 3U11A 1XD7A 3LSTA 3ZMTA 4UUSB 4R9DA 3MIGA 2D6NA 2CYYA 2B8MA 4HXCA 4FCYA 4YGCA 4FP3A 4JQTA 1SPPB 1OYWA 4G6DA 3RYRA 4I98B 2VE8A 5B4XA 3CQZJ 4H55A 1JYXA 4RFRB 2PAKA 2X09A 4A3BJ 5KHGA 3FXUA 1JBCA 2CQKA 2R061 2L7MP 2LY1A 3WQBA 1UAIA 1SAUA 3AX4A 4GZ9A 3HQUA 3OYNA 1LFBA 2BZTA 3R61A 1VRH3 3FHAA 4N9HA 4HX7A 2HQRA 3HKZN 2R073 5A3PA 3I55I 3WTXC 1AYN3 2TNFA 3AL6A 2VT2A 3I71A 3JRAA 2ZKZA 2Y6GA 3T4HB 3HKZA 2NXNB 3RYKA 4BB3A 4O7XA 2PHTA 5DUWA 2NLRA 2ENRA 2MA3A 2RS13 3HHGA 1W6OA 1WW5A 1S3JA 2CAVA 3NAPA 3M3IA 3V56A 5I0UA 1RC6A 3DTEA 3PTYA 3UK9A 1JGGA 3RZJA 1GV2A 4CYDA 1RUF1 4GFBA 1LOEA 2ZGMA 3RQIA 1F36A 5L3BA 5BQTA 4KMQA 3Q5FA 4NC7A 2WO1A 1SMTA 3ZDSA 1MBKA 1FPN2 4PJLA 2IS1A 1TT5B 3WEZA 3K51A 3WF4A 4A3LJ 5FZ8A 1Q56A 3O1UA 1WZXA 1IKQA 3TEXA 5JZGC 3BTYA 3MD2A 5A7NA 2VZ1A 2QDNA 1UB9A 2G7HA 3CLOA 5E16A 3LSMA 1IXSB 3NQOA 5JLXA 1RXGA 2YXSA 5GLWA 2MLKA 4V2WA 3JREA 4XAAA 4FOQA 3LSEA 3E6CC 5LRSA 1W6PB 3AK0A 4HDVA 4P9LA 1YO8A 3M3YJ 1ZYRF 2WY8Q 2AENA 4OHXA 2QF7A 2EILH 1GLNA 5F3GA 4LKFA 2ZAAA 2P3IA 4LO7A 2E2IJ 4CHUA 3AZXA 1AR63 5J1RA 3I2DA 3KGLA 2W4SA 2AR6A 3G2BA 1US3A 1GYKA 3KHBA 1ON2A 2BPA2 1OQYA 3VKLA 2LLKA 2A6TA 4QSHA 2G1MA 5E3NA 4LBKA 2E35A 1R5GA 4XONA 1VAVA 2OXBA 5A32A 2RGVA 3G6EI 4GGGA 5LBFA 3IRQA 3Q0VA 1WJ5A 1P9QC 2CGPA 2HXOA 2QYOA 4LFUA 2J1AA 1HSJA 5D8LB 4C90A 2R7UA 2W24A 1J7KA 1ZREA 1T33A 5FK7A 3RZZA 4LKEA 1R5HA 2FEZA 3M7AA 3GO5A 4CCCA 4HBLA 3A01A 4A42A 3GTJJ 1ETOA 1CF7B 4MGYE 3WUDA 2A05A 5BNQA 1Z21A 4HA8A 3TOJA 2NMNA 5FUNA 2DN0A 3SITA 1KITA 1YQ2A 3PFIA 4KICA 2XJVA 1SMYF 3NQHA 4BHCA 3HT1A 1VMHA 2ZZQA 1K79A 1QJY3 2GOXB 1LDDA 1PM4A 1HLCA 3MUZ1 5D8AC 3EJKA 3LPGA 1Q8VA 1TNTA 4S0HB 4I2OA 1DZQA 2SBAA 4XOTA 1ZBA2 1YOVB 3VDDA 3LQRA 3HDDA 4LIVA 4A3ZA 4YW2A 2IWGB 1JODA 3MZYA 3H0GJ 1AVBA 1GR3A 4IRHA 4FTHA 5KXEA 5ILSA 1KQRA 1MDMA 3A0BC 4V19K 2CHHA 5C44J 1ST8A 3CCMI 4H4KC 5KHDA 1UU5A 4RLFA 1RUJ2 3TDZC 3BKZA 1ND3A 2WADA 4IOAF 4AW7A 4NB5A 2PMWB 1RUE3 2ETHA 5FO5A 2WBMA 3ZOBA 4WCGA 1N3PA 4L5EA 1JKRC 3WNKA 5FRAA 1SCSA 4HKOA 2E7WA 2ZSIB 3N7LA 4A0ZA 3SFIA 3WSOA 1NA1B 1HSTA 5BXXA 2B5HA 5FKMA 4AIHA 5A2QZ 1YJ9I 3J7AY 3FZ3A 4LGWA 3VL9A 3ZYPA 3HSFA 1K83J 2Z3YA 1XBFA 2GIZA 2Y48A 2OX0A 2AYHA 3LDRA 4A44A 4JX4A 2Q8EA 3VHPA 1W2UA 1FIAA 5ICGA 1UELB 1UZYA 2I8DA 4UB6C 4XN0A 1NA1C 1IRFA 3ACLA 4RS5B 4KYWA 4XYXA 4K8RB 3H1CA 4PLOA 1IGNA 4CEYC 3OB8A 3A2KA 3IB3A 4M0HA 1UW8A 3IM0A 2VBXA 1SBEA 2GP5A 1C3HA 4UFIA 4RB1A 3MFAA 5IVJA 3AL0C 1PVC1 1GQPA 1Z0HA 2W1UA 4A3IJ 2HWB1 2EBIA 1B59A 3CESA 3VLBB 1VRH2 2R072 3R60A 4BXFA 1U8RA 2Y0IA 1AYN2 1GWKA 4QX8A 3B01A 1W8ZA 3CDHA 2VMFA 4HG6B 3DEWA 1ODDA 1JUMA 2PLV3 3UKTA 4RDUA 2B39A 5IK8A 3AMNA 2DVBA 1GP5A 3B00A 5A1AA 4GD4A 2ZCWA 2UV1A 2UZKA 3KP7A 2W94A 3GZEA 1ZZBA 1JUHA 5IT6A 3CCLI 4P08A 3E0JB 5GZCA 4XEZA 1BXHA 1RR7A 3NSTA 2XF6A 1TQIA 4LJHA 2VBPA 3HOVJ 4Q2FA 1OYIA 3M4FA 2ESHA 2XL7A 3KWVA 2DT6A 2C26A 1TT0A 1EAH2 2YYOA 4BXSV 1R7JA 2L7ZA 4W6XA 4IEZA 2JPBA 2PA7A 1IOAA 4QX7A 1WMXA 4QX5A 3DL3A 4UVCA 1PNFA 2P6CA 2VQHA 3UNPA 3TOAA 4Q4X3 4I02A 3PIOF 4ZKTB 5L3FA 2CTVA 3FLPA 4Q4W1 4K3UA 4RS8A 4ARXA 3TEYA 4Q27A 3CJRB 2Q1MA 4MLOA 2J22A 2VMEA 3WINE 4ZH4F 2SLIA 3RZGA 4YIIA 2AEYA 2HYFA 2TRTA 2OU2A 1LODA 4LOTA 3SEPA 4CUGA 5CADA 1Z7UA 3N05A 4AEKA 3KPHA 5FZMA 5FYUA 1U5TA 5BNNB 3B9IA 1AR62 4B8EA 3ZSEA 1YITI 4D69A 4OI2A 2DA2A 2R7VA 4Y33A 4HNVA 1X3UA 3NKGA 4HKLA 1PGW1 2D6LX 3PU8A 5T5JA 5ERIA 3GWZA 5GLUA 3QLQA 3HAGA 2CUEA 4XBLA 5CIRA 4ZYGA 1NG6A 1G59A 1W99A 2VXJA 3M70A 1JTXA 4QPWA 2QSGX 4IHTA 1J58A 3GFMA 2YBSA 4ZZDA 4B3NA 4AIJA 1F9NA 4AFDA 4LXLA 1FNNA 2R16A 4BEHA 2OUHA 3L2YA 1UOJA 2DMQA 3PIJA 3E6MA 5ANNA 4P5OA 3TN91 2XKPA 4OMZA 2WR9A 2F5DA 3MV01 1OKRA 4CUBA 5FLXZ 2KFDA 1YJKA 4IV1B 4CP9A 3Q3SA 1W1WE 2QKDA 4XKVA 3FK6A 1XSXA 2A71A 4Q0UA 5HXVA 1ZRDA 4HPQA 3MLLA 3FFQA 3ULQB 5BNPB 3MW3A 4PHZA 1FAYA 1KQ9A 3QP6A 5K7PA 3J7AO 4UFLA 1Z6TA 3WODF 5A33B 3QPLA 1IS3A 2OYZA 5DQ0A 4YVWB 5CU1A 1EJ9A 2D6KA 3J7YJ 4CDWA 3EUKL 5F2SA 1OHFA 3JTHA 2Y64A 4PBOA 2ICWG 3VD3A 2JG9B 2HQAA 2VW2A 2X48A 5F37A 4XBFA 1HB3A 4HLTA 1R1TA 1YLFA 2ZEZA 5HNFA 3AKRA 5LBBA 4O9GA 4AQSA 4YVWC 2DFCA 3TKYA 4QX0A 3RZDJ 5LEKA 1BEV2 1BI2A 5KNLA 5FZ0A 1PK6B 3WU0A 4BWOA 1UYZA 1UCXA 3KLSA 1BK0A 4RR3B 2JB4A 3NMBA 4CDUB 4HBNA 2O8XA 4ASKA 5D5XB 4QXCA 2YB7A 2ZMEA 5TGTA 4EJUA 3CZUA 3DYOA 4KWJA 4IEOA 1BJQA 1TNRA 3LFIA 3M1EA 2E51A 4LUKA 2XAQA 4MQVA 1YHQI 2ZABA 3DGTA 2AEZA 3C7OA 1W8NA 1TNSA 4R9BA 3X29B 3WDXA 4CDQA 1HQNA 1JXSA 2Z1DA 4O9EA 3ABLH 2RS31 1MZFA 1QOSA 1QJU3 2CV6A 3SISA 4YZ1A 4WVMA 2BWCA 2FQPA 4XF0A 4IEXA 1DQ6A 4Z92B 5KHHA 2W57A 1EF4A 1R093 4Y3OA 3UGHA 4B4PA 1Y43B 2Q2EB 2XGDA 3KLOA 5K0UB 4IGPA 3KHCA 2JDAA 1S2BA 2RC4A 2YU9J 3K1MA 3ILRA 4PBPA 3WW1A 5DZEA 3CZ6A 5JVVA 2QKLB 2E5NA 1HKTA 4FISA 3O8GA 1NQJA 3J80Z 3S2HJ 2XJPA 5GPAA 2HWD1 2ZHKA 3O6BB 1TLHB 2WYFA 3AYEA 2PLV2 5FFOC 3WY6A 4SLIA 1O4YA 3GZAA 2LALA 4IDZA 2ARCA 1Y39A 3J7MA 3DKXA 3WDVA 1GXQA 2VQCA 2KPMA 1X1BA 5ABJC 3S5AA 1OI6A 3V4GA 2VODA 5HXMA 2W1OA 5C8CA 1ZR4A 1XC5A 4PDWA 3NAUA 2ID6A 3CNAA 4I3GA 4ARYA 2E1NA 3HOUJ 3VB9A 4XDPA 2CJJA 2LR8A 2STWA 3B7MA 3RVHA 2K46A 1YTYA 5LK7B 4KDPA 3CDZB 3WE3A 5KC5A 2H1KA 3QOPA 1S72I 3LEMA 2HOAA 2DAOA 4XTPA 1LHVA 1SD4A 5CKNA 5BYNA 4M4RA 1OPMA 2JXAA 1PX3A 1ALYA 4B09A 1AR71 5HLGA 2E6VA 4XTMA 4KIGA 5DM7F 4BQ1A 1V6IA 4L18B 4E7SA 4CZZA 4K1YA 4C91A 1XGNA 1AR82 2QZ3A 1YFWA 2MGQA 1BM9A 5I93A 4YVSC 3NV1A 1CAVB 4FFGA 4I09A 1H8TA 4Z8BA 4EEFG 1A6CA 3OYMA 3WQ7A 2B0LA 3HOYJ 3OSFA 3BPSA 3FHIB 2DTWA 1QA6A 2KMUA 4IXLA 2L3DA 4GMP0 3OUJA 4M9ZA 4A3DJ 1NLQA 3WGHA 4WK8F 4CUCA 4UW5A 1UFMA 1FLIA 2QVOA 4Q0QA 2J1RA 2HVSA 4QDSA 1OCTC 1BI0A 5DYMA 1JZ2A 1EH6A 4GQ7A 2CYFA 2Y0SN 3VBHA 4HEA2 3MQ0A 1YRNB 4GB32 5FZAA 2I10A 3WNNA 4FE7A 2AGSA 4DQAA 2V6EA 1OT5A 2BGPA 1FSHA 2GMEA 1SLBA 4HK9A 1T2XA 5L7OC 1ASJ1 4A3KJ 4ZC3A 2QKMB 4A7KA 4XQWA 2KIFA 5K4LA 5FZCA 3UNGC 2MLGA 4DFSA 1R081 4XHBA 4NUBA 4ZDPA 2WAAA 2VIXA 1R22A 3O0VA 3AKTA 1DF0A 3VBOA 1UX7A 1WGXA 2FCUA 1LHNA 1VZ0A 2IFRA 1Z3YA 1C4RA 1HQWA 1B72A 4BQQA 3FBIB 5HCBA 4P9FA 3ZQCA 4N4OB 1HV1A 2VQ0A 1X8MA 2J1VA 1G4DA 4COVA 1DGWY 4XBNA 4MFEA 4AVZA 1B35A 1A8MA 1K78B 3N7KA 4RGSA 1KGYA 1LR5A 2A5WA 1BKZA 4ENNA 2L9NA 5C3EJ 1ZRRA 2WT2A 1QOOA 5H9SA 2KM2A 5CEHA 5A7QA 4ATEA 5K5QA 4FT8A 1Z6RA 2PAEA 2HEOA 5L9RA 1GNHA 3M1CA 5FPLA 4XQ4A 1HV0A 2E2HJ 4NHJA 4FHTA 3RYPA 1TNFA 5EHDA 2TCTA 2WZR3 3DU5A 1MR5A 4QPGA 1X2NA 2Y69H 3JXSA 4KN7X 3KF3A 4WM8C 3DQVC 4D9JA 2YU2A 4CH7A 1AF9A 3THTA 3K3OA 1VQLI 2EH3A 1SFYA 2DDAA 2X5IC 1QVUA 4QWQA 4XICA 5E1XA 3ZMDA 1MZ5A 2VI6A 3ONQA 3WQ1A 5H6QA 4NRMA 1GV5A 5FKNA 3CUQC 3W5MA 1KJLA 1QJEA 1JMUB 5J96B 3B5LB 5D8KB 4M0NA 2EZIA 2A5ZA 2QCSB 3FWEA 2B4KA 4TN7A 2FQ4A 2YGMA 2O0OA 2P8TA 2WABA 2K85A 3LFMA 4FPFA 3SZTA 3KX2A 3HHHA 1T56A 2GC2A 2RNJA 1UG0A 3ERED 4UW3A 4CXYA 1QJX1 1ZTRA 1CZSA 2VCMA 4LEJA 1R092 1S2EA 3H92A 3BJOA 3HBZA 2JD4A 3VZNA 4QDQA 3APBA 4H2AA 1NCQC 2K4BA 1R49A 3LAGA 1LESA 5BPIA 1SBDA 2VQAA 4LOSA 4QQPA 4JGZA 4A69C 3N7MA 5CKQA 4HG2A 4IHYA 3HVDA 4A6DA 3GVAA 3K7AJ 1DU6A 3HRMA 1X4PA 4FPHA 3WW3A 5E3MA 2R7TA 1CZVA 3M3OA 4A6SA 2HS5A 4OZXA 1E3PA 1UY4A 3KCXA 4LHSA 2ZNZA 3K9TA 4YFZA 2L9VA 4C1XA 3IKVA 3V7SA 1KRIA 5C71A 3ORJA 2VVEA 1WRJA 4GKYA 1X3ZB 3URFA 3PUIA 3IMMA 4I3PA 3CCYA 1O8PA 4J1XA 2HWE2 5JUVA 5FLJA 2LDUA 2W84A 1I6HJ 2HWC1 1RUD1 4P5YA 4RFT0 4LA2A 3F22A 1AYM1 3POBA 2FDKA 3OCPA 3MCZA 2XKOA 2DJIA 2PFBA 1Q5OA 3DF0A 1CQTA 3ON7A 1X1PA 1WSUA 2LM3A 2R063 1WWYA 3TO7A 2GNTA 4JBAA 4CXWA 1MH3A 2AO9A 2R7QA 1P7IA 1ETXA 3A22A 2LFBA 3ZXDA 4LLLA 1V55H 3H50A 2V4AA 1O8SA 1XB4A 3F8CA 4BE0A 1WJEA 2C4XA 1H8VA 4CO8A 1OOPC 1SFPA 1W6QA 2HEWF 4PGGA 1MZEA 4LO4B 3OS2A 4MZUA 3LSPA 1W8TA 1T95A 3K2ZA 1GVJA 5JR7B 2OQRA 4WM7A 5DAQA 2XQRA 2QQBA 5LW9A 3ZMNA 4NWVA 3DCQA 2E71A 3MEXA 1GP4A 1VMFA 4YRDA 1BBT2 1BZWA 1RUF3 2V1DA 3UJQA 4K6BA 4G9YA 1W4MA 1U5YA 2D6OX 3A4UA 3DCFA 5HDNA 2A75A 2OUMA 2UYAA 1W7PA 4YEJA 4CDGA 2FQ3A 5CFCC 1F5FA 1WMEA 4EN7B 3BUCA 3ZM8A 1DIWA 4A41A 4A12A 1N3OA 2VB6A 4E2QA 1R00A 2V6CA 2YPDA 3H42B 4LE3A 5AC93 3ROUA 1QU3A 2BZDA 4EE2A 1PVXA 1RI7A 2ZX4A 2DCEA 4M6XA 3PLQA 2Y0OA 4HETA 4K21A 2G0EA 3I8TA 4I76A 4ZDOA 4AC0A 3FMGA 4UUSA 3AVRA 1XNDA 5LWBA 4GH4B 1IHMA 1T8IA 2MHFA 1NXD1 2VBDA 4UFMA 2CWSA 3P9KA 4GYIA 3VKFC 3MYXA 3WCSA 5CNAA 2X6OA 1VPHA 4IXAA 2YUSA 2LROA 5A7OA 5DAXA 3GJAA 2HR3A 1YYVA 1S7AA 2DA1A 3CCJI 4BM8A 3HTSB 4XUQA 1XXNA 3KP2A 3HPGA 3JBG3 4META 3RPUD 4GWNA 4GH4C 1QIQA 3AMQA 5E3LA 1BL0A 1MBJA 5F3CA 1IUYA 4HSTA 1G3SA 4PJMA 3POFA 4RGXA 2AS5F 2NZ9A 5FROA 4NHYA 1DPRA 1HCRA 1S0CA 3O8HA 2X6XA 1USTA 2W82A 3NJZA 4MG2A 2K40A 2PQ8A 3ENRA 4JCKA 4G7ZF 5JSPA 2J1SA 1IF1A 2E7QA 4UFJA 2HEYF 3SMHA 3T0YA 2ZGPA 4HANA 3AG3H 3BOWA 1GZTA 4FPEA 2DA3A 2CV1A 5C3RA 3MBWA 1B1BA 3WCRA 2O6GE 4AM3A 2Y6HA 2WN3A 4ABZA 3HC7A 1WA6X 1LECA 5FLIA 5C4WC 4W6YA 1RNLA 1VQKI 5I8SA 3VD7A 2VOXA 2LKPA 1APNA 1NYWA 2ZEXA 4EWEA 1MW7A 3AP4A 3GGLA 4QTRA 2A69F 4I7HA 5HS7A 5A7WB 3QH6A 3ZFEB 4ASNA 4OFGA 4BE3A 2KDZA 3C3WA 3S16J 2V9KA 3NL1A 4BY7J 3MIBA 3WXPA 1W6PA 3UV9A 1UY3A 4M3EA 3M8EA 3BTLA 1YW8A 2KT0A 4XRFA 5GZGA 2CDOA 3RQ0A 3E97A 3W59A 1ONVA 4DGWB 3S57A 1DQUA 5EDNA 2Q4SA 1P4WA 3ZXSA 1PHMA 3ZFEC 5BS6A 3SLIA 1MD0A 1WLWA 5A80A 4J01A 5E6HA 1IJWC 3NVCA 3VBRC 3U37A 3ZQLA 1H2LA 3R4DB 3FXMA 5IP6A 4OLLA 4O61A 2L4MA 3IAPA 1Z7LA 3F8FA 3AC0A 5JIAA 3RTRA 1OSGA 3HXLA 1K5MC 1QJZA 5FV3A 2V79A 3RKQA 1SVMA 4GALA 3ECQA 4W50A 3F6OA 5HODA 4XFBA 5CISA 1R1VA 3AAFA 2WINB 3WG9A 2BOIA 3QU3A 5HI0A 3GTMJ 4PSXA 1GQHA 5DS9A 4PI2A 1T38A 2JN6A 5F32A 2BW3B 1H9WA 2JECA 2VOVA 2EV6A 1CR7A 1JZ6A 4AIDA 1GLHA 1OLMA 4HL0A 2BY3A 3WE2A 4AU7A 3IBMA 5ED4A 2NOJB 3ZYRA 5F0CA 3O2PE 1PVC3 2P5VA 2CAUA 3CCEI 5C3SA 4AG4A 4ATFA 2DV9A 3QACA 2VULA 3SNMA 1DQ4A 2BY0A 1CF7A 1WVRA 2V09A 4GYGA 3HRTA 1ZRCA 2J7MA 4LA3A 1J3PA 2FBKA 2XL9A 2VGDA 1VBE2 3J4UH 5FKKA 3UKGA 2PLYA 1R5ID 4XFCA 4UI9L 2R1BA 2D2WA 2HOSA 3VHRA 3REOA 3RSJA 1LEMA 1G3YA 4N53C 4C1WA 3K2OA 5AFBA 5EG0A 2D98A 3GTKJ 2VZRA 1FPN1 1GZWB 3NNGA 1LB2A 2GBYA 2ZXJA 4Z2AA 3DP7A 1VQ9I 3I2GA 3BG6A 4KJZA 3MLJA 1MBEA 5KVRA 3HOZJ 2QVSB 3VB2A 5FLMJ 2UY8A 3L09A 2H27A 4KG8A 4RGRA 4BHPA 2HVQA 4ZYDA 1G2HA 3EHKA 4OOIA 1NA1A 4OIOF 3QYEA 4LT5A 1GANA 2WA3A 5AC92 2AACA 3SYTA 1UZ0A 1VRBA 1H9PA 3OYCA 2OTJI 4NE9A 4DXRA 3SEQA 2L02A 2NMOA 1WWXA 1IDZA 2GN3A 4NC8A 1HRV2 2W91A 5FPBA 3O0WA 1YX5A 2DFBA 4Z6YA 5HS9A 1VIWB 2FU4A 4EATA 3JCUC 1HJGA 1GZ9A 2OPTA 1JOBA 3TBDA 2LF7A 3ZR5A 2BNOA 1WCKA 3SCFA 2IFWA 1KU2A 4DUVA 2CU5A 4AVBA 2XWJB 5I91A 2VM9A 4XLAA 2WJSA 4AVTA 3JRHA 4EN0A 2LC2A 5FD6A 2DBNA 3IL2A 4FTBA 3H3UA 1UNBA 1Y1VJ 3JBG2 3RIRA 1MS5A 2JDNA 2WQZC 2QBYA 3NV4A 2PMZA 2LMDA 2JSCA 1NLSA 4P9JA 1LOGA 1FOYA 4GJZA 2VMDA 2V7FA 4TLFA 4L9TA 1PJRA 2FZ2A 3TN93 4QB1A 1FYMA 1WD4A 4B3AA 3K4DA 4HX8A 1WCSA 4FFHA 1LOBA 1YW7A 3PTRB 1J0RA 2OT7A 1D2SA 2NVUB 2ZMKA 4MOAA 2WAOA 2QGUA 3AZWA 2K02A 3EMRA 2ZX0A 4Y22B 1Q3EA 4KN4X 1IPSA 3IDCB 4QX3A 3ES4A 5GZDA 1PO11 2R30A 2DCYA 2G9WA 1JTZX 5CVRA 5F5AA 3HOXJ 3GUDA 4E27A 1NE6A 3C2UA 2IT0A 1KEXA 4E2GA 3ZIWA 1ZBA1 1QVTA 3I2OA 2WNUB 3A0HC 2C0ZA 5FBZA 1CIYA 1C1LA 4A45A 4YGBA 2WNEA 3KV5A 2LW8A 1W36C 3R05A 1RUJ1 2LTNA 2WO3A 2KJCA 2FDIA 2K9LA 1PGSA 1X1DA 1V6LA 1NLRA 1WLTA 2E5ZA 2R7ZJ 2E1MB 2E34A 2ZGOA 4RSUA 5HCAA 5BNNA 5IK7A 1WCDJ 1WJCA 4HQMA 1EYBA 1OVSA 4Z2WA 2CW0F 3W2WA 3GTQJ 1R1A1 1YJNI 4G7OF 1ENRA 3V0AB 3U4SA 3AVSA 4WVZA 5KHKA 1MZBA 2P3KA 2E1MC 4XQDA 2D93A 2OTLI 2HGCA 5JCTA 3B6CA 1K3IA 2DUOA 1IZ3A 1HW1A 3WNPA 2OQ6A 1E5IA 1MNDA 2RS33 3S6PA 1ULOA 2DFFA 2FCTA 1EPWA 4Q8KA 1DBNA 1MPXA 4HOBA 2WZ8A 4LOCA 2FJ1A 4QQHA 4YW1A 2K5CA 1F5JA 3KP4A 1R71A 4HZFA 1VB2A 1JTYA 3RFRA 3FKJA 2JT1A 2M34A 4D3WA 1H2MA 4O65A 2BNNA 4WZCA 3CQOA 2M1BA 1I5PA 1WLDA 3ZSKA 3WG3A 4OIRF 3PJQA 1JHFA 4I30A 3LSIA 1W0UA 3ACIA 3G1OA 3SZGA 3NNLA 1JYIA 4OU0A 1VRH1 4LTAA 3VYTB 2R071 1HB4A 5H20A 4FI9A 1AYN1 4XCAA 4AXOA 3HQXA 3O0XA 2XGEA 4UB8C 3U75A 4LITA 1LOAA 2HWD3 2JA2A 3IKWA 4YVWA 3IH2A 3ABMH 5KXBA 2WRAA 1X8EA 4M4PA 2NRAC 2X53S 2MC4A 3WP3A 2CW7A 2QQJA 4DINB 4QPYA 1RR8C 1KZHA 2QNKA 2JG9A 1R36A 3R4KA 1TVGA 4BNCA 5JPMB 3GFIA 5DG2A 3OYWA 1UPIA 5DUIA 2TEPA 1G8WA 2EFWA 1HRI3 5IUQA 2LK2A 1ZGAA 1BIAA 1QGPA 3OD0A 1JT0A 1GWLA 3FXRA 3S1NJ 3EBRA 3HEIA 3D5LA 1IS6A 5FJHA 1YIFA 1EAH1 3AKSA 4QIWN 5GZEA 1O5LA 3QAHA 3UKNA 4AI8A 5GP9A 1F31A 3N35A 2DCJA 3FISA 2Y8KA 1GSLA 1S55A 1AR73 4NROA 1LPQA 1VQOI 2C9AA 1TZLA 4WF2A 2R1DA 5FYBA 4W1UA 1V6JA 2DW4A 3FXJA 4ES8A 5C4JJ 1BI3A 2BFUS 3OYJA 2X4HA 4PJ0C 3VKNA 5F08A 1FYUA 4G6QA 1UZZA 3Q9SA 1SFXA 2HFHA 1BC7C 2COBA 4RB0A 1SLLA 5K7HA 3ETPA 2VNGA 5FKBA 1AR61 3KMHA 4BLIA 3HPHA 3FXKA 3V7CA 4XNFA 1LE8A 1YWKA 4HF0A 4D7MA 4AYBN 4DO0A 2C5DA 3DKWA 3J8F2 1TP4A 2RNGA 2VE1A 1QWRA 2Z79A 3ZP5A 3CF2A 4IJAA 2MFZA 2EFNA 1U8BA 2Q2EA 3CCSI 2PXJA 4LHNA 4AYBA 2HLEA 1O59A 2WA0A 2GA1A 2NVTJ 1LOFC 3COAC 3H1MA 1QRYA 3H1WA 3U0ZA 1TQMA 2P6SA 1Y56A 3E6DA 5A3WA 5H9QA 3OL3A 2VC9A 1B9MA 4UHTA 3HMYA 3RI4A 1BR1A 2Y75A 4U88A 1OURA 1JU3A 4KIBA 2YU3A 2CRGA 4R4XA 1ASJ3 1OH4A 2ZFWA 4C2MJ 4EGZA 3F95A 2JSPA 1GZCA 1R083 1U3EM 2VR4A 2HOTA 2ET7A 2FDJA 3LFUA 1NCRB 4LHLA 3QPSA 2ZGKA 3JCIA 3ZQIA 2DU0A 4S2GA 4HVOA 4N8MA 2JZYA 4YLZA 3RPQA 1K4TA 1FOD2 3A0KA 3U2RA 3RS6A 2EZKA 1OPCA 4PCQA 3O1TA 4ONUA 5LBEA 2OA2A 4BGDA 1U9OA 3I54A 1X9PA 1PUFA 4AR2A 3IV5A 4I01A 1HB2A 1QDOA 2LP0A 3ZSJA 4PJJA 3AJYA 4XMAA 4Q4V2 1GXPA 2PJPA 2M8EA 3K70D 5IYDJ 2DA7A 4LKDA 2VC1A 3OV8A 4Y5Z0 4XUOA 4L5IA 4UBHA 4C0HA 5F5CA 3WLUA 4IEYA 4EMSA 3WP6A 2Y26A 2OZ6A 2L9SA 3S15J 1LU1A 1FOXA 2ISZA 3KIOA 1BEV1 5GLTA 3V65A 1BBYA 1G86A 2VNRA 3DPTA 3I3MA 3SQOA 3H35A 4NPRA 3MI8A 2ZGQA 5KAFC 4RYDA 5K7ZA 1ZM1A 1FJLA 1GMMA 2ZKNA 1DGWA 5DTDA 1S0JA 3FDYA 3F21A 4UUTA 4AYUA 2XAHA 4X6AJ 1IN7A 3OEBA 3K4CA 2XPVA 1EA3A 3ITQA 1Z0XA 3AFHA 4EJWA 1Z91A 3OSDA 4BZ4A 4E4DX 4IGQA 5L7OA 5KR7A 3JUUA 2ESNA 1O6UA 5LCWL 2WNVB 2ZGNA 5A3TA 3DXUA 1MQTB 1TME2 2ZFUA 2RS32 4LE4A 2IVMA 3L00A 2VONA 1A6IA 3HRSA 1POGA 3F0CA 2Z42A 5FYYA 3M9AA 4OYUA 2GWRA 3BG7A 1IDYA 3SDGA 1JU4A 1EH7A 1BW6A 2V73A 3BG9A 1QJX3 1OCOH 4LO8A 1J5YA 4XDQA 4QLCU 2RR12 4OI4A 4IEUA 1OC1A 4GO1A 4XR6A 4CP1A 2QLZA 1NUKA 1I50J 2DCKA 2XAJA 5EJ3A 2Y9YA 1U5TC 4QT6A 3H0OA 4AEJA 5B1BH 1FMD3 1OCRH 1YIPA 2XB6C 4X8PA 3CLQA 5GTHC 3HOWJ 1OLQA 2PLV1 3SDBA 4AI9A 1KS4A 2R041 2E53A 3NV2A 2R92J 1A34A 3OWTA 3SJMA 1K78A 4XKBA 4ENKA 3FJSA 3KT7A 3ASIA 4P00B 3D3AA 1USSA 4KUMA 3V8JA 4ENJA 2DURA 1AL0G 1YS6A 2OUJA 3ILFA 3I4PA 2X1EA 3JU9A 1LULA 1F15A 1HRI2 5FR3A 3MIHA 2H1LA 2X5IA 5HDKA 1V6MA 2HWC3 1PX4A 1AYM3 4HN1A 2F5EA 5HPOA 2VMIA 1X2MA 3LDBA 2XWBB 2QQ9A 3AP9A 2LYCA 1NK3P 2PELA 3GF6A 2R0QC 3NNMA 3CUQA 4QM8A 1HXS1 3BR3A 4B1RA 2QQKA 2QQMA 1AR72 5FZ9A 1IRZA 4R9AA 1AR81 3RWNA 3ZQ7A 4AUXA 3BTAA 2ZHLA 3IC7A 3ZYIB 2VT3A 3UYJA 2ME0A 4IHSA 2OV7A 5F27A 1MVQA 1QPIA 1JOJA 4DEQA 3L2WA 3CU7A 4MADA 4UWDA 2WT0A 1QPMA 3WNLA 1XNBA 2CUZA 4IE7A 1QU0A 5H2FC 1NCQA 4BLJA 3NWSA 1VQ7I 4A7ZA 3VDXA 4HYEA 2DFEA 5J48A 4D7NA 1U5XA 1C57A 2VO5A 3TL4X 2QFEA 4EYUA 2PYTA 4G7HF 2QDRA 1J59A 2B45X 4Y20B 3MKLA 2JG8C 1MMGA 2IJLA 3KP6A 4LMYA 3AYDA 2VNOA 1SMVA 5FY1A 4Q4ZF 2W46A 1QNWA 4Q1PA 4GB31 3KZYA 2VBZA 5C7GA 2RQQA 2D45A 2QQOA 5F6FA 3FL7A 2NOGA 3HN1A 5CVUA 2A3XA 4OVEA 2YG0A 4M3CB 4CP2A 2HWF1 1W28A 5IT9Z 3IAQA 2E19A 2ZMEC 3VKOA 2UWCA 1SFNA 5F6KA 3VBFB 4YW7A 1XTAA 2CUFA 2O7OA 2VQLA 2M7AA 2JA5J 1W05A 5FMBA 4JQFA 4M01A 2DA5A 4XLNF 1QDCA 1IS4A 2JWPA 2LNBA 5CAZA 4DZJA 1WW4A 2XUBA 4G9SB 4RGUA 3OOUA 3HOTA 1MH4A 2DVFA 2G9FA 1U2WA 1MJAA 2VG9A 5L36A 4XLCA 2GNDA 3BU7A 4LK6A 2HDCA 1OOPA 2GXGA 4YYOA 3T0AA 2R93J 4AFMA 3BC8A 5EIYB 3C7GA 4E4ZA 2W7NA 2BERA 3GW2A 3GCXA 4E9KA 1LAJA 1O57A 4L9NA 4IX7A 1NAEA 3PNYA 3KZIC 2A6YA 3RI9A 1FZPB 2RMU2 1RKTA 1GDTA 2DO7A 4XE9A 3HOSA 4F8AA 2M2EA 2A73B 2ADEA 5C6CA 3ZXLA 1WJDA 4XJ8A 3EUHC 5FCCA 4S2DA 1YCIA 4EZ4A 3AKPA 4LK1F 1HQLA 1OH3A 4LD5A 1D4VB 2DMTA 4KISA 3LSKA 1AOYA 2EIBA 2Q8OA 3ABKH 1GQGA 1LHOA 2W25A 4XLHA 4IV3C 2WZEA 3EYPA 4CDXB 5ERLA 1APLC 1ZH5A 4FAGA 5LEJA 1Q8QA 5JXJA 3V8LA 3LQCA 2M8GX 4A4AA 4BQ5A 4NHXA 3VDAA 1RUH3 4DOZA 4E4HA 2ZGTA 4FAHA 2VTFA 2Q0OA 2YGLA 3CMEI 3P7NA 4RM3A 2DTRA 5T52A 3IKTA 2VUAA 3ZQGA 4D7TA 2XH6A 4HNUA 1DQ1A 1STMA 2D5VA 4CP0A 5J1XA 2GZWA 4DUXA 4XFFA 2ELHA 1JHJA 1QJX2 1Q1HA 1R091 1H8TC 5FZBA 1W04A 1KD7A 1R23A 2LRPA 4GH4A 3BY6A 1OKOA 5D5UB 3CEWA 2X1CA 1JZ8A 2VJ4A 1CAWB 1FMD2 5A3MA 2VASA 4UNOA 2M9HA 4RAZA 2PHRA 2DYSH 1OMIA 3DEUA 4IRGA 1N1TA 3LA7A 4PLMA 1LEDA 4F92B 4IERA 2J1TA 2AZ5A 2WLPA 3SKVA 2IGMA 3ZFGB 5F04A 3H8RA 3OS0A 3W6JB 3THPA 3WW2A 1NXMA 1RL3A 3CC4I 3BYWA 1S0FA 3JAMK 3KV4A 4NWWA 1JW6A 3N9QA 3P9CA 3KT1A 3GALA 4N0BA 2BOJA 3S8PA 2XSDC 2BGOA 5JOZA 3W5NA 2HWE1 4L97A 2A3WA 4AAXA 4L0ZB 2DDUA 2PFWA 3OY9A 5FJ8J 2J42A 4BA6A 4CCKA 4RB2C 4E7HA 1RUOA 2A6WA 2GALA 3T8RA 4HLYA 2M87A 4AGGA 5A6YA 5J40A 2OVUA 2R5YB 1TE1B 1RUG2 3WD5A 4RGAA 1V0AA 2EFOA 2Q1ZB 2FMLA 5KXCA 1FXZA 2ECBA 3BWGA 1D0HA 1F4HA 5A3OA 2WB1N 2CWEA 4Q47A 3VODA 3CJIB 2GSYA 4FVVA 2GN7A 1SFUA 3PUFA 2WB1A 2FA5A 2Y34A 3OUHA 3L2UA 3ZFEA 1BBT1 2M0MA 1XSDA 2KIMA 3DEEA 4HW0A 2R5ZB 3VBRA 4L11A 5IK4A 3N9LA 3R0AA 1FPN3 3TNQA 3CMGA 4JKLA 2F4LA 1K5MA 3ZKYA 4OMCA 3CP2A 5IY5H 2DYRH 4OAZA 4D5FA 5I8TA 2YC2A 4RA0A 3QRFF 2NM1A 3LF7A 3PVEA 4PT6A 1REFA 4KL1A 3OYGA 5JR2A 3PO3J 3AZVA 4D94A 3TBIA 2YFZA 5B3SH 2Z4FA 4JHZA 4HPKB 3Q8AA 4QQOA 1WW6A 3W20A 1OUSA 5DEQA 4YSFA 2A68F 2W0XA 3FUQA 5D4RA 4J00A 1DYOA 2PHFA 4NDLA 3LQQA 6PAXA 1XNCA 1KU9A 2QBXA 2DUQA 2HZTA 3LIHA 3ZXEA 3KF5A 2Z5UA 1W0OA 3OYKA 1HDPA 4FTEA 1EH8A 2I07B 1MS3A 5FZ7A 2V9VA 2WV0A 4UFHA 1VTNC 4EN6B 2DOEA 3POIA 4QKDA 2H94A 5LFAA 1GU3A 2WDBA 5EYRA 2BQPA 5JSRA 1S7OA 3F6VA 2HQNA 5I0RA 3U14A 2VQGA 4M3DA 5AIQA 4DS0A 1MJ9A 2YV8A 4JV4A 3IDAA 3AJZA 2HTSA 1YQCA 4LG0A 1UOFA 5FWEA 1NZCA 2EFPA 2XAUA 1OQ1A 1XN7A 4XJAA 4AFAA 4M3FA 5CFDC 4X6QB 4AD9A 3CLPA 1RJ8A 1PP8F 1ONAA 5FMOS 4AQ6A 2QTWB 1BLZA 3AXEA 5K7FA 3QQAA 4BIFA 5L3EA 4Y4RA 4P9IA 1L0OC 5JR3A 1XC6A 3RJ2X 4HX4A 4JTNA 2ORXA 4MVTA 4YPJA 4LO6B 3U10A 2IXCA 1PO13 1KGSA 4JKKA 4HKWA 3RCOA 2O1QA 1L7LA 1RUH2 1IQAA 2V1NA 4D7SA 3VSKA 5H9PA 1Q1VA 2E2JJ 2M4GA 5F0HA 3MN2A 1LEBA 5FJKA 1BR2A 3VBUC 1XOYA 5J8FA 3AG1H 4B7KA 5JHUA 4W8JA 3BJ6A 5FP8A 4FQGA 3CO2A 5FYHA 2DT5A 4IETA 4J25A 3CO6C 5G05L 3PMEA 5B4NA 1MBHA 1S0BA 2F5CA 4ZTJA 1POV3 1W6OB 3T2OA 3OGRA 3NAPB 5CLSA 1DZTA 2B9SA 3LNQA 1OF4A 1JZ3A 2OIIA 1U6GA 3SH3A 3H7YA 3L2CA 1VF9A 2UUZA 5ILVA 2GC1A 3GXOA 3ZX7A 3NO8A 3TDUC 3TWIA 3GBWA 1XSVA 3WHCA 1R1A3 4A3GJ 2Y6LA 2XJUA 5J98B 1TW2A 1XSRA 3CMMA 5IVBA 1WGPA 2K9SA 2BYVE 2GP3A 2DXIA 4CCOA 3ABZA 4TSVA 1JN2P 5JHFA 2DVDA 4YFXF 5JMOA 5H6RA 2DTYA 1DLLA 1WPKA 4LMFA 4CVUA 1LHUA 2BW8A 4MGIE 2IGOA 4FX4A 1KYWA 1ZX5A 3LAJA 1W9SA 3P5JA 1I9RA 1VR3A 1MS9A 2D1HA 4L9JA 1K45A 4CU7A 2LREA 3GZ5A 3ZR8X 3FKIJ 2KHMA 1MNMC 4BISA 5HLIA 2ZJRF 2F4IA 4UFKA 2R7DA 5M5YJ 2YR2A 1AKHB 5IPAA 2ZPXA 5FZ4A 3TRSB 1CPMA 4ES9A 1G9BA 3FN9A 2EALA 2DU1A 3PL0A 4OWRB 1H89C 1PIV1 2YMZA 5A2QK 5CQGA 1VQ5I 4OZOA 4YWAA 4XXAA 2VZOA 2VZPA 1VBE1 3IIIA 2VNVA 2VKHA 2VPVA 1BCXA 2IBDA 4UV8A 2H6BA 5GAEJ 1R1ZA 1FYKA 1XG1A 1SANA 1XS9A 2YPRA 5HLTA 4BQ3A 4MQ9F 5A32B 2VD7A 4CEWB 3E5XA 2UXNA 1SQ4A 5FFZA 3OSGA 2FDHA 4B4RA 1XNAA 4LBLA 2JE8A 1V9U3 2EIMH 4QHZA 1ZGJA 5IOZA 4U7BA 1MNEA 4OHYA 4DQ2A 1I6XA 1YW9A 4MGSA 3L2RA 1WLCA 3FXLA 3VD5A 1EAH3 4U0VA 1ZNPA 3I3EA 2JIJA 2L0KA 5EJ1B 2DUPA 3WU1B 2DWRA 4ZS3A 3K3NA 2CH0A 5F9TA 4GRIA 2QUOA 2WIIB 4ISQA 1QNYA 3WG2A 3H9GA 2IEKA 1IG0A 2FMDA 1ZZ9A 4BHBA 5AC91 5EP9A 5FPXA 3V0AA 2O0YA 2W68A 4QHBA 1UIJA 5B2GB 1XMKA 3F2ZA 3MMYB 3J7HA 2LBFA 3I59B 1HRV1 3I4MJ 3I58A 4AI0A 1XJAA 1O4TA 4XXPA 1ZBE3 2DFHA 3FE5A 4BU2A 3FFZA 3VDDB 5FXVA 2QJVA 1K42A 1JKQC 2LG4A 2BFUL 2OA4A 1MDMB 1AU7A 4IPAA 2KKOA 3SXWA 1DGRA 2CQNA 2ZA9A 2HYKA 3N9PA 5FP4A 2E7TA 5JI7A 3ZXGA 3BCWA 3JBG1 3BCAA 1IV6A 3FM3A 3J7NA 2EXHA 2I2SA 1WZ2A 3DXJF 1LQ1A 2KIQA 2TBVA 3ECOA 2KA3A 5FPZA 4LK7A 1YX3A 5A3UA 3T2QA 4CCDA 2PN6A 2CSOA 1OFNA 1SFKA 4MIMA 1CESA 2VJIA 3VL8A 2O3FA 5BPDA 1V00A 4QMAA 3FHNA 4LR4A 4MGZE 2FCVA 3PQJA 4S2FA 2Z33A 4YM3A 3JRFA 3SXYA 1YI2I 4XFIA 2XQXA 2NS7A 3OIQA 2W00A 1WI3A 3ABUA 1UYPA 1WBFA 1J3QA 1UHWA 1LNSA 1XE0A 3GCWA 1FWZA 3NV3A 1RIRA 3VBSB 2O03A 2VE9A 5KAIC 1J75A 1DGRM 1VBB2 3GZ6A 4P5HA 1PO12 3GNEA 1ULPA 1A78A 5D1IA 5HNHA 4HF1A 1NY72 3GFLA 1IGOA 5CPRB 3K70C 2UY9A 3KETA 5ILUA 2VOTA 3M07A 3RZKA 1ZYBA 1W8OA 4II2A 3T2TA 2ZKLA 5AONA 2V9PA 3VBSC 1CAUA 4L2NA 3NRVA 4LLGF 4ZXEA 3AMHA 1LHWA 5GJ6A 4LBQA 3IMNA 1UHMA 3ZGKA 1BEV3 1BHGA 1K5JA 2IA2A 1W9YA 1GFF2 3RZOJ 1ZLKA 3GTGJ 2AXLA 4D1QA 1UX6A 1IN6A 3MZ8A 1LOFA 3S5QA 4E70A 2EICA 2LTPA 2DCZA 2XVCA 4QAWA 4QKFA 1H1IA 5EEGA 1Q8SA 1MEC3 5J4VA 1OXCA 3FK7A 3S32A 4CGZA 5FZOA 5F1RA 1R1A2 1E0EA 2PQSA 5GKAC 1VBC3 1MZ6A 5CBLA 2NYXA 3DF8A 3MGUA 5K5RA 4BDVB 2K3PA 1XMAA 1YI9A 3ZXKA 3ELKA 1OJLA 4L0YB 1FX7A 2A6VA 3QCWA 2HPMA 3BR6A 2W2IA 3I4NJ 1CZTA 3W6VA 3F8NA 1W2NA 3WNXA 3BU0A 1NX9A 1OYYA 3I3DA 2Y38A 9ANTA 3LSRA 2PTMA 5D4SA 4QXHA 2EINH 2Z16A 1N75A 4JGYB 3PSIA 4XW3A 2OZJA 1VB4A 5DM6F 1YFYA 3CO7C 3H8UA 5A70A 4LLFA 2H0VA 4CCLA 1UKGA 1Z77A 1UMIA 3OYIA 4IOCF 2D3RA 2ZX3A 3DKYA 4M9SA 2PHXA 4RS5C 3WTYC 3E5QA 4M6YA 2RJ2A 4DZPA 5FZKA 2HZDA 3RDIA 3R4UA 1O3TA 3MPBA 2R043 1L3LA 5FY8A 1T6SA 4HK8A 5A3NA 5IAXA 4AGVA 1H6XA 4F55A 2YS9A 5AFEA 3I0TA 1PGL2 4CA9A 2FBHA 3M7GA 1QQP2 4KU7A 5DZGA 1RUC2 4IO9F 4BQAA 4XVHA 2F5VA 2X85A 1LVAA 2ZNYA 2JMWA 3EYIA 1V70A 1S0GA 2GMPA 3MUY1 1OPOA 1QZYA 2FF4A 1V9U2 1KU7A 1A04A 2LOOA 3HN3A 4WVVA 3VZJA 1JGSA 4B7EA 3M8JA 4CP9B 4HRIA 4X6RB 4RD7A 5GPCA 2P3YA 4JDOA 4V1PA 1SVOA 2AREA 2WAQN 2CL2A 5B66C 4HAMA 1HXS3 1LRHA 4CCMA 1XB9A 2WO2A 3PHMA 1YS7A 3V0BB 1AR83 2WAQA 3ML6A 1GOGA 2ZXIA 1EUTA 2ZC2A 3J80K 3JRBA 5J09A 3S0MA 3RRDA 3WTZA 5ACA2 4DUWA 4CDWB 4S2HA 3BG3A 5DUUA 5EV7A 1PO23 4ASLA 5J8CA 1QKQA 1WJAA 2IAIA 2WNVA 2IXHA 1OR7C 4IVNA 2WN2A 3ZIXA 1JKOC 3QBQA 3OGSA 1K6OA 5BNGA 1DG6A 1ZBE2 4S04A 3W6KB 2VECA 2XPWA 2GMMA 1PZ9A 2ZJQF 2ZS6B 2E32A 1HJFA 1YFXA 4KH9A 1BMV2 4BK5A 3J8F1 3LB9A 5A6QA 5JVTA 1J09A 4UUVA 3BB6A 1RETA 4MTDA 1T2KA 2O8QA 4Q0SA 4NPLA 3H5RA 3QYFA 1BOBA 2FNAA 4X1EA 4BJ0A 2JDPA 4GB33 2GIVA 3O7OA 5BNNC 1XPWA 1EPZA 2IXLA 4FP2A 2HWF3 2BY2A 3S3MA 1K61A 5FYIA 5IATA 1BC8C 1AJKA 5EQUA 2VVDA 3PO2J 1FNYA 1I3QJ 3RSNA 3RKWA 5AVAA 1JI8A 3N7JA 4Q4Y2 2RREA 4A3FJ 2EA2A 4XQFA 2F5FA 1XNTA 2M7BA 2WKKA 1X58A 3DN7A 2W85A 5LA9A 3I7DA 1W6MA 2A07F 1C8M1 2WZPP 3DTKA 4ZONA 3OBRA 1FOD1 5D5WB 4F93B 3KD4A 5IP7J 2ADDA 4IV1C 3SEEA 2FSWA 5HOOA 2XJQA 2W08A 3HRUA 2CW8A 4Q4V1 4IEJA 3D8CA 2JUCA 2A5YB 3B3QE 2CQXA 1S2KA 4DNYA 5BNPC 3AP6A 2VN2A 2YSRA 3JW4A 4GKXA 4JK1X 5DV5A 2JEMA 1GT0C 2EXIA 2LKXA 1W39A 1N25A 4ORFA 1D3YA 3GZTB 5FAXA 4MXWA 3IWFA 3NNFA 2P34A 5FYVA 3PUAA 2EAKA 1L7RA 5HVQC 2CFXA 2JG8A 5EJCA 2JG9C 5CG9A 3B02A 5FY9A 3OGJA 1REPC 3KVBA 2LY2A 4BQYA 1ULYA 1Z67A 3W2VA 2D44A 3ERMA 2W47A 5C8CB 4KFCA 4Q8LA 4PDWB 3SKJE 5IYYA 4N4NB 2LUWA 5D6FA 3K75B 3IAS2 5BMZA 2ZHMA 1MEC2 2PG4A 1O7FA 4BMBA 4A3MJ 2RG4A 1D7PM 4UOJA 1VBC2 1UO9A 4Y20A 5DUVA 5IYCJ 1K6YA 1PK6C 3BALA 3FIWA 4RR3C 1TME1 3FHZA 3EB7A 4CDUC 2XC7A 3DPRB 4NHKA 3ZYFA 2IVJA 5FQ0A 5FB2A 3S14J 1O4XA 1NE4A 4Q0VA 4NPMA 5FYMA 3H9QA 1C1FA 2RS52 5FY5A 2K3FA 1Z9CA 4URAA 4COUA 3VBFA 1AZDA 3JQWA 4CCEA 2VUJA 3X2QH 4UYBA 3LEIA 1J1TA 2RR11 1ETWA 3GFJA 4HN0A 3IRRA 2NAZA 2ZGUA 1S9HA 1XE7A 1YJWI 2GXAA 5EZWA 2ELKA 4XURA 1FATA 5A7PA 2R3SA 5EF6A 2LF8A 3E5UA 3I3QA 3IWZA 2FXAA 3ACFA 4AHWA 2MW8A 2A6XA 2CV0A 4E2SA 4JTOA 1JYTA 1IKPA 2WYSA 4MHRA 3EUHA 3VD9A 2R042 2Y6FA 2HI3A 4SBVA 2WY7Q 5K0UC 2O61A 4K7JA 1E5RA 4BQWA 3BCBA 3KYCB 5DG1A 3VBHB 3T1MA 4LNVA 5J6XA 5DAVA 3G3ZA 1VJ2A 4IV3A 3P9IA 4OHVA 1HRI1 2C6YA 3DYPA 3GTLJ 3L2HA 1CGPA 2HWE3 5FZ1A 1X9TA 5J36A 1DYKA 3DLLF 3JD72 3I2KA 1ZAOA 1VQ8I 4BBSJ 5FXXA 3HIFA 1YQ5A 2K27A 3DV8A 2YX4A 1MS8A 1ZRIA 3BTJA 1SLIA 3ZYGA 4B44A 2E9QA 1UY1A 1KFUL 1HXS2 1UPSA 4BXUA 3CP8A 1Z7S3 3TOBA 3WG4A 3MKYB 2CO5A 5IJRA 2JD9A 5FZ6A 1YIOA 1WCUA 2WUHA 3IIAA 3L9JT 1CAXB 3MW2A 4BCUA 2ZJPF 5DPNA 1DQ2A 3S2WA 1QQIA 4GMP3 1B35B 2BRTA 2KL4A 4A5NA 1QH7A 4IE0A 2P6TA 1PO22 3KZZA 1KFXL 3VOEA 1DUXC 4IEQA 4W65A 1R4NB 3IPVA 4DXSA 1KXGA 1DP7P 3UL2A 2WFF3 1W6NA 2WWSA 2HBTA 3CKHA 1D1BA 4XABA 5FY4A 3ESWB 2WTEA 3S17J 5FRMA 1BBT3 3FBMA 3T09A 4K9SA 1UXXX 1X3WB 2RDQA 4ESFA 2B7EA 2Q5TA 1ENSA 3DUIA 1TMF1 2HBUA 4BKXA 2QQ8A 2ATFA 5LA1A 4TWTA 1SD5A 1H0MA 4XIDA 2FHRA 5L19A 2XRNA 3TMOA 2IUWA 3LFKA 2NNYA 3ZYBA 2R7SA 4MYEA 5J37A 1CAWA 3WW4A 4AHXA 5IT3A 2XJSA 5JXIA 2HWF2 1JHNA 3O1PA 5FYTA 1XGMA 1UJ8A 1VI0A 1F2NA 5LA0A 4MEXF 2KD7A 3CJNA 5FTTC 3JRIA 1D8KA 4BQXA 2RAEA 4KMUX 2H6CA 2H8WA 4KBZA 5JI9A 2MH2A 1GWMA 5FIXA 4BQ2A 5L73A 1CONA 2CV2A 4XFGA 3WF3A 3I2FA 3VZKA 4QPIB 3CZJA 1HN1A 4XDOA 3VKMA 3BVCA 1QGLA 1ULEA 3T3YA 3DLAA 4JX0A 2GOMA 2PHDA 1JJ6C 1XYPA 2QUFA 4ET7A 3VGIA 1W03A 5ICEA 3PUHA 3HB9A 2Z99A 3O1SA 1MJBA 2IZWA 4JYKA 4AVPA 3C1DA 4LBJA 4N43B 3WP5A 2RMU1 1HIXA 3BPZA 1JUSA 2CNAA 4RMNA 4NIDA 4JGZB 2XVLA 3E1F1 1D5YA 3R0RA 2ARBA 3DPLC 1W90A 2J1EA 3ZRGA 2FBIA 3OR1C 1QOTA 1MS4A 2QQUA 4GAZA 2DU9A 2EVXA 4BS9A 3CJIA 3C7FA 1EV11 3USUA 3ZN6A 2PI0A 2ERFA 4L0PA 5FRNA 1COV2 4N43C 1QZEA 2R7WA 4BOWA 2RKHA 3HR9A 2F4PA 3CDIA 1ZA4A 4KT6A 1PMHX 2R5ZA 5JDBA 5DCMA 5E3OA 2VL4A 4BE2A 3ZYHA 4BMEA 1REEA 3E6BA 3DXTA 3IZOA 4Y17A 4BQNA 2P1BA 3OYLA 2IS2A 2FRHA 4UT5A 3BJAA 2BE5F 2VPRA 4G4FA 2UWBA 4K2EA 2DBBA 3HG9A 3OL4A 3LMMA 3I64A 1VQPI 1HW2A 2P7VB 5ISLA 4XUNA 4MO7A 2VTXJ 4AF9A 1A31A 1OD5A 4XC9A 1UZVA 5BNOB 3OYAA 4HV6A 1ACIA 2ET1A 4FFFA 4O5VA 1ZZ6A 1JZ4A 4DOUA 3LSGA 2J1UA 3AYCA 1N78A 1QMJA 3JAMZ 1U12A 2UWMA 5F6LB 5GLVA 3VYSB 3OBZA 2VZUA 4K20A 3NJVA 3P6BA 1WJFA 5HV4A 2EIEA 1FMD1 2JA8J 1IN8A 2EV0A 1P92A 4EQQA 4R8HA 4PJYA 1F4KA 4Q5OA 1X4OA 1MSEC 2ADUA 4BQOA 3PUQA 5F5QA 3VEPA 5CFDA 1I39A 2RJKA 2FUG2 3KEYA 1RITA 5FXWA 4X8NA 1H9GA 1IC8A 2JB8A 1BK1A 1RUI2 2QM3A 3KV9A 1S29A 3IDEA 5FYZA 1TWAJ 3LGRA 2HDWA 3FHQA 2HYJA 2WWYA 4XLPF 4B3XA 2VH9A 3F9KA 5JFRA 2Z2SB 4A3JJ 2XLAA 3HJEA 4HVRA 1TWFJ 3W21A 1M06G 3WOGA 1X1CA 5FZDA 4RA2A 3PIGA 4I0BA 1RUG1 1V6KA 4UXAA 3PNAA 3ZN4A 4M3BA 2XB0X 1XQNA 3O12A 3VBUA 1Z7S2 3HNBM 1HXDA 1TG7A 4IQPA 1PIV3 2IS4A 3MFKA 4QU2A 2Z5WA 1YYNA 5TSWA 4OMYA 2JA7J 1VBE3 1BOAA 1GNZA 3WDWA 2BP6A 1S4CA 2QSHX 4YGDA 1FNZA 3BTXA 3FUOA 1OQDA 2ILMA 3FX3A 2W5FA 2DODA 2WFF2 3L7WA 2HOEA 3IH4A 4XAEA 2VOOA 1E5SA 3KEOA 5AIPA 1PZ8A 4R79A 1DU3D 4CXXA 2IXKA 3ZDVA 3KQRA 2H09A 4IF4A 1SD7A 3O1RA 5FREA 5J1UA 1SBFA 4QX1A 4KG0A 4G6TB 4B4QA 1T0FA 4XF3A 1X36A 1FP2A 3SC7X 2VJ5A 4NR1A 1FP1D 4UW4A 2ETEA 4HSLA 2QQWA 5FGMA 3I9V2 4AAPA 4NO4A 5E18F 4LLNA 4U7DA 5JZGB 1S5LC 1V5EA 1GNYA 2I74A 1XU1A 2WQ4A 3D82A 4CPBA 4RLQA 1XE8A 1M4WA 4K40A 4O6JA 2YPJA 4FXKB 3HUGA 1CN1A 2VMHA 1BJAA 2COMA 1YG2A 1D1CA 1KU3A 1Y8QB 1XSQA 2DK5A 4CYCA 2EIKH 3V7RA 4LLOA 1ZARA 2PMHA 3QH7A 2K9MA 1A8DA 3BI3A 1Q43A 2DI3A 1HRV3 3OEAA 1BJZA 4E7ZA 4JC1A 4CUAA 3PIPF 3ZXFA 1F35A 1SPPA 1ZR2A 4LIUA 2MNGA 1GOHA 2EPFA 2XRLA 2JJ6A 4DRRA 2JA6J 1XYOA 1DU0A 1YUDA 4ANJA 2I45A 4BACA 3GLXA 3S1RJ 2PN5A 1FTZA 4BUPA 4GCVA 5FOBB 1DP3A 1AKHA 3KB5A 3S7IA 3T0BA 5T54A 3POYA 3W3CA 2G9ZA 4D0QA 4IQJA 4XBQA 3V64A 4E7IA 2L2OA 4J19A 1S0IA 5JIUA 4A5MA 2MD0A 1AL22 5IAVA 5M5WJ 3GXUA 4ITVA 1BN5A 3W58A 2F4MB 1ZA7A 3NNJA 2RDRA 1SLCA 2BVMA 2K9ZA 5GAHJ 2JKBA 1WW7A 1TBXA 3OOPA 1D0YA 2ZEYA 3R4SA 1KYZA 5FZFA 3ZN5A 1VP6A 2VW1A 1M1EB 2PEXA 5FLHA 5E8AA 2XGCA 4CEWA 2ZGLA 1C5HA 2HWVA 5C3PA 5C4XJ 1DFQA 3P1IA 4S05A 1J1LA 1Z3XA 3CBNA 2EV5A 2G4IA 2ZGRA 3HNYM 3K77A 1RUH1 1OCCH 1GUIA 1IO2A 5FLVA 3MEPA 3ZFFB 1VFCA 4ZYHA 2Y60A 1CJPA 4C2UA 4FTSA 5D8AB 4YFNF 2NYYA 4D6QA 1N1SA 3ES1A 1ENHA 2Y9ZA 3BIEA 1W9TA 1REDA 2IA0A 5KK1A 1UMHA 5GZFA 1WQ2A 1ND2B 2EB7A 5J1YA 2R0HA 3U78A 4PFPA 3ZFFC 1Y3TA 3LA2A 1NTCA 3I59A 2RJLA 1URXA 3M3QA 5FO7B 3JSOA 2VBWA 1QEXA 3T0DA 3PNTA 2JPCA 3J81K 4B48A 1PNGA 3O3KA 1JYWA 1ZHFA 5HS8A 2JDYA 1MACA 3QYBA 5CQEA 5CKMA 2CQ7A 2OS2A 2OKXA 3SQNA 5EG0B 4P9YA 3B69A 2B9VA 1ND2C 3J7ZI 1ZLJA 5A6XA 4GJYA 3AKQA 3QOEA 4RM2A 1IPKA 1UY2A 5BV6A 2IXSA 4GDFA 3LOCA 5FD5A 2X0LA 1JUIA 2QQPA 4GA9A 2KRHA 1BVVA 4KNYA 2RVCA 2XBO3 3S30A 1ON1A 1RJ7A 4AVCA 4NNJA 4BH9A 3F3XA 3QPTA 2KZGA 1H2NA 2NN8A 1XGSA 2BNMA 4Y1ZA 1SDDB 5FZLA 3VUOA 4IHXA 5LATA 4PDKA 1HQCA 4LO5B 4M3CE 4CEYB 3OY8B 1Y9GA 1TW3A 2XHKA 1ETYA 1SD6A 3I3BA 1JYNA 2ZX1A 2B46X 2D97A 2FMYA 5FY7A 2D5HA 3AL0B 1A36A 3DU6A 3JQXA 5E89A 2Y33A 4IW3A 4U36A 2K0GA 1FPQA 5DXDA 3WVJA 2XJRA 4FFIA 3OF1A 4P9WA 3GDBA 4XJ9A 1K12A 2Y0MA 1XRUA 4PZJA 5LHGA 2BVLA 3VBSA 2MPFA 4IESA 3GBFA 1ZZ7A 2B42B 3LZZA 1PIV2 5JI6A 1X19A 2ZO4A 3AL5A 2ZEWA 2KJBA 2XB5A 4DXTA 2RE9A 3ZSLA 1LTEA 4M74A 1H4HA 1V5FA 1CD3G 5LRRA 2QZ2A 1DYPA 2XF7A 2VKEA 3K2AA 2QBYB 4DYRA 4NIGA 3WT3A 1Y0NA 2D3PA 3K4KA 2FBEA 4GWJA 4P1WA 5JWPA 4H7LA 2R7XA 1F8VA 4KI5M 4IQ4A 2HXIA 3H36A 2OF7A 3OYHA 1TTYA 4ZXKA 1B4AA 4EM2A 3UGFA 1AX2A 2P37A 1PM7A 5BY5A 3OS1A