The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
193
|
structure length |
185
|
Chain Sequence |
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb |
molecule tags |
Transcription
|
source organism |
Rhodobacter sphaeroides
|
molecule keywords |
RpoE, ECF SigE
|
total genus |
36
|
structure length |
185
|
sequence length |
193
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2007-05-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF12973 | Cupin_7 | ChrR Cupin-like domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Arc Repressor Mutant, subunit A | ||
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |