2Q1ZB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
185
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
molecule keywords RpoE, ECF SigE
total genus 36
structure length 185
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2q1zB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1zB02
2D40A 3TNPB 1OMIA 3R6SA 5JCTA 2XKOA 4ZU4A 5KHJA 4LLOA 4Z07A 3BCWA 3H1MA 1I5ZA 2GC0A 2ET1A 4PJYA 2GC1A 3D82A 2IXKA 4Q0SA 3NW4A 1QY4A 4NQWB 3CL1A 1X8MA 4MUVA 2GH2A 1YFUA 1Q43A 5I8SA 1EY2A 1LB2A 1RGSA 2PQQA 3CO2A 4X6QB 4HLTA 3D0SA 1RL3A 4MX3A 2OPKA 3EJKA 2GU9A 3ZDSA 1X8EA 2ET7A 4PIYA 4LUKA 2XLFA 2XLGA 3IWZA 1WA4A 2WC2A 2EVXA 3MDPA 2I45A 2VPVA 3LOIA 4B29A 1J3QA 2HKXA 3HT2A 2PA7A 3FZ3A 2IXCA 3H9AA 5I8YA 4I2OA 4QXKA 4XFBA 2OZ6A 3JZVA 3RPQA 1FXZA 5I0RA 5KHHA 5LEJA 1O3TA 1UIKA 3RZZA 1J1LA 2D5FA 4WBBA 4IEXA 4IESA 4AXOA 3SMHA 4LTAA 4XETA 4I0BA 1ZZ7A 3FFQA 4E2SA 2ZCWA 2GAUA 4KU7A 2QJVA 1G6NA 1O3RA 2QNKA 4D7SA 5LEKA 2OZJA 2H6BA 2FMYA 4UBHA 4ORFA 3DV8A 2D5HA 1VR3A 4HN1A 3CJXA 3IIAA 3LWCA 4Q29A 2Q30A 1NXMA 4KU8A 1LKNA 4IEOA 3E6CC 2DCTA 3EQEA 1IPJA 3GBFA 2H6CA 4HSJA 4QMAA 1EPZA 1X82A 4MZUA 3U0ZA 1CAXB 2BNMA 4I02A 4JTNA 3H3ZA 3L2HA 3RYPA 4L11A 2H0VA 1ZRRA 4XF0A 1DGRA 2HJIA 1CAUA 1J58A 3BU7A 4EWEA 5KHGA 4GULA 1J3RA 4UXAA 1ZVFA 1XE7A 3DKWA 3PLQA 4YARA 1ZZBA 4MGZE 4AVCA 2QVSB 1TQ5A 3IBMA 5J7MA 1YWKA 3NJZA 5KHKA 2PYTA 1Q3EA 5LRSA 1SQ4A 4F8AA 5EFUA 4I01A 3TNQA 3LA2A 1J59A 5E1RA 2B5HA 1FI2A 1QXJA 4JV4A 2CAUA 3OGJA 1UD1A 1GQHA 3B02A 3H3UA 1Q5OA 4QM8A 5FQ0B 1VJ2A 1O5UA 3QOPA 3U11A 4QGLA 5C8WA 4XFFA 1UCXA 3S0MA 1UIJA 4PIXA 2QDRA 4D7TA 4RD7A 3LA3A 3BPZA 5T3NA 3CEWA 5FLJA 3IDCB 3ACLA 4CYDA 5F1RA 3RYRA 3E97A 2CGPA 1QWRA 2C0ZA 3FJSA 4P9GA 3FX3A 1SEFA 3KGZA 1O7FA 4E2QA 4MGKE 3H1YA 2FQPA 4KWKA 3M3IA 2ETEA 4BHPA 1I6XA 1ZZCA 4IEUA 3OD0A 2EAAA 2Z2SB 3HT1A 1FT9A 3O14A 1X7NA 1Y3TA 3M70A 4FT8A 4H7LA 4ONUA 5KBFA 5KHIA 3WW4A 1CAWA 3RYKA 3E5QA 3ETQA 3I7DA 4N9IA 3MPBA 5I0TA 3HUGB 1NZCA 2UY9A 4AVAA 3RNSA 1ZREA 1ZNPA 3USSA 1YLLA 3H8UA 2PHLA 2BNOA 4E2GA 4I09A 1XE8A 1CAVA 2IXIA 3BB6A 4HSLA 2QCSB 1UW8A 4HMZA 3EO6A 1VP6A 2N7GA 3SHRA 4N9HA 4LULA 4J1XA 4R8HA 5BV6A 2GC2A 3EBRA 2O8QA 4NVPA 5LRRA 3MZHA 4HBNA 5FLHA 4KWJA 3VHRA 2VQAA 3E5UA 3H1WA 3KGLA 4XFCA 2PHDA 4QX5A 2Z69A 4MGYE 2PAKA 3I59B 4TLFA 2CAVA 2IXLA 4IERA 1XRUA 4UBGA 1L3JA 4META 4AQ2A 1CAVB 1LRHA 2K0GA 5AVPA 2IXHA 5JSPA 3RDIA 4R52A 3SXWA 2BNNA 2ATFA 3NSTA 4PIZA 5CU1A 1HW5A 4F7ZA 1CAUB 3WW2A 5D1IA 1O5LA 5I0UA 5CADA 1DZRA 4XF1A 3E6DA 4HVRA 1CAXA 2MHFA 1ZRCA 1YHFA 1ZZ6A 3U10A 3G7DA 3UKNA 1U12A 2Q1ZB 1WGPA 2PAEA 4WZCA 3SCHA 4YSFA 1CAWB 4FBFA 2B8MA 4YYOA 4QM9A 4YNIA 1V70A 2BYVE 3HQXA 3LAGA 4AVBA 3MYXA 1RUOA 1CX4A 2VECA 1J3PA 3HIFA 2O1QA 1IPKA 5I93A 2PTMA 2UY8A 4OFGA 4JTOA 5BXXA 1O3SA 2GC3A 2EA7A 2IC1A 2GZWA 1EYBA 1YFXA 4IETA 1RUNA 3C3VA 4ZU5A 3WW3A 1NYWA 1O4TA 2BGCA 3FE5A 4HVQA 5E16A 3EHKA 4IEZA 4Q0PA 4BYYA 1JUHA 2UYAA 2P17A 2UYBA 4EWAA 5CVRA 3OF1A 4MGIE 4YRDA 1Y9QA 5K8SA 5HI0A 1WLTA 2CV6A 3SCGA 5FPXA 4JVAA 2E9QA 3IDBB 4IEYA 3SCFA 3S7IA 4O9EA 4XF4A 5FCCA 1ZX5A 3NL1A 5JSOA 2PFWA 1RTVA 4HN0A 3D0JA 3KMHA 2B9UA 3OCPA 4A2UA 5BY5A 3DN7A 5FDBA 3NVCA 3S7EA 1EP0A 3FWEA 3UKTA 2K9ZA 2IXJA 4O9GA 4LUMA 4MH0E 4QGNA 2XLAA 3LA7A 4XFHA 1ZRFA 1UPIA 3WW1A 4OLLA 1NE4A 5J48A 1OI6A 2WFPA 4AQ6A 4WVZA 4X6RB 2XL9A 1CGPA 3FHIB 3ES4A 1ZZ9A 5JAXA 5I91A 4Q0VA 4K8FA 4XFGA 3DL3A 2F4PA 3NKTA 5I0SA 1ZZ8A 1RC6A 1DZTA 4IEPA 1YFWA 1GQGA 4XF3A 5BPXA 4EV0A 3KSCA 3E6BA 1H1MA 2D93A 4MV2A 4Q0QA 5I8TA 4XEZA 3OTFA 4IEWA 3UKVA 4BH9A 2KXLA 3ELNA 5BUVA 4EWDA 3H50A 3CF6E 4KWLA 2MNGA 5FLIA 5C6CA 1NE6A 2Y0OA 2PAMA 4KL1A 4L2NA 1OFNA 4LEJA 3ROUA 3I54A 3BALA 4J1WA 3LZZA 1YUDA 2MPFA 2BEOA 4HVOA 4IEQA 3GYDA 4IEVA 4XFIA 4XF9A 4BIFA 4FAGA 5J3UA 2XHKA 3I59A 1PMIA 3ST7A 1LR5A 4HZFA 2V09A 4LA3A 2XL7A 1PM7A 1QXRA 5JR7B 4XFAA 3CLPA 4Z82A 3QACA 2ZKLA 5JSRA 4I0AA 3ES1A 4EROA 3N4MA 4DINB 4I3PA 4ZU7A 1YFYA 3PNAA 4Q0UA 3H7JA 4LA2A 5EZWA 2Q4SA 4FAHA 2OYZA 1O3QA 3KCCA 2XGXA 5FQ0A 1DGWA 1OD5A 1ZRDA 1SFNA 2XKPA 2Q0AA 3H7YA 3PVBB 2OA2A 1H1IA 3E5XA 5FPZA 4QGMA
chains in the Genus database with same CATH superfamily
4GKYA 4BDVB 2XKOA 3VD4A 4OHVA 4FCYA 2L9SA 4AVPA 3TW7A 1R5ID 4HX4A 5ILUA 1YITI 4RS5A 2IJLA 3M8LA 1PK6B 3CDHA 4RR3C 5BOXA 1RGSA 3K4LA 4ES9A 3CO2A 2EXHA 2P3JA 4X6QB 5HS7A 3WGIA 2DU0A 2X10A 4MX3A 2W52A 3V7CA 3X29B 2CV1A 5A3UA 3WHUA 3MW4A 1T95A 4BK4A 1RHI2 2KDZA 4B29A 3KV6A 2R7DA 2EZKA 4UUTA 1R7JA 5DUXA 3ACHA 1FPN3 4IRHA 3CMEI 1O3TA 2KR2A 3O1RA 2X1DA 1GNHA 4A3LJ 3C2UA 1N47A 3OGGA 2E35A 1ETYA 1S0EA 3FFQA 1A8DA 1TME2 3J4UH 1YJKA 1BN5A 1VAKA 1KJRA 4BCUA 2XDVA 3B6CA 3VD5A 1BJZA 4UBHA 5DCMA 1ZELA 3CCUI 1VR3A 3IIAA 3OPZA 2EPFA 5FRAA 3E6MA 3HEIA 3EYIA 2FOWA 1TME3 2IEKA 3DBLB 4PJLA 1E57A 2J1RA 3FMGA 5FYIA 2EAKA 3O1VA 3DGTA 5EWSA 3KLOA 1EH6A 3N9PA 1W6OB 1SMYF 4JGYA 1KZHA 3HM5A 2JMWA 3NAPB 2K9NA 4M3FA 5AC92 2DYSH 3QD6A 1UJ8A 2VQLA 2WLQA 3J80Z 4D1QA 2XWBB 3AKQA 1S0GA 2X29A 3MVPA 1UXXX 2W1OA 2OQGA 5FMOL 1S0BA 1RMU1 3POYA 3GZUC 2W82A 4HLYA 5CFDA 2XPJA 3NAPA 3FHAA 2P3KA 2JB4A 3WCSA 5HCHA 3LA3A 1RNLA 4IEJA 4GFBA 3CEWA 2Y34A 3IDCB 5L19A 2Q5TA 4LT5A 1H6XA 1QJY3 4BHPA 2C24A 4QD2A 3W2AA 1HB2A 5LASA 4YZ1A 4YFNF 5JWPA 1P92A 4NDLA 5KHIA 1I9RA 3OYDA 1H2MA 1OQYA 4YZ2A 2M8GX 1AL0G 2VUAA 3FLTA 4SLIA 3QYBA 4FOWA 5JZGA 3IN9A 2VASA 4UNOA 1K61A 4W6YA 1RUG3 1W2OA 3WTUC 1A6QA 4XQDA 2EALA 3LCPA 3CUQA 1RUH3 2ZGRA 2Z9OA 3DUIA 3PJRA 2JZYA 4NVPA 1YIFA 5DAVA 2VXRA 3LIGA 1UG0A 3HEFA 3DLLF 3REOA 4N53B 2O5RA 3WHTA 1LFUP 3DEEA 2DURA 2VQTA 3A4CA 4UBGA 2M9HA 4CUBA 2VUCA 2QEXI 2GXBA 4XRFA 3OYIA 3DBHB 3SLIA 4CSWA 1TP4A 3R4SA 3W21A 1PNFA 2A6ZA 3TKYA 2VPRA 1YHFA 4OI4A 2DI3A 4B47A 5DUKA 5BNGA 2F5DA 4E7JA 2JDMA 2NPIA 1S5LC 3I4MJ 1GUIA 1POV3 2G7HA 1S3JA 4XM3A 2VQUA 5C44J 4NJ4A 4IE7A 5FK7A 2JA6J 1H1AA 4FQ4A 4YFWA 1DFQA 1OPOA 4B3NA 3C3VA 4FX4A 1EAH1 5FWJA 3EMRA 2FBKA 1D0YA 1LFBA 1GYKA 3VKMA 2BHZA 3EHKA 2ZGNA 4BYYA 1H88C 3VFZA 4FPYA 1MSFC 5CVRA 3OF1A 5FAXA 3CJIB 1T39A 3V8JA 1R1TA 2WFF1 4DXRA 3URFA 2WQZC 5EEAA 3IDBB 4EM1A 5HLHA 1Y0NA 1LGCA 1PX3A 3WP4A 4XUQA 4FVVA 5BY5A 1AYN3 2CQ7A 5E18F 1FOKA 2WAQN 4JHZA 3DKYA 1W6NA 2ZACA 2IVMA 1CESA 4ZZDA 3HBLA 4KMUX 5K4LA 4HOOA 1NG6A 1S2BA 1CGPA 3POIA 4JGZC 1VMFA 5CYVA 2EBIA 4FHTA 4IHVA 2OTJI 4TXWA 2CV0A 5FZLA 1W04A 2RDSA 5F5IA 4ANJA 2WIIB 3CCEI 1H1MA 2D93A 4MGQA 3GZ6A 3WGGA 3HNBM 5BUVA 1NTCA 5E3LA 5JDBA 2ES3A 2HR3A 1DU3D 1WW7A 5L3GA 4E4SA 1ULGA 5H6RA 2M4GA 2XAHA 1MZ6A 5J3UA 4LPLA 4HZFA 2V09A 4LA3A 2RR11 3JRAA 3LSIA 1Z1DA 4RR3A 2XL7A 2A71A 3OG2A 1ETXA 3KZZA 5FZBA 3G2BA 4QQHA 1C28A 5BNNA 1Z0XA 4Y4RA 3PNAA 4LO7A 4LA2A 2PLYA 4Q0UA 4ABZA 3HOWJ 1YJ9I 4LBKA 4OVEA 3KCCA 1JT0A 2V9PA 1GMMA 5FIXA 1PVC1 2ZMNA 2DXIA 1IS4A 2WZEA 3W9AA 2QQAA 1MBGA 1WJCA 1K78B 1NZIA 4CXXA 1ODMA 5CJ9A 1SCSA 4BE0A 1AWCA 3WDXA 4FSJA 4UVCA 3FBYA 2KIFA 2L9LA 3HMYA 5DM6F 4NHJA 1STZA 2PQQA 1JXNA 2P6CA 3OUIA 4LORA 3D0SA 3R0RA 2W7NA 3ILFA 4MGSA 1QH6A 2XLFA 3OY8A 4A5MA 2QQVA 2PQSA 4AL9A 2E7XA 1QQP3 3ZFEA 2DVAA 3I3QA 1HKQA 1V6IA 3IH3A 3PDQA 5LK5A 3N9NA 3GYHX 4II3A 5DAWA 1W3VA 5HNHA 4Q4Y3 2XG3A 1AR91 2M45A 2VO5A 1XSXA 3LQQA 3MF9A 3WX5A 2F5FA 3W6JB 4QWQA 1QOOA 1G6NA 1UAAA 1QGLA 1ON1A 2CH0A 5ABJB 4RSUA 2OZJA 2WY8Q 4ZXKA 1V00A 5JLXA 1ETWA 1LOEA 2ECCA 4CZCA 1GWLA 3I97A 3SXYA 1GR3A 1MZEA 3PVNA 1AR83 4Y13A 4A3EJ 1IQDC 1WUVA 3CMAI 1CJPA 2ZKZA 4AGRA 1ZHFA 1UL9A 4XF0A 1X19A 5TISC 2Q8KA 4QX8A 5ANQA 3QOEA 3BUCA 4XLNF 3BU7A 2YPDA 2JWTA 3WLUA 4D7NA 3DXJF 4F55A 4BHCA 1YOVB 1K45A 2VLAA 3KM5A 4MGZE 2NYXA 3ZR5A 3PL0A 3IBMA 4LO4B 4B4PA 3PMEA 1KQ8A 3NJZA 4GAZA 5L3BA 3VD3A 2BXZA 3K46A 3FK7A 4BPZA 3DPUA 1QXJA 2G9ZA 3TEYA 1MS5A 2V72A 5HDNA 1UD1A 5A6ZA 1VQ9I 3BCAA 1MBFA 4NN0A 4QHZA 2WNVC 3KP2A 4CE8A 5C8WA 4PIXA 2DMPA 2QDRA 4D7YA 4M00A 4DFSA 4LO8A 5F27A 4U87A 2GN3A 2CSOA 2GOMA 5CQGA 1W90A 2RVCA 2NVTJ 3CTAA 4DW6A 4AWDA 3AK0A 4XBLA 4AFDA 3HDDA 1TWAJ 2YS9A 3K4CA 3CMMA 3K7AJ 1YQCA 1VBE3 4BMEA 3V0AB 1POV1 2XGEA 2W0XA 4IQ4A 1TMF2 3ETQA 4RQPB 2HNHA 4Y22A 2ISYA 1ZREA 1STMA 4FPFA 3DF0A 4C8DA 4PLOA 1XE8A 4N4NB 4C3HJ 2BWAA 3EO6A 1QNYA 2GC2A 1MJAA 2MC3A 4M72A 3OIQA 3HB9A 4OAZA 1MS4A 1JJ8C 1D0GA 4QPGC 4Q48A 5JLWA 4PUSA 3V7RA 2HZDA 2IA2A 4LOSA 3DPTA 1H30A 1F4HA 2X8KA 2Z99A 3GX4X 1L3JA 3Q8BA 1E3HA 1VMHA 3VKFC 5JSPA 3PVOA 2Y6KA 1OKRA 3PIPF 4A3FJ 5KNLA 1WRJA 4C0BA 1B8IB 3CUOA 5DD8A 2GLOA 4E6KG 3DQVC 5CPRB 3OMYA 4WZCA 5G04L 1PP8F 4NIHA 3ZRGA 2B42B 4FFHA 5KR7A 4AVBA 1CX4A 4KICA 2QQLA 3CHXA 2UY8A 4TV7A 3OPWA 2W39A 4BY7J 3PUAA 4YVSA 2BOLA 1NK3P 4LHKA 1UMZA 1I3AA 4KDPA 1HB3A 3BR6A 1PK6C 1V0AA 5L36A 3F3XA 4ZJZA 4C3IJ 1KFXL 2AEZA 2CV6A 3V0AA 3GEZA 5KXEA 2X48A 1O57A 4KG8A 3KT7A 4X6AJ 1QVTA 1GV2A 3PL8A 5KAIC 2JD9A 5FKMA 3LEIA 3HOTA 2OTLI 3USUB 2HWD3 4ZYHA 3IT8A 1B9MA 1Z78A 5JXGA 4UB6C 3KP7A 3HN3A 3HOVJ 1AR81 2GNDA 3I2DA 2OT7A 2WFPA 3BG3A 2ID6A 1JUIA 4KMFA 5JAXA 3TL4X 1OC1A 4Y17A 1PO21 5FP9A 1W7PA 3OPTA 1DZTA 2XVCA 1Q56A 5FZ6A 2VI6A 4Y7NJ 4XLPF 2EFWA 3RZOJ 1HA8A 2GN7A 2VD7A 3LKJA 4RLQA 2D6KA 3U21A 1YX5A 1XB4A 3CF6E 5EYXA 3ZQHA 4P00B 1DPRA 5FGMA 3UT0A 4J1WA 1D1CA 3RPUA 1FOD3 3ETPA 4KISA 3I2FA 3D4KA 1WBFA 4QPQA 4CCEA 1VMJA 4PF5A 1TNFA 4AYUA 2HGCA 4XF9A 3PO3J 5CKTA 1HDDC 1ONAA 1U9NA 1TE1B 5H6QA 1X9TA 2VBYA 3JAMZ 3TO7A 3BKZA 2E31A 3CCQI 2RV8A 3KYLA 4EROA 2IA1A 3ES1A 4FPGA 3GZNB 3S2HJ 5EZWA 3ZMOA 2IVJA 1O4YA 3N7MA 3PSFA 4XDOA 1BEV2 4KJZA 5FO7B 2KP6A 2ID4A 1SFNA 2PLV3 1HQCA 2VKDA 4FE7A 4YVWA 3ZFGA 4ES8A 3RZLA 1QNTA 3QU3A 1EA3A 4C9YA 2OD5A 3WUCA 2EIGA 1JXSA 3TP0A 2IXKA 5GLTA 5FP3A 4CDQA 2AXTC 4CU9A 3IRRA 1HB1A 1Z9CA 2GH2A 1T6SA 3S8PA 1BBT1 4P5YA 2Z42A 3FF5A 4UUVA 2VZSA 3NNFA 4YW1A 1W5TA 1WI3A 5FZ7A 5FKNA 1PGL2 3HAGA 1JJ6C 3IPVA 3ABMH 4B7EA 4XIOA 1TQMA 1PX4A 1WGXA 1FBSA 3MDPA 2YBKA 2RJLA 3ZQQA 1OPCA 3OV8A 3WP3A 5F6LB 2EZHA 3I2JA 2WUHA 3N9LA 2VVEA 3JZVA 5T52A 1CQ9A 1AR92 3JRHA 2G4IA 2XB5A 1UIKA 1IS5A 3SEEA 2DDUA 4S2DA 3KETA 5BNPA 3K4MA 3T30A 3BPSA 1WMDA 1K4TA 3QAHA 3DTIA 4AGVA 5CQEA 3OL3A 1N78A 2FDIA 2DK5A 4KU7A 4BQQA 4QX3A 1SBEA 5LEKA 4I3GA 1KJLA 1FOXA 4OZOA 2ZJQF 1KONA 5B3SH 1AXKA 1R36A 1LQ1A 3GZAA 2JN6A 4KG0A 5BNNB 3H9GA 1P8JA 3A0NA 3LAPA 3LWCA 4B4QA 1W6MB 1DCSA 1AKHB 1DYKA 4V2FA 4EJTA 1CAXB 2BNMA 4H3WA 1TT0A 1UU4A 4JAAA 1IKPA 2UURA 2O6GE 3IHUA 5DUIA 1B59A 2ZX2A 1KD7A 5ILVA 2VL8A 1DQ0A 1ZZBA 4XC9A 4AVCA 5F5CA 2RS11 4GKXA 4DUWA 3ZN4A 3VB2A 4DIQA 1CIYA 2FF4A 1R00A 1LU2A 2R7EB 3B93A 2W57A 4AEDC 4LHSA 4ESBA 1K3IA 3NV3A 5K0UB 4E7ZA 3WTYC 1OT5A 2R072 4KYWA 1QJX1 2FBIA 3WNOA 1XE0A 3VYRB 5FZOA 2VKEA 2VC9A 3RCOA 4DRVA 2FJ1A 2MEV2 3J8F2 1ZGJA 2E7TA 2QKMB 1YHQI 4COYA 1LTEA 3M1EA 4K1ZA 2IS1A 1LCLA 1UZ0A 3KGZA 2O7OA 4YVSC 3ZR6A 4WXDA 4L9TA 3POEA 3LSDA 4RS5B 3QPHA 1BJQA 1NOVA 2LBFA 4H7LA 1B35C 2W1WA 1XNBA 4YIRX 3P5BA 1Y6IA 2DOFA 1D1AA 2BVBA 5FZ8A 4O61A 1A5JA 2AQEA 3AP5A 5A3PA 5DS9A 1VQ5I 1ASJ3 2JG9A 3NNLA 1G9CA 4P5OA 1UYYA 2IP2A 4NNJA 5C70A 2O8QA 5JI6A 3W6VA 3MZHA 4UWDA 4ZYEA 4HG2A 5BNNC 5DYMA 1AX1A 4G6DA 2C26A 1XU1A 2WNOA 2YBSA 2IXLA 4FPHA 2WL1A 4DY5A 3S1NJ 3WY6A 1CF7A 5F37A 3A21A 4NRPA 3ZN5A 2DVFA 5KXBA 2LROA 1NCRC 4HPQA 4EN7B 1MMNA 2LVSA 2ATFA 3ABZA 4R1HA 2EF6A 1BR4A 2Y0IA 4GD4A 5M5XJ 3B7MA 2R073 4BHBA 4CU8A 2EXJA 2LFBA 4RBOA 1Y8RB 1JHNA 1V5EA 4PGGA 4OAYA 2QQUA 4QM9A 1T2XA 2VN2A 4CCMA 1OCTC 2EV5A 2VCBA 3MQ0A 2VBXA 1N1YA 2V4VA 3VBHC 5DEQA 2V6CA 3N7KA 4XKVA 3VDCA 3FM3A 3I2OA 1RPWA 3F8BA 1LU1A 4IVNA 4W65A 4LLGF 4MGIE 1YE9A 5FV3A 3LAJA 2GDFA 2VG9A 4OULA 2VW1A 4WVVA 1FTTA 2E63A 4IRIA 3L2VA 4N0BA 4D8MA 2QBXA 1T6GC 3AP7A 1BI3A 3QYFA 2HWB1 5BQTA 2H94A 1KDMA 4M3CF 1EV12 4ATEA 5CEHA 1V6MA 2NRAC 5SV8A 2VL4A 1SMVA 5ICCA 1IW7F 2XLAA 4IXLA 1XX5A 4C2UA 2GMMA 4O7XA 3IKWA 1RUF2 4JQTA 3I4PA 1ZZ9A 5I91A 2ZGOA 1XU2A 2HOEA 1LVKA 1APLC 2QGUA 4RQPA 1RC6A 1BMV2 3H36A 4N43A 3OBZA 4XF3A 2DT6A 2ESNA 1CZVA 1SEUA 5BPXA 2MC4A 1N3OA 2TEPA 3JRIA 5C4JJ 3FXUA 2RM22 3ZPLA 1WLWA 3UKVA 4EN8B 1T6BX 3M3QA 1XGNA 1WCQA 5C6CA 2NNYA 4FETA 2YC0A 3M8EA 1VBB1 4L2NA 4FOVA 3WGHA 3T08A 2HTSA 1YUDA 3BPVA 1R1A1 4XIDA 3HSRA 3NQHA 3H92A 4KITB 4YPJA 2YU2A 5J37A 5C4WC 3AZXA 1RYYA 1G9DA 3C2HA 3PJYA 1UWWA 4Q4V3 3G3ZA 4YM1A 1SD4A 5KC6A 4RS5C 4I0AA 5J8FA 4ZY9A 4AHYA 2TNFA 1YFYA 2KL4A 2JVHA 1GWMA 1ZR2A 1LESA 2CW8A 2BVVA 3W6KB 1WSUA 4QPYA 1D0HA 2FRHA 2DN0A 4FCAA 2R1BA 3CF2A 2WNVB 4ENKA 3BDDA 1DU0A 5KVRA 2JQ7A 4P08A 3O8GA 4LD5A 2HYFA 3GMEA 4ISQA 4BQXA 4YLZA 1AR73 2PEXA 1IV6A 5K0UC 1H0MA 2Y48A 1SD6A 4V2VA 1SFKA 1FAYA 4RB2C 3OUHA 2KD7A 1OFCX 1L7QA 4OMCA 2ORXA 3RS6A 4TYSA 3EJKA 4PJNA 1HRV3 2BBYA 4G4FA 3HRMA 3CCJI 4OMZA 3POBA 3SFIA 2VB6A 4IQPA 2DQLA 1GP4A 1R4NB 4LNVA 1TNRA 1SC7A 2F5CA 3HT2A 2WS93 1W2UA 5E8IA 2X5IC 3JQWA 2OUHA 2P4EA 4YM2A 3GFLA 1HXS3 1WD4A 3A1YA 5J3LA 5IVBA 5D2AA 4ZH4F 1N1SA 3SZGA 3BQZA 5A3OA 1VBA1 2ZCWA 3TDUC 2WA3A 1WWYA 3LGRA 1MNEA 1T08B 1BK1A 5FK8A 1K6YA 1ULCA 1QJZA 1FOD1 2E33A 1PUEE 4MTEA 1RHI1 5LA1A 3BC8A 3LSKA 4HNTA 2Q30A 1LJ7A 4XJUA 4LKFA 3OR2C 2QM3A 3E6CC 3K48A 2MABA 2H6CA 3Q0VA 4QX2A 2RQQA 4AEKA 3O1MA 4BBRJ 4L11A 4BA6A 1V4RA 5FYBA 5CISA 3WNLA 3VBOC 4ZPIA 5ILSA 2R7SA 2EK5A 3VZOA 1GZCA 4EWEA 2JEMA 2FDKA 2WWUA 2ZAHA 1JYWA 1QPMA 1XE7A 4HA8A 2DAOA 2QVSB 1REDA 2YB7A 4WVMA 5LGUA 2A3XA 3ZXEA 1FNNA 5HBAA 5JLVA 1J59A 4CA9A 4B1MA 1A36A 4AVSA 3FXOA 5FXWA 3WDTA 1GQHA 2QCOA 4OUSA 1VBE1 5L7OC 3S1MJ 1YIOA 5CIRA 1WWXA 4Y33A 1V9U3 3ZQIA 4JGZA 4QPWA 3T3YA 2RS52 5FZGA 5T3NA 3CJRB 2JJ6A 1S2KA 1G4DA 1QOTA 3FLRA 1EV13 1X1CA 2QKDA 3FKIJ 3K70D 5FLXZ 3ZFFA 3ACFA 3VUOA 3ALQA 4B1LA 1K4SA 4HBLA 5FXZA 2DJIA 3T1MA 3DXTA 3GJBA 1US2A 4DYQA 4CCJA 1WA6X 3VBRC 3WG1A 2XMLA 4D5FA 4FTBA 4ENMA 1MQTC 1PGW1 2QQOA 3E5QA 2BUKA 1VAMA 3L2QA 1XCBA 4A3BJ 2KKOA 2CO5A 3N36A 1GP5A 4AG4A 3SH3A 4FPKA 4FP2A 1ZR4A 3G1LA 2SLIA 3D5OA 3GVAA 5IATA 3BR0A 2GXGA 4HANA 3S1RJ 5IP7J 1K5JA 4AI1A 3OEAA 4AK3A 2VBBA 2R7WA 3N35A 5FLHA 1OKOA 2CWEA 5F0CA 4L18B 3OGVA 3AB0A 4HYEA 1MGTA 1GP6A 2E34A 3GNEA 5IYYA 4BISA 4BQ5A 1V3FA 3FBIB 2M34A 3IRQA 2EICA 2JRMA 3VDXA 1SFEA 3RDIA 3NWSA 4XORA 1OA3A 2E1CA 1Z7S2 1AZDA 3AL6A 1G7YA 1BM9A 2VUJA 1JT6A 3BYWA 4BE2A 2VW0A 4HSRA 2OCEA 2VECA 3MI8A 4PDWA 1W6PB 3BG5A 4MHUA 1W0OA 1PVC3 4UF0B 5F7UA 5ACA1 5LBCA 1SBDA 2G9FA 4PJ0C 1J7KA 5TGTA 2EA7A 3AFKA 1JI8A 2FDGA 3N7LA 3BTXA 1JUHA 3H9QA 2OX0A 4GB32 5HPOA 5HI0A 4X8NA 5FP7A 2JB8A 1YRNB 1CPMA 1MQTA 1RUI2 4Q8LA 1L7RA 3I3LA 2LM3A 4OOIA 2VM9A 1XN7A 2QZ3A 4IEYA 3QPLA 2C6YA 3LD8A 2ZJRF 5BNOB 1OURA 3Q8AA 5D8KB 2PFWA 2PMZA 4U7DA 3AM2A 3S2DJ 2A6HF 3CU7A 4CDUB 1W9YA 2A1XA 1Z77A 3QPTA 1HQNA 3ECOA 2G7UA 2L4AA 4LUMA 2WLPA 2RJ2A 3LSMA 4MH0E 1G9BA 2FBEA 4LE3A 4MGTA 4OIRF 3K1MA 2HXOA 4KIFA 1LHWA 3F8MA 4INDA 3HPNA 1RJ8A 2CGOA 2RS33 2HWF3 2Z5WA 2A6XA 3HSFA 2HYGD 1TMF1 4WF2A 2HQ5A 4CP0A 3TMOA 1WH5A 2HQRA 5DQ0A 4QU1A 2Z5UA 2VULA 4OINF 5LA0A 3OTFA 4BH9A 4ISRA 3S2WA 2HWE1 5DCMB 3UGGA 1OFNA 1L3LA 3CKHA 1CD3G 1CJDA 3POGA 2PMZN 3KEQA 4A4AA 4XHBA 2WAFA 5EZHA 4QAWA 1OLQA 1UKGA 3KCXA 1UX6A 1LR5A 1ALYA 3BG6A 1LUJB 1YQ6A 4RAYA 1VQNI 2MFZA 1XSDA 2LALA 5HDGA 1VB4A 4EMSA 3GTQJ 1TLHB 3RKQA 5IWFA 1GZ9A 5IY5H 1DDLA 3FMQA 4YW4A 3QPSA 4ZU7A 1QKQA 2WNUA 5HXVA 4B8EA 5IYBJ 1YTYA 2DA4A 1SVMA 3UJOA 2ZX3A 3GFIA 4MO7A 3TO9A 4CDWB 5B1BH 4MLOA 4E70A 4S2HA 2ETHA 3NJVA 5LB6A 1G2HA 4UB8C 4LGWA 5KHJA 4ZU4A 1B8IA 1SFXA 2OCCH 5K1YA 3TN93 2DFIA 1QBJA 3D82A 4R9AA 3CL1A 2XASA 1FV3A 2XSDC 4DEVA 3PO2J 5LBFA 3T0DA 4BM8A 3SQOA 4CP2A 1PJRA 5T5PA 4G6TB 1R1UA 4QPIB 5K9YA 4BIOA 4NO4A 2HYXA 3VDDC 2ET7A 3RZKA 3MIGA 2VMEA 4XSXF 1DYPA 4HPKA 2I45A 3O7OA 4Q4X1 1QQIA 4R79A 4PCRA 2DUQA 5AONA 3FISA 3E1F1 3DU6A 1D2QA 2PELA 3T1LA 5L7OA 1FMVA 3CUQB 1E5SA 1ULDA 2VOWA 4CCCA 2X6XA 2XROA 3J7LA 5A33A 4EN9B 4QX1A 3C7OA 3FC0A 5GLVA 2WA4A 1NKGA 4AI0A 4H55A 4KNCA 3NAUA 4BEHA 2GAUA 1DGWX 2VOPA 4QWNA 3ZFEB 3I2HA 2Q8CA 5BPDA 5FY5A 3H8XA 3VBUA 1V6KA 2PJRA 3HOUJ 1OUSA 3MV11 3EUKL 4MHRA 3FZVA 3M4FA 3ZX7A 4W8JA 3MD2A 4CVUA 1R1VA 2P3YA 1PVEA 1OA4A 5IUQA 2ZBJA 5FZ0A 3EUHA 4PQ9A 2IFRA 4COVA 1SBFA 5CB7A 2W85A 4HDUA 1NG7A 3NQOA 5DDGA 3B94A 3AYDA 2A3YA 3RVHA 5A7QA 3IH4A 4MQVA 3JRFA 4UXAA 1CZSA 1W03A 2CUZA 2VZTA 1PZ8A 1AYM3 2E2IJ 5FZKA 4BXSV 2JUCA 1SACA 2NOJB 1OXCA 1HC8A 3CJQB 1YWKA 3ZSKA 1OCRH 3ZXKA 3OBAA 4UHTA 4Y5SA 4F8AA 3GGLA 1PHMA 4OI2A 4ZONA 4K3UA 5K7PA 1SVOA 2M4KA 3DPRC 4XRSG 1RJ7A 1YS7A 2RDPA 3PMSA 3UNPA 1PUFB 1PNGA 1RIRA 4RYDA 1UIJA 1Y7BA 2PLV1 2DMTA 2KRFA 3HKZN 4L0YB 2LKPA 2W3JA 4CYDA 3RZGA 1HJGA 5K7HA 1UZCA 1LJ9A 1JTXA 4E2QA 2C9KA 3GFMA 2JA7J 3KX2A 2ERFA 1ENQA 2GMPA 4OI0A 4BY1J 3VDAA 3ISPA 1O4XA 1AYN2 3O14A 4FFGA 5GLWA 4DYRA 4DBRA 4J01A 3R0JA 4ONUA 2WWYA 2JG8A 4EGZA 1CONA 1S55A 2O8XA 4A6SA 3H42B 3CD6I 5IVEA 1RUG2 3AMPA 4EJVA 4N53C 4QT6A 2VOOA 3GLLA 1FX5A 2DCZA 4Y1YA 5FZMA 2GP5A 2VUMJ 3CF5F 3ZN1A 3USSA 3SH4A 5GAHJ 3AVRA 4RGUA 4LK7A 2ZGKA 3O1OA 4A6OA 5KCMA 2VY0A 4CEWB 4QSHA 4U88A 3M1HA 3AAFA 5LLQA 4A3XA 5CG9A 2BE5F 5LRRA 5EV7A 3EB7A 4KWJA 1T0FC 3VLBB 4M3CA 2VQAA 1JI6A 3B3QE 5DUUA 3HN1A 4MQ9F 2YDEA 4Y1UA 2VTFA 3SITA 3JB8A 1VQ7I 1TWHJ 2QA4I 3UKGA 3GXUA 3M4OJ 1SFYA 4II2A 3LSEA 2IS6A 3C2BA 2J5PA 1RR7A 3NSTA 1OBNA 4NROA 4HK8A 3DEUA 4CO8A 5T54A 4GMP1 1XC6A 4V1PA 3WP6A 4G94A 1GNZA 2BZDA 5BNOC 3OYNA 2VOXA 2HZTA 1XBFA 5E1WA 4F52A 1X1BA 2V5DA 5A7PA 2J1TA 4M9ZA 1FMWA 3A22A 2ADEA 3MFKA 2ZJ2A 3CJIC 3WDVA 1KS5A 2RKHA 4G8XA 3NRVA 2EILH 5D8AC 2R0HA 5APAA 4FFIA 2Y6LA 2KT0A 1IF1A 4GMP0 3BJ6A 2UYAA 2WS91 3T2QA 3BP8A 1TMF3 5IVJA 3RQIA 1H0BA 1HB4A 3DYOA 4OUMA 1IUYA 1SLIA 1VRH2 3H3VK 3NWKA 2ID3A 4QPGA 1TEIA 1IN6A 1H2KA 4LIVA 4P55A 4P9FA 1SVLA 5JSOA 3HRSA 3H0OA 3ZPOA 3S7EA 1EP0A 3K2OA 4PJMA 2J5OA 1LE8A 3KT1A 1UN1A 4CEWA 4AI3A 3GWZA 1XYNA 2QQBA 1QIQA 3Q0UA 2GOXB 4W97A 5FLVA 1UPIA 2DCJA 1UZVA 4OLLA 3K70C 2DFEA 2XL9A 4AVZA 3OYHA 3J80K 4QB2A 1D5YA 3PQJA 1K5MB 5CZKA 1HCRA 2MW8A 2HQAA 4XCAA 3MGUA 2R7TA 1F5TA 1PZ9A 2R061 4GJYA 2M5WA 3BY6A 1R1A2 4AQTA 4MV2A 4Q0QA 1RUF3 4FTHA 4D5CA 2HS5A 2P5VA 2QDNA 2QSHX 4KWLA 4MYEA 3UR3C 1FP2A 2RN7A 3PIGA 4LITA 4AIDA 1VI0A 5JI9A 3MO4A 2PG4A 3IAS2 4GALA 2VZ1A 4JX0A 4G6QA 2IA0A 2OS2A 2F4IA 3AKTA 4H4KC 3V0BB 2W25A 4B1RA 4V2GA 3VDDB 3FIWA 2JDNA 3TOJA 2K46A 3KV4A 2DUPA 5C4XJ 4Q4W1 2NQYA 2MBFA 3ABLH 2A6VA 3IKTA 1OD5A 4IV1A 3TYJA 4LOTA 4XUOA 1X2NA 1GVJA 3AYAA 4M74A 3T4HB 4EZ4A 3OBTA 3O1PA 1SHWB 1JODA 5JZGC 4XMYA 2H8RA 3AG4H 5LK7B 5JCTA 2DYCA 1FNYA 1I5ZA 1VBD3 3WQBA 3ZM8A 1FV2A 2D6MA 1RUI1 1YFUA 4CU7A 1YJLA 2B46X 3SC7X 1W9SA 2L7FP 2VXDA 2G0EA 4XTMA 4CXYA 1Z6TA 1DQ5A 2VJXA 1H4HA 4DXSA 1P6RA 4LK0F 4HXCA 4CXFA 1WKYA 2ZXHA 1H6YA 1Y4WA 2NYYA 3FZ3A 1UB9A 2IXCA 3SKVA 1AYM1 3WVJA 3HNYM 2TUNA 5LEJA 1TQPA 5JVVA 4LQRA 3MICA 1JYIA 3R05A 4F3JA 4WBBA 2E53A 1IXSB 2OAZA 5T50A 3TEZA 4WM8C 4PF1A 3V8LA 4SBVA 3L00A 2JJ7A 2YU3A 2W48A 1FLIA 4IHTA 1A6IA 2QQPA 1QZZA 3DXUA 5C8CA 1JYVA 4NHXA 4XXPA 4XLAA 3SH5A 3GM8A 3AMNA 3DV8A 2Q2EB 1HX6A 1W2NA 3PTRB 1IPJA 1V6OA 4HSJA 1DGRN 4FQZA 1LGNA 1WVRA 4N43B 5D4SA 3MPPG 5DUVA 3TEDA 2HJIA 1J58A 2CU7A 3MKLA 3ZSEA 1IOAA 3FHZA 1E5HA 5EHDA 3P9CA 3J8F3 2W94A 2P3IA 1HOMA 5C3PA 1MJ9A 5AFBA 1BCXA 3LSPA 4CRQA 1ZGWA 2W9XA 2DBNA 5A7WB 1HRV2 4HLXA 4IE0A 1JN2P 1W6OA 1D4M1 3C8XA 1U5XA 1GOHA 2VONA 5C8CB 1QEXA 1QU0A 3VOEA 4QB1A 2QFEA 3F8FA 1W99A 4K2EA 3RYRA 4ZS2A 4C91A 1DDNA 1H89C 1SEFA 3F9KA 5DZFA 4G3YC 2AYHA 2YUSA 1CPNA 4IEUA 5C5UA 4QKDA 4DXZA 2Y0SA 1FT9A 3ILRA 1R58A 4JK1X 2VXZA 2R043 2Z3YA 2UY9A 2TDXA 2YZ4A 1XYPA 3IUOA 1BVVA 1PGW2 1QHHD 4OQ8A 2Q8OA 2W92A 2XF5A 4OMYA 1V55H 3ZFFB 2ZKNA 1PIV2 1A35A 1AKHA 1HRI1 3JSPA 3ZYPA 4N9HA 2E5NA 4Y1ZA 2COBA 3POJA 3N9MA 1A04A 1NCQA 4NIIA 4COZA 3VEPA 3VBHA 4XOTA 1R4MB 2LP0A 2RDNA 4RFT0 5DAXA 4CP9B 4MFEA 3FBMA 5EGOB 2BW8A 3I59B 1C57A 1KA8A 4D7MA 3N9QA 3A0BC 1B35B 1ZG3A 3RFRA 1QPIA 4HAMA 5CVIA 1OH4A 2E2HJ 1LECA 3GFJA 3R4DB 2IXHA 1HV0A 5EIYB 1ZKGA 4LE4A 3U4XA 1WKMA 3I3BA 2R7ZJ 3ENRA 2BY2A 2GA2A 1PM4A 4XF1A 4E4DX 2FMLA 1H8AC 2E36A 3FL7A 4GB33 4DY3A 2PAEA 2DU1A 4YSFA 3U9GA 1B35A 4YNIA 2A68F 3GBGA 3LAGA 4IOAF 2HOTA 4AI2A 3GTKJ 1ENRA 2JG9B 3GHMA 2OPTA 2Y75A 4JZRA 4A0XA 2HBUA 4IPAA 4C1WA 3CZUA 1LGBA 1JOBA 1AL21 4K7JA 1WD3A 3NKGA 2P37A 1H9WA 4BJ5C 3AKPA 1XNTA 1S7OA 4Q0PA 5C4WB 3D6EA 1DHKB 4KFCA 2FUG2 4QX7A 2XF6A 3T09A 1WLTA 3SCGA 2LLKA 3WR0A 3TBIA 1H9GA 1KU9A 1JKRC 4GWJA 4R9CA 1C1LA 3PM1A 1FYLA 1IN4A 2WZR1 1ENHA 3KFWX 3O3KA 1YI9A 2RS12 5FDBA 2IGOA 1K6OA 3S30A 4XACA 2V1UA 1V5FA 2K9ZA 4XILA 2XJTA 2ZX0A 2WB1N 1DBNA 4JC1A 4QGNA 2V1XA 4MTDA 1NCRB 2K40A 2DLLA 2NVYJ 5DDJ1 5FYYA 2UWMA 1E3OC 3WU0A 5L9VA 1BR2A 3KE2A 4Q0VA 1RUJ3 1U0AA 3ABTA 3CCSI 2X6YA 4K8FA 3DKQA 1BR1A 5GZCA 3JD72 4LG3A 4IEPA 2OKXA 5BPIA 3KSCA 4NWWA 5J1YA 4MXWB 4KWUA 5H2FC 2VMGA 3WG3A 2F2EA 2X5IA 5I8TA 4L9JA 4YWAA 1UOBA 4HDVA 1UOGA 3AX4A 5GZFA 1Y43B 3ASOH 2W5FA 3CP8A 4A5NA 1PIV1 1RUJ2 2GALA 5IK7A 3OEBA 5L73A 1W2TA 4CH7A 4MGRA 1TTYA 2ZFWA 4IEQA 1DG6A 4RAGA 3LSRA 3WNKA 4EE2A 2FCUA 5K5QA 1Z7UA 4NAMA 3GO5A 5TJJA 5FZOB 3GTOJ 4NMIA 5IJRA 1D1BA 5JSRA 1YEWA 1W6QA 1OH3A 4XJZA 1AF9A 4I3PA 5K0UA 4XDPA 1PGSA 4FTSA 5J4YA 1AXYA 5FRMA 2HWF2 1G3TA 4F92B 5K7FA 2DTWA 4P1WA 2HEOA 1HDKA 4CUGA 2L0KA 3SISA 2HWC2 4DQAA 1X36A 2DFBA 2J42A 3QH6A 1ZARA 1OMIA 2DOEA 5FKCA 4PDKA 3BCWA 1XXNA 2PJRB 3CCMI 4ZZ5A 5KXCA 1QY4A 4AIHA 4DQ2A 1X8MA 3WZ1A 2LC2A 4XZPA 5DPNA 4AEDB 5E3OA 5EQUA 1P9QC 1FY7A 1J09A 2IWGB 3JXSA 1VQOI 1K83J 3T2PA 1XOYA 4C90A 1VBC3 2V1NA 1MBJA 2GH8A 4PQQA 3K75B 3PSIA 4CDUA 1VALA 3HRUA 3W2VA 3POFA 1R5GA 2VZVA 1QZYA 3OYFA 1T98A 3ZXSA 4Q8KA 4WK8F 2K7LA 1W28A 3AKRA 1G8XA 2HXIA 1XSRA 5GLUA 5AC93 3EUHC 2F5EA 4XUNA 3AG2H 2NVXJ 3SMHA 1XMAA 3PU3A 2DTRA 1LDKB 2X05A 3G1OA 1MEC2 1YIJI 4AFBA 5FXXA 4XJWA 1LOCA 3RJPA 1F4KA 4JYKA 1HJFA 2KZVA 1VRH3 1S0IA 5J8CA 1G59A 4UF0A 5EPAA 2I8DA 1PVXA 1F31A 3L2HA 3THCA 3Q9OA 4HONA 1I39A 2YPJA 3O1TA 4OQ9A 3TEXA 4PI2A 5J09A 1W0UA 5FFZA 5F6KA 2E1MB 4EM2A 1TWGJ 4YG0A 2XGCA 1F9KA 4P9XA 1PIV3 2VOVA 2FU4A 4AWXB 1ULFA 3IDEA 1SANA 2G19A 5F5AA 1VQ8I 4DJAA 2ZJCA 2D6NA 3ZO0B 1SQ4A 5EFUA 5F32A 2NNNA 4JBAA 1E3PA 1DGRM 4LBQB 1FX7A 2B0LA 5T5JA 2BFUS 4QTRA 2YGLA 2RAEA 1Q5OA 2KMUA 1SPPB 3L9FA 1YQ8A 2HYJA 4HSTA 3U11A 1IS6A 4JHTA 4KGQA 5A1AA 4PCQA 2CY6A 3UESA 3PTYA 3KD4A 3BPZA 4PBPA 2DO7A 2CSGA 3M2MA 1XG1A 1K78A 3LQRA 4XKBA 2MD5A 4QXHA 5D6FA 2WWSA 1O7FA 2ZS6B 2Y64A 3MMYB 3PURA 2ETEA 2ZMEB 3R4KA 1ZZCA 2ME6A 3B69A 4AEJA 4KNYA 2R063 3IH2A 3WEZA 3TOAA 1A3KA 4ZDPA 3M70A 3BG9A 2RNGA 2DCEA 4MO3M 3WW4A 1IN8A 1FMD3 2ZXJA 4Y24A 1RB8G 4LO5B 3HOZJ 4QPGB 2NVUB 4CDXB 2O0OA 1ZQ3P 1Z7S1 1D7PM 2WT2A 4OCTA 4GQ7A 4F3QA 4EATA 1H4GA 2ICWG 1IRFA 3WTVC 3CC7I 3M7GA 1MS1A 2X0LA 4ENNA 1MH3A 4J00A 3RI8A 1XGOA 4Q1RA 5FREA 3L9JT 3MLJA 2KLOA 2EIMH 2L54A 3AJZA 1X1AA 4AQSA 4HKOA 2HPMA 4A3IJ 4MGYE 5BNPB 2IW5A 4UXNA 2PAKA 3K0LA 5TSWA 3S15J 2VC0A 2LH9A 3V65A 2KJBA 3CJNA 1QJX2 3QRFF 2ZBKA 2R7UA 3ERMA 1SDWA 3P9KA 1I6HJ 1ENSA 4YZ5A 2EV6A 2SBAA 4A0ZA 3KQRA 4KN4X 1QA6A 2KJCA 2Q1FA 3DTKA 2QBYA 2VQ0A 3RMYA 1JUSA 3U10A 3S3MA 5FZIA 4O3MA 3O6BB 1JE8A 2WDBA 2XVLA 1WGPA 5CKNA 5IK5A 1VPHA 2VCCA 1AVBA 1V6LA 3MZYA 3I8TA 1UMIA 2NS7A 3C2GA 4TTGA 1GICA 3CNAA 4UYBA 4AEDA 2FXAA 2D98A 1YFXA 5IP6A 2BU9A 4H7MA 1IN7A 2YV8A 3TRSB 3BOPA 1Y8QB 4ZC3A 3I3EA 1JKPC 4DEQA 4RMNA 4AM3A 2IFWA 3WF1A 4L9BA 3RJRA 1ZBA3 5M5YJ 1F36A 2PQ8A 5KAFC 4XPVA 2LY1A 4LHNA 3BLYA 3B00A 5JR3A 2YMZA 1LNSA 3OGRA 1ZX5A 1RR8C 2JE8A 1NCQC 1MZBA 3A0HC 1RUC1 4HN0A 3IDAA 1PVC2 1SAUA 3NJXA 4AIJA 2CDOA 1XNDA 1IO2A 3MIDA 2Y6HA 3BT9A 1OQEA 2C9AA 1MKMA 2EV0A 1AR93 5A2QZ 3HPGA 1K5MC 1HLCA 4F93B 5ACA3 3ZIWA 1XDSA 1ZRIA 1YXWA 1MPXA 1SLLA 1JZ8A 4AEMA 3NNGA 4QKFA 1AOYA 1OFSA 3WTZA 5I0SA 3PUIA 2RJKA 4R4XA 2D2WA 1ODNA 1WCSA 3ZXAC 3AZWA 3UNGC 3HXLA 4XAEA 2FSWA 1R082 4EWDA 1TZOA 1NE6A 2E1NA 5F0FA 3T0YA 3ROUA 3I54A 1QZEA 2A61A 3ZYRA 2TRTA 4L9VA 2I2SA 4FPLA 2Z33A 5FKBA 2Z79A 4XBFA 2DA2A 2GNMA 5FZHA 4JDMA 4UFKA 3M07A 2L9VA 5DZGA 1RESA 4CCOA 2C6SA 3X2QH 5JOZA 1KFUL 1QNWA 3HOYJ 1O7LA 1ZA7A 4NUBA 4LXLA 5FFXA 3VGIA 4IE5A 3JBG2 1USSA 1IRXA 5E17F 2JG8B 2K9MA 4OU0A 3D8CA 2JE9A 2OYZA 4B7KA 5FQ0A 5FZ3A 1ETKA 5FKKA 5CYYA 3PVBB 1ST8A 4BKXA 1GOGA 1U0JA 3KZIC 2KFDA 4QGMA 1FATA 5FMOS 3O1SA 4XYXA 4ZZ8A 2ARBA 3MEPA 3R6SA 4BU2A 2R7FA 4XONA 3H1MA 3S3OA 2KIUA 4MUVA 2VMDA 2WFF2 3SZTA 3CC2I 3GTJJ 3Q9VA 5FZAA 1CVNA 2EXKA 2GU9A 4UW3A 1W0PA 2Y33A 4UUSA 2XXZA 1TNSA 3AZZA 2W1UA 4B48A 2FDFA 5LGNA 2DODA 2RVAA 5JOYA 5JOWA 5FUIA 3RKXA 2VOKA 4S05A 2LY2A 1R1ZA 2MH9A 4QXKA 2OZ6A 1A34A 5LATA 5EEHA 4QDSA 4LIUA 1QJEA 2ZABA 2G9WA 3J7NA 1CWPA 4KUMA 3QQAA 2DDBA 2DWRA 4IESA 2ZGUA 2WO1A 3A7QA 2HOSA 2R1DA 2P6HA 3T2TA 5KC5A 2CUEA 4AIKA 2Q0OA 2JDZA 2B4KA 2JPCA 2VAUA 3TGNA 1YQ2A 1QRYA 3L2UA 4XUTA 2LRPA 1LOAA 2IT0A 4IHWA 4FO9A 3JUUA 4FPJA 4PZJA 1I1EA 4CP1A 1UU6A 1IPSA 4M3BA 1NXMA 1LKNA 4URAA 4RA2A 1G9FA 1XSVA 3IKVA 4F83A 3HGYA 1XD7A 5FROA 2IGNA 4C2MJ 2D43A 5L9BA 4XK4A 3DPRB 3WG4A 1B4AA 1GKBA 3A4UA 4GULA 4J6GA 3H9JA 3KPHA 3DEMA 2XAUA 1CZTA 3TOBA 5A70A 4M3CE 1XS9A 3WHBA 2K3PA 2F6BA 3GCWA 2R32A 5M0TA 3M3OA 5DXDA 2DOAA 2EIJH 4I01A 3LA2A 4QPIA 2CV2A 2QZ2A 1AJKA 3D5RC 3IZOA 4IHYA 1ND3A 1X1DA 1J84A 2ZO4A 3OOUA 1RUE1 4ZS3A 3GTGJ 4N43C 4JCKA 2LNBA 1LOBA 1O5UA 3WG9A 1F43A 3Q8FA 4LLFA 2LYCA 4AAPA 4CEYC 3BZKA 3FMSA 3ZPYA 3TW6A 2C0ZA 5D8AA 4P9GA 1AYM2 4ARXA 5F8PA 4E4ZA 4KWKA 5FJKA 3IV5A 1MMSA 4AYBA 4KI5M 1XNKA 4Q4W2 4GRIA 2GA1A 4FT8A 1TZLA 4ETSA 3AFGA 1Q1HA 5ERLA 4YFXF 3PUSA 4BQAA 2ZHKA 4LLLA 1X58A 3FXJA 3MPBA 3OYKA 4G9SB 4RGKA 1BI2A 4WM7A 1NZCA 1W06A 2ZMLA 4O65A 2IXIA 3BB6A 4CEWC 4QHBA 1S7EA 1TVGA 3T1BA 2PHUA 4J1XA 2D3SA 1YI7A 3R0AA 1Y56A 4LG0A 3M9AA 4LBNA 5F39A 3FDYA 5CVJA 3FKJA 3DPRA 2A5ZA 3BVCA 3OSDA 4B3AA 5IT3A 1ZG5A 3M3EA 1EJ9A 2A07F 3ZYBA 3RSNA 4META 2CWSA 3KHBA 3H8OA 5A32B 4R52A 4FPOB 3HZJA 4PIZA 1LFPA 1HW5A 1VRBA 4F7ZA 1MR5A 1QJU3 1DZRA 2TBVA 2ME0A 5IVYA 3DCFA 2GP3A 1OVPA 2Z16A 3P1IA 3FFZA 4Q4V2 5FYHA 3WXPA 1Z67A 2BGOA 3I58A 3K2ZA 1JU4A 1ND3C 2B8MA 1L7LA 4YYOA 2ACJA 4CDWC 5FY0A 1SCRA 5GM0A 2EINH 3RIRA 1J3PA 2CQQA 2HDCA 1RVF2 1NQJA 1NA1A 1DPUA 2B45X 1KGSA 2P6SA 2FX0A 4XL9A 4Q4Y2 4JDNA 4A7KA 2QSFX 3ZQGA 3IAPA 3WTWC 2AEYA 3IL2A 1VF9A 2R7OA 4S2GA 1S7AA 3ZN6A 5F5QA 3OWTA 3NAPC 4EJRA 2W46A 4YRDA 2VU9A 1R091 2WN2A 2M1BA 2ZOEB 2E9QA 2GWRA 4GH4B 2HWF1 2ELHA 5DG2A 2VNRA 2R071 3SCFA 1AR61 4D6QA 2JDYA 5LBQA 3NL1A 3A02A 2H1LA 3E7LA 4EGYA 1V9U1 5CFDB 1MBKA 2B9UA 4XMIA 2P6TA 1MVQA 4Q4W3 2M7BA 4QQOA 5KXDA 1HQLA 1RUC2 4KBBA 2ZGMA 2XBO2 3ZQFA 1ZA4A 5J48A 1W5SA 5GZGA 1B6AA 2MH2A 1BEV3 2Q1MA 4XFGA 2B9SA 3TBDA 2WV0A 2WS92 5CFCA 1YFWA 3C1DA 4BOWA 3FUOA 1RUI3 3JD71 4KIGA 2Z1DA 3ZVXA 3GDBA 3NMBA 1U5IA 4CP9A 2Y6JA 1NHAA 1JUMA 5JUVA 3ELNA 2JA8J 3H50A 3LF7A 2CQNA 5IYDJ 3I71A 2WBMA 3UJQA 3JRDA 1YIPA 1LOFA 1WJEA 3J7ZI 4GH4C 5B66C 2EFPA 4Q26A 1JKOC 1LEBA 5GZDA 3F8CA 2VQGA 5F3GA 3PIJA 1BC7C 1ZGAA 5DV5A 5DMYA 1BA5A 5C71A 1X33A 1QXRA 2WZR2 1RUG1 1ONVA 2QQWA 4BE3A 4XKCA 4L97A 1RUD2 3QACA 5C3EJ 3H8RA 2HBTA 1U2WA 1AYN1 2QBYB 4D6SA 3WNNA 2D45A 4GWIA 1R081 4XN3A 2ELJA 1FJLA 3MEXA 2RDQA 2XKPA 2YY1A 2CJJA 1IG0A 2GXAA 2XV4S 2YBPA 4WVWA 3FXKA 3E3VA 5C3SA 3GXOA 4B4CA 1AXZA 4AHWA 4ASMB 1QJU1 3LB9A 4S0HB 2BV4A 5IK4A 4Z07A 3MBWA 2ZZQA 1PUFA 5A1LA 2AXLA 4NQWB 2ZSHB 1YW8A 3LSJA 1OSGA 2D3RA 4NRQA 4WVMB 1T38A 2PFBA 4QKBA 1O6UA 2FQ3A 3C7JA 1GV5A 4M9SA 2J1UA 3C7HA 1YO8A 5FKLA 4HF1A 4UFJA 2YUEA 5D21A 3CJTB 3TB0A 2JVGA 3HG9A 2JRTA 5C5TA 3SQNA 4LB6B 4D94A 3AL0C 2VPVA 4UFMA 2R7XA 2F4MB 4D69A 3H0GJ 5DZEA 2LREA 4UFIA 2M0CA 2WTEA 5AFEA 2CUJA 2VMCA 2V9VA 4Y1VA 4XSZF 2ELKA 4FX0A 4XLCA 2NZ9A 4AXOA 1VFCA 1FSEA 3VODA 4E2SA 4QQPA 3JSOA 3WT3A 2CU5A 3V4GA 3RI4A 4D7SA 3K1PA 2QENA 1SPPA 5JI7A 2K85A 5DDJ3 3H5NA 2JD4A 2WN3A 3WTXC 4ZXEA 1AHSA 1TW2A 2ZEXA 2DUOA 4KU8A 4B44A 2WYFA 2EZIA 1AJOA 1EPZA 4JTNA 4Q4ZF 4RGGA 4B3XA 1Q1VA 4CHUA 1HV1A 4PFOA 2ZGPA 3BCBA 1DUXC 4GA9A 3LOCA 4P02B 5FD6A 3ORJA 2LTNA 3I3MA 1FPN2 3VV1A 5F04A 2HLEA 1H9PA 1QHDA 3L09A 4RR3B 2L7ZA 4QXCA 2WAQA 4BXUA 3WNXA 1XNAA 1YQ5A 4X1EA 2E26A 3SZPA 2R4GA 2B5HA 3M8JA 4QB6A 2DJNA 2RM21 4BDYA 3LFIA 5ED4A 3WF4A 1B72B 2L7MP 4IE4A 5FP4A 3QOPA 3B9IA 4CDWA 4IV1C 2IXSA 5FMDA 5A2QK 2WNUB 1BI0A 4WWCA 5JMOA 1BMV1 4HNUA 1NCRA 3LFMA 5FYCA 1WJ5A 2GQQA 3M3IA 5F2WA 3LSGA 2UZKA 3HT1A 3BI3A 1MS0A 1X7NA 2RDRA 3DP7A 1M06G 5IVCA 1JGGA 4I7HA 1RXGA 5GADJ 1PP7U 4A3DJ 1HN0A 2JUGA 1OCPA 1K5MA 1W9FA 1VBB2 2LSOA 4IGOA 3ZMZA 1LAJA 3BZCA 3ZGKA 5J36A 3ATGA 3PNTA 4HBNA 3LMMA 2RMU2 3ML6A 2L4MA 3O8HA 3VHRA 2CDPA 1Y1VJ 4WM8A 3GJAA 3V56A 1XCVA 4LHLA 4TLFA 4QPIC 1XRUA 2R30A 1UFMA 3ZMVA 1MD0A 3WE2A 2WADA 3BR3A 2BJSA 1OQ1A 2W68A 1LODA 1RITA 2EFQA 1XNCA 2OBPA 5H9QA 2LDUA 1O5LA 3JTGA 3FN9A 1H8TA 5JVGF 1BOBA 2BZTA 2CRGA 4CEYA 1C1FA 4MG2A 1R9TJ 5FO5A 4RB0A 3I2IA 4YZ3A 4ZYDA 1F35A 5LHHA 2CQKA 4UFHA 3WV6A 2JG8C 2K27A 2LY9A 1XMXA 3I5UA 1OUXA 4Z2WA 1RUNA 1ZBE1 1WZ2A 1LEDA 1JZ7A 5C7GA 2R7RA 1YRZA 1ULEA 2BGCA 1NYWA 4QHOA 4IEZA 2LTPA 3KZYA 2P17A 4AD9A 5JR2A 2ZB9A 4GO1A 3JBG3 4BQNA 4JVAA 2VE1A 2YYOA 1UPSA 1LDDA 2VMFA 2V1DA 4XF4A 4EEFG 4AFAA 2KRCA 2YX7A 1RTVA 3IPVB 1B1BA 5EJZB 4OYUA 1JZ4A 5F3IA 2O0YA 4HOBA 1NLSA 3CCRI 1N1VA 1Y9MA 1IGOA 1MJBA 1GANA 3WW1A 2OUMA 3IAQA 3ULQB 3U1DA 5J98B 2JA2A 4A42A 3ZP5A 1WI9A 4XQ4A 4M9XA 2D1HA 1X4OA 2GIZA 2K9LA 2W00A 1OISA 1Y1WJ 1GHCA 3BWGA 2O61A 1PO12 4FPEA 2MEV1 1WLDA 2E32A 5E6HA 2DCYA 2J1EA 2VZ3A 4IEWA 5K7ZA 1S6LA 3OYWB 1KEXA 1YYNA 3AFHA 3KHCA 2BFUL 2QVOA 3BQYA 4I6ZA 2NMNA 4QIWN 1WPKA 5FOBB 2X4HA 2HVQA 5AVAA 5A3TA 2K5CA 5FP8A 4M73A 3I53A 2X6WA 1OYWA 2M2EA 4FASD 2AUYA 2QTWB 1LPQA 5JR7B 3QU6A 3SEZA 5FZ9A 1LVAA 4Y20A 5DM7F 3N4MA 2V4JC 4IV3C 4HKLA 3AC0A 3CP2A 5F2SA 2ZC2A 1MS9A 4QQLA 3GW2A 1Z05A 3KIOA 2YC4A 2QUFA 2FNAA 2V5YA 5C3RA 2E71A 1F5JA 3WDUA 4GGGA 2RS51 2M8EA 1K42A 4ATFA 4IZZA 2D40A 3K4ZA 4EYUA 2LG4A 2GC1A 2X6OA 4Q0SA 5DD4A 5GP9A 2YU1A 2VR4A 4G7ZF 3FXMA 3I49A 2E51A 1BJAA 5I8SA 3AKZA 4LO6B 1HDPA 1ZLKA 2VCMA 3APBA 1DGWY 4HLTA 1QJY1 4AI8A 4MHGA 2OPKA 4L8QA 1NLRA 4PLNA 2WY7Q 4IHSA 2NMOA 4UAPA 2WA0A 1QDCA 2XLGA 3E0JB 4QKNA 3SDGA 2QQ9A 1JYTA 5FY8A 1AA7A 4KGGA 1Z7LA 1VBA3 3N7JA 1ULPA 3LDRA 2XVKA 3F6VA 1DZQA 1FOYA 4M0NA 3RPQA 2WFF3 5A6YA 3S5AA 4NHLA 2K86A 5GALA 1W8WA 3OYWA 1MEC3 4A6EA 2ZHMA 5J96B 5FTTC 3T8TA 4BE1A 1UNBA 3TN91 2UUZA 4ZKTB 3ZR8X 1C8M2 4AC0A 1OR7C 3BJAA 1U5ZA 5J1RA 3VBRB 2QJVA 2QYOA 4IW3A 3N3HA 5FRNA 1HBXG 1U9OA 4CXWA 4WM7B 4A3GJ 3VSLA 1PDNC 3JREA 4HN1A 2A6TA 1F2NA 1YQAA 2DCTA 4NC8A 3GBFA 2WZ8A 3H3ZA 4P14A 1D4M3 1DGRA 1BEV1 4OIOF 1UG2A 1D8KA 3PUBA 1MBEA 2IBDA 3ZQ7A 1J3RA 2IVIB 3JTHA 5KWRA 3JU9A 4D0PA 3S1QJ 3P3NA 3V0BA 1VBB3 1UZYA 2PLV2 2QF7A 1FYUA 2VMIA 1F8VA 1IKQA 5KHKA 3JB4C 4BNCA 5HVQC 4BDZA 3EUAA 2XAFA 3VZKA 1AU7A 2E5ZA 4XJ9A 3QP6A 5E1RA 3VBRA 2B63J 5EXOA 1RINA 2FHRA 4YGDA 5FBZA 4ESJA 5FQ0B 1I3QJ 4ZYGA 1REPC 3CQOA 4M6YA 4D9JA 1UCXA 3FHQA 4LB5A 1OPMA 4Z92B 4L0PA 1QH7A 4A6DA 3C7EA 1WW6A 5F1RA 3U2RA 3BTIA 2JENA 3I4IA 4Z1VA 2VQHA 1JHHA 4E7LA 4M6XA 4XVHA 2A3SA 2Q8DA 3RJ2X 5LA9A 2EAAA 1W8UA 1WBLA 5A80A 2UWCA 3MUY1 1A8MA 2V9KA 5A3NA 4Y5TA 2V7FA 3I9V2 5LHIA 3DTEA 1ON2A 3K6GA 1W6NB 2OA4A 1PO23 2XJPA 2CYYA 4KBZA 2ZEYA 3HBZA 3BTJA 1YLLA 4TN7A 1POGA 4I09A 2ZTNA 4M3GA 3MIFA 2X5IB 1J0RA 3BTAA 4CUAA 2A05A 5FO8B 3GZEA 2ILMA 4JQRA 2COMA 4N7UA 5JXJA 1RKTA 2FD5A 5FLMJ 4BL0B 3H1WA 4XFCA 2XBO3 4QX5A 1S4CA 2HI3A 3JCUC 3HGGA 2XF7A 1Z6RA 2IUWA 5A33B 1YNAA 2R49A 1LRHA 3V8KA 3HBKA 1IAWA 2DVGA 4JRLA 4HV5A 1LOFC 5IFPA 3KEYA 4EZHA 5ICEA 4P9UA 4B09A 5CADA 1WQ2A 3S5QA 2MD0A 4L5JA 4RB3C 3OJBA 2AH2A 5EZGA 3NWTA 3G7DA 2LOOA 3UK9A 2Y8KA 2P7VB 5EJCA 4P9WA 4UVBA 3HC7A 4EJWA 1LEAA 3MYXA 1KS4A 3AL0B 1WJBA 3ZMTA 4HKWA 5E1ZB 1QQP1 1BIBA 3DKXA 1OF3A 2FZ1A 1C8NA 2YU9J 3VYTB 2EFNA 1MMGA 2H1KA 2OF7A 4A45A 2OJED 3D5SC 1KU2A 2D6OX 4MFDA 4EWAA 1U5TA 3KYDB 2OVUA 1Y9QA 2XUEA 1W7PD 1XMKA 2EQRA 1Z21A 1REEA 1QO0D 1ACIA 2VCAA 2KA3A 3S7IA 3PNYA 1HW1A 4L0ZB 3MIBA 4I99C 4DRRA 4BS9A 5DTDA 3OYCA 3VL8A 1ZK8A 2Q8EA 1WCKA 4A2UA 3KF3A 5AC91 1V6JA 3Q0WA 3SNMA 5JXHA 1UY4A 4XLFA 4FXGB 4LK1F 2F6CA 1ETQA 3SFZA 5JVTA 1YJNI 1YCIA 4MSVA 2ORZA 2WRAA 1G8WA 1GOFA 2VMHA 3ES4A 3VBUB 1UQXA 1MVEA 1RUH1 2F4PA 5A6QA 3E6BA 2CMPA 3OYGA 4EJUA 3OYEA 5TRDA 1T8IA 4XEZA 1WMXA 3MFAA 2KXLA 4CCKA 4M3EA 2BVLA 5DDJ2 2FE3A 1G9AA 2XB6C 2PAMA 4AHXA 5FR3A 1TME1 3S32A 1VBD2 4M4PA 1RUC3 3LNQA 2CS3A 4BJ6C 3GYDA 2DF7A 3ST7A 5FUNA 1N25A 1Z3YA 1EF4A 2HWD2 3DYMA 2B39A 5GZEA 4NR1A 2WT0A 5A3MA 4U2AA 5EGOA 1NAEA 3ME2A 4FAHA 1U5TB 2XGXA 3EDPA 1QJU2 2PX9A 3HOSA 2Q0AA 5DCFA 3C7FA 3E5XA 4ON0A 1W8ZA 1D4VB 2L7KA 5HCBA 3TNPB 2V4AA 5LD2C 4LBQA 4M3CB 3JBG1 4UT5A 4M6VA 2ZFUA 3D5LA 4N7IA 4CDQC 2KHMA 3OL4A 2YFZA 1LULA 3RRDA 2JIGA 4ZHNA 2DW4A 4L5EA 1BLZA 3SKJE 1FMD1 4QPOA 3Q8CA 1GXPA 2W08A 2HWVA 3G71I 3RKYA 1RC9A 3FM5A 1R093 4MXVA 2XHNA 2BY1A 4BACA 3IWZA 5E3NA 3OYMA 2W87A 2E7WA 3LEMA 3RGBA 1NT0A 4YW7A 2VJJA 5I0RA 1FXZA 1WMEA 3OR1C 1OLMA 3PUFA 4XHXA 2JICA 1GXQA 5L9RA 1C8M1 1J5YA 4IGPA 5FKOA 4A3ZA 2VTXJ 4IEXA 4RQPC 1RRJA 2ZJPF 4CGZA 2ZZJA 1TG7A 4I0BA 1YJWI 4AHZA 3CESA 4XQWA 2PXJA 5DABA 4ENJA 1H8TC 4AGGA 2FMYA 3L1PA 2DTYA 3GTPJ 1D0XA 4N90A 1GVDA 2RS32 2DA3A 5KHDA 2K4BA 2D5HA 1ND2A 4IL6C 2CNAA 4XABA 3VZJA 2FNPA 2A6YA 2DFHA 2JWPA 3KZ4C 1X82A 4CZSA 3BU0A 2O8KA 2P7CB 3U75A 2RS31 1ZM1A 2R5YA 4XUPA 2ZGLA 3RZJA 3OUJA 3WOGA 2CL2A 1OHFA 2PMUA 5IOZA 1SMTA 2AZ5A 3ZN6B 3FLPA 1SLBA 4MEXF 3FXQA 4AR2A 4ASKA 2WINB 1ZVFA 3ERED 4UW4A 4YARA 2WKKA 3MWMA 4RM2A 5J7MA 3EETA 1USTA 1PGL1 4GZ9A 3KQ4B 1JOJA 1R6RA 1UHSA 3WNMA 1HXS1 5C9AA 3P6BA 1RVF1 3KF5A 2CUFA 1BBT2 1CIWA 1ZTRA 4XN0A 3TP3A 2R93J 2GNTA 2CAUA 1GZTA 1S0JA 2XBO1 3B02A 4DNYA 1W0NA 1VZ0A 2IZWA 4XRMA 4DNCA 5E79C 2STWA 2O3FA 5CKQA 5FOJB 3T8RA 5L7OB 3TWIA 4F91B 1XJAA 3ACLA 2QSGX 4XTPA 3POSA 4CA0A 5FPLA 1IXCA 2Z2SB 2M3AA 5KBFA 1VBC1 2PI0A 1CAWA 2VXJA 4FQGA 3RYKA 4HPKB 4B43A 4Q4Y1 4EJOA 3ABKH 1R22A 5I0TA 1YX3A 3K10A 1ZNPA 1JH5A 3ZKYA 3WG7H 3H8UA 1FWZA 3AZVA 3AXEA 2QCSB 2Y38A 1Q8SA 2AENA 1JZ6A 4Z6YA 1IDZA 4W6XA 3AYCA 4R8HA 1S9HA 1XGMA 2J7MA 1D2SA 4M3DA 1BK0A 4Q4V1 4OZXA 5F08A 5ABJA 4TZDA 3PNVA 3O0WA 2P5BA 2DU9A 4E8DA 1ZBE3 2WAOA 2QQNA 1BW5A 1UMHA 4Y20B 1FC3A 3H35A 3SXWA 2BNNA 5CG8A 1KRIA 3S14J 4A3JJ 3WW2A 1MS8A 2R5ZB 3SJMA 3ZQLA 2HYKA 2MHFA 1W3XA 4BQ4A 2P4WA 2WJSA 1O59A 3SEPA 3UKNA 1WCDJ 4Y5Z0 1CAWB 1ZBE2 2L02A 5IT9Z 2K2SA 2LUWA 3HQXA 4HX8A 2IAIA 1BHGA 3AL5A 2HWE2 3I56I 5JMCA 3W5MA 4QDQA 4OMDA 1ULOA 4LBQD 1N75A 3NNJA 3OOPA 2IC1A 2RC4A 2C1FA 1BOAA 4ZU5A 3WW3A 1HRI3 3VDBA 4BXFA 5FZ1A 3KLSA 2WZPP 2HWB3 5FPAA 1NUKA 4CDQB 2P2KA 3KLNA 1Z91A 2XJUA 3MKWB 1R49A 3IC7A 1OCOH 1TWCJ 5FMCA 2JSCA 4BQWA 5HV4A 3GZ5A 2VNOA 4EQVA 2D3PA 3O0XA 2RHPA 1US3A 1LEMA 3FK6A 1H9TA 4HX7A 3KMHA 4XZUG 5FZDA 1IRGA 4Q5SF 3LFKA 3OY9A 1BXHA 2KRHA 3BR1A 2F4OB 5HLTA 1DF0A 1JHFA 3ZYGA 5FY1A 4ESFA 4JGZB 4RAFA 1GWKA 5ABJC 1ORKA 4YIFA 1WJFA 2RR13 4Y1XA 4YGCA 2PHFA 5BNPC 3I3DA 1NLQA 5I0DA 1E0EA 4RDUA 5BS6A 5D5UB 3ZLIA 4A93J 4EV0A 2EIBA 1V54H 2JPBA 4S2FA 1Z7S3 1SLAA 2ZSIB 2BHYA 1URXA 1CR7A 4XICA 5ACA2 4JKLA 5HLIA 1QGPA 3P7NA 4FOYA 3H5AA 2HEVF 5H9SA 2JX9A 5HCFA 3WUDA 1NX9A 2XJRA 4IEVA 1K7AA 4FAGA 3QWLA 3ZOBA 3K1NA 4DPNA 3QYEA 3HWJA 1MNDA 4RGXA 4Q4X3 1AUYA 2JA5J 3KEOA 3BJOA 1IS3A 1QQP2 1LNWA 1JZ3A 3PFYA 2LBFB 1PMHX 1UOJA 2X09A 1O3QA 2F17A 1I1GA 1U6GA 1DGWA 1MMAA 3CZJA 5FO9B 2ZX1A 2TCTA 2XPWA 1SD5A 3WU2C 3P9IA 1FPN1 1VIWB 3NARA 1SD7A 4BGDA 3KV9A 3CO6C 1D3YA 1BZWA 4LLOA 1WJAA 2J22A 1KQRA 4Q47A 3U4SA 3NW4A 3CJIA 1KYZA 2G9GA 3L2WA 3B01A 1U78A 3IB3A 4IJAA 5DAPA 4D6RA 5T5OA 3ZDSA 1ZBA2 2VQCA 4RB1A 2EA4A 3J7MA 3ONQA 4GH4A 1VQ6I 3QCWA 4CYCB 5EJ3A 3V64A 3K4BA 3LOIA 3OIPA 4CCNA 1N3QA 3KP4A 2KISA 3OYJA 1IZ3A 2BDRA 1TT5B 4M01A 5LCWL 4XFBA 2Q2EA 3UGFA 5FYUA 1DLCA 3NJYA 5BYNA 3ELKA 3VKOA 3MAJA 1R23A 2NS8A 4J25A 1W8FA 4PDWB 1ZZ7A 2HDWA 2FBHA 3JRCA 2JECA 3SEQA 4YZ4A 1AX0A 3ZSMA 3EXUA 2BOIA 1C4RA 2H6BA 5E3MA 2PHWA 2KIMA 5A6XA 1E2XA 4FXKB 4C1XA 4YIIA 2HH9A 1MZ5A 3GBWA 2E7QA 4GDFA 1ASJ2 5SV5A 1QHGA 5JIAA 4BQOA 3EQEA 4CPBD 4ZTJA 4IX7A 3U0ZA 2FDJA 2H0VA 2P8TA 1JU3A 3MUZ1 1VQPI 2FA5A 1FYKA 3HRTA 3HKZA 4RHV1 5C4WA 4U7BA 2J1SA 1C8M3 2JDHA 3GUDA 3Q9SA 3D3AA 1JW6A 2NOGA 2JKBA 4LJHA 1J1TA 1A6CA 1EPWA 4XBQA 4ZDOA 4FP3A 1KU3A 2PYTA 4IV3A 5LRSA 1UO9A 3OB8A 2JXAA 1QMJA 3BPXA 4AOCA 4NB5A 1FI2A 4C3JJ 5GPAA 3OGJA 2RV9A 2CWMA 5D6EA 4XKWA 3AG3H 4YW3A 4FISA 1OYIA 4QM8A 3MN2A 3AZYA 1JZ2A 1OKQA 2ZX4A 4U0WA 1CN1A 1MW7A 2WB1A 1QJY2 2X1EA 5FLJA 1SLTA 2VGDA 1QVUA 2CGPA 2ISZA 1U5TC 2F4LA 3THPA 4NIDA 2CQXA 4Y4YA 2FQPA 5F64A 2HVSA 3S3NA 1BKZA 1K79A 3CIHA 5EP9A 1FSHA 5FPVA 1LOGA 5LY1A 3DF8A 1XGSA 3I7DA 4YG3A 3OYBA 2R7VA 5FWEA 3HUGB 3NO8A 1MBHA 1JBCA 3DEWA 2JDKA 1LHNA 1XDUA 4WV8A 1N3PA 1WLCA 3ZXGA 2BY3A 3CUQC 3S16J 2N7GA 4BEHB 4AZZA 1KDKA 4LULA 3WP5A 4HNVA 4M0HA 3AXDA 3ZMSA 4NPMA 2E1OA 3HQRA 2JDPA 3ILNA 2A73B 1KXGA 4BMBA 3ABUA 5ISLA 2CG4A 2J1AA 1JTYA 3VYSB 5JIUA 4Q2FA 4BB3A 4I98B 2HKOA 3M7AA 2Y31A 2EIKH 4IERA 2ENRA 5FY7A 4CDGA 4W50A 4KIBA 1WW4A 3AP4A 1R1A3 1JZ5A 4AQ2A 4YRVA 1Q8VA 5EF6A 5CA6A 5IAXA 3W2WA 2DVBA 4D3WA 3O0VA 4S04A 2BY0A 2O8OA 2GMEA 4Q1PA 5K5OA 2W24A 5LWBA 2F5VA 1ZRCA 1DP7P 1ZZ6A 1X9PA 4QQ2A 3ZKUA 1GLNA 1I3HA 4YGBA 2BPA2 3I2KA 4YG2F 2BYVE 3QODA 1V70A 1IC8A 3BGAA 5HDKA 2O1QA 3LOBA 4R9BA 4IO9F 2XONA 5I93A 2EJRA 3CDLA 4OFGA 4YG6A 4JTOA 3R60A 4XQFA 1IG3A 4X8PA 1H8VA 3ZDVA 2K9QA 5EG0A 2E2JJ 4OHWA 4XOGA 1MNMC 1Y9GA 5HXMA 3H1CA 4RS8A 2W2IA 3FE5A 4YW6A 2ADUA 5HODA 2P81A 1XQNA 4LKDA 1OA2A 2ESHA 1AR71 3ZOIA 3OOXA 3WDYA 4JOMA 4YELA 3J7YJ 2B9VA 3Q3SA 3GZTB 4DUVA 3WCRA 3WF0A 3PVEA 4O9EA 4HF0A 2ZXIA 4K6BA 2W84A 3VBSB 3WG2A 3ACIA 1W0TA 2WT1A 2XAJA 2BOJA 2E7AA 2VPLA 3L2CA 2HTJA 4FI9A 4IV3B 4AQ6A 4WVZA 3SDBA 1GDTA 6PAXA 3WF3A 3FHIB 2WYSA 1YLFA 2RS53 3WDWA 2FMDA 1NY71 4HW0A 1GZWA 3NKTA 1POQA 5M5WJ 2WAAA 1DQ2A 3AMQA 3K2AA 5IHRA 1TQIA 4P9YA 2VE8A 3LFUA 2R042 4Y3OA 1SFOJ 2DYRH 2ZGQA 2JSPA 3ITQA 3ZFFC 2LRDA 1IXRC 1MMDA 4KL1A 2HQNA 2UXNA 1DP3A 4LLNA 5F1JA 3LZZA 1AR72 3M3YJ 2PN5A 3U1KA 4A69C 1GZWB 4LMYA 4GMP3 4NAOA 1HXDA 1DP0A 5GLZA 4UW5A 2QUOA 1S0DA 1OCZH 5GTIC 1CX1A 4XFAA 1RUH2 4Z82A 1FBUA 4BUPA 3NEUA 9ANTA 5E89A 3BTCA 3JR9A 1GBGA 1SLCA 3B6AA 3K9TA 2XSJC 1MEC1 2UWBA 4DZGA 5FPBA 1UY1A 2QLZA 3LEKA 2A69F 5FY4A 5D8LB 4XR6A 1ND2C 4DZJA 1OLME 1GNYA 5GPCA 1FNZA 4HFSA 3VHNA 1X50A 1H1IA 3OIOA 5FPZA 1PMJX 5A3LA 1NA1B 1RETA 1Z0HA 2GNBA 1OCCH 2WSUA 2B7YA 3MW2A 5IT6A 4COWA 2CGNA 5FPUA 5LZ6A 2LD5A 1ZLJA 1OOPC 2HVRA 2WQ4A 4L9NA 1UYZA 2ZHNA 1XB9A 5F3CA 2R7QA 5J1UA 1FEXA 3KP6A 4PIYA 4CPBA 3HR9A 4V19K 3GTMJ 4EQQA 2JG9C 3O12A 2IGMA 3PJQA 4LKEA 3ZQCA 2PA7A 2LR8A 2A5WA 2VVDA 3WTTC 3H9AA 1W05A 5F0HA 2HWC1 1F1ZA 1Q8QA 1OYYA 1XC5A 3N97A 1VE0A 3VKLA 2ZNZA 1YI2I 5C33A 4HK9A 4ITCA 3J8F1 4RGRA 3OYLA 3T2OA 4XETA 3MLKA 2L5QA 2Y0MA 5B5EC 4A3KJ 1FOWA 2X1CA 1HKDA 2W95A 4LKSA 1OQDA 3CDIA 3M1CA 5GJ6A 4Z2YA 2BBAA 4NBQA 3VBOA 3U07A 1TW3A 3B9CA 2YC2A 1WH7A 1E17A 4IEOA 2DTZA 4HRIA 3VBSC 1POV0 1WW5A 4I02A 4Q5OA 2VNGA 1W8OA 3OY8B 1QJX3 2X51A 1CAUA 5B4NA 1RXFA 2O14A 5KHGA 2Y30A 1CF7B 2L3DA 2J1VA 2VW2A 3RQ0A 2CFXA 2ARAA 4OUEA 3F95A 1AL22 4C30A 2QKLB 1UXZA 1VQKI 5FB2A 3I4NJ 2WO2A 3BTLA 4GYGA 2VJIA 2O9LA 2XUBA 1EUUA 1NA1C 3H3UA 2C5DA 5FYSA 3CBNA 2XPUA 4AFCA 3A03A 4IV1B 3OBRA 2P5LC 4D7TA 4RD7A 3K4NA 1O8SA 3ZSLA 4JQFA 2K4JA 3CQZJ 2XAGA 3FJSA 1BIAA 3DFGA 4U36A 2DA6A 3H1YA 3KVBA 4MADA 2CW7A 2VZOA 1G3YA 5D4RA 3U78A 1Y3TA 3IIIA 3I2GA 3COAC 4LG0B 5IW0A 2W1QA 2DQRA 4DBQA 1P4XA 5ICGA 2RM23 1W8TA 4ZDLA 5A7OA 3RNSA 2M30A 4CTEA 3UETA 4UOJA 1VNDA 1UY3A 3W20A 2PHLA 1DIWA 1CAVA 4XJAA 4HSLA 3T0AA 3F6OA 5CVUA 4HMZA 1XTAA 1SG3A 1VP6A 1M4WA 2VIXA 5JPNB 1RUD3 2Y69H 4K8RB 1EV7A 3LIHA 1BI1A 4CUCA 4DUXA 4OIQF 2EH3A 5CNAA 1JS9A 4M71A 3NV4A 4BXXJ 4RLFA 5LHGA 1FPQA 2AACA 1J2XA 3KT4A 4MEYF 3ZN0A 3BODA 2KDOA 5D5VB 2DV9A 3E1SA 1P4AA 4NC7A 4OI1A 3MFCA 3ZFEC 1ZG1A 5AVPA 1OLTA 3G4SI 1WCUA 2FZ2A 1A78A 5F9TA 5CU1A 2L9NA 2JKXA 1O4ZA 4XAAA 3F2ZA 3RSJA 1LKXA 1S72I 3INAA 2WNUC 2WZR3 3I64A 1W6MA 2Q1ZB 1LHVA 2KIQA 4AVVA 4LJZF 1HRI2 2LW8A 4TLGA 2NP0A 4PGHA 2KZGA 4BBSJ 3UL2A 1V5GA 5CVVA 4CDXA 1FP1D 5T5LA 3OSGA 3KV5A 3ZMNA 1IRZA 3UYJA 2ZXQA 2IPQX 2R0FA 5A7WA 2LF7A 1EYBA 3MCZA 2BBVA 5FBJA 1I5PA 4IE6A 1PK6A 1W8NA 5C3QA 1I27A 5BMZA 1YYVA 2UYBA 3EQLF 2BP6A 2A70A 2LMDA 5B2GB 3JD73 3RTRA 3F0CA 3GTLJ 1HQWA 2VJ5A 4PHZA 4L99A 2D97A 2M7AA 1COV1 2QQIA 4AI9A 4Q4X2 1EH7A 2W47A 1ND3B 5IOYA 3DCQA 3JQXA 5JXIA 2JIJA 4NPLA 3D0JA 4CZZA 1FIPA 4NHYA 3IWFA 1KQ0A 3BG7A 2VODA 2DA7A 3RPUD 1YO5C 2PHTA 1EAH3 3LA7A 3SHFA 2DMNA 1OF4A 4RHV2 3MKZA 1IUFA 1NE4A 4XRSA 1UZZA 4DMIA 4WXCA 5IYCJ 2PMHA 3ECQA 5A7SA 2BGPA 3U37A 3VBFB 5ICFA 3J81K 4YVWB 1Y0UA 3KP3A 3ZFGB 1L0OC 2VT3A 4DS0A 1ZZ8A 4DB5A 2LKXA 1R083 2RE9A 2VKVA 5FUPA 3KWVA 1JYCA 3LQCA 2MLGA 1MH4A 5M3MJ 1BBT3 3PHMA 4LFUA 1E5RA 3HQUA 2A6EF 1AR62 3ASNH 2CHHA 3A2KA 3RKWA 3AJYA 5E8GA 3I55I 1U8BA 4W4ZA 1UMQA 2N8GA 2OPWA 4P5HA 4RFRB 4XFIA 2XPVA 2VBPA 3L2YA 3MHZA 2IS2A 4DO0A 2DBBA 4BWOA 2MLKA 4UVAA 3WU1B 5FYTA 3P3PA 1Y39A 3ZYHA 4TSVA 3G6JB