2Q1ZB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
185
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RpoE, ECF SigE
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 36
structure length 185
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2q1zB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1zB02
3FE5A 1HW5A 1ZREA 5C8WA 1ZZCA 5HI0A 4LEJA 4MUVA 2GU9A 3OD0A 1G6NA 3DL3A 3E5UA 3RYKA 5KHJA 2XL9A 4IEWA 3TNPB 3BB6A 4YNIA 4Z07A 2CGPA 5I0TA 1O4TA 5FDBA 5E16A 2OZ6A 1GQHA 4XEZA 4QM9A 3D0SA 4LTAA 4D7TA 1IPJA 3LA7A 1LRHA 4QXKA 5E1RA 1H1IA 4HN0A 2BYVE 4X6QB 4TLFA 3E6CC 2CV6A 5KHKA 4MGZE 3ROUA 3IDCB 3E6BA 4AVCA 4QMAA 1UCXA 4K8FA 4EWDA 4BHPA 4I09A 4XFAA 1DZTA 4F7ZA 4HLTA 5I0RA 3FWEA 4KU8A 2GC1A 5EFUA 2ET7A 1SFNA 4Q0UA 3M3IA 4GULA 1O3QA 5LRRA 4XFHA 4EWEA 2F4PA 3FFQA 3E5QA 3NJZA 4XETA 3KGLA 3ZDSA 3U10A 1CGPA 1CAWB 1Q43A 5K8SA 4HVRA 3WW2A 1QXJA 2PA7A 4LA3A 2BGCA 2OA2A 5JAXA 5FCCA 1EYBA 4MX3A 3FHIB 3SCFA 5BY5A 2FMYA 4R52A 2GZWA 4J1WA 1GQGA 1YLLA 5LEKA 1VR3A 4YRDA 4XFCA 1X7NA 4AXOA 3JZVA 4I3PA 1EP0A 5F1RA 3H8UA 5J3UA 1ZRFA 3PLQA 3RPQA 3H7JA 1ZX5A 2UYBA 3C3VA 1DGWA 2QDRA 2GH2A 4QGMA 1CAVB 4HVOA 1RGSA 1QWRA 2E9QA 3MDPA 4N9HA 2OYZA 1UD1A 1ZZ9A 1FXZA 4N9IA 3SXWA 1YFYA 1XE8A 4E2GA 3NKTA 4FAGA 4YARA 2EA7A 3ES4A 1LKNA 3D0JA 1J3QA 2DCTA 3GYDA 2C0ZA 2UYAA 1CAWA 4IEUA 4PIXA 5I8TA 4XF9A 4EWAA 4OLLA 3RNSA 2PHLA 1DZRA 4KWJA 5J7MA 4IEOA 5I8SA 5BXXA 3NSTA 5FLHA 3SMHA 1NYWA 4Q29A 2EAAA 5I93A 1OI6A 4Q0PA 3O14A 1X82A 4A2UA 1V70A 3BALA 2XHKA 1OD5A 4BYYA 4BIFA 1ZZ8A 4O9EA 1I6XA 2BNOA 4J1XA 5FQ0B 1X8MA 3CEWA 4ONUA 3WW1A 1EPZA 1NE6A 2D93A 2Z2SB 5CADA 4HBNA 2XLGA 3ELNA 4PJYA 3ES1A 3BU7A 5KHIA 2XKOA 4QX5A 4MGKE 3H50A 1CAVA 1OFNA 3M70A 3SCGA 1NZCA 3KCCA 5LEJA 4FAHA 1XRUA 3G7DA 2IXKA 2XKPA 5I0UA 5JSRA 2H6BA 3LZZA 1O5UA 2IXIA 4XF1A 3RDIA 2XLFA 5JSOA 4FT8A 4HN1A 1O7FA 2ET1A 1RL3A 4XF3A 4MV2A 4PIYA 2PYTA 3B02A 5AVPA 3QOPA 3VHRA 3MPBA 4JTNA 4YSFA 5KHHA 1RUNA 3EBRA 1O5LA 1FI2A 3CL1A 3FZ3A 3I59A 4F8AA 2IXCA 1QY4A 4CYDA 4BH9A 3WW3A 1X8EA 3CJXA 2P17A 4H7LA 5FQ0A 3IWZA 3S7IA 3TNQA 4UBGA 4ZU4A 2D40A 2EVXA 3BPZA 5BV6A 1U12A 2BEOA 4Q0QA 4I0BA 3IBMA 2D5HA 4JVAA 5EZWA 1J59A 2IXHA 2GC0A 2WC2A 4IEQA 1ZRCA 2O8QA 3HT1A 4IEPA 4IEVA 4MGYE 2ATFA 2B5HA 1OMIA 1LB2A 4D7SA 4XFFA 3U11A 2PAEA 2I45A 4XFGA 4MZUA 2WFPA 4UBHA 4WZCA 4META 2GC2A 2QJVA 3H7YA 4QGLA 4JTOA 1ZZBA 4LUMA 1H1MA 3EHKA 2B8MA 2FQPA 2MNGA 2D5FA 5CVRA 1J58A 2UY9A 3H3ZA 2ZCWA 3DKWA 1SEFA 3E5XA 3LWCA 2CAUA 3OTFA 4LULA 4MH0E 4XF0A 3PVBB 3KSCA 3MYXA 3UKVA 3I54A 2XL7A 1WGPA 1UPIA 2HJIA 3LAGA 4Z82A 5C6CA 5I91A 2XLAA 3DN7A 1YFUA 1CAXB 4AVBA 4QM8A 1NE4A 4KL1A 2VECA 3LA2A 4IETA 3PNAA 1J1LA 3UKTA 2Q0AA 5D1IA 3H1YA 1WA4A 4LUKA 4DINB 3OCPA 4AQ6A 2Z69A 3KMHA 4AQ2A 4QGNA 1ZZ6A 2IC1A 2O1QA 4KWKA 4ZU7A 4I01A 3CO2A 1XE7A 1CX4A 2VPVA 3UKNA 2MPFA 4NQWB 2ZKLA 4E2SA 2BNMA 3ST7A 1SQ4A 2Q1ZB 1Y3TA 4I2OA 4ZU5A 3LA3A 4HSLA 1PM7A 2PAKA 4LLOA 2PQQA 5JCTA 2PTMA 2GC3A 4HMZA 5KBFA 3ACLA 1J3RA 3H9AA 1JUHA 4IEXA 3CLPA 3HIFA 3OGJA 3H1WA 5LRSA 3OF1A 1RTVA 5JR7B 3FJSA 3EJKA 1CAXA 1ZRDA 3EO6A 4KWLA 4JV4A 4AVAA 4I02A 4PIZA 2H0VA 3IIAA 1L3JA 3EQEA 2KXLA 4NVPA 4Q0VA 3S0MA 5CU1A 3USSA 1ZRRA 3E6DA 3H1MA 3SHRA 3S7EA 5BUVA 3N4MA 4Q0SA 3NW4A 3RYPA 1O3SA 4E2QA 3HT2A 2B9UA 1CAUB 3RZZA 4I0AA 4IERA 2Y0OA 1NXMA 5FLIA 3HUGB 1Y9QA 2K0GA 1VJ2A 2QCSB 3HQXA 1YWKA 4ORFA 2CAVA 5FPXA 1UIJA 4X6RB 2Q4SA 2Q30A 2H6CA 4EROA 3QACA 4UXAA 1O3RA 4L2NA 2QVSB 4O9GA 1FT9A 4IESA 2VQAA 3CF6E 2UY8A 1RC6A 2K9ZA 2HKXA 4RD7A 4XFIA 5I0SA 3U0ZA 2N7GA 1UIKA 2OPKA 3H3UA 2BNNA 3IDBB 4L11A 3RYRA 3E97A 1RUOA 3BCWA 1YFXA 4IEZA 3GBFA 3L2HA 5BPXA 3LOIA 1YFWA 4HSJA 1YHFA 1Q3EA 2PFWA 2V09A 3DV8A 1O3TA 1EY2A 3I7DA 5FPZA 5T3NA 1ZNPA 4YYOA 4XFBA 5I8YA 3MZHA 1CAUA 4WVZA 1IPKA 2MHFA 2IXLA 4IEYA 4MGIE 1I5ZA 4WBBA 2OZJA 2PAMA 3SCHA 1Q5OA 1QXRA 1UW8A 1VP6A 2PHDA 3NVCA 2ETEA 3D82A 3WW4A 4HVQA 3R6SA 3ETQA 1LR5A 2GAUA 1ZVFA 2IXJA 4R8HA 1YUDA 3NL1A 1DGRA 5FLJA 1ZZ7A 2XGXA 4P9GA 4XF4A 4FBFA 1WLTA 1PMIA 4OFGA 4KU7A 3FX3A 4B29A 4LA2A 1J3PA 2QNKA 3KGZA 4HZFA 5JSPA 1TQ5A 5J48A 5KHGA 4EV0A 3I59B
chains in the Genus database with same CATH superfamily
4ITCA 5ISLA 4A45A 2P5LC 5IOZA 4K8RB 1EKEA 3ASIA 1XNKA 4K1YA 2XONA 2NVXJ 1R092 4HPKB 4EN6B 1K6YA 4TTGA 3BROA 4IEWA 4AI3A 1KS5A 4KISA 4KA4A 4IVNA 2DMUA 2E53A 4B4QA 2DYRH 4LTAA 2DA3A 2NVUB 4PCRA 4X6QB 4EN7B 1BM9A 1RHI1 4FFFA 1YQ5A 3TN91 3L7WA 4Y7NJ 1B09A 3HBLA 4AIHA 2L2OA 2ZX0A 1PO13 3MWMA 3RQIA 2QZ3A 3O1OA 2QYOA 1FMWA 2ZC2A 3JAMZ 2W1WA 2VVEA 1QQP3 3KZYA 3M3IA 2RN7A 5BNOA 2ME6A 1PVC1 4J00A 4F83A 2DQRA 2HWVA 4XRSG 1AKHA 1TME3 5IP6A 3T1MA 4AL9A 3TDUC 3I97A 4LJZF 3NV3A 2A5ZA 2QQVA 1GHCA 2WBKA 3DEUA 1EYBA 4MX3A 1HB2A 3FHIB 3SCFA 4IOCF 4ES8A 1F31A 2ZTNA 4PBPA 2UWAA 3BTIA 2WQZC 2JZYA 4UVBA 4B1RA 1R58A 4PCQA 5FD6A 4DGWB 4Q5OA 3VD9A 4TN7A 4KIFA 1WKMA 2EAKA 4P9LA 3CZ6A 3NMBA 1V6NA 4RFT0 2XPJA 4WXHA 1FP2A 3UKGA 3T1LA 2KZGA 2WZ8A 3CQOA 1W0NA 5DN2A 4M9ZA 2EFOA 2FQ3A 4ENMA 1TZOA 3WHCA 3CJIB 5I8TA 5DQ0A 4R1HA 1NY71 1U5YA 3WUCA 2PHRA 2BBYA 2XAJA 2VNVA 3RTRA 2GA1A 1BOBA 5FZ8A 4L0PA 4AYBA 1O91A 1Y0NA 1J9IA 4CU8A 2I2SA 3KPHA 2NN8A 4BYYA 4KH9A 3WQ1A 2XPWA 1UY0A 1LGNA 3NWTA 3JXSA 3IRQA 2Z9OA 4XVHA 4XHBA 2Q8CA 1MZ6A 3VDAA 2L9LA 3H50A 5F5IA 1HQCA 1AXYA 4XIDA 3DF8A 4JKKA 4FAHA 3ZMZA 3IT8A 1FPN1 2BWAA 1RKTA 3MKLA 4W6WA 3M7GA 4YM0A 1ENRA 5FZGA 1G9BA 3LD8A 5H9PA 4B09A 4MHUA 5FZEA 4XILA 3OYKA 5H6RA 3OYWA 4YW2A 2D6OX 2Z3YA 1BIAA 4YSFA 5FREA 4UI9L 3RKQA 3I49A 1NA1A 5B4NA 3KV9A 5GZCA 5ILSA 4OIOF 2FZ1A 3HKZN 2JA6J 3RMXA 3ZR5A 5F3CA 2W4SA 3NAUA 3VYRB 2LUWA 3KEQA 1RUF3 1D7PM 1BR4A 3ZXEA 3D3AA 3PU8A 1PNFA 4MSVA 1O59A 4JRLA 2PMWB 1TZLA 4A6DA 2B63J 4W65A 3FXKA 1ZZBA 2GALA 5DDJ3 2VBPA 1O4ZA 2DQLA 2MNGA 4ASMB 2AQFA 1XDSA 2B7YA 2CAUA 4MH0E 1RUE3 5M3FJ 2BUKA 1HIXA 4CU9A 1LHNA 5CVVA 4P9IA 2X48A 2BW3B 2Y34A 4YVSB 1MGTA 2CHHA 4A4AA 5CKTA 4Y22B 1VQNI 2HEVF 5JI6A 2C1FA 5LD2C 2DTYA 2W00A 5A6XA 5FZ7A 3SEPA 3ZFEA 4BQ3A 2E71A 3MAJA 1SCRA 4IV3B 1LGCA 2RS32 3CTAA 3G71I 3GX4X 3WF0A 3QWLA 5FPUA 1ZZ6A 2IC1A 4L97A 3TO6A 3B73A 3O1PA 5IYDJ 1RKWA 5FXZA 1YFHA 1GDTA 1JZ8A 4ITVA 4NQWB 3T4HB 4AHWA 3F8NA 2VONA 4P1WA 3DCFA 2XASA 3WTZA 3OB8A 1JS9A 1OLMA 4YZ1A 3RCOA 2X6XA 4FPYA 1I9RA 2RREA 3ZMSA 1LE8B 2BHYA 3KVBA 5TISC 1MQTC 2XUMA 5F04A 4AWXB 1XC6A 2HVSA 4TZDA 1IOAA 3OYGA 2VOXA 4YRVA 1FOD2 1HRI1 2VQUA 1IGOA 2HQNA 3L2UA 1NK2P 2EV6A 1MDMB 1SANA 3RYPA 3NW4A 1CIWA 3NNLA 5J1YA 3ZQCA 1S0BA 1UAIA 2JRTA 1U6GA 3JSPA 3JUUA 2K0GA 3OBZA 4L9TA 2FHRA 4UW5A 2A3SA 5EGOA 3ZMDA 2WYSA 3FLPA 5JZGC 4CDQA 5KR7A 2XAFA 3VFZA 3QQAA 2RS12 3KCXA 4WM7C 2R1DA 4LIVA 1O3RA 1WD4A 1AR92 3A03A 3OYCA 2A71A 1EAH3 4FQZA 1UY3A 2QWWA 1QU0A 1WCDJ 3K46A 4IW3A 1IN8A 1S8NA 1WZXA 4RGRA 5KK1A 4RFRB 1QH7A 1W9TA 2CU7A 2ID4A 1F43A 4N0BA 3LEGA 4IO9F 4BQXA 2P5BA 2NAZA 2ECBA 4DUVA 2M1BA 4YYOA 5HV4A 5K5OA 5C3SA 1K78B 2VIXA 1FOYA 1TQIA 4A3GJ 2IGOA 2HVRA 4PBOA 3UESA 4CP0A 4CCDA 5KC6A 4AU7A 3SCHA 4DQ2A 1COV2 1OH3A 3AZYA 2VQTA 1YUDA 2ZXIA 1RJ7A 1GWLA 4YFNF 1WW5A 2LY1A 3WXPA 4BEHA 1J3PA 2W1QA 3LOCA 4C1XA 5GAGJ 4EJWA 3ON7A 3QPTA 5L7OB 2JG9B 1HN0A 3A01B 3VB9A 1NZIA 2J7MA 1BN5A 3HGGA 1VBD2 2VNRA 1ZBE1 2ZGTA 4FPHA 3T0AA 3NJYA 4XJWA 3FM3A 5I0TA 5E16A 3ZN4A 3D0SA 3IH4A 1FZPB 2VCAA 2JRMA 2DFIA 1MNDA 1PO21 4MGZE 5FYTA 4CDXC 4RSUA 4UW4A 2DUOA 2RVAA 4RGGA 1KJRA 1JHNA 1OCTC 2LG4A 4I7HA 3SJMA 4OINF 4E9KA 4I09A 4S2DA 1H0BA 5F32A 2GMPA 1YQ2A 5B1AH 2CL2A 1VLNA 1F9NA 2X8KA 5IT6A 1GV5A 1UU4A 3NJZA 2HWF2 2OVUA 1CGPA 3ZQQA 1GOHA 3BTCA 1F4KA 4GB33 2KT0A 1W8NA 3OYMA 1OQ1A 1VB4A 4XIOA 2ZNYA 1WI3A 3BG3A 3V8KA 4Q4V1 4R52A 3THTA 1JI8A 1SG3A 4Y33A 4LGWA 1F5FA 1BLZA 2XAUA 3LNQA 1KU3A 5K7ZA 4C90A 4IOAF 4N53C 2F5VA 3C1DA 4AWDA 5FFXA 2O8KA 4YW6A 3V56A 2CUEA 3H7JA 2WNVB 2QQKA 1HLVA 3I53A 1OUXA 5HLGA 1CQTA 1N77A 1MBKA 2WO7A 3HOSA 4UF0B 2VMHA 1GLNA 1XCVA 2HYJA 2E2JJ 2YDEA 2P2KA 3U4XA 3VN4A 2AHQA 1W6NA 3VSLA 2NM1A 4FOWA 2VZSA 3WG2A 3RNSA 3K70C 2WV1A 3G2BA 1SDWA 5FK7A 5GP9A 5GADJ 1MMDA 3NSTA 3HEFA 4YVWC 1CF7B 1X2MA 1XTAA 3HAGA 5FZMA 1DFQA 2M4GA 4MEYF 3IH2A 4JGYA 1GQPA 2XRLA 1W8ZA 1C8M2 1DBNA 4JDMA 2FBKA 4G6DA 2HYGD 2DA1A 1UHWA 1OYWA 2MLGA 5IP9J 1SFOJ 3O1SA 4CE8A 1RVF1 2BTVC 1PIV2 2IXKA 2E31A 3X29B 1B1BA 1EV7A 4LQRA 2F6CA 2E6VA 1V9U3 5IUQA 1CN1A 3ZQHA 1OF4A 2ET1A 4UFJA 5JOZA 1ENSA 4LHSA 2PYTA 3B02A 4M4RA 1W5SA 3MV11 2Y6KA 5CFDA 4BK5A 3PTRB 4JTNA 2Q1MA 5FZAA 4FFGA 4D3WA 4O3MA 1PK6C 5K0UA 3BPXA 2QLZA 1HLCA 1VZ0A 1VBE3 2JD9A 1YIFA 4LPLA 1N47A 5EJCA 5A7PA 5J1XA 4LBNA 2GP5A 4ZU4A 5BV6A 2DCKA 3AMMA 5D8LB 4Q0QA 1E5HA 1FAYA 2PLYA 1NTCA 3LGRA 3CMGA 5CFCC 1ZARA 3OUJA 1YYNA 1A04A 2QBYA 4XFFA 3Q8BA 2ZMEC 5IP7J 4YW5A 2ZJCA 2W1OA 2O7OA 1V5GA 5JPMB 2IFWA 3PO3J 2K85A 5GKAC 5L9BA 5D5VB 3LFUA 2WFPA 1T0FC 3WX5A 3SEEA 2RS53 2I5UA 3H3ZA 3JRHA 3OYHA 2YX4A 1KYZA 3OPZA 2W24A 2QFEA 3UKVA 2O0YA 1FYUA 4Z82A 2RV8A 3G1OA 3T8RA 2JUGA 2VO5A 4EM0B 4PLMA 4G7ZF 1CESA 4QM8A 5C9AC 5EJZB 4N7UA 4BS9A 2JT1A 3FMQA 3GFMA 5FKCA 2VTFA 5D1IA 2OF7A 2W25A 4Q4W2 1NXD1 3ZX7A 3KLSA 5A6YA 5FY5A 2AYHA 4PJNA 4JAAA 2KFDA 1GWKA 1MBEA 2ORZA 3QH7A 2ZEYA 3H1CA 3ST7A 4TXWA 1SFXA 1K5JA 3JRCA 2VPRA 1B72A 1G9CA 3IPVA 2PQQA 2OBPA 2R7QA 3S1NJ 5JHUA 1AKHB 1ZBA1 3ZQFA 4P5OA 1Z3YA 2C9KA 1Q8OA 4M74A 5FO5A 1RRJA 3JBG3 2J1TA 4XL9A 3I5UA 5FRNA 2IA2A 4B8XA 1BMV2 4XNFA 2VE9A 3WNKA 5L19A 2JK3A 4E7JA 1ST8A 5H6QA 3NJXA 1LHVA 2B9UA 2WA4A 1GXPA 4RQPC 2MABA 4AE2A 4XQDA 2RR13 2ZJ2A 2E19A 2WNUA 2XJQA 2M7AA 5F0FA 5JIUA 2L4AA 4NROA 4EROA 4EE2A 3SEZA 3P3NA 5DABA 4MFEA 3M3CA 4GZ9A 4QPIA 1RC6A 2HKXA 2CYFA 4XUQA 2VOWA 3W59A 1UIKA 1PUEE 1S0EA 3JRGA 3ZYFA 2XAHA 2VCCA 1JYIA 1FMD1 5T5LA 4IEZA 1XD7A 1GXQA 3IRRA 2ICWG 1LDJA 3MICA 5HCBA 3MBWA 2ZX3A 1D0ZA 1ZNPA 4WVVA 4QIWN 4L8QA 4IUGA 4I76A 2E7XA 4QX1A 1D0XA 2EZLA 4RLFA 2FBEA 2MHFA 4MGIE 2PHXA 1KQ0A 4BL0B 1DU0A 2G4IA 4RS8A 3FUQA 5FP8A 4M72A 2PEXA 4AEKA 3KP3A 5LK7B 5JHFA 4MIMA 3CDZB 1JTXA 1VBB2 1DF0A 1W36D 1S0DA 1DGRA 2W85A 3NV4A 2RDSA 1OOPA 4H2AA 4BJTA 4KU7A 1OVSA 4Y1XA 3FL7A 4KGQA 5FGMA 5C4WC 2X1DA 4CTEA 1NCQA 3TN93 3ZOIA 4TV7A 3ZMOA 3C18A 1JMUB 3HG9A 5L3DA 5FZKA 5BPIA 2WUHA 2Y6LA 1XU1A 1HB3A 4OHZA 1CONA 5GAEJ 4XEZA 1P7IA 3RJRA 4P5HA 3DU6A 2BOIA 3C7JA 1W2UA 1ZM1A 3DTEA 3DEMA 3K1NA 4FTSA 5FY4A 2DCJA 2IAIA 4OU0A 3DWLE 3J81Z 3FKJA 3O0XA 1PZ9A 3TWIA 3JR9A 3IDCB 3A4CA 5FZ3A 2E35A 3L2WA 2WY7Q 4BQAA 4Y1UA 2YU9J 3POFA 4Q0UA 1NH3A 3D5SC 4WM8A 3KHCA 1VQKI 1LEDA 3KGLA 3V65A 2P81A 3QP5A 5IVFA 4W6XA 3RGBA 1J5YA 3MKZA 2QQUA 2HGCA 4EQVA 2OA2A 4H7MA 4RN5A 2V6CA 1UZ0A 1LOGA 3PSIA 4KBBA 1A3KA 2EIGA 3LIGA 5F2SA 2M30A 1C1FA 1H8AC 1O4XA 2WWJA 5FZBA 2JIJA 3H8UA 1W5CC 1SAUA 3WNLA 4C1WA 2GH2A 2E1MB 3K4MA 4BQ5A 1QWRA 1OQDA 2O03A 1TNTA 4NHXA 1FXZA 4DUWA 3BG6A 4E7SA 2ZNZA 4LK0F 4U7BA 4PDWA 1ULCA 2VODA 5DUWA 2R7VA 1C5HA 3FMSA 4RR3A 4IEJA 2W95A 3FF5A 1CAWA 1R71A 4XZPA 3K4BA 1DZRA 4KWJA 4Z2AA 1J83A 5J4YA 4BQ1A 2XPUA 3NARA 4QD2A 1TT5B 1V70A 1FPN3 1PZ7A 5DM7F 3JTHA 1F15A 2CSOA 4A3LJ 3MW2A 2WFF1 5A80A 2FDKA 1R36A 1A6CA 3CJNA 2VLAA 3GLLA 3CEWA 4UOJA 5JVGF 4ONUA 2BOLA 2D6MA 2D93A 4MG2A 4LK1F 4CXFA 4IKFA 1O7LA 2A6TA 4CU6A 1IZ3A 3EYIA 1W6OA 4RL7A 2VTXJ 2TBVA 3TRSB 1YC61 2W47A 2RM21 4HKWA 2ISYA 3DTIA 3PNTA 5L9RA 4HN1A 3INAA 1IV8A 1S0JA 2FBIA 1YS7A 1E0EA 5F5AA 3TW6A 1APNA 4A6EA 1QJEA 3S93A 2VUCA 2GMEA 2E1CA 3KLOA 1RUJ2 1SFEA 4XM3A 3EETA 2F5CA 4JX4A 4U0WA 4WK8F 3N9OA 2CU5A 4RB3C 2DCEA 1VAKA 5EJ1B 3UJOA 4XKBA 3IBMA 4A7YA 2AUYA 3PVNA 2PQSA 2FD5A 3I0TA 4OQ8A 2PHFA 1H8VA 4QX7A 2CW8A 3HT1A 4RGSA 3VWBA 5FWEA 3FXLA 3ZM8A 2GWRA 5F0CA 3U07A 1ULEA 4B47A 2I45A 4AFAA 1D1CA 2XC7A 1K61A 3J80Z 4PLNA 5D5XB 4M4PA 4OOIA 2WZPP 2G9WA 1OCOH 4W1UA 4RM2A 2MW8A 3P5BA 3CD6I 4XF0A 3GTGJ 1HW2A 3GHNA 1Y4WA 2ZGNA 1G8XA 1Z91A 2HJIA 3S1RJ 4YG2F 2NZ9A 1T39A 2LYCA 3IAQA 3MLKA 1T6SA 3NAPB 2QKMB 1YJLA 2A5WA 4I30A 3F23A 1JKQC 1W7PD 2QUOA 2JDPA 3RZOJ 5IVYA 4QTRA 1UL9A 2DT7B 3NKGA 3EB7A 1FX7A 1CZVA 2ZGKA 3WF4A 3AB0A 2FDGA 2VPVA 2MPFA 1YX5A 5IPAA 4M3FA 1ASJ3 5KWRA 1K4SA 2NMOA 2Q1ZB 5FD5A 4YGBA 2WZR1 3KQRA 5AONA 1XDUA 2GC3A 4HMZA 2H27A 3ACLA 3OS0A 3K2AA 3VBHA 4A7ZA 4QX2A 3HR9A 4F92B 1S2BA 2CRGA 5DXDA 2HZTA 3N97A 2UZKA 2DBBA 1QZZA 3LPGA 3QU6A 3VV1A 1MMNA 5HDGA 5HNFA 1QHHD 4NNJA 3GCMA 5DYMA 2P1BA 2X29A 4COYA 4DYCA 1GR3A 1UOJA 2X6OA 2ZZJA 2GNMA 2P8TA 4RAYA 2EIKH 4UB6C 2CUZA 3W2VA 5M5YJ 1CAUB 3RZZA 1ODNA 1YG2A 3KZ4C 5EHDA 2QCSB 2HS5A 3H0GJ 3CJRB 4O6JA 1KJLA 2BZTA 5HV0A 2FMDA 2AO9A 4IV1C 1D0HA 1PGW1 3K4LA 2A7AA 2QQMA 3JD72 1MS5A 2W2IA 3KM5A 5H20A 2OPKA 3H3UA 4DPNA 4Y5Z0 3Q8AA 5EIYB 4RBOA 2DW4A 2P34A 1EUUA 4ZXEA 2L5QA 2JVHA 3EQLF 5J36A 5AIQA 2CW0F 3I7DA 4XBNA 3A1YA 3WZ1A 3MZHA 2UWBA 4C2TA 1RZ4A 4WVZA 2ZACA 3OGSA 2VBBA 3E7LA 1ULYA 1CD3G 3FK6A 1FV2A 1UW8A 1VP6A 3V8JA 4E6KG 1ON1A 5F2WA 4NIHA 1C57A 1ZHFA 2QSGX 4E7IA 3THCA 1LENA 2D6NA 2A75A 2R7WA 2IPQX 2AREA 1F2NA 4Q2FA 2XVLA 2OCEA 3KFWX 5A7OA 2A61A 1LNWA 1MZBA 3TGNA 1MS8A 3HZJA 1TE1B 1XB4A 2WA0A 2HWB3 4ETSA 1XPWA 2ES3A 1HB1A 4GYIA 1PM4A 5BNOC 1ULGA 3ZFFA 1I50J 4LBQA 3GFLA 1WUVA 1UF2C 3V0BB 2BQPA 1X9PA 3DYMA 3MKWB 3VZOA 1GZWA 1DQUA 4ATFA 1B4AA 4MYEA 2WAQN 4UV8A 4K9SA 2H1LA 4WZFA 2DTZA 3SFZA 4XJZA 4BHPA 1HV1A 2M4KA 5J98B 2Y8KA 4P9FA 2Q1FA 1OT5A 5FZCA 2XBO2 3K51A 4M3CE 1CJDA 3MW3A 4PI2A 5A2QK 4GIQA 2P3KA 4HBLA 3TMOA 5K8SA 1RUC3 3UGGA 2JE9A 4IGOA 2BGCA 3LSPA 1RUD2 4LKEA 4YM2A 2KRFA 3PUAA 1GQGA 1QOSA 3T08A 4Y1ZA 2ZBJA 3HRMA 4KIGA 1X7NA 2UU8A 4EJVA 4I3PA 1PP8F 1AR82 1OA2A 5E20A 1OUSA 5CVJA 2IZWA 3BPVA 2R7SA 3IPVB 2FCTA 1YFYA 4G6TB 2WJSA 3FXMA 2W9XA 3JB8A 4XF9A 4IHXA 4JQFA 5FFZA 2PHLA 2C24A 3NWKA 2V1UA 3G4SI 1WLWA 5FLHA 1ULPA 1UX7A 3HOWJ 5J1RA 3GCWA 2CDPA 3EMRA 5LA1A 3OWTA 2VD7A 4A5NA 1S0GA 3CCRI 2CFOA 1LKXA 5LGTA 2A6EF 4H3WA 5JR2A 3MIDA 4LOTA 4X1EA 5ACA2 5B4XA 4EJOA 2GXGA 4Q4Y1 2G7UA 1KFUL 5DD4A 4NBQA 3QOEA 3M70A 3O0WA 5FUNA 5LEJA 1GVJA 4MXWB 5F37A 3S1MJ 2TUNA 3M3OA 3VBUC 3HPNA 2V72A 4QHOA 1I1SA 4CUAA 3RI8A 5CPRB 3JRAA 4N43A 3ILFA 2JDYA 1HXS1 3JQXA 1AR73 2NQYA 3KV6A 4PF5A 2NOGA 4ZDLA 2EIEA 1EH7A 4C3HJ 3ZYGA 4M9XA 3S7IA 2AC1A 4Y20A 5C3RA 1T6GC 3SFIA 3CCQI 1T08B 1MACA 4QPQA 2O8QA 3LSJA 1YIJI 4RHV3 1POGA 3U1XA 2L3DA 3HNYM 3O1RA 1S5LC 2PX9A 3ZYJB 1IZ1A 2HBUA 3H3LA 5FP7A 1JYCA 2H09A 1OOPB 2C6SA 4QWQA 1MEC3 5IWFA 4LUMA 3ZMTA 4XR6A 1Q8SA 3ZFEC 1H2LA 2FQPA 5JOWA 3U75A 2X5IB 4ZKTB 3LSMA 4ARXA 4MTDA 3OTFA 1FIPA 2JIGA 1DU3D 1RI7A 2LDUA 1EV13 4MVTA 3LAGA 2FDHA 4CEWA 2PMHA 2ZOEB 1UZZA 3A0NA 3K70D 1YFUA 1Z7S2 4KL1A 1H2NA 2DJIA 4AQTA 2GA2A 1ZBA3 2Z1DA 2IGKA 3LOBA 4JOMA 5AC91 5CEHA 4C3JJ 2OXBA 2CJJA 2FNPA 4Y24A 1FOWA 3UKNA 3FMRA 2RVCA 4BACA 4E7KA 1WHUA 1SLLA 2WT2A 2XF7A 1UYPA 3T30A 3DF0A 2PXJA 2XVKA 3ILNA 4D5FA 1WVRA 1JJ8C 3S2HJ 3TAYA 3ZYPA 2QA4I 1HSTA 4UB8C 4CP9A 3S2WA 2VNGA 5HCAA 3EJKA 4KJZA 1S7OA 1MKMA 4CDQC 2CH0A 3BKZA 2FDJA 5BNPA 4NVPA 4Q26A 2VXJA 2FD8A 4PDKA 3H1MA 3GTMJ 4NR1A 2CSGA 4I99C 1HDPA 1MSEC 1X33A 1JHFA 1AL22 2XH6A 1NXMA 3VD7A 3DPUA 1WJAA 3WF3A 5FY9A 4JX6A 4EYUA 2KR2A 2KJBA 2VW0A 5B5EC 1EH8A 2VZOA 2AR6A 1Y6IA 1UIJA 2V5YA 1FMD3 3WHUA 4B7KA 3ITQA 3BCAA 3VODA 4XTMA 1R1A1 4UXAA 3S57A 1QJY1 4UUVA 5A3PA 1Q1VA 1RITA 4ZONA 1D1AA 2WAEA 4YEJA 5FMOS 1ZYRF 3L1PA 2XJSA 3K4KA 5GLWA 3ZXLA 3K4DA 1D8KA 4P9UA 3AMQA 3W2WA 3BCWA 4LLLA 2R93J 4CDWB 4ET7A 4HSJA 3PJQA 2JG8B 1VRH3 4N8MA 3PJYA 1A36A 2E5ZA 4QB1A 2ETEA 4YG3A 4HVQA 3ETQA 2JN6A 2AZ5A 1FSEA 3TOBA 3LSGA 3MZYA 4DXSA 2R1BA 3R60A 1MMSA 1E3HA 1K5MA 2R063 2QQPA 1RUI3 3HKZA 1AYN2 2QNKA 1HQWA 3KGZA 4MQ9F 2QTWB 1TWGJ 1QPMA 4D9JA 2E5NA 5FZOA 2R072 1VBA2 2WT1A 1W2AX 3ZKUA 5FB2A 2DVDA 4ASKA 3IWFA 5KHJA 2WWUA 3V7RA 1IW7F 3WCSA 2O0OA 5FDBA 4GYGA 1PHMA 4RYDA 5HNHA 4GO1A 2V4VA 4XMIA 3K4CA 2LNBA 2CV6A 3K2OA 5EQUA 2HWE2 1Z05A 3RRDA 3B5LB 1FATA 2ZHMA 2ZZQA 5BYNA 2VMFA 3C7FA 1URXA 4XFAA 3KP4A 4BQWA 1DP7P 1F8VA 1JUPA 4D69A 5EEGA 2MH2A 3LSTA 3ZP5A 4G3YC 2A3WA 1PZ8A 3IN9A 3FKIJ 2W91A 3LSEA 4NN0A 3WTXC 1I6HJ 2D97A 4LG3A 4RS5C 3E3VA 3IH3A 4XKVA 4EVIA 1HOMA 3MEPA 3G73A 5KXEA 5FRMA 4R4XA 1ENQA 1RUG2 1X50A 3AMHA 1I3QJ 3CC4I 2JKXA 1AYM1 1YRNA 2DPDA 3X2QH 4KN4X 4Z6YA 3T0DA 3BZ6A 3PJRA 4DYRA 4WXCA 1A34A 3O1VA 3ZPOA 1JT6A 1XJAA 1YTYA 4BJ5C 1IS5A 2E9QA 2VZUA 1H8TC 3IUOA 2E7AA 2OYZA 1WMXA 2A69F 2Y0SA 2JB8A 4JGYC 1MS1A 3VYSB 3TO7A 4LBKA 1UJ8A 3H9QA 4IEUA 1OQYA 2YY1A 4OLLA 1DPUA 4CGZA 5M5XJ 1LPQA 1OYIA 5D8AB 1BEV2 1R5ID 3GBGA 4QPOA 2YB7A 1QDOA 2MEV3 5E89A 3BR0A 1GV2A 2R7DA 4IE0A 4QSHA 5TJJA 4SLIA 1N1VA 4H4KC 1ZRIA 1QJZA 5JFRA 4AEDB 5FOBB 2LP0A 2HXOA 4DXZA 2Z2SB 5K5RA 2QQ8A 2GMMA 2LKSA 2XLGA 2GDFA 3POGA 4OIQF 2ZO4A 4MGKE 1UHSA 5K0UC 2B4KA 1QJU1 2HBTA 4MQVA 4XLAA 5JSRA 4XCBA 4XLNF 5JSOA 4Q4X2 2PLV3 1BK0A 4Q1RA 3I3DA 3UNPA 3N7KA 3S1QJ 4AFBA 3GDBA 3OD4A 2EXIA 3OUHA 5EDNA 1OCRH 4QDSA 4HFSA 1OKRA 5F0HA 5IK4A 1J2XA 3CESA 1HQNA 1W06A 3TNQA 2OD5A 1L7LA 2EVXA 1BVVA 1WLDA 5FMCA 3HD8B 2B9SA 1W9SA 5I0DA 2WC2A 4JX0A 2VULA 2DODA 1IQDC 2DXIA 1R093 2GSYA 3RKYA 4B4RA 3AM2A 2W1SA 3MIHA 1OD3A 1EJ9A 5FKOA 2ZX2A 4XFGA 1JOJA 4AFCA 2PJRA 2X85A 4XRMA 4META 2V7FA 4NC8A 5FRAA 5DZGA 2JDKA 3WGIA 3F8BA 1K6OA 4AIDA 3HTSB 2ZCWA 1HDDC 1S1AA 1W8TA 5LA9A 1WGPA 1A31A 5L9VA 1RMU1 3S2DJ 4MADA 5LLQA 1TWHJ 4I6ZA 4MGQA 5G04L 2HVQA 1DZQA 2VBWA 3I2HA 4G7HF 4HDVA 1GZTA 1VQ4I 4XAEA 1SEUA 4XYXA 3ZFGA 1NG0A 3I2DA 2DN0A 4QXCA 2VUDA 2Z4FA 3IKTA 1RXFA 5D2AA 5A3WA 2PN5A 3NNGA 4D8MA 2SBAA 3DPRA 4I01A 5E1ZB 1XE7A 3K4JA 3SQOA 3DCQA 2EXKA 3BUCA 4B8EA 2ELJA 2K86A 3WP4A 5FY0A 4AAPA 2OUHA 4UY8I 4YFWA 2ME0A 3WTUC 4M3GA 1QA6A 2CGNA 2ZKNA 2OT7A 3C7GA 2G7HA 2CUJA 2LALA 3OGVA 2GBYA 2EZIA 3O6BB 4AR2A 3APBA 1KFXL 4M0NA 2ZXQA 3HPHA 4PJLA 1OF3A 3UGFA 4I02A 1U5XA 1X3ZB 2VXZA 4AVSA 4W8JA 4PZJA 5BNNA 4A3CJ 1DLLA 3A02A 4QHBA 4QPIC 4HKOA 3PSFA 5FZIA 4BCUA 3M3EA 3B6CA 3CLQA 2EILH 3TKYA 4BLJA 1ZA4A 1TMF2 3LPFA 4SBVA 2R5ZB 4FSJA 3VBRA 1FX5A 1VQPI 1OPOA 4HV5A 1PO11 3OG2A 4JQRA 2J22A 5I0SA 4FQ4A 3K7AJ 1TNSA 2DPUA 2XB0X 2ZJRF 1W6PB 1QQP1 4S0HB 3T5XA 3BWGA 3WNNA 3FZVA 3U2RA 1I5PA 3ZXJA 1REEA 1TME1 3L2HA 4YW1A 2E36A 2V09A 4PI0A 4LBJA 5T3NA 2Z33A 1HDKA 4H0EA 1AHSA 1WKYA 2CO5A 4XJAA 4WF2A 1NCQC 3J7YJ 4IRGA 4MGTA 1ZR4A 3ABLH 3EXUA 1ACIA 3FX3A 4IHYA 1ZLJA 5IAVA 2QQOA 4JGZB 2BDRA 2JDHA 3VDDB 2DMPA 1XNCA 1WH5A 2A5YB 1WLCA 1XNDA 2MBFA 1TG7A 3AYAA 1PGL2 2OAZA 4Y20B 4B1MA 3FBIB 2VJIA 1U2WA 4RB2C 4LNVA 4ZZ5A 4XIKA 3IMMA 4DNYA 1K42A 1DGRM 2OX0A 3TW7A 5A32A 2ZGQA 1W8UA 4XOGA 4WM8C 5GALA 3LA7A 4U87A 4OAZA 5EF6A 2RGVA 1C28A 4XUOA 4L9NA 5LASA 5DG1A 5KXCA 1PVXA 5DDGA 1R22A 4KG8A 3LFIA 3VBSB 4QXHA 1P4WA 4X0GA 3N7MA 2RS33 5LGUA 1QDCA 5EYYA 4Z2YA 4M73A 3PUBA 2R92J 1GP5A 4XHXA 4GFBA 3U10A 5LHGA 1OLME 4BGDA 1LHOA 2ARAA 2OV7A 2YBSA 2IXSA 2D6KA 4XMAA 3BOWA 1LECA 1WJCA 4ESJA 5IW0A 3WHBA 4LR4A 1RUH2 4PDWC 1IG0A 1KD7A 3NNJA 1MPXA 4RR3C 3RKWA 5F1JA 1P2FA 4XFCA 2DCZA 1BW6A 3F21A 2NLRA 5J3UA 2HQRA 3K6GA 1RUF1 4NWVA 4Q48A 2UYBA 3HSRA 1K7AA 1ETQA 1CAVB 4YGDA 5IAXA 2LM3A 3CC2I 2M5WA 3P1IA 5FP3A 2HWD2 1RJ8A 4Q1PA 4CP9B 2YHJA 3F9KA 4Q4Y3 2VR4A 4IEOA 1QRYA 1X9TA 5DDJ1 2RS13 2DVAA 5EP9A 3I3QA 1Y8RB 4Q0PA 3N9NA 2A1XA 5BNPB 1ENHA 3ISPA 3EUKL 1BQPA 1AR93 3OY8B 3LIHA 4OHYA 3GTQJ 1RUE1 1ND3C 1VB2A 2JKBA 2MC4A 5KHDA 1EPZA 4A3MJ 2E63A 2EXHA 2NOJB 4XBFA 1OFNA 2XF6A 4XRFA 3O7OA 3ZPYA 5EZHA 2V4AA 3AJYA 2WY8Q 4UV9A 1YQCA 2XVCA 1UMIA 3M4OJ 3CJIA 2HPIA 2EIMH 3K10A 4RS5B 2HQ5A 1COV3 2R6QA 2R7RA 3VHPA 3DBLB 2RJLA 4F8AA 3FDYA 3ZSMA 1CJPA 4HOOA 4FISA 1QVTA 4RGKA 2B7EA 4H7LA 4OCTA 1YJNI 4DB5A 1O57A 1HJGA 5FKNA 3SKVA 3ACIA 5F8PA 1ETWA 5LBQA 1UY1A 2WA3A 4F91B 2B5HA 4QKNA 1UKGA 1H8TB 3JCUC 2A6XA 1OR7A 2FXAA 4IRIA 1X2NA 2BERA 3ZLIA 2YMZA 2XWBB 1BI0A 5LW9A 4PHZA 1UY4A 1TEIA 2IA1A 3VZJA 2BY3A 3WF1A 1Y43B 2EINH 1H1MA 4XK4A 4E8DA 5DAQA 1W3XA 2E34A 1QKQA 2GIVA 2FA5A 3SH5A 3CMYA 1X1BA 2Y6HA 1VBC2 4D6RA 4Y26A 1EAH1 4AVBA 2KL4A 3OYIA 3ASOH 2Y38A 2WO1A 2A07F 3RWKX 1Z67A 1MS0A 2HWF3 3SH3A 1VQLI 2CQ7A 3IKWA 3BG5A 3CBNA 1MJ9A 3OCPA 1JOBA 1VQ9I 4FX4A 4LBLA 2ARBA 2O1QA 2VZRA 5DAVA 3E0JB 1IRFA 3ESWB 5JXGA 2IWGB 2BNMA 1SQ4A 3WDXA 4OQ9A 1CX1A 3ILRA 3K48A 1Y3TA 2EFPA 1AF9A 3PVOA 3POBA 3R4KA 2TEPA 2XMLA 3JQWA 4HF0A 5LRSA 1DGWY 1E5RA 1ZYBA 1WA6X 4Y13A 2BW3A 4YVSA 3ELKA 3KHBA 3EO6A 4HNVA 4GALA 1PJRA 4AVAA 4Y22A 1G3TA 2WQ8A 1U5TB 5ABJB 2K2SA 2HFHA 1MS4A 3TBIA 5KAIC 1UNBA 1XMKA 4D0PA 1R1A3 4IV3A 1JW6A 3WD5A 1DYKA 2JPCA 1PGSA 4CZCA 4NQWA 2PI0A 1V0AA 1PX4A 2WYFA 1C8M3 1GT0C 2J1EA 3VD3A 2F17A 3OMYA 1LE8A 2HH9A 3H92A 5JUVA 2CDOA 2ZGPA 1T56A 3BOQA 1PIV3 4QT6A 3A0HC 4WX9A 4AW7A 3V0AB 3IDBB 2WS92 1B35C 2TRTA 3SZTA 3AVSA 2DOAA 2QQWA 2WRAA 4GB31 4OI4A 1MDMA 2M7BA 1TVGA 2DFFA 4PLOA 4AZZA 3ZXAC 5F08A 1J0RA 2F2EA 4WBBA 2V79A 3IDAA 2BXZA 5BOXA 5IT9K 3LMMA 2EA2A 1OKOA 1UELB 4A12A 4A3BJ 2W0XA 5DAPA 1LOFC 4CU7A 2XGXA 5CNAA 3A0BC 1J7KA 1WLTA 1PMIA 3A0KA 2EIDA 5FIXA 3ZFFC 2PBIA 3I3MA 2LSOA 4BZ4A 4PQ9A 4EV0A 1DCSA 5DTDA 3VDXA 2R042 2HYXA 5C8CC 1OYYA 5KXBA 2DVFA 1DG6A 2KDZA 1UN1A 3OD0A 1PMHX 3JCIA 2DWRA 1K78A 2W39A 2WN3A 1IQAA 4RA0A 3C2GA 4CDUC 2XSDC 1Z7UA 5F27A 3K9TA 2OQGA 3JRDA 3E6CC 1RXGA 2JPBA 1UWWA 2ZX1A 3OBTA 5KHKA 1BKZA 3J7LA 2BV4A 1W1WE 4AYBN 2PJRB 3GEZA 2WO2A 3IDEA 2ZKZA 5IVCA 4HLTA 2DVBA 4Q4W3 3FISA 1VFCA 2JJ7A 5L7OA 1AYM3 3EUAA 5A6QA 2JG9A 3A01A 1JZ5A 3HXLA 5F5QA 4P00B 2M9HA 2Y6JA 4YW3A 5LY2A 3I64A 4CZSA 4IGQA 3H8OA 4P96A 5JAXA 2QZ2A 1ZELA 1ETVA 1WQ2A 4IGPA 4LITA 2YU3A 2AXTC 3OSGA 3S3OA 5GLTA 4P5YA 2EF6A 3OGGA 3D8CA 3C7HA 1FPQA 3PUIA 1HA8A 1VBE1 3ZN6B 4E8CA 3RZLA 3DPRB 1P6RA 4AVVA 2VVDA 2BPA2 4BM8A 1V9U2 1XPXA 4QGMA 2HXIA 4HVOA 3AL0B 4N9HA 3GYHX 4N9IA 5FJHA 1X4OA 4EJUA 1XE8A 1USTA 2EA4A 1LKNA 3HNMA 2CQKA 1Q8PA 4A3JJ 2UYAA 3HMYA 5M0TA 4CEYB 4BWOA 2VBZA 2DV9A 1DQ2A 2XB5A 1JXNA 3ZSEA 3J7MA 3BC8A 4M6YA 3LDBA 3JW4A 5GPCA 1Z21A 4ZH4F 4K40A 1R1ZA 3H8RA 2RS51 5A2QZ 1HC8A 5BNNB 3DBRB 3MV01 2EZKA 4JP0A 1APLC 3KE2A 2WNOA 2ESHA 2WNVA 3ZR6A 4EEFG 3ELNA 4CHUA 2XKOA 1J84A 1DLCA 1SBDA 1OPCA 1G59A 4PQQA 2OZUA 4UF0A 3RVHA 3R05A 4HV6A 1HRV1 4LMYA 4XDOA 3J7AY 2XJUA 1STMA 1WD3A 4AVPA 4HG2A 4I3GA 1YITI 3WNPA 2TDXA 3PM1A 2C26A 5C3QA 1CF7A 2H0BA 1K45A 2BBVA 3T8TA 5GZEA 3ZVXA 4UVCA 3OBAA 1T38A 2QBXA 5IVJA 3I59A 4O61A 2ELHA 5K4LA 2FJ1A 4G9SB 3IWZA 1FJLA 3HTUA 4PJ0C 2RMU2 5FY1A 1D4M1 3KYLA 4AYUA 3F2ZA 4ON0A 3JBG1 1NCRC 4HANA 4D7MA 4IEQA 1Y39A 3AXDA 3FXUA 2EBIA 3LE0A 1Y56A 1BW5A 1A5JA 4BJ0A 1QJX2 2DT6A 5J47A 1WCQA 3TEYA 4NIAA 3KYDB 3GLXA 3NV2A 4E7HA 4PJJA 2XOMA 2RR11 3F0CA 3POEA 5A70A 4XTPA 5CVRA 3WV6A 3WDVA 3MF6A 2VBXA 4EZHA 4XLPF 1NG7A 1X36A 3O2PE 2HWC2 3AZWA 5J6XA 3ZYIB 1C5IA 1L0OC 3FBYA 1YE9A 1ND2C 3UETA 3NNMA 4NHJA 3GUDA 1OISA 3KZZA 3RZHA 3J4UH 2WIIB 2WAQA 5FKMA 5B1BH 1CPNA 2WB1N 4RB1A 3CCMI 1BBT2 2HDWA 2WAOA 2EJRA 3BN6A 4KWKA 4ZYDA 1KZHA 4OVEA 1HKDA 4ZZDA 4G7OF 1G2HA 4HX8A 2DA7A 4HX7A 4FO9A 2X1CA 3OPTA 1G9AA 2L01A 1JKRC 4UT5A 3ZKYA 1W7PA 4E70A 3SQNA 4FPLA 3S5AA 4Z2WA 3PNVA 3KD4A 2OTJI 1SD6A 3D6EA 3WTVC 3HN3A 3F6VA 2GN3A 2H0VA 1P9QC 1GP6A 3LQRA 4BMEA 2VOTA 4G12A 1AVBA 3SHRA 4LLFA 4Q0SA 4JHTA 4XOPA 2BBAA 4GGGA 3UR3C 3HUGB 3UK9A 4WV8A 1VJ2A 5FYCA 1YWKA 2P4EA 4EMSA 1DYOA 1T33A 5IK5A 1IGNA 1I3AA 2NS8A 1H30A 3CMEI 3MEXA 2KDOA 1RHI2 2VE1A 5E8AA 2K9ZA 3TN92 3MVPA 2V5DA 1KDMA 3I58A 3VOEA 3ZIXA 1DQ5A 4FPGA 3EYYA 2FE3A 5IFPA 2WBMA 3I4MJ 3POJA 1WWYA 5K5QA 1YFXA 4U36A 2VZTA 1ORKA 1NOVA 1A8DA 1GLHA 4U7DA 3Q8EA 5BPXA 2ZX4A 2DF7A 4MHRA 2OJED 1PVC2 1K5MC 1GNYA 1WJFA 4LKSA 3HEIA 4L99A 3RFRA 1G9FA 1W90A 2RE9A 1V6IA 4IL7A 3Q3SA 2PAMA 1QXRA 1TWAJ 5KCMA 3R6SA 2Y64A 2VI6A 4KT5C 2GAUA 4K3UA 5IVVA 2Y2ZA 3DXJF 1WMFA 2DMNA 2BOJA 1U9NA 3C3WA 1GUIA 4OFGA 4DOZA 4E7ZA 3GNEA 4LA2A 2VOKA 3U14A 3ZYRA 5JSPA 5KHGA 3VBFC 3AL6A 4QU2A 4IXAA 5LHIA 1ETXA 1LFBA 4CCMA 1JU3A 1BI2A 1ZREA 5FLMJ 3HOYJ 4A41A 3RSJA 4FX0A 4W4ZA 4MUVA 4LO5B 5FAXA 3OSFA 5E88A 2HLEA 4A44A 3E5UA 5CYVA 1BI3A 3V4GA 1EPWA 3RZMA 3I9V2 2JSPA 5A6ZA 1PP7U 2MD0A 5FR3A 5FZ9A 1NY72 2VUMJ 2L7ZA 3N7LA 3EDPA 4PFPA 4I0WB 1IRZA 3QU3A 4YZ2A 4II3A 5H2FC 1SLIA 3U4SA 3MIGA 3HJRA 3WDYA 1BVP1 1HB4A 2QF7A 1IHMA 4C3IJ 5I0RA 3ZSLA 4QDQA 3FWEA 1TWCJ 2FQ4A 1HKQA 5HCHA 4GULA 5LB6A 4BXUA 2ILMA 4AG4A 4XURA 3RZDJ 3AFGA 2XGEA 4AHZA 1JYTA 2LKPA 1OURA 1FPN2 3WW2A 2XJVA 3PIOF 5D5UB 2N8GA 2Y31A 2FSWA 2AXLA 1JUIA 1RIRA 1UMHA 1WFXA 2FMYA 3MIBA 1OA4A 3V7SA 2G9ZA 1FMVA 4IE7A 4PFOA 3VLBB 3VUOA 1UMZA 1RB8G 3PIJA 4EZ4A 3QPLA 3KS7A 2YC2A 4NDLA 1YJKA 3VBOB 3HOTA 4DO0A 1ZKGA 1GWMA 2JENA 4UFHA 1MBHA 1YO5C 2D5VA 3GTOJ 2DA2A 4BB3A 3CCYA 2XRNA 2AENA 3I3BA 4OI0A 3WP5A 3OL3A 1ACCA 2KZVA 2C5DA 3POWA 3T3YA 4LO6B 5T54A 1DP3A 2VQCA 2ZEWA 4GJYA 2V9VA 4B3AA 4DNCA 3QH6A 1H88C 3L2QA 2NYYA 1OLRA 3F3XA 2VZQA 2G19A 3JD73 1I6XA 4KFCA 2VQ0A 2DTRA 1UXZA 1H6YA 1MSFC 4YZ3A 3BTZA 4D6SA 1A6IA 5LBBA 3BU7A 4QX5A 4KGGA 3AG1H 5A33B 5K1YA 3OYEA 4FASD 3WTWC 5T5OA 3W5MA 2YU1A 1SFKA 4CP2A 1O7FA 3W5NA 4Y17A 5FZ1A 2CTVA 3COAC 1W9FA 5FP4A 2ZGMA 2AH2A 1BYHA 1U9OA 1W6MA 3CCUI 3MPBA 1ASJ1 5KHHA 4JK1X 1UKRA 3BU0A 5IHRA 4AD9A 5HOOA 1SMVA 4YFKF 2WSVA 2WNEA 3TP3A 2GM4A 2ZEZA 4XACA 4XN3A 5A7NA 4KWUA 2GNBA 1H9GA 1ZGWA 3CP2A 1ULDA 2G9FA 1DPRA 2ZEXA 1EH6A 1QGLA 3RWNA 3LFMA 3ACGA 2C9AA 4EATA 1GV9A 4FTBA 1ZGJA 2V1XA 2KRCA 3CDHA 4ZYHA 5C71A 4IQ4A 3GZUC 2WN2A 1FTZA 4CUBA 1W28A 4LG0B 1GZCA 4XUNA 1SFUA 4RGUA 5A3TA 1HRI2 3L09A 4GH4B 3H35A 4CO8A 1WCMJ 5C5TA 2QM3A 3KX2A 3LB9A 1PX3A 3AP5A 1UU6A 5IJRA 1FNYA 3M8EA 2X09A 3OL4A 5HS7A 1BIBA 2O8OA 2QQ9A 1OBNA 2EIJH 1U8RA 2P7CB 1WCUA 1TW3A 2WLPA 1AA7A 2XBO3 4QQLA 4XLCA 3K1PA 2LH9A 2ADDA 2D3SA 3AKRA 2Z5WA 1S55A 4DINB 2L9NA 3AYEA 2BZDA 2DO7A 3GZAA 2Y69H 5C70A 4M00A 4C91A 4ENJA 1RUD3 3OGRA 4QGNA 5FXXA 5T55A 5K9YA 4FVVA 4FOYA 4HT1T 3B94A 3DUIA 1XNTA 2J42A 1X4PA 4P9WA 4TYSA 2VJJA 3ABMH 3H0OA 4YVWA 4ZU5A 1XU2A 1VMJA 2PTMA 3THDA 2HYKA 4UFMA 1AR83 3TEDA 4XLHA 3CLPA 3H1WA 2KA3A 4CCKA 2VCMA 2B0LA 4RAZA 4UWDA 1RTVA 4NMIA 3BT9A 3WP3A 2EPFA 2ZFWA 4IHVA 2RDRA 2R7TA 3NAPA 3VBRC 4LT5A 4FXKB 2LROA 3PIPF 1DGRN 3CLOA 1I1EA 3S0MA 3ZQ7A 1KS4A 1ZRRA 2R32A 4S04A 5BMZA 2GXAA 2KJCA 1LU1A 3WE2A 1H4GA 3BJOA 1OVPA 1O3SA 1XYNA 3OIQA 5GZDA 2HWB1 1LNSA 4IERA 1X1CA 1ZBE2 1Y9QA 1GFF2 2O8XA 3J8F1 2D6PA 5GAHJ 2GH8A 2DFCA 4DIQA 2V1NA 3Q8CA 4XXPA 5DV5A 1XX5A 4BXFA 3OV8A 1OKQA 1PK6A 2PQ8A 4YZ4A 2YROA 1UOBA 2OC6A 2EXJA 2VQAA 5FKBA 1OXCA 5G05L 1PO22 1S9HA 1WJEA 4P55A 5DUVA 2B46X 2O9LA 1NAEA 2YX7A 2P6TA 3AP9A 2MD5A 5FYSA 4Q47A 1F9KA 3GBFA 4XAAA 1RUC1 1YHFA 2P4WA 1KDKA 1D2QA 3WTYC 1H2MA 2KMUA 4YFZA 4XFBA 1HCRA 1CAUA 1BHGA 1W3VA 2FCVA 4IEYA 3CO7C 2NNYA 2AQEA 2Y0MA 1PNGA 1JZ2A 1TNFA 1YQAA 4Q4V2 5JXHA 2AEYA 5DD8A 1N78A 1N75A 3SISA 1Q8VA 4ZS2A 5AFEA 4FBFA 1QPIA 2VZVA 4NJ4A 4YGEA 1R4NB 1VAVA 4IXLA 2BGPA 1TQ5A 1SBEA 1XMAA 3I59B 2HEOA 4UVAA 1HBXG 3ZSKA 3PO2J 3FXOA 1HKTA 4QKBA 4R4ZA 4JDOA 1WJ5A 2ZGRA 3ZCOA 2XL9A 3BB6A 4Z07A 1UXXX 1T6BX 2DK5A 1E5IA 4OZOA 4QXKA 2NVYJ 2QQBA 1WWXA 1IUFA 1NK3P 1SD4A 1DYPA 1HKSA 1Z7S3 2WO3A 2OQ6A 5DPNA 3CO6C 1D1BA 2YGMA 2ACJA 2BVVA 1T2KA 3PNYA 5ICCA 4J19A 2LVSA 2X4HA 4OAYA 3POSA 3FN9A 1F5TA 2XQRA 3HN1A 5IOYA 4BXSV 3UGHA 3ZQIA 3HWJA 4L0YB 2B9VA 1IS3A 1MBFA 1UMQA 1KGYA 1RVF2 4DXTA 1US2A 4ZY9A 5C33A 3OYDA 4LE3A 3HOUJ 3GW2A 2YPJA 1W5TA 4LA3A 2ESNA 5BPDA 4KICA 3GTLJ 3KT4A 5ED4A 3FIWA 1G9DA 1ULOA 3WGGA 5SV5A 3GFIA 3GZ6A 1AR71 1OLTA 5LZ6A 1STZA 3V0BA 2HOEA 4PGHA 2VQGA 4FFIA 2QEXI 3H5NA 5FJKA 1OC1A 1XSQA 3HGYA 1ZX5A 3OYAA 3AZXA 3L9JT 3ZOBA 4N4NB 4OUMA 1RGSA 4CPBD 1KQ8A 2Q0OA 3M8FA 1X58A 4RHV1 3SXWA 1OSGA 2ZXHA 3VBFB 4E2GA 3NKTA 4FAGA 1W7PB 1AL23 1GSLA 2VJXA 3CUQC 1GNZA 2Z79A 2P6CA 4J6GA 1FIAA 5L3CA 3KEOA 3KF5A 1E3PA 1JU4A 1NLQA 4OMYA 4BA6A 4E7LA 1MEC1 5FPAA 4JDNA 1W9YA 4OULA 1BR2A 2WZEA 1MD0A 4HOBA 4M71A 1OI6A 3TP0A 2DA4A 4BU2A 3AZVA 2DA6A 3GGLA 3NQHA 3BR1A 3ACFA 1HRV3 1AJOA 3CJIC 1EV11 4J1XA 3OYFA 1WGXA 3U9GA 3M3QA 4XONA 4LIUA 2EV5A 3USUB 5KHIA 1VMHA 5BNQA 5A1FA 3CIHA 3A22A 2R7FA 3KCCA 4LO8A 4UYBA 5CIRA 3ZGKA 2AACA 4B44A 2HOSA 2WADA 3LSKA 3OEAA 1HJFA 2ID6A 4F55A 2KIMA 1D4M3 4HONA 1O6UA 2VPLA 3GFJA 2BW8A 4LHLA 2P5KA 3C7EA 1LFUP 3KF3A 1OR7C 5FMBA 2RAEA 3CJXA 3N36A 1AYN3 1B8IB 4C0HA 4FTHA 1QBJA 3GJAA 5FLXK 1UOFA 1F5JA 1ZBA2 3FHZA 3R0AA 2OA4A 2R073 2GC0A 5E6HA 3M8LA 4OMZA 1OMIA 4AK3A 3I4PA 4MXWA 1NKGA 5FKLA 5IT3A 3VHOA 2F5FA 1GICA 2VXRA 3VGIA 1POV3 3SKJE 3H8XA 2IP2A 4XRSA 2WQ4A 1RETA 1H6XA 2VU9A 2HWE3 3WG9A 4F3JA 1U0AA 2VH9A 4A6OA 1JUSA 1R4MB 3HYIA 3MPPG 5ILVA 1YW7A 4ESFA 1JN2P 4G4FA 4DEVA 2L54A 2MH9A 2XLAA 5DG2A 1CAXB 3CDIA 4QQ2A 3HVDA 4R9CA 1MH3A 3ETPA 2F48A 2HQAA 1POV0 1LAJA 3KYCB 4A3XA 3KP7A 2OTLI 4AQ2A 1UYXA 4YVSC 3AFKA 1FMD2 1IS6A 1VE0A 3WQBA 3BG7A 1G8WA 2VGDA 1MQTB 1VRH1 3Q0WA 1ZG5A 2IVMA 4Y1YA 1PUFB 2X5IA 1QNWA 3BY6A 4IV3C 4LLOA 1MMAA 3S30A 1BJAA 1J3RA 4LO4B 1JBCA 2F4OB 4ARYA 4IEXA 2VUAA 2VTXA 2YC0A 3R0JA 3A21A 5CJ9A 1QNYA 1XMXA 2JDZA 4AGGA 2R061 2RHPA 4LLGF 1RUI1 4O7XA 1IKQA 4CXYA 2A05A 3MIEA 3EQEA 2J1RA 1VIWB 5JZGB 4WM7B 5BUVA 1BEV3 2MGQA 2VASA 4BBSJ 4P08A 1W0OA 2W94A 2CWSA 4A0XA 2LY9A 4LBOA 3HQXA 2FCUA 5FYHA 1H9WA 4OUSA 1GMMA 1JOPA 1S6LA 1FT9A 4NPLA 1XYPA 2YU2A 2K02A 2DCYA 1KQRA 2BNNA 5IYYA 3W6VA 3ENRA 4Q4X3 2IS2A 3ABTA 1GKBA 2JDNA 3MLJA 1NUKA 4BDZA 1KU9A 2DYCA 4ZC3A 4HK9A 4ENNA 2P0WA 2DVGA 3DV8A 1FYKA 1EY2A 5FPZA 1JHHA 5E8IA 1JJ6C 2EALA 4IF4A 2VT2A 3I2KA 2CUFA 4PUSA 5KXDA 2VW2A 2W1UA 4BQOA 3JU9A 2B39A 1LR5A 1KGSA 4E4ZA 1UOGA 2VVFA 1JYXA 5L3GA 4HDUA 1W36C 4BHBA 4XF4A 1Z6RA 2ECCA 4K6BA 4U2AA 2E32A 1LODA 1W6MB 5CB7A 3TL4X 2O61A 5TSWA 1R23A 2HEYF 4HZFA 3R4UA 4AIKA 5J48A 5GZFA 5DZEA 2ZAHA 2L7KA 4S2GA 5HI0A 4CDWA 3JTGA 4CDXB 2JG8A 4PSXA 1E57A 1LJ9A 1YI9A 4DYQA 2JG9C 1D0GA 2L0KA 3TEXA 3LEKA 2XDVA 1LRHA 4Q8KA 5HLIA 1UY2A 2MEV1 2OW4A 5IVBA 3QYEA 1CVNA 1LULA 1KEXA 3AP6A 2M45A 3P5JA 4EGYA 4HETA 4ZPIA 2WFF2 1SLBA 3MD2A 5C44J 1AWCA 2F5DA 2LC2A 4F7ZA 1KRIA 1AR61 4KU8A 5FP9A 1LVKA 4XQ4A 2VOOA 2K7LA 4GCVA 1R081 1O3QA 4PJMA 2ZXJA 4XFHA 4RM3A 4XQWA 3FFQA 2QGUA 5DM6F 5B66C 5IK8A 2PLV1 3ORJA 1W8FA 1US3A 2RM22 1PVEA 4XQFA 4N53B 1MVQA 5DCMB 1V4RA 2DLLA 1GBGA 1MNEA 3RIRA 1QXJA 4YW7A 3HC7A 5FPLA 1ZQ3P 3M1EA 2P5VA 2XSJC 4UUSB 1DGWX 3IZOA 1DQ6A 5BY5A 4OUEA 1YLLA 1TBXA 5LEKA 3QPSA 1W2TA 5A3MA 4LMFA 4XSXF 3KIOA 2VOVA 1DHKB 4F52A 4HLXA 4IV1A 4AM3A 1YIPA 3VZLA 4DZPA 1SAXA 1SVLA 5AIPA 4YIIA 4YVWB 1LEAA 1C0WA 2BV6A 3ASNH 4U88A 1R091 3OR2C 3LDKA 5DUKA 4QQPA 2I10A 1MW7A 2WNVC 1TMF3 1D5VA 1QO0D 4XW3A 1XGSA 3O8HA 2A6ZA 2K9NA 4XICA 5I8SA 4MHGA 2HZDA 2VZPA 4R9DA 1X82A 3M8JA 3RG0A 4B43A 3N9PA 1GU3A 1BBYA 1K3IA 2KRHA 3GZNB 4G94A 4MNUA 1C3HA 3P9IA 2H6BA 2WT0A 3RDIA 1PK6B 3OYLA 3AKZA 5DUXA 3KEYA 4GKYA 4L5JA 5D8AA 3BZCA 3QOPA 2NVTJ 1IKPA 3VHRA 4IX7A 5CFCB 1RUNA 3HQRA 1FI2A 1B9NA 5APAA 2LBFB 4NPMA 3WU2C 4S2FA 3J7HA 5E1WA 2P17A 2ZMEB 2WZR2 3HDDA 2UXXA 4AEDA 1WZ2A 2FUG2 3HRSA 1SLTA 3WINE 2JTVA 1M1EB 3AFHA 1RPWA 4OYUA 2COBA 3E6MA 1S2EA 4JKMA 2DDBA 3MHZA 3IC7A 3BVCA 4O5VA 2XF5A 3CUQB 3O12A 4QPGC 4LJHA 2D3PA 1YOVB 4M3CB 4B4PA 1IC8A 5C9AB 3RZKA 5CG8A 4E4SA 2UY9A 2ARCA 3ZXGA 1DDLA 1IG3A 4P9YA 4JQTA 2ELKA 1QF3A 3I54A 4LKFA 1RINA 3KT1A 3GZ5A 1XB9A 2VQLA 4J01A 3DKXA 2XJTA 3K77A 1U5IA 3BTYA 4ANJA 2VECA 3DBHB 1PGW2 1XNAA 2V4JC 4CH7A 2BFUS 1ZG1A 4CCCA 3MN2A 2X1EA 2AGSA 2UXNA 1RUH3 2O6GE 2VL4A 1JZ3A 2ZKLA 3MUZ1 4W50A 5D8KB 4XE9A 1SHWB 5HDKA 1W04A 3LA3A 1KA8A 3DXTA 4COVA 2ZGUA 1H89C 1W8HA 4GMP1 4CCLA 3GBWA 2HU9A 2OUMA 1BCXA 1YEWA 2ZMNA 3FJSA 1RR8C 3U37A 2HWD3 1JHJA 4RQPB 4IQJA 3J8F3 3K0LA 4RA2A 4ZTJA 3DKYA 2M0MA 3DQVC 4AF9A 3E1SA 4KI5M 2RC4A 2R16A 1AX0A 2ERFA 4CXWA 3S7EA 3PTYA 3N4MA 4DRRA 2IUWA 3CU7A 5CVUA 3URFA 3DPLC 1Y8QB 1MJAA 3VBUA 3WNXA 3BR2A 4LLNA 5LBCA 2Z99A 1MZFA 3KP6A 3BG9A 2CFXA 1Z7LA 2Q30A 2M3AA 3JB4C 1T2XA 2W68A 2FOKA 4BE2A 4BAYA 3H9GA 4BKXA 5FYIA 3KV4A 4COZA 3CF6E 1IN4A 2UY8A 4RD7A 4GWNA 4CDGA 1N3PA 5JLWA 3WHTA 2RS31 4F93B 3N7JA 5DZFA 1PMJX 5B2GB 4R79A 5GJ6A 3WG7H 2QSHX 1E2XA 4B3NA 3RKXA 2Y6GA 5A7WB 1FNZA 1O3TA 2XJRA 3PQKA 3VD5A 1SDDB 4L92A 2EFQA 3C8XA 1ZTRA 2OZJA 1Q5OA 3C2BA 5C4WB 2R5ZA 3NVCA 2Y6FA 3WW4A 3LSRA 1ODMA 3AKSA 5ICFA 3TBDA 2KKOA 4Q27A 5C3PA 3BGAA 4MXVA 4BE0A 3KQ4B 4P9GA 1W0PA 4HXCA 3T4VA 1OCCH 1FOD1 2X6YA 5CG9A 3LF7A 4NE9A 3M1CA 4CUCA 1JODA 5JDBA 3S14J 1W6PA 1R5GA 1DGLA 4DY5A 3MQ0A 3C7OA 3CMMA 2J1VA 5C8WA 3PFYA 2LS6A 4W6YA 5J3LA 2X6WA 2FOWA 3VDCA 2GU9A 5DS9A 2YPRA 4EQQA 2Y0SN 3G1LA 2W84A 5HPOA 1Y9GA 3Q5FA 2LMDA 1NA1C 2RS11 3VYUB 3IB3A 2GIZA 4B3XA 4D7TA 1S4CA 2JDUA 1H1IA 1AR91 4TLFA 1VBC3 5FYZA 4D0QA 2ZGSA 3FK7A 2CV2A 1MR5A 1GP4A 4AVCA 2JMWA 3D5LA 2Z5UA 4EWDA 5DMYA 3BQYA 2BVMA 4N7IA 2C4XA 2RDQA 5FMOL 4JGZA 2RNJA 3VDDA 4M0HA 3OPWA 5LRRA 4Q4Y2 3QLQA 1FYLA 3TYJA 3E5QA 3S5QA 1V6OA 2VZ3A 4M3EA 4II2A 5LA0A 4HVRA 3HBZA 2LRPA 3M3YJ 3T2TA 1COV1 1J1TA 2WB1A 1S72I 1UCRA 2PG4A 3AVRA 1ENXA 4LORA 1BOAA 4FQGA 2DU9A 3ZXSA 3HB9A 2TCTA 1HXS2 5FO8B 3ULQB 2DTWA 1K12A 1GUUA 1UO9A 3FHAA 3WP6A 2MYSA 1ON2A 4KT6A 2CG4A 3VBSA 4HA8A 1KYWA 5AVAA 2QDRA 1LHUA 3I4NJ 1OPMA 2DBIA 2DI3A 2WSUA 1VBD1 4YG0A 3CCEI 3I2JA 2E51A 4B1LA 3ZMUA 3T2QA 1FYMA 1Q56A 4XC9A 4D6QA 2E1MC 4A5MA 1W8WA 1HSJA 5JR3A 4XKCA 4XXAA 5ILUA 3QBQA 3BALA 1L7QA 2L7FP 2GN7A 3HSFA 3FFZA 4OHWA 4BIFA 2G1MA 3QAHA 5FQ0B 1Q8QA 1ZK8A 3RS6A 2WS93 2QKLB 3BJAA 2HOAA 4JBAA 1CAVA 2HWF1 4XUTA 2FNAA 5CZKA 3SCGA 2GNDA 4UFKA 3G7DA 5I0UA 2XKPA 2Q2EB 5ERLA 1O5UA 3IM0A 3HPGA 5JVVA 2CQQA 4IE6A 1BC8C 1XS9A 5F9TA 4WVMB 5AC92 4C8DA 3G6EI 2LY2A 1UYYA 3UYJA 3EBRA 1O5LA 3CL1A 2VMDA 3OY8A 3F95A 3LSDA 4DQAA 3CP8A 2IVIB 4XPVA 4QPYA 1IUYA 1JZ6A 1JGGA 2D2WA 4ZXKA 2YXSA 4AOCA 1U12A 3RZJA 2NP0A 3DEEA 1WBFA 4H55A 3C2HA 1D4VB 2R043 1NHAA 5EEHA 3E1F1 2ATFA 3WG4A 2M8GX 1WMDA 5LHHA 1LB2A 4D7SA 1QGPA 2BVBA 5C3OA 2W5FA 3IMNA 3D4KA 3WLUA 3RI9A 3K3NA 3DP7A 5JWPA 4UBHA 3GXUA 1DU6A 1ETKA 4RS5A 3AJZA 2EV0A 3WGHA 1IAWA 3PFIA 3GZTB 2K5CA 1C8M1 2VBDA 5TRDA 3DKWA 1FSHA 2JDAA 4QHZA 5B3SH 4GWJA 1TWFJ 1AL0G 3SZGA 3ECOA 1I1GA 2VKHA 5C6CA 4V2VA 1R1A2 5FYYA 2DUQA 1PIV1 3LA2A 1QJY2 1K79A 1VF9A 5J8FA 4L0ZB 4AC0A 4DXRA 2STWA 1POQA 2WR9A 5FLVA 3B6AA 3H1YA 1SACA 2ETHA 1H8TA 1GYKA 3QP6A 2VJ4A 2BY0A 1JI6A 2NS0A 1R6RA 3FXJA 1V5FA 3NAPC 3TOJA 4HSRA 3TDZC 3WNMA 5JCTA 4Q4ZF 3NRUA 2W82A 3H9AA 1F35A 3HIFA 2YG0A 1JTYA 5GTIC 4KNCA 4CYCA 5FBJA 3DECA 3ZXDA 4FP2A 3ZN1A 5D5WB 1PDNC 4HAMA 4ZYGA 2LOOA 3BZKA 1L3JA 2IGMA 3PMSA 4ASNA 3E6DA 2EZHA 4IV1B 4ABZA 4HNUA 2VL8A 4AIJA 4IRHA 2NVQJ 4E2QA 2XHNA 3S17J 4E4HA 4QPGB 4I0AA 5KAFC 1IRXA 3SYTA 4ENKA 4QAWA 3KETA 2IJLA 3FHQA 5C7GA 1O4YA 4KMQA 2HI3A 4Y3OA 1N25A 1YJ9I 1D0YA 1WW6A 4UW6A 2H1KA 5F6KA 2R5YB 2QVSB 3ATGA 5HLHA 2LTNA 2LLKA 4A3ZA 3K2ZA 4DZGA 2D44A 3H5RA 2V73A 4DW6A 3HNBM 1IN5A 4Q4W1 5EZGA 2ZHNA 4QX0A 4IHTA 1U5TA 5ABJA 4QB2A 5E3NA 1N1YA 4QLCU 4OI2A 1GZ9A 4LHKA 5E18F 5FROA 5A1LA 2FU4A 4R9AA 2HYFA 2DU0A 3WCRA 3H0DA 4TLGA 3V7CA 1YYVA 1C1LA 1QMJA 2K27A 4HLYA 4UXNA 2IXLA 4ZHNA 1QEXA 5FUPA 2W52A 4K7JA 2PHDA 3D82A 2VJ5A 3RPUD 2RMU3 3B00A 2QENA 1ZVFA 1AYM2 3AXEA 2IXJA 1SBFA 3BP8A 3NWSA 1VAMA 1OCPA 3ZMNA 2JQ7A 1BMV1 5KNLA 3V0AA 3T0BA 3KV5A 2V26A 1QJX3 1M06G 2PHWA 5BNOB 4RAFA 2PHUA 1W2OA 4AI0A 3OY9A 3OR1C 4FPJA 2R0FA 2R3SA 2MG4A 2Q8EA 3VL8A 3ZXKA 2JXAA 1IJWC 1W9WA 3KWVA 4PSWA 1LGBA 3Q9OA 5T52A 4Y5SA 5CFDC 3DL3A 1AR63 2P6SA 2HWC3 1R083 5BNGA 4HEA2 4FHTA 1U8BA 3UJQA 2X53S 1CPMA 4ZZ8A 2E1NA 3AC0A 3M1HA 2RJ2A 1J75A 1S0FA 3O0VA 3PUHA 5JI9A 2H8RA 2ZSHB 3O3KA 1DZTA 2VMIA 3OYBA 2GC1A 5A7QA 3Q9SA 4LFUA 5CA6A 1BBT3 2ZPXA 4GQ7A 2BE5F 4HQEA 2F4PA 1VQOI 3QPHA 1Q43A 1QJU2 1JH5A 1DDNA 3N3HA 2BY2A 3QRFF 3NJVA 2VMEA 2K4JA 2M87A 2DBNA 2JE8A 4EGZA 2VMGA 2K3PA 1UYZA 4C9YA 4J1WA 3LWFA 1P4AA 3WDWA 2Z42A 5IY5H 1VBB1 2CW7A 3TQNA 1OHFA 4A3EJ 4XABA 2ADUA 1SZBA 2W92A 4KIBA 5T5JA 4FOQA 2RV9A 2VCBA 4QQOA 2A3YA 1YNAA 1QIQA 1S3JA 2CMPA 3MGUA 3ALQA 1S7EA 1S0CA 1G3YA 1I27A 3BI3A 2IEKA 5J7MA 1R00A 4M9SA 1F4HA 5BXXA 3OYWB 2CWMA 4MTEA 2GP3A 5I93A 1YHQI 2VT3A 3O14A 1LDKB 1NA1B 4LB6B 4O65A 3GALA 1WSUA 1RHI3 1IPSA 3WR0A 3IAM2 3GM8A 3W6KB 2BNOA 3ZN6A 3W9AA 2F6BA 3L2RA 1NE6A 4FCAA 3CJQB 3VBUB 4AAXA 2ZXWH 1KXGA 3ES1A 4HQMA 3ZYBA 1RMU2 4A6SA 4OZXA 4D5CA 3CC7I 2VC1A 4XDQA 2E2IJ 1SVOA 1XRUA 4OI1A 1PVC3 3LZZA 3S3MA 1WI9A 1KU2A 4FT8A 1YS6A 5J96B 4HL0A 4UFLA 4FP3A 3IL2A 4CEYA 1MH4A 4NIDA 1QHDA 5GLUA 2FEZA 2QQIA 4PIYA 4IE4A 2WNUC 2VMCA 4XJ9A 5H9RA 3D5RC 3VKFC 4AFMA 3SDGA 4QX8A 5FY8A 2Z16A 1JYVA 2B42B 4BH9A 2DFBA 1H1AA 2YC4A 3I56I 2QQJA 4DUXA 3HRTA 1O8PA 2D45A 5C3EJ 4UBGA 3AMNA 1KU7A 1ITYA 4JVAA 3G1MA 2NYXA 2IXHA 1IN7A 2A6WA 4MGYE 3ZFEB 3T09A 3W58A 3L2VA 3AKQA 3BTLA 2KISA 5HS8A 4PGGA 4KYWA 2QJVA 4XUPA 3DFGA 4FOVA 4RDUA 2B8MA 1XN7A 2QUFA 1ETYA 1SEFA 3E5XA 3FUOA 4HYEA 3LWCA 4LHNA 2J1SA 2QQNA 4LULA 4DRVA 3PVBB 3LSHA 4GD4A 2R4GA 1OOPC 2NPIA 4DY3A 1X3UA 3ZMVA 4Y4YA 3VKLA 3O1UA 3T0YA 3WU0A 2A68F 1FBSA 4XZUG 1W03A 1H2KA 1PO12 4AVZA 2X5IC 4KN7X 5L73A 3OYJA 1SC7A 2Q8KA 2NXNB 1WA4A 3AKPA 1QQP2 4GMP3 1W99A 1WJDA 1A78A 3VZKA 4GKXA 2IW5A 2HR3A 2XIGA 4XLFA 2Y48A 4RLQA 5FLXZ 2RQPA 3CO2A 4KMUX 2GXBA 1TME2 4MO3M 5A3LA 3HM5A 4HF1A 4ES9A 1RUJ1 2XUEA 3OSDA 5EGOB 4NB5A 4CDQB 4HSLA 1IXRC 1W05A 4CZZA 1Y7BA 1UAAA 4UW3A 4FTEA 2DJNA 3HBKA 2D1HA 5J1UA 1X3WB 1T95A 1ND3A 3S16J 2L02A 5M3MJ 4GMP0 1MZ5A 3V8LA 4COUA 5IK7A 2HTSA 3HHHA 4GWIA 4PIZA 2JSCA 5TGTA 3I2OA 1WPKA 2IVJA 4A69C 1CWPA 2A6YA 1AJKA 1Q1HA 1JE8A 5C4XJ 2V6EA 4NHLA 2L7MP 4MEXF 3QYFA 5FLIA 1DIWA 2O5RA 1MBGA 5LCWL 5FZDA 1NX9A 3IHUA 1SPPA 1YLFA 2D6LX 2H6CA 4L2NA 2BXYA 3L9FA 4R9BA 4RGXA 1S0IA 1ZH5A 2STTA 2VKVA 4B4CA 2FDFA 4HX4A 4BEHB 4YPJA 2YPDA 1UFMA 4NUBA 1OJLA 3ZRGA 2N7GA 2KD7A 5FBZA 5HXMA 3E97A 1XQNA 4D94A 3DEWA 5HODA 3D1NI 1V6JA 1YI2I 2VAUA 2RJKA 5D4SA 5K7FA 3B69A 3P9CA 4CA9A 3R4DB 5CYYA 4CCNA 1FOD3 2MA3A 3QYBA 4BOWA 4GAZA 3HUGA 1QZYA 3UNGC 3WSOA 3WY6A 3EUHA 4FPOB 2GQQA 4CDWC 1SD5A 5CKQA 4HG6B 3ZXFA 4DZJA 2JG8C 4HSTA 1C4RA 2Q8OA 4NHMA 4BY7J 2DOFA 4B29A 1RESA 1VI0A 1I39A 3WUDA 1RUF2 4UNOA 1HRI3 1FBUA 5JXJA 4BUPA 3CNAA 3FE5A 2EWNA 4CICA 3POYA 3VSKA 3W21A 1G6NA 1XE0A 3RQ0A 4GDFA 2XAGA 5FV3A 3TNPB 1ETOA 4NOTA 3CCJI 4QM9A 3CF2A 4XBLA 1IPJA 3FC0A 2BYVE 3DYPA 2E26A 1MS9A 2Y60A 5DDJ2 2Y9YA 4ATEA 3JD71 3FXRA 3MF9A 4AUXA 1MIJA 3VZNA 1RUE2 3E6BA 2JECA 1XC5A 4KITB 4IPAA 2IGNA 5C4JJ 2XG3A 3WDUA 4EWEA 1BK1A 1FY7A 3GCXA 1RR7A 4YZ5A 1SD7A 1HXDA 1W6NB 1W39A 2V9KA 5FO7B 1JZ4A 3L2CA 4IQPA 4Y15A 1TL8A 4DBQA 3M2MA 5LGNA 4BLIA 3GJBA 2DDUA 2GZWA 3HQUA 4A7KA 1VBD3 3BODA 1NG6A 2O3FA 4URTA 4JGYB 2LF7A 4YRDA 4AXOA 4B7EA 1ZRFA 1Y0UA 4FE4A 3VKOA 1P8JA 3PDQA 4BQ2A 2YSRA 1JGSA 3K3OA 4FPKA 2UV1A 1AU7A 4HK8A 3ES4A 1B35A 1REDA 1J3QA 1XYOA 3LAJA 1N3OA 2DCTA 3GYDA 1ZBE3 5GLZA 4CYCB 2VY0A 3Q0VA 1UX6A 1ONVA 5CFDB 4B48A 1IG7A 4BY1J 2LKXA 5KC5A 5K0UB 3VBHC 4FCYA 4CPBA 2D43A 3MKYB 4CUGA 1PO23 3OYNA 4CXXA 2PMZN 1J09A 1Z9CA 1ZAOA 2XBO1 5D8AC 3DPTA 2SLIA 3VBOA 4QKDA 5ICGA 1LOFA 2JA5J 5GTHC 1DUXC 2E60A 5CBLA 1EAH2 3PMEA 2Q8DA 4OHXA 1VQ7I 2OPWA 4XCAA 5A3NA 1RNLA 2QBYB 4M3DA 4EN9B 4AEDC 1S29A 5E3LA 1QU3A 4D7YA 1RUD1 4EN0A 5C8CA 3HJEA 1YJWI 1OCZH 5EYRA 3M7AA 1H9PA 4Q4V3 2X10A 1JXSA 4JKLA 1HQLA 2XVGA 2WWSA 3DLAA 3FZ3A 4Y52J 2IXCA 1QY4A 3WF2A 1X8EA 5SV8A 1AR81 4CDUA 1Z0HA 3U21A 5J40A 1S2KA 2D5HA 3AYDA 4N4OB 2C6YA 4A3DJ 5L3EA 1ZRCA 1CZTA 5A33A 4A3FJ 2YGLA 1ONAA 4QU1A 1WCSA 2PAEA 4JYKA 2ZJPF 2COMA 1IN6A 1IO2A 1BC7C 3AKTA 4M6VA 4M01A 3N05A 3VYTB 2EB7A 2GC2A 1Z1DA 4QXBA 2B45X 2RDPA 3F72A 1V3FA 4YLZA 3LQCA 1B72B 1Z78A 1F36A 5BS6A 4MFDA 3KLNA 2ZJQF 4MO7A 1W4MA 2JE7A 4Z8BA 1OA3A 5ACA1 1F4AA 3BTXA 3OUIA 1R9TJ 1XBFA 4QKFA 3VDBA 4W97A 4U0YA 3Q9VA 2PMUA 2JA7J 4Q8LA 4FETA 3PNAA 2JEMA 5E79C 4EN8B 3ZYHA 2X0LA 1RVF3 4MGSA 4L5IA 2VE8A 2K4BA 4LG0A 1E5SA 4C0BA 2Z69A 5J09A 1TQPA 3KMHA 4GH4A 1IRGA 5L3BA 1LEBA 1UU5A 3BTAA 3R0RA 2KM2A 1F1ZA 4GB32 3L00A 3T1BA 4Y4RA 1EA3A 3HOVJ 2L9SA 2VNOA 2WNUB 4I2OA 3I2IA 3L2YA 4LB5A 1WRJA 2WAFA 2PAKA 1QXPA 1UZWA 5KBFA 2CNAA 1JUHA 3OJBA 4QPIB 3OF1A 3H3VK 3BR5A 2WTEA 1ZRDA 4OMCA 2FZ2A 1YO8A 2PN6A 4AHYA 4E27A 2KXLA 4ISRA 1ZR2A 4GJZA 6PAXA 3ZSJA 1MBJA 2MSYA 2RG4A 4OIRF 3MI8A 1OH4A 2E33A 2WDBA 5LWBA 4CCOA 3ZPLA 2DYSH 4ZYAA 2VC9A 5FJ8J 2DMQA 1R5HA 1QJFA 5FUIA 2K9SA 1G7YA 1Z7S1 3BPSA 3GXOA 1N1TA 3KT7A 3UT0A 3ZIWA 3FBMA 4LOSA 1KITA 1R49A 1S7AA 4V19K 3BR6A 2W46A 3NEUA 3I3LA 4XMYA 1NCRA 2HKOA 1VMFA 1QZEA 1A8MA 1NCQB 1YRZA 2DOEA 4KBZA 2J5OA 5F3EA 4JHZA 3MFCA 1V6LA 3B01A 2R7ZJ 2M34A 4ZZLA 3SZPA 3JAMK 4NHYA 3PU3A 3CCVI 4P9XA 3HHGA 3K4AA 1ULFA 3AMPA 3FLTA 3RI4A 5FLJA 2DAOA 1VBE2 1D3YA 1ND2A 2Y33A 3AX4A 2UUZA 4LK6A 4ZDOA 4WM8B 3ZN0A 2XGCA 4PK4A 2LD5A 4AVTA 1U3EM 1AL21 1Z77A 1W6QA 1C8NA 2NNNA 2R7OA 3BJ6A 1LUJB 3A2KA 3G6JB 4N43C 2K9QA 3PL8A 1R64A 3IIIA 3ABZA 3H9JA 4JGZC 4NHKA 3VDDC 2G9GA 5ERIA 2P37A 1HW1A 3GF2A 1NQJA 1KONA 5J8CA 3WVJA 1REPC 3WT3A 4XJ8A 2RS52 3WEZA 1ALYA 4NWWA 4AGRA 3NV1A 1P4XA 3GHMA 1RYYA 3AG2H 1VBB3 1XSDA 4UHTA 4PDWB 3LFKA 3REOA 4G8XA 4XETA 4QX3A 4A3KJ 3AYCA 4RR3B 2ZSIB 1XCBA 1CAWB 3VBSC 3UV9A 1U0JA 1USSA 2VN2A 1HRV2 5FCCA 4Y1VA 3KZIC 3MCZA 3ONQA 5EEAA 1LOAA 4NO4A 4KMFA