2Q1ZB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
185
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RpoE, ECF SigE
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 36
structure length 185
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2q1zB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1zB02
5EFUA 4XETA 3H1MA 4QGMA 5BY5A 5CVRA 2ET7A 5I0SA 2D93A 1O7FA 4AVAA 5I8YA 5E16A 1IPJA 5FCCA 5JAXA 3HT1A 4HN1A 2OZ6A 1CAXB 2PTMA 4XFBA 4I09A 4XFAA 4XFHA 5T3NA 1J59A 3RPQA 4WVZA 3H8UA 3IWZA 2Q1ZB 3DV8A 4GULA 4BHPA 5LRSA 4Q0PA 4IETA 1NZCA 1ZNPA 1UW8A 2QCSB 1O5UA 1QXRA 2IXJA 4MX3A 5K8SA 2BNMA 3G7DA 4HZFA 3ELNA 1NE6A 2QNKA 4R8HA 3SCFA 3E6CC 1U12A 4I2OA 3I54A 4JVAA 2H0VA 3FWEA 3OF1A 4IEOA 4KWLA 2VQAA 1O3TA 1CAXA 1YFXA 3NJZA 1PMIA 3CL1A 2QJVA 3LWCA 2HJIA 1I5ZA 3EO6A 4KWJA 2IXIA 2XL9A 1O4TA 4MZUA 2BNOA 3SCGA 5F1RA 2K9ZA 4LTAA 2Z2SB 4TLFA 1ZRRA 1OFNA 3ACLA 4J1WA 3HT2A 2PAKA 4QMAA 1CAUB 3ES4A 4XF3A 4Z07A 3L2HA 3U11A 3FJSA 2D40A 4OFGA 3WW1A 4AXOA 3CJXA 2B5HA 3S7EA 1ZREA 2PAEA 4HVOA 4HSJA 4XEZA 3EJKA 2H6CA 3IDBB 3SCHA 1CAVB 2O1QA 4R52A 5I0RA 2IC1A 2XKOA 1PM7A 2UYBA 3CEWA 3BALA 1ZZ8A 4AVBA 2XLGA 3LA7A 4YYOA 3UKNA 3M3IA 1YFYA 1RUNA 3KCCA 4LUMA 3UKVA 4FAHA 4MH0E 3H50A 5CU1A 1YWKA 4IEZA 3CO2A 4K8FA 3NL1A 5HI0A 4P9GA 4Z82A 4N9HA 5I0TA 1FT9A 3OTFA 2GC1A 3ES1A 3FZ3A 3E6DA 1Q5OA 3I59B 4IEXA 2PAMA 3KMHA 3H7JA 4E2QA 3WW4A 3MPBA 2MPFA 5I8SA 1EP0A 3DL3A 3DN7A 3RNSA 4HSLA 1CAUA 4BYYA 1H1IA 3E97A 4ORFA 1ZRDA 2XLAA 2MNGA 1Q43A 3SHRA 1WLTA 1H1MA 1VJ2A 1ZVFA 3E6BA 2O8QA 1CAVA 5FPZA 1GQGA 1YLLA 5JSRA 4IEPA 2XL7A 2ZKLA 4IEUA 3I7DA 3GBFA 2GC3A 4PIYA 3NSTA 3ZDSA 1TQ5A 1J1LA 4O9GA 1YFWA 2GAUA 3EBRA 4NVPA 2Q0AA 1ZX5A 5KHKA 3PLQA 4KU7A 3PNAA 4XF9A 1CAWB 3D0SA 1SEFA 4HMZA 4KU8A 1XE7A 3FX3A 4XF1A 3I59A 1GQHA 1DGWA 5JR7B 4RD7A 1LR5A 4I3PA 1ZZ7A 4O9EA 4FBFA 1YFUA 1QWRA 2CV6A 1XE8A 5C6CA 3SMHA 3RYPA 3SXWA 1NE4A 5KHJA 4PIXA 2EAAA 3CLPA 2IXKA 2EA7A 3USSA 5EZWA 4F8AA 4D7TA 2PQQA 4FAGA 2Z69A 2DCTA 4ZU4A 4QM9A 3H1WA 3KGLA 3FHIB 2Q30A 3R6SA 2C0ZA 1FI2A 4META 3IIAA 4MGKE 2FQPA 3MZHA 2QVSB 2V09A 2WC2A 2Y0OA 2PA7A 5BXXA 1CAWA 2ATFA 3RZZA 5JSOA 1Y3TA 4EROA 4NQWB 3H3UA 2PYTA 5FDBA 1O3QA 3FE5A 1RUOA 1UD1A 4IEQA 5LRRA 3CF6E 1UCXA 4AVCA 4YSFA 4IEVA 4F7ZA 1EPZA 1VR3A 1DZRA 4MGYE 3LAGA 4MUVA 3BCWA 1SFNA 2KXLA 3VHRA 3MDPA 4ZU7A 4AQ6A 3GYDA 2UY9A 4L11A 1CGPA 1HW5A 2CAUA 2XLFA 1G6NA 1WA4A 3JZVA 3HQXA 2VPVA 1QXJA 1UPIA 1WGPA 2OA2A 2GZWA 1LRHA 4EV0A 2XHKA 3IBMA 1VP6A 2D5FA 2OYZA 5LEJA 3ST7A 2FMYA 1ZZCA 5FPXA 2ZCWA 5C8WA 4E2SA 1DZTA 1EY2A 4X6RB 1RL3A 3QACA 2D5HA 1J3PA 4I01A 4HVRA 3O14A 4IESA 3DKWA 3TNPB 2ETEA 1O3SA 2PHDA 3HIFA 3NW4A 2B9UA 3LA2A 4QM8A 4LLOA 4D7SA 4XFFA 5FLIA 4N9IA 3TNQA 2OPKA 1IPKA 1SQ4A 3WW2A 3KGZA 2VECA 3WW3A 4E2GA 1X82A 4MV2A 4YARA 1FXZA 4BIFA 1ZZ9A 1UIJA 1OMIA 1ZRFA 2WFPA 2B8MA 3D82A 4CYDA 2CGPA 3H7YA 1OD5A 4I02A 4B29A 3IDCB 3B02A 4DINB 2F4PA 4UXAA 1UIKA 2UYAA 3BU7A 5KHIA 2P17A 5JSPA 5J48A 3H9AA 1EYBA 5BUVA 4ONUA 2XKPA 3S7IA 2IXLA 4HLTA 3EQEA 2BEOA 4PIZA 2CAVA 4QGLA 5KHHA 3U0ZA 3E5XA 3LOIA 4KWKA 4Q29A 3UKTA 4LA3A 5E1RA 4MGZE 5I0UA 5FLHA 4A2UA 4OLLA 5JCTA 4Q0UA 5KHGA 2I45A 4Q0QA 1NYWA 4PJYA 5I8TA 3U10A 5J3UA 3ETQA 4JTNA 4IEWA 5KBFA 3MYXA 2K0GA 2H6BA 4J1XA 1CX4A 5CADA 3S0MA 3QOPA 3LA3A 5I91A 2HKXA 5BPXA 4BH9A 1L3JA 4UBGA 4HBNA 1ZZBA 4EWAA 2IXCA 5D1IA 4I0BA 1X8MA 4I0AA 4UBHA 5J7MA 2GC2A 2PHLA 2BGCA 2EVXA 4XF4A 4XFGA 3H3ZA 5FLJA 4Q0SA 3RYKA 1RGSA 1QY4A 3E5UA 3RDIA 1O3RA 2GC0A 3HUGB 1RTVA 5FQ0B 4EWDA 1I6XA 4JTOA 2ET1A 3D0JA 1YHFA 2GH2A 2Q4SA 4FT8A 2XGXA 1LB2A 3E5QA 1J58A 3C3VA 3M70A 1JUHA 4EWEA 1X7NA 4JV4A 4HVQA 4LULA 1YUDA 4LUKA 2QDRA 4YRDA 4IERA 4XFCA 1J3QA 2E9QA 3N4MA 4ZU5A 3RYRA 2MHFA 4LA2A 4X6QB 1Y9QA 4QXKA 5I93A 3H1YA 3OD0A 3BPZA 2PFWA 2IXHA 4AQ2A 2N7GA 4MGIE 1O5LA 2BYVE 1Q3EA 3KSCA 4KL1A 1NXMA 5FQ0A 4HN0A 1J3RA 1DGRA 3NVCA 3LZZA 3OGJA 1ZRCA 1X8EA 3BB6A 1LKNA 4WBBA 4H7LA 3FFQA 5AVPA 2GU9A 4XFIA 4XF0A 1ZZ6A 5LEKA 3EHKA 2BNNA 5BV6A 4IEYA 4L2NA 1V70A 1RC6A 3NKTA 4Q0VA 3ROUA 1OI6A 1XRUA 4WZCA 4YNIA 2UY8A 3PVBB 4QX5A 2OZJA 4QGNA 3OCPA 4LEJA
chains in the Genus database with same CATH superfamily
3C7JA 1ACCA 3RI8A 1PK6B 3BCBA 2DN0A 4CZCA 3OGRA 3IKVA 3I2OA 1BR2A 3FXMA 3S15J 4B1RA 1XB9A 3MCZA 5T3NA 3MFAA 4CP9A 1RXFA 2F4IA 4ZZDA 3BQZA 3U2RA 3BZCA 1FZPB 4B09A 3VD4A 4OI1A 5LRSA 1HCRA 4WM8B 5F37A 1O5UA 1X19A 3ZYFA 3NARA 2IXJA 3S1QJ 4RGRA 3AK0A 1W7PB 4HZFA 1GOHA 1TZOA 3ZYBA 3OPZA 4E8CA 5GLZA 4EYUA 4FPOB 4KITB 1QA6A 2DTYA 2A05A 1XDSA 2GWRA 1O4XA 3GNEA 3K75B 3PQKA 2C6SA 3D8CA 3WP3A 2GA2A 3HOVJ 4N43B 4K8RB 3CL1A 4LBMA 1AJOA 5EEHA 1L7LA 5A2QK 2R0FA 1I5ZA 3FM5A 1W6NA 3BOPA 3HNBM 3ZN5A 3RG0A 2BBVA 3ILNA 5AIPA 4XXAA 4ES9A 2WZR1 3J9SA 4EN6B 3L2CA 3ACLA 3AFKA 2DCEA 3I49A 4Q5OA 4Z2AA 3WGIA 3PO2J 1IDYA 3WINE 3AMPA 3WHUA 5B66C 4HX8A 3SH4A 2VZQA 3L2HA 3U11A 4ZYGA 4L5IA 5IK8A 4BXFA 3W21A 1UCRA 2ZXWH 1TNRA 2IC1A 2JKXA 1A6IA 3OBAA 1JZ3A 1W6QA 1OCZH 2V6EA 1S0FA 1FOKA 5FYBA 4II2A 2HYXA 5B4NA 2HQNA 4HF2A 1W6OA 1ZBA2 2XH6A 2VGDA 1R1TA 2WZR3 1WBLA 1JTYA 4A6DA 5IK5A 5CKTA 3ZR8X 3O1TA 1BI1A 2BXZA 4AVVA 2R93J 2PAMA 2HEYF 1U0AA 1VRH2 2MPFA 3MPBA 3DL3A 4N0BA 2Y0MA 2PQSA 1MVEA 1XPWA 2W48A 4CUGA 5JVTA 1HJGA 5ACA1 5A32B 1WMXA 2OTJI 1YHQI 5FKLA 1XN7A 5FTTC 4Q4X1 1A31A 3JAMZ 2FBIA 1RETA 2A7AA 1WSUA 3POGA 4EN8B 1REDA 5J1UA 5JUVA 2D6OX 5CEHA 3NSTA 4LKFA 1COV2 4LBLA 5IVYA 3QU6A 4HSRA 3TP0A 5LA1A 1B9MA 1W6NB 5FO5A 3KWVA 2YMZA 3HD8B 4QKFA 4DY5A 1A5JA 2P7VB 3ML6A 4CZZA 4CA0A 5ACA3 3BG5A 1I50J 3AKPA 3FUOA 3T2PA 1SZBA 2A5ZA 5DUXA 3OGGA 4R9BA 4Q4X3 1XC6A 4PIXA 5JLVA 2RV9A 1SDDB 2EIEA 5DV5A 5A3OA 4DGWB 3C2BA 2CUJA 4PCQA 1VBD1 2COBA 4RS5B 5M0TA 2YPRA 1UOJA 1ENRA 2KMUA 2E60A 2W24A 3R6SA 4XIOA 2P3JA 1TVGA 4CDUA 3IIAA 3ZQHA 5HS8A 3MZHA 2V09A 3EYYA 1F4AA 1XTAA 5F3CA 5F6LB 4FTSA 5BXXA 3LF7A 1JODA 3VGIA 4NQWB 3ZIWA 4H55A 4BCUA 5IAXA 1UD1A 1U78A 2VZVA 5F2SA 2A61A 2XSJC 5L7OC 1I3HA 2BVVA 3ONQA 2P6CA 1TW3A 3B7MA 5CNAA 2HXIA 2JX9A 1VBD3 1W9TA 3VYTB 2NMOA 5L7OA 3WF0A 2FZ1A 1QJX2 3K4ZA 2FZ2A 4Z1VA 2CUFA 3M3EA 4OHZA 5FZOA 3JRBA 3FXRA 4E2SA 2V1UA 2ZAHA 1RL3A 1ZQ3P 1WWXA 2LR8A 2TRTA 3GHNA 4O61A 3EETA 3BQYA 3NNFA 1J2XA 1Z1DA 5LZ6A 1AX0A 1XG1A 5E1WA 1V5EA 2EFQA 1W8NA 5CLSA 5FP9A 3PUHA 4CU7A 1X82A 2LKSA 3QYFA 4GKXA 4FSJA 3JB4C 1RUD1 2D6NA 2ZS6B 4YM1A 4DINB 5EWSA 4ZYEA 4FCAA 1UIKA 2B7EA 3RKYA 4RM2A 2C9AA 4XBNA 4PCRA 2DFBA 4B4CA 1MS9A 2Z5WA 4TN7A 1ULPA 3NQHA 2V7FA 5FZ8A 3U0ZA 4M6YA 2IA1A 3LOIA 1R36A 1Z3XA 4Q29A 3UKTA 2WV1A 5EGOB 3M1CA 5A70A 5F5CA 4DUWA 2OD5A 4DRVA 2DXIA 3KD4A 2FQ4A 2L9VA 1LJ9A 4Q8LA 3IRQA 1VLNA 2VC9A 4Y1UA 1RUD3 5CADA 5IFPA 3GX4X 5F5QA 1EV12 2KRCA 1ZZBA 1G9AA 5LBEA 5C9AA 3A23A 1BI2A 3S8PA 2D6LX 4MVTA 4XF4A 1MGTA 3KYDB 4CO8A 2W91A 3H5NA 2Z1DA 4NIGA 4XQFA 1SDWA 1RTVA 4J6GA 3DXTA 1QHDA 4NIDA 3RJ2X 2DVDA 2PLV2 4BLIA 1Z7UA 2Y6FA 3T30A 4ASLA 3H0GJ 3OYKA 4C3JJ 2KKOA 1R49A 3B73A 3DEWA 4YG3A 5CQEA 4G6DA 1D3YA 1AKHA 5DTDA 2VOOA 3OYWB 4M3DA 2D45A 3TDUC 3C7HA 2WAQA 1UZCA 1ZG5A 1JYWA 1ETKA 2QSGX 1ASJ1 3ZSJA 5CG8A 4LD5A 3FBYA 4B3AA 5KHDA 5GLUA 3LZZA 4QX2A 5K4LA 4HKWA 1RUH1 1SFEA 1VB2A 3TP3A 5C4XJ 1USSA 3K69A 1BIAA 5GZGA 1KITA 4B8EA 1QNTA 2V1DA 3AM2A 2M34A 2OV7A 2ZBJA 1RUI2 5EFUA 5LK5A 5CYVA 4IVNA 1W9SA 4A3KJ 4CP1A 1IV8A 4N7UA 4XZPA 1OLQA 5HDNA 3JRGA 4RS8A 4KBBA 5E16A 1ASJ3 1D4VB 3RKXA 2WO7A 3W6VA 4LHNA 4D69A 5KXCA 1QJZA 5FKKA 4B3XA 4LT5A 4QX3A 3GHMA 1RUH3 4V2VA 4FPEA 3K4CA 5KC5A 1GZ9A 1GHCA 3K77A 5BNPC 4W50A 4BHPA 3WOGA 2BZTA 1MJBA 2JEMA 2VTXJ 2OUHA 3ISPA 1PO22 4MX3A 1QZYA 2GDFA 4IHVA 1W5SA 2X85A 3IDEA 5EQUA 4IF4A 4G4FA 4YW5A 3HG9A 4AI8A 5FY5A 1DP7P 4LJZF 1K6OA 5E3OA 5IYYA 4FETA 3L00A 1BBYA 2H94A 4L5EA 1DLCA 2ADUA 3I55I 2K40A 2FSWA 1ZA4A 2IXIA 3OYGA 1F15A 2K9ZA 4LTAA 4DXRA 5CQGA 2F5VA 4GQ7A 4BQYA 1A34A 5FZ6A 3T3YA 3DWLE 4XJ9A 2VB6A 4AQTA 2ICWG 1ETWA 4GXOA 4ZZ5A 1FSEA 2I10A 1Z9CA 4XCBA 1NG6A 4RB2C 1YFYA 4DMIA 3OG2A 2DUQA 4LNVA 3VZMA 1SD5A 1YQ6A 3K4MA 1VAMA 2DLLA 4P5YA 3WF4A 1GT0C 1WJFA 4QQ2A 3VBSA 4FHTA 3LFIA 4UVCA 3FUQA 4RQPC 1O4YA 2G1MA 5FUPA 5F27A 3MD2A 1QGLA 1W9FA 4LLLA 3WU1B 2YDEA 5EXOA 5I8SA 2DOFA 4HSLA 1N1YA 2WS91 4PSXA 4ORFA 3AFGA 1Y0UA 1TEIA 1WCMJ 1HB4A 2LYCA 4EN9B 5BNPB 4RBOA 5C3EJ 4MTDA 1HW1A 4RQPA 5FMOS 1JZ6A 4ZS2A 2XWBB 1GQGA 3AG4H 5F5AA 2P81A 1SMTA 5F1JA 1H6YA 4O9GA 1YFWA 5HLIA 1OPCA 3BT9A 3H3LA 2VI6A 1ETQA 2VNOA 3LSJA 2F48A 4J00A 4FPFA 1VQLI 2ID3A 2YC4A 4RB0A 2A5YB 4NUBA 2WS93 3SDGA 2QVOA 4U7DA 3LEMA 3USSA 1CONA 1WJEA 3ZOBA 1U5ZA 2PQQA 3GTPJ 1JYNA 4FAGA 1PVXA 4AQSA 2JWPA 1OCOH 4Y26A 5HODA 2FQPA 4MTEA 2QDNA 4LE4A 1FYMA 5FV3A 5LY1A 4DYRA 4BGDA 2IA2A 1RUOA 3B01A 5BNNC 4IEQA 3CF6E 4GGGA 3LQQA 3VYRB 2KXLA 2P3KA 3MDPA 2DA2A 2UY9A 4L11A 2ZACA 3QH6A 5BNNA 1R5GA 3M1HA 3TDZC 5FZ3A 4XLAA 5EZHA 1E0EA 3DF8A 4RAYA 1S72I 3MIDA 4EV0A 1N25A 1S7OA 5DUVA 1HQWA 5F9TA 2QCOA 3ST7A 5FPXA 2ZCWA 4HETA 3SQOA 1KZHA 1RJ7A 1GV5A 1RHI2 3QACA 3C7EA 1J3PA 5A6ZA 1TL8A 4PDWC 2VOXA 3ATGA 4KG0A 3OEBA 5FZ7A 2ZBKA 4QM8A 1IV6A 2DA1A 3OY8B 1X58A 2EFPA 5J47A 3GJAA 3TYJA 3WW3A 4ZXKA 3WHTA 2XVKA 4NNJA 2JUGA 5IVEA 4XRFA 4DZJA 4I02A 2M0MA 4PI0A 3B02A 2DUOA 3ZYJB 5GZEA 4AR2A 1O8PA 3ZMDA 2MH2A 5CKNA 5JSPA 4M74A 5EV7A 5FYTA 1Z7LA 4HPKA 4LK7A 3O5SA 2EIMH 2W95A 3MO4A 2ID4A 2ZB9A 4LBKA 3WG2A 3EPZA 3OUJA 4ET7A 5KVRA 1R091 3AX4A 5J3LA 2GXGA 1C57A 1OKRA 4Q0QA 3HM5A 1WKMA 5FZAA 3F21A 2MSYA 5F39A 3VDXA 3SLIA 4KGGA 3SNMA 4HBNA 4ZH4F 2ZABA 4LGWA 1K6YA 3RCOA 2W87A 5J7MA 2P4WA 4MHRA 2GC2A 2WNUC 4TXWA 3IV5A 1GNHA 5FLJA 1JZ5A 4PDKA 4GCVA 5BNOA 2ID6A 4YVSB 2E1NA 2QQNA 2LOOA 1R093 4HG6B 3WDUA 1AU7A 3CCMI 2X1CA 1JUPA 2WNUA 4G12A 3C2UA 1LB2A 3H8OA 4GKYA 4RB3C 4PDWB 2HWVA 2XGCA 1DUXC 2VOTA 3DKXA 1GQPA 1JKQC 3HNMA 5L3CA 3JTHA 1E2XA 1H9GA 2FHRA 1NT0A 2M0CA 4YRDA 5E8GA 3DFGA 1LDDA 3N4MA 1MD0A 4V19K 3NWSA 1AYM2 2LW8A 1NQDA 4G7HF 4I0WB 3UNGC 4XZUG 2VW0A 5SV8A 3H42B 1F35A 4KL1A 2QQWA 4PT6A 3AB0A 3WD5A 1NXMA 3KZIC 1ZR4A 4IHTA 3KP5A 3T08A 1QJU1 2QQIA 3L2RA 4OULA 3A0KA 1WLDA 5FBZA 4XF0A 4OMCA 3IAQA 2B45X 5TGTA 4EGZA 3WG1A 4Q0VA 4LG0A 5E17F 3WY6A 2KRFA 1D4M1 2ME6A 3THTA 3QD6A 2VN2A 1MMSA 4XRSG 4QGMA 3ECQA 3GF2A 5I8YA 3AG3H 5HXMA 1CAXB 2PTMA 2HDDA 1XYOA 3HNYM 1QJU3 1WI9A 5ICEA 4LQRA 4UW4A 4A6EA 4ZPIA 1IN4A 3VODA 3TGNA 1E57A 2E53A 5A2QZ 2QQKA 1O8SA 1ND3B 1WHUA 2JK3A 3M8FA 2RS51 3RI9A 2FD5A 3MLLA 2VCBA 1D4M3 1Z7S1 2LUWA 4LOTA 3JTGA 5CPRB 2VNRA 3E6CC 3QYEA 3O6BB 4LB5A 2EFNA 1X9TA 2FCVA 3HVDA 4UFMA 3BTZA 4KWLA 2XR4A 3SQNA 4AF9A 2W68A 4D6RA 4R9CA 2HJIA 4IOAF 3M3QA 1TE1B 4QDSA 4QPYA 2F4MB 2RS53 1OH3A 3TO6A 2W25A 1QQP1 2PELA 1Z7S3 1QPMA 4F52A 4LG0B 5K7PA 3D4KA 4XTMA 3O0XA 4KDPA 3WW1A 2DMNA 1IXRC 4AIHA 4XEZA 3FM3A 3ELKA 2O1QA 1J09A 1AYN1 3BOWA 3H35A 3VKNA 4QHOA 5KXBA 3LA7A 1W0NA 5A80A 2VBPA 1E17A 4FAHA 1W03A 2VJ5A 4FTBA 1Q8QA 1UYZA 3PIOF 1GKBA 1VMHA 2GC1A 4YGCA 2HOSA 2CV2A 2WLQA 3FXKA 1K45A 2ZGTA 1UNBA 3UYJA 5JR2A 3WW4A 2BV4A 2YZ4A 4QKBA 1GUIA 2WUHA 2KJBA 5JVGF 3SEEA 5IP7J 1RUG2 4C9YA 2Z4FA 1VJ2A 1AYN3 1PX4A 1E5HA 2NS8A 4EJUA 4XJZA 4CUBA 4QDQA 5FPZA 3W6KB 2QQOA 3UKGA 4CDWA 4K2EA 2XL7A 3ERMA 1ETVA 2YUSA 2HTJA 1QU0A 1HXS1 2J1RA 4HLYA 2QQUA 2R5YA 5DZGA 5IVBA 3E7LA 1I5PA 2WYFA 5ICGA 2W94A 4CPBA 3L1PA 3I4PA 3S93A 1W8OA 2G9GA 4RD7A 4BNCA 3VBOA 2VCMA 5FP7A 4PZJA 5FYHA 3BTCA 1EPWA 1BQPA 4Y20A 4F8AA 4XE9A 4D7TA 5ERLA 3U4XA 2OKXA 4Q4V1 1X3UA 1DQ5A 3CCSI 2C0ZA 4META 2QBYB 3NMBA 3INAA 4G9SB 1E5RA 3BCAA 4XTPA 4XYXA 1OPMA 3URFA 4XLHA 2XJVA 2GNMA 3KZZA 1JZ8A 1G3YA 1MS0A 3CBNA 3H3UA 2VL4A 2W1QA 5FDBA 2IFWA 1EJ9A 2MA3A 3ABTA 1JHNA 1RVF1 3T0BA 5G05L 2F5DA 1WJCA 3WTYC 1ZGWA 1S7EA 4A5MA 3BCWA 1SFNA 1WVRA 3RZJA 1TNTA 4ZU7A 5K5RA 2Y0IA 3ABMH 4M3FA 2HH9A 5GPAA 5LFAA 4DEVA 2ZJPF 4DNYA 1K78B 3K1NA 1OCCH 1O91A 5HDGA 1UPIA 2NN8A 2XDVA 1UPSA 1UY3A 3CJTB 1F5JA 2XHKA 4XLNF 1MJAA 4XONA 5FREA 1Y56A 4BE1A 4MEXF 2MBFA 1PGW2 3K4JA 2Q8DA 2ZHMA 4X6RB 1J9IA 3C7GA 1SMYF 1OQDA 2WNOA 1RVF3 1V9U1 3U75A 2ZGQA 1UMHA 3HJEA 4NO4A 1C28A 2B9UA 1OQYA 3C7FA 1W2OA 4LOCA 2WWYA 1YYNA 1JT6A 1SQ4A 3IH2A 5LHGA 2HPMA 2ES3A 3OYFA 5FD5A 4YFKF 2L7MP 1FXZA 2JA2A 2PN6A 2EALA 4BIFA 4XLEA 2KIQA 1G9DA 1YC61 1I6HJ 3RZMA 1FOYA 2ZAAA 5IY5H 2D1VA 4CUCA 4YWAA 2LLKA 4BL0B 3AAFA 5BUVA 2P6HA 4LKSA 4XMYA 4RLQA 3HOYJ 3K4LA 3G4SI 4O6JA 3UJQA 3DTKA 3EUAA 1JUSA 3ITQA 1MBJA 2UV1A 2XASA 4CDGA 2R062 2XUBA 2R042 2ETHA 5H9QA 1HF0A 4UUSB 1RUC1 1J5YA 2WV0A 4PJYA 1BI3A 1S0GA 4A3JJ 3OWTA 3MYXA 3FXJA 3CF2A 2F5EA 4BLJA 2L7KA 4UBGA 5D1IA 4I0BA 3PMSA 3VYSB 2W85A 2P5KA 1LDJA 3PJYA 1FSHA 2CG4A 2E63A 4WVVA 3K10A 4L9JA 2WTEA 1RGSA 4QQOA 2XPUA 2QQJA 1X50A 4AAXA 3CLOA 1RUC3 3GLLA 1NOVA 2XB0X 5EZGA 4GJZA 4YFWA 1VQNI 2GH2A 3TEZA 3PUBA 5FKBA 4OU0A 4LBNA 4XDOA 1MNDA 4ENKA 4CP2A 4G6QA 1PYVA 4XJUA 4C3HJ 2ELHA 5EJZB 2L9SA 5IK4A 1YJNI 4ZYAA 4C1WA 3CDLA 2RQPA 3CC2I 4YFNF 1XBFA 2KD7A 1RKWA 1Q3EA 5B5EC 2WBMA 2X09A 2QUOA 3HQUA 1D8JA 3CO6C 2DA7A 4IGOA 1JYTA 3S1RJ 3AKTA 5EHDA 1AJKA 2X48A 1CVNA 4Y13A 3H9GA 2XQXA 2XAJA 2ISYA 2BNNA 4FISA 4C2MJ 5A7NA 3VHNA 3ROUA 4G3YC 1BOBA 4GA9A 1YRNB 2DF7A 4L9BA 3J8F1 4S2GA 2AEZA 2KR2A 1ULOA 4B7KA 4A3CJ 4IE5A 4YGEA 5JXIA 3BKZA 3AVSA 5A6XA 4AHZA 1BCXA 1T6BX 2RDSA 4HN1A 5F32A 3M9AA 3OY9A 1SMVA 4IV1B 2JN6A 3FMRA 2W46A 4B43A 1YJLA 3E3VA 2DYCA 1RUE1 3C2HA 3RQ4A 4A6OA 1UW8A 4RM3A 3L9FA 1UY1A 4BM8A 1QZZA 3REOA 1JGGA 1R4NB 1SLCA 2XC7A 1A3KA 3FL7A 2GMPA 2Q5TA 4I2OA 4QWNA 1RXGA 4JZRA 1H89C 3D5RC 2Y38A 4FVVA 1LAJA 5KWRA 1VB4A 2JPCA 1PGSA 3RGBA 1CZVA 2HS5A 3PVEA 4GXLA 1RR8C 1CF7A 1RUE3 3GW2A 4CU6A 3QH7A 1XB4A 1O4TA 3ESWB 4XK4A 2LRPA 2WT1A 4GMP0 4Y22A 2PHXA 2CMPA 3IWFA 3J7HA 2DCJA 1GOGA 4Q4W1 3PNYA 2Y0SA 3LE0A 3JREA 3IMNA 1ZAOA 5IOYA 2UYBA 4LBQA 3ZFFC 4F91B 1RUNA 1LHOA 2MABA 2ZMLA 2FJ1A 1YO5C 3GCXA 4A7ZA 4QB2A 4COVA 4CH7A 3JR9A 4P9GA 4MADA 1WCKA 1T6GC 2VJJA 1R1A3 3QRFF 3ZFFA 3OYMA 5A3TA 4JHTA 5CB7A 4HF0A 5F08A 3MAJA 5JDBA 1RMU1 5DS9A 2JJ6A 1AR62 4Q4W3 4AZZA 3J26N 2GH8A 1FMVA 1SBEA 3MLJA 2VKHA 4JQFA 4RGGA 4OI4A 2LREA 2NZ9A 1UZVA 4IEUA 2O03A 1X9PA 3VDDB 1GZTA 1MS4A 3NRUA 4ARYA 2XIGA 2JD9A 4KU7A 2P5LC 2PHTA 3D0SA 2KRHA 1V5GA 1S0CA 3I59A 1XMXA 4XJAA 1RMU3 5EG0A 3S1MJ 2HWF1 5T54A 1X3ZB 1ZZ7A 3OYIA 2CTVA 4NAOA 2EZHA 1SBFA 4YEJA 3SFIA 2JDHA 4A3IJ 3UESA 4QX8A 4ITCA 5ACA2 2LY9A 1GWKA 2QKDA 5CJ9A 3CJQB 5EZWA 3CCEI 5T5OA 1OVPA 5HCFA 4DB5A 2IS2A 2HI3A 3ZFGC 2VE9A 1YI9A 2NS7A 4S2HA 1P9QC 2RNJA 4D94A 1D5YA 1Y1WJ 3RZZA 2HWF3 3Q9VA 5JSOA 3O1VA 4E7IA 1IHMA 2VMFA 3ZFGA 5C7GA 4F7ZA 1AF9A 2KIUA 2WO1A 4ZZLA 1HLVA 3W9AA 3GYDA 4KIGA 2CAUA 4JDOA 3FKJA 2QZ8A 3ZYRA 3KEOA 3A4CA 3HSFA 2WABA 3UGFA 4ESBA 1VBD2 3LFMA 4OVEA 4GMP3 2OYZA 4RAZA 4BQ4A 2KISA 4EQQA 4D5FA 4QKNA 4JX4A 4P9YA 2LNBA 1LTEA 1VE0A 4A3DJ 1BA5A 5LHIA 4BJ5C 3HL2A 4XHXA 4QPGA 2DOEA 3IPVA 4UNOA 3S30A 2HVRA 4OI0A 4I6ZA 3HOWJ 4FE7A 4XNFA 5IAVA 2FMLA 5FAXA 2ARBA 2XF6A 2M3AA 3BZKA 2K9QA 5B3SH 2VVDA 5BPDA 2Y64A 2D44A 3H8XA 2A3SA 2CHHA 3WNXA 2NYYA 1H2LA 1FP1D 2D3RA 3MWMA 1LJ7A 4OUSA 3WNLA 2E1CA 3CZJA 2ZNZA 3SHFA 1OURA 4QU1A 4FOWA 5FROA 3J7LA 3I2FA 1TTYA 2VM9A 2X29A 1FBSA 2I45A 1NYWA 3W2AA 3KV5A 5I8TA 3U10A 2LF7A 1JUIA 1UKRA 4PJMA 5A1FA 1HDPA 2HKXA 3LAPA 3I5UA 1RUD2 2XHNA 1RUF1 3OSDA 3ZXAC 4UBHA 2E1MB 2FCTA 5KXDA 1CJPA 4R9AA 4Q0SA 4B44A 2XRLA 3OSGA 5FMOL 1P92A 3T4HB 5D8AC 3FFZA 2WA0A 1DDNA 3ZSMA 1I6XA 1GWMA 3ACGA 3D0JA 4HDUA 4FT8A 3MPPG 2XGXA 1EH6A 2WIIB 3AZXA 5D8AA 2VMIA 4IHWA 5L3DA 1ULGA 4FQ4A 1RUF3 3HQRA 2HYGD 3ZMUA 5A1AA 1MSEC 2AQFA 2OT7A 1DP0A 2H1KA 4KJZA 3S3MA 1SLIA 1YOVB 4HAMA 1DIWA 4HF1A 1ZM1A 4YZ5A 2CH0A 1F5TA 2IBDA 2MEV1 2QQLA 4QX7A 2TUNA 1HIXA 1IRZA 3EDPA 2ZGLA 1APNA 4KH9A 1DPUA 3MFKA 3Q8EA 4UHTA 4NWWA 1IS6A 1VRBA 2VAUA 1H0BA 4ON0A 1MNEA 2GQQA 4E7LA 1FMD1 4LMFA 1FMWA 1LEMA 1X4OA 3WGGA 1XX5A 1E3PA 3ZN1A 3NKTA 2J1EA 5J6XA 3OJBA 4Y4YA 5LW9A 3K4AA 1K5JA 4RFT0 3BTXA 1BL0A 3H1MA 1W28A 5B1BH 3RZGA 5AFBA 1OA4A 1WJBA 4XKBA 2D1HA 4FXGB 4JGYC 4CDQC 5IT3A 4U87A 2D6MA 3RPQA 3CHXA 3ME2A 2CO5A 2DFFA 2ECCA 2D3SA 3RIRA 1RUH2 5FPBA 5CAZA 4JGYA 2DK5A 3ZMOA 3SEPA 4CDQA 1ZLJA 2SLIA 1DLLA 3CNAA 2JDNA 3P3PA 1FWZA 1QHHD 3F3XA 5LBFA 2FDKA 5DCMB 3LNQA 2V5YA 2EAKA 4XBLA 2Z99A 2AR6A 1FAYA 2RR12 1AL21 3G6JB 4NRQA 2E6VA 2KDZA 1KU7A 4A44A 2IP2A 2X0LA 3G73A 3VBHB 2VXRA 3OBZA 1PZ9A 2CW7A 1UFMA 1GXPA 4Q5SF 4AI1A 4JCKA 3J81K 1SCRA 2JA6J 3SCGA 5FZLA 4UFLA 5FZDA 2PAKA 1CAUB 1K5MB 3OMYA 3ILRA 4XW3A 1OYWA 3GUDA 4L8QA 2NRAC 3GWZA 1W06A 1FJLA 4HSJA 4ITVA 3I2JA 4FFIA 4R52A 5EJCA 3K4DA 5M5WJ 5FOJB 2L7ZA 3VBFA 3M3IA 3H8RA 3KP3A 2F17A 3S3OA 1YWKA 2RDQA 1EV7A 1SLTA 3ILFA 3AKZA 2OUMA 4FCYA 1FX5A 2C4XA 3CCUI 4JOMA 2FDHA 3RPUD 4XUTA 1A8MA 3AXDA 1FOD2 5DAXA 3FZ3A 3E6DA 1U9OA 2WA4A 3H9JA 1GDTA 2OZUA 5H20A 1B09A 4XDQA 1PVC2 2L4AA 1S3JA 4M73A 1SPPB 4RA2A 2DFHA 2VR4A 3OYEA 4CXXA 1XGSA 1PMJX 4S0HB 3AZVA 2ZKLA 3VZNA 4ZXEA 2XSDC 2MD5A 1W2UA 1XU2A 3JRFA 2YU9J 1OFSA 2Q0AA 1DQ1A 1JZ7A 2R7EB 2FRHA 1BBT1 1QJY1 1GICA 3U1DA 4M3CE 2O14A 4AW7A 1ETYA 2BW3A 1W5TA 1V5FA 3HBLA 1F4HA 3CCQI 1ENQA 2IT0A 4B3NA 5IYDJ 5FMBA 2R071 3CP2A 2PG4A 1QVTA 1M1EB 3RFRA 3CC7I 2HYKA 1H8TB 4WVMA 2AUYA 3KIOA 2XJRA 5EJ1B 4EROA 4AWDA 1LVKA 4P5OA 5CKQA 3MFCA 2VMDA 3RJRA 1ULYA 5LB6A 4BJ6C 3DGTA 1DZRA 1D8KA 1ZR2A 2R073 3M7AA 2EZKA 1YQCA 4IL6C 2RVAA 2HFHA 4R9DA 5LY2A 4FX4A 1F36A 2ZMEB 1S4CA 1SEUA 5L36A 1PHMA 1POGA 5CBLA 2GZWA 1QXPA 3R60A 1MMNA 1W05A 2QZ2A 1FNNA 4LHLA 1HKQA 2HWC3 1W8FA 2VTFA 1Q8PA 4FPHA 1DGLA 3MIFA 4HK8A 1O3SA 4QSHA 1SFYA 1LDKB 2Q8CA 2XF7A 3H3VK 2JPBA 3PTYA 2XV4S 1QOOA 1W9YA 3POSA 2CNAA 2B8MA 4PBOA 2BY1A 3WNMA 1NCQB 1XGMA 1FY7A 4C0BA 1DPRA 2QE3A 3LB9A 2WA3A 5GADJ 4OMYA 2HEOA 2DFCA 5H9SA 4HLTA 5EDNA 4AGGA 2EB7A 5KHHA 1W8WA 3CKHA 3BC8A 3LPGA 3ZN0A 3R4UA 1F9KA 4ETSA 2DJIA 1KGSA 2Y8KA 3NQOA 2DMTA 4AOCA 5E18F 2YFZA 1R1VA 4Z2WA 5DQ0A 5J3UA 5FRMA 2HDWA 2VL8A 3UETA 3TRSB 5FJKA 4B4RA 2B0LA 3QOPA 3LOBA 3O7OA 1GANA 3BPVA 1G59A 5A3LA 3O1PA 2CQQA 2XAHA 5T50A 2YU1A 3ZP5A 3F72A 1YQ8A 3VKFC 3S5QA 2K7LA 3IAS2 2RS11 4AUXA 4A3EJ 2VZTA 2XJPA 3HUGB 1HLCA 5IOZA 4XILA 2NM1A 1I3AA 2VJXA 3CJIC 3WU0A 2Y6HA 2XAQA 2LP0A 1OCRH 4ZTJA 5FZIA 4JV4A 2ZGKA 3FXUA 4SLIA 2NQYA 5DD8A 3DKYA 4XSXF 3CJIA 3H0DA 4GWMA 2HQ5A 2J5OA 1GBGA 4CCCA 3H1YA 4BUPA 1JUMA 1L7QA 4NHXA 1GV9A 3ZOIA 5KC6A 3QOEA 1R64A 2LBFB 4UF0A 3HOUJ 4LXLA 4JK1X 1X8EA 1GV2A 4EGYA 4DXSA 4WBBA 4C30A 3NJYA 3FFQA 3IHUA 3PMEA 5GLVA 3L09A 2XONA 2ELJA 5A7OA 1U3EM 1D0ZA 4AGRA 3KVBA 2R7XA 1V6LA 3VZLA 3M3YJ 2W39A 1MMAA 3OCPA 1JZ2A 2DT6A 3X29B 3WDXA 2YU3A 2UUZA 4WXDA 1X1BA 3JSPA 2RQQA 3H5RA 1UMIA 1TT0A 3T1MA 5GLWA 1V54H 4BJ0A 3K2AA 4RGAA 1H1AA 2ZX0A 5JMCA 1QJU2 4B8XA 3IZOA 5E8IA 4OIQF 1IG3A 4UFJA 3ZXFA 3DU6A 4L0ZB 1QNWA 4JGZA 1HSJA 3SCFA 4I98B 4P1WA 1U12A 1CX1A 4A12A 5F2WA 3AL0C 4E6KG 3ZPYA 4IE6A 3J7NA 5FUNA 3OF1A 4XQWA 1W04A 3KLNA 1VQ9I 4B4PA 2YU2A 1GVDA 3K70D 3S17J 4PK4A 1YITI 2IFRA 5A7QA 3VDCA 2P5VA 1SG3A 2JUCA 1RJ8A 2P2KA 4H14A 2C5DA 4YELA 5C3SA 2KPMA 1ULEA 1TW2A 4QMAA 3QPTA 2W1UA 3HOBA 4XF3A 5FY4A 1WI3A 2RREA 2DTZA 4OFGA 3U4SA 3A1YA 1Z78A 4Q4Y1 3GFIA 1QH7A 4JDMA 4RA0A 3ABZA 2W52A 4Q1PA 1HC8A 2XKOA 1LPQA 3ABLH 2A3WA 4BZ4A 2R30A 4IQ4A 3BY6A 3PVNA 4MFEA 3AL6A 4AEJA 3J80Z 3OS2A 3B3QE 1FPN3 2X9DA 1IN5A 5I0TA 1NK3P 3GEZA 1Q5OA 3PVOA 1JHFA 5EEGA 1ZRDA 1S0JA 4Q4Y3 3N36A 1S8NA 1OF3A 4K1YA 4E7JA 1Q43A 1OLTA 4EQVA 3AKRA 2GP3A 4BB3A 2UWCA 3GZNB 2JG8A 4QX0A 4E7SA 3ZKYA 1U5IA 4UAPA 2E1OA 3WNPA 2GAUA 4NVPA 1ZX5A 3PLQA 4G94A 4CICA 4LHSA 2VONA 1QDCA 1XE7A 2J1AA 2Y69H 1BEV2 5FYZA 4ARXA 2A6VA 3I53A 1S0IA 3ABUA 1D0GA 5ICCA 1OYIA 4O65A 5E1XA 4JX0A 4GFBA 3WTXC 3DF0A 2BHZA 2IJLA 1LOBA 2KL4A 1JOBA 1Y8QB 4GO1A 4COUA 2ZGOA 1SFXA 4ATEA 1MVQA 1B4AA 2OQRA 2OPWA 1XU1A 2QF7A 3M3CA 2WC2A 1T0FC 2K9MA 1WBFA 1MH4A 4HDVA 2DK8A 4GALA 3O3KA 2O3FA 3NAPC 4UYBA 1GLHA 1EPZA 4YM0A 2BE5F 1T0FA 4OI2A 2JVGA 4FX0A 1XPXA 5K0UC 2WAOA 2R1BA 3NAPA 5GLTA 2XLFA 4MEYF 3LSPA 2EWNA 1L7RA 2YROA 3BOQA 2QQMA 4QPIB 3OGVA 5FO8B 2E26A 2GN7A 5K0UA 2DT7B 4H0EA 2W9XA 1YEWA 4YG2F 5AC91 2WNVB 1KU9A 1C5HA 1UX6A 1UKGA 1LU1A 2EXKA 1IKPA 1W4MA 2G4IA 3WP4A 1NA1C 1RVF2 4XFFA 2DVGA 5A33B 3BG7A 3W20A 1B9NA 1C0WA 2AYHA 3AVRA 1J7KA 3KGZA 1QHGA 2E7TA 4MV2A 2K4BA 2YY1A 2GMEA 1UF2C 1ZRFA 2CGPA 1NA1A 2ORXA 4M0NA 2WB1A 2AO9A 1CJDA 1QRYA 5AC93 2OAZA 2P17A 4XKVA 4F3QA 2CDPA 1X3WB 2DQLA 1XNCA 1V6KA 1E3OC 2IXLA 2PI0A 4FE4A 2CAVA 2DI3A 4E4DX 4Y1VA 4UW6A 3FISA 2CV1A 3MBWA 5C3OA 2UU8A 4OUEA 3CJNA 4D3WA 1EH7A 1LVAA 2X4HA 3DLLF 3OBRA 3S5AA 1BC8C 4N53B 2WAFA 2HWD1 3WCRA 1V6OA 1MZFA 2VQUA 4UI9L 4W6XA 5JI7A 3WVJA 1WKYA 1VBC3 1W2NA 2IXCA 1MEC1 1B8IB 4M3BA 2ZX2A 5CFDC 3B93A 3J7ZI 3O1MA 1JHJA 2OVUA 1L0OC 4C91A 2C9KA 1YS7A 1YO8A 5FPLA 3GLXA 2LRDA 2ZOEB 1RZ4A 1VBE2 4M01A 5FQ0B 1ZA7A 4UFIA 5CFDA 2HWD3 1IXSB 3OUIA 3ZYIB 4P9XA 1UYYA 2RDNA 1U5TC 4XSZF 1J58A 1B1BA 1MBKA 5HLHA 4LK0F 1FV2A 4GB31 2NYXA 4EVIA 1ULDA 3VLBB 4E4SA 1HW2A 1W3VA 4IGQA 2Y6GA 1BVP1 4HK9A 3BU0A 1KYZA 4JQTA 3RYRA 2PJRB 1WJAA 1S1AA 1AR71 3DBHB 4FOVA 2ILMA 2OIIA 3F6OA 2PFWA 3UL2A 4JX5A 2BVBA 4LBJA 2WBKA 4ENNA 4LO5B 2DQRA 2EJRA 1WCDJ 2E35A 4BU2A 2M45A 3CP8A 5FYVA 3JBG1 1HRI3 1B35C 3OR2C 3FC0A 1NLQA 1QOSA 4GB33 2XBO3 3CZUA 1JE8A 4AHYA 4G7ZF 1V70A 2EIKH 3ZMVA 4QQPA 1UYPA 4AFMA 3IM0A 3SJMA 4QX5A 1AR73 2OZJA 1B35A 3ZMSA 4M9XA 5JI9A 2XPVA 2FNAA 1HN0A 1NAEA 3K2OA 5CVRA 3V4GA 1KYWA 4GYIA 1G8XA 2M8EA 2V1XA 1MDMB 2XAUA 2X5IC 2EIJH 3I9V2 1T33A 5G04L 5D5UB 2RM22 3KP4A 4Q1RA 3BTLA 1TMF3 3JBG3 2WADA 3SFZA 3A7QA 4BMBA 1YNAA 3HN1A 1S6LA 1H2NA 1OT5A 2X5IA 1UL9A 2V79A 1KD7A 5HBAA 4GULA 3LFUA 1M06G 2ZX1A 3J81Z 3N9OA 2ORZA 2DCYA 3ZMZA 2WDBA 4I30A 2L01A 1NE6A 1U5TB 2ZXJA 4IL7A 2A07F 4RAGA 3MN2A 3DU5A 4UB8C 5FY9A 4NROA 1SFPA 2IAIA 2L3DA 4Y1XA 4NIHA 2W84A 1PUFA 2JKBA 2HQAA 1IS4A 5FXWA 3MW4A 2ZXQA 3KHCA 2JDKA 4BK5A 3EMRA 2BNOA 1DQ4A 4QB6A 2E5ZA 5LGTA 2G9FA 4B4QA 1AR81 5D21A 5JZGA 4R4ZA 2J7MA 1B35B 1ENXA 1QMJA 3WDWA 4MQVA 2EA4A 5FYSA 3UNPA 3F2ZA 3FJSA 3I3LA 1GMMA 2Y48A 2B9VA 4KICA 2D43A 4TYSA 1UOFA 3MIHA 5ICFA 3VBUC 5I0RA 4URAA 5FR3A 4CYCA 1ZZ8A 1QH6A 4EM2A 4YYOA 3U1XA 1FC3A 2ERFA 4AVZA 4MH0E 4NAMA 1CZSA 3CMYA 4HANA 3NL1A 3T8TA 1UX7A 4EN7B 3VBUA 4XMIA 5E20A 4FQZA 2ARXA 1MNMC 4FO9A 4WK8F 1AR83 2XQRA 1R1A2 1UY4A 3LDKA 4E27A 4LLNA 3RNSA 2J5PA 4CCEA 4JX6A 1IN8A 2GNBA 5DD4A 4Y1YA 1RESA 3VB2A 4IQJA 4P96A 4KBZA 2O8QA 1ULFA 4EJOA 4IEPA 2VBWA 5IVCA 2QQVA 2HYFA 4PIYA 3CJRB 3WCSA 3T4VA 2A6XA 1QBJA 2JE9A 2CDOA 4FASD 4CEYC 1TME3 3PO3J 5IPAA 1P4XA 1T98A 1ORKA 4A0XA 3GGLA 1R5ID 4QDRA 4AGVA 1NXD1 3E0JB 4Y5TA 2CV6A 1LOGA 1RMU2 2WT2A 2PLYA 2DODA 4L97A 3RZHA 3CMMA 3F23A 2WKKA 1UB9A 3DPRB 2LDUA 3BPSA 3K70C 5F0CA 4G6TB 2V9VA 2PFBA 1IUYA 2ZEXA 3VZKA 3FHIB 4NDLA 1FOWA 2DA4A 1BZWA 3PIPF 3SYTA 3KP6A 1ZBA1 3WTWC 4MGQA 4WX9A 3KHBA 3IB3A 4PHZA 4IHSA 1CAWA 2YX4A 3AFHA 1F1ZA 1AHSA 1P6RA 5IT9K 4KUMA 3Q3SA 3ZQFA 3T5XA 1VRH1 1IRXA 5GTIC 1XCVA 2HWF2 4V2FA 5H2FC 1QIQA 4GH4B 4GYGA 4FOYA 3O1UA 4AQ6A 4U2AA 3LL7A 3W3CA 1ZTRA 1VQ7I 1T38A 1UHMA 2B9SA 1SCSA 3HQXA 2J1VA 1B6AA 2QQPA 2ADEA 2YR2A 4EATA 2OA2A 3BYWA 3L7WA 1ZBA3 4OIPF 4AFDA 3VN4A 4AEMA 2VBYA 3N7MA 1W39A 1W8TA 3AMMA 3LSDA 2JG9C 3PSIA 3IKWA 1VQ5I 2BJSA 4HQEA 4BQXA 4KFCA 3CUQC 1VRH3 2V9PA 2QEXI 1N47A 3SC7X 3WTZA 3UGHA 2JG9A 4WF2A 3NV1A 2GOMA 4RGXA 4D7SA 5BQTA 3NAUA 3FDYA 4YM2A 5LLQA 4CEYB 3HDDA 3CUQA 4IOCF 3VB9A 5GM0A 2W1WA 1CESA 5FY0A 2WFPA 3D82A 1XCBA 5ERIA 4P02B 2L54A 3UK9A 1OVSA 2DTWA 3N9NA 3GDBA 4LPLA 3AP9A 2E5NA 4ONUA 1N3PA 1WZ2A 3QLQA 4B1MA 1TT5B 4P5HA 3B5LB 1S0BA 3U37A 1F9NA 2ESHA 5KXEA 1W8UA 1P8JA 4I3GA 4LA3A 4NHLA 1W8HA 1UMZA 2ZJQF 3PUIA 1PO12 4QPWA 1IO2A 1HBXG 4LKEA 4QB1A 5C4WC 3C3WA 4FPKA 2VKEA 1APLC 1MMGA 1UY0A 4AC0A 5DABA 1VQ4I 3M8JA 3CDHA 1LQ1A 1JKPC 4EJTA 5C4WA 3NV2A 2R7RA 2V9KA 3NO8A 2Q1MA 2PHLA 3VL9A 1D1CA 2AEYA 3ENRA 5FZFA 3JD72 1V0AA 2QZ3A 4YFZA 2VO5A 5HV4A 2DMPA 3TEXA 4J19A 1GZWA 4LHKA 3RI4A 3ZXSA 4BXXJ 1VMJA 1YJWI 4DEQA 4IZZA 1A78A 1YJ9I 2Q2EB 1VF9A 2DMQA 3TEDA 1MACA 1KDMA 1F43A 4HEA2 4XFCA 5FOBB 4RR3C 4UUVA 1LGNA 3CCLI 4LA2A 4QXKA 5LBQA 4D9JA 2JZYA 2HWB1 2P34A 5F3GA 1BJZA 4MGIE 1REEA 1MS5A 5J8FA 4RR3A 1RB8G 4CP9B 2E51A 1U5YA 3KQ4B 5LBBA 3WX5A 3V0AA 3HRSA 4XFIA 5LEKA 1EV11 4O3MA 3EHKA 4EM1A 4MFDA 4IKFA 2Y9YA 5L19A 3GFJA 4YNIA 4B1LA 5FYMA 3LPFA 2HWB3 3MKLA 2IS1A 4C2TA 2A6EF 3VDAA 5JOZA 1BLZA 4V2WA 5D2AA 3S32A 3AYEA 3NNLA 2LC2A 1N3OA 4NOTA 3Q8BA 3WSOA 3EXUA 3ASIA 3VL8A 4ZDOA 4PGGA 1WRJA 3JU9A 1EV13 4OAZA 4HPQA 4R4XA 5E6HA 4N8MA 2R7QA 1NZCA 1JYIA 3ON7A 3G2BA 2RVCA 2DVFA 4XUPA 2A6HF 3GBGA 4HBLA 5IFTA 4BQ1A 1RIRA 2XG3A 1ZGJA 4BJTA 4CDUC 4XVHA 2W2IA 4MOAA 4EJVA 4ZZ8A 1SD4A 2VNGA 3WEZA 4DQAA 4OMZA 1W6QB 5H9PA 3WTVC 1TWGJ 1WA6X 2GLOA 4H2AA 5FY1A 2DCZA 5GAGJ 2Q1FA 4H4KC 1W6OB 3DEMA 5JI6A 4CCDA 2HBUA 3EO6A 2XAGA 5DUWA 3V0AB 1IPSA 4EM0B 1QZEA 4QIWN 1QVUA 2YPDA 1FPQA 1XDUA 4J1WA 4NHMA 4BQWA 4NJ4A 3ORJA 1OKOA 3FXLA 2Z42A 1UY2A 1RUI1 2DURA 4XN0A 2NOGA 2DYSH 2YHJA 2KHMA 2ZZJA 5HS9A 3FBMA 1WJ5A 1J83A 1XSRA 3GFLA 4KI5M 4JRLA 4XOPA 5FKCA 4AI0A 4G9YA 3BN6A 2DCKA 2EH3A 2DPDA 5AIQA 3GXOA 3NNMA 5A3UA 1TQMA 5AVAA 4F83A 3I4IA 3E1SA 4ABZA 3AXEA 1YX5A 3A22A 3KE2A 2VMGA 4DQ2A 3QPLA 2BOJA 2KJCA 4D0PA 4CTEA 2WNEA 1PO21 4AIKA 4XCAA 4AEDA 5LWBA 1EP0A 1IRFA 3V64A 4A0ZA 5A7WA 2EXJA 3WTTC 1MW7A 3FXOA 1LHNA 3BIEA 4L9NA 4FP2A 2VOWA 2ZZQA 4AE2A 2WO2A 3VKMA 2RHPA 4HNVA 2Q8EA 2VODA 4BDZA 5CIRA 2W4SA 4CDUB 4ASMB 5DZEA 1K79A 2KM2A 3CLQA 2E7WA 1CQTA 1PO23 4XF1A 4U0VA 2K27A 4CXWA 2B63J 2BGPA 5JR7B 1VTNC 4FBFA 5GZFA 3P1IA 2A73B 1OCTC 3IMMA 2E36A 1F4KA 2GSYA 3SMHA 5C9AC 3CCYA 4XHBA 4PFPA 1KS5A 4QHBA 2EAAA 4HA8A 1LESA 2YYOA 3O1OA 1ST8A 2CQ7A 2R7DA 1D1AA 1DBNA 3SZPA 5L7OB 2Z69A 2DCTA 3KGLA 1JOJA 3PM1A 3OL3A 5FZBA 1WMEA 4OHYA 4Y52J 3OB8A 4MGKE 2VW1A 5FZOB 3PTRB 4QX1A 3M7GA 4CA9A 1F31A 3GBWA 1ON1A 1MBFA 4L92A 2LTNA 3EUKL 4BA6A 1IG0A 3UJOA 2ZEZA 4UFHA 4DYQA 5A7PA 4JKLA 5KNLA 3ZMTA 4MG2A 2BVMA 2PQ8A 2FOWA 1MZ5A 1POV0 4BQOA 1TLHB 2JECA 3DBRB 2R072 1UHWA 1VQ6I 1RITA 2VMHA 1IZ3A 5C5TA 2A6TA 2D5FA 4CP0A 2WAAA 1B72A 1JYXA 2AQEA 2HZDA 2FMYA 5DAQA 5JPNB 3D6EA 3HEFA 4BY7J 3B9IA 2HWC2 1PZ7A 3DKWA 4LLOA 3EUHC 3RKWA 2E2JJ 5HXVA 5D8LB 5TJJA 1MS1A 5FFZA 3DYMA 1HRV1 4PI2A 1VBB1 3LIHA 1OD5A 4B29A 3IC7A 1D5VA 2PEXA 3EUHA 2UYAA 5C9AB 4Y5SA 4W65A 3W2VA 4PIZA 4QGLA 3ZN6A 1GLNA 1I27A 4BBSJ 2O8OA 1KONA 4YLZA 3AMHA 1V4RA 3I2HA 4GWIA 3H92A 3K7AJ 4OLLA 1IOAA 1MQTC 4DO0A 2R5ZA 5JOWA 4DUXA 4QQLA 1KFUL 4EE2A 5C8CC 4CPBD 2A75A 3LSRA 3KP7A 1HRV3 5IVJA 3FLPA 3ETQA 1VBB3 2DBNA 4IEWA 4YVWC 2K0GA 3QCWA 1RUJ2 2OU2A 1PUEE 3THCA 2V4VA 1MQTA 2WQ8A 5C8CA 4CCMA 2ZXIA 1PVEA 4I0AA 4YVWA 1YTYA 2NOJB 1RHI1 3FBNB 2RMU2 4XFGA 1AKHB 1IZ1A 4RN5A 1BXHA 3FHAA 4HOOA 4BAYA 1POV1 2RDRA 2FXAA 3AJYA 3GZAA 1NK2P 1KRIA 3N3HA 5IW0A 2VQCA 3MEXA 1MJ9A 4QPQA 1F8VA 1M4WA 3I2DA 4DY3A 1LGCA 1JI6A 3D5LA 1JUHA 3D3AA 3KZ4C 2DU1A 1DGWX 2Q8OA 1OYYA 5IYCJ 1IN7A 1YUDA 2MC3A 4LUKA 1I1SA 3BR2A 3H36A 2QDRA 2BY3A 4IRGA 4IERA 4N7IA 1EAH1 1RHI3 4ZU5A 2PMWB 3O1SA 1H8AC 5DDJ2 4AWXB 3MW2A 1OJLA 3R4KA 5K5QA 2LF8A 1YCIA 1XSVA 5DAVA 1POV3 1YW9A 3VBSC 3GTJJ 3G3ZA 4DFSA 3CMEI 4AQ2A 2VQLA 1UELB 3GVAA 1LE8A 5FYUA 2ARAA 4P9JA 2AHQA 3T1LA 4D1QA 2JDAA 1YW8A 2JA8J 1JJ6C 5IP6A 1UZZA 4H7MA 4NWVA 4BXSV 1JJ8C 1W0OA 3LDRA 2AREA 1C1LA 1N1TA 1SACA 4UV9A 1EAH3 2VC0A 1AL0G 1OI6A 3WQ1A 2PBIA 3PVBB 4QU2A 4QGNA 1JXNA 4LEJA 1VFCA 2BFUS 4BEHA 1G3TA 3BLYA 4LO7A 2FUG2 4YW3A 3SH5A 1CIYA 1BW6A 5FCCA 4MXVA 5FJHA 1J59A 4IX7A 1A6QA 2O61A 3HN3A 3KP2A 4MXWA 1HDDC 2ZC2A 2ZMKA 3PFYA 4OZXA 5FZ4A 2R32A 5DUIA 3IKTA 3B00A 3Q5FA 2HOAA 3DLAA 5CVIA 2EZLA 3ECHA 2DDAA 3TW7A 4Y33A 1WPKA 1XMKA 5SV5A 1TNFA 1QOTA 2E34A 4CEWC 1BVVA 1ND2C 2JJ7A 3N7JA 4NMIA 5LASA 4AHXA 2JDYA 2VQAA 3AYDA 4OZOA 2NVUB 5TRDA 4Y1ZA 4BY1J 2HZTA 1V6IA 2IEKA 3JQXA 3S6PA 3HYIA 4CEWA 3CQOA 1R082 3VBSB 2HVSA 1ND2A 4D7MA 1Z67A 1JMUB 3T0DA 3R61A 2W82A 1OOPC 1R71A 4RAFA 5IWFA 4UVBA 4RQPB 3K6GA 1FV3A 3VBRC 2LSOA 4A69C 2P1BA 1OOPA 1DZQA 3GZUC 4HRIA 3MF6A 4JAAA 4BE2A 1IDZA 3UKVA 3H50A 3ZYGA 4FTEA 2MYSA 4Q27A 3VBRA 1F2NA 3AZYA 1IRGA 3OOUA 3WTUC 3OGSA 4XABA 2VXZA 1FPN2 1MBHA 1PM4A 3WG7H 2XJTA 3E97A 1Y4WA 3BG3A 5IP9J 2MNGA 3CIHA 4HXCA 3SHRA 1GNZA 3C18A 3E6BA 1BYHA 3RSJA 1CAVA 3RRDA 2HVQA 2B39A 4IO9F 2DA6A 2LALA 2ARCA 4Y5Z0 2G9WA 3M2MA 2R0HA 1LODA 4N4NB 4B47A 1ZBE2 2VZ3A 3AP5A 4XF9A 3LKJA 3NEUA 1JGSA 4B48A 2EILH 4IJAA 2NVXJ 4L9VA 2FCUA 2N8GA 2E7XA 3S16J 4UVAA 5IT9Z 1W0TA 1SAXA 3GTGJ 2VVFA 4KNYA 1YFUA 1GFF2 1UXZA 3WU2C 5FJ8J 3SITA 1H9PA 1XE8A 3NV3A 3SXWA 4M0HA 2I07B 1KEXA 1K12A 2HWE1 3IAM2 2IXKA 4BIOA 5BNNB 4HV5A 3ZPLA 2AH2A 4ZU4A 4OHWA 3TBDA 3P9IA 2BWAA 1SVMA 5BNOC 3BTIA 1GR3A 2FU4A 2CQNA 1JW6A 3CMAI 2P7CB 4GRIA 4L0YB 2XMLA 2VUJA 3S57A 5JLWA 1YQ2A 2CY6A 1YQ5A 2A6ZA 3ZXLA 4MLOA 4LIVA 4X1EA 2JDPA 1RUG1 2HWE3 1OQEA 1AR91 1YG2A 2GNDA 1G6NA 3A01A 3ZR6A 5GJ6A 2E2HJ 1LHVA 1AHDP 5HCBA 2VBBA 2EZIA 1VP6A 4BKXA 3AP6A 2WAEA 4A3LJ 4HPKB 3V8JA 5LA9A 1PIV2 3KV9A 2A6WA 4LBQD 4I01A 1O59A 2A3XA 3O14A 3AMQA 3TNPB 3WF1A 4LJHA 2EV0A 2X6XA 2JRTA 4OQ8A 1AR93 2OPKA 2W92A 2EICA 1P7IA 5D6EA 2HXOA 3TB0A 4E2GA 2HNHA 3BR3A 1JHHA 2RJKA 2KFDA 1G9BA 1C1FA 4UXAA 4S04A 2H0BA 4IHYA 1NQJA 5AC92 2RS31 1HQLA 2BEOA 4KWKA 5BNOB 1PGL2 1FBUA 4WXCA 4NPMA 4KQ7A 4W6WA 5JCTA 1E5SA 2WNUB 3C7OA 4XRSA 5J1XA 3V7CA 5KBFA 4HKLA 3KFWX 2H6BA 3U78A 3SISA 3I97A 2KDOA 5I91A 2NPIA 2FBEA 1MZEA 2O5RA 1PGW1 3F95A 2H27A 1W36C 1VBC2 1UZYA 2RS33 4OHXA 2ZFUA 1VBA2 2LROA 4Q2FA 2XB5A 1SANA 2LVSA 2R7FA 5JFRA 4XLCA 1W2TA 1R1UA 4HYEA 2F6BA 5H6QA 2OJED 1WD3A 4MGSA 5FZHA 2K3PA 3E5QA 2VMEA 3A0BC 1V6NA 1HB3A 1ZG1A 2RGVA 2WSUA 1X7NA 4HVQA 3HC7A 3ZCOA 4EZ4A 4AIJA 1XSDA 1VZ0A 1MS3A 3R05A 4C90A 4L9TA 4GWJA 3Q8AA 3ZPOA 1Y9QA 1W6MA 1BC7C 3QODA 2VW2A 4RYDA 5FZ0A 2XGEA 2J42A 5DZFA 4GIQA 5ABJC 2ZGRA 3ASOH 2R061 2R041 4ZY9A 2WZ8A 4KMQA 4IHXA 5FZKA 4E7KA 1DG6A 5M3MJ 2VE1A 3IL2A 1A04A 1X1DA 1POQA 5FFOC 2GA1A 4X0GA 5ABJA 3VSKA 2DVAA 4AI2A 2NXNB 1WUVA 3M1EA 1QQP3 4BDYA 1HRI2 2ZHLA 1IAWA 1RRJA 4XAEA 1V6JA 4GB32 2XBO2 4IV3C 4CDWC 3V0BA 3BR1A 4RHV1 1Y9GA 4XOTA 4KMFA 4PLMA 2KLOA 4COYA 2IXSA 3OYDA 4G7OF 4KGQA 1QNYA 1S0DA 3MKWB 2R043 3MIGA 2VULA 3F8FA 3NNGA 1W6PA 3LQCA 4IV3A 5DPNA 5JAXA 1FNYA 1TWFJ 2DDBA 2AZ5A 4RGUA 4XFHA 3GCMA 3VBOC 1TMF2 2WQZC 2M30A 4Y15A 3JBG2 1PK6C 1NX9A 3QYBA 1EF4A 1Y6IA 1XQNA 3HAGA 2Z5UA 4RHV3 3OS1A 1DU6A 3G7DA 3NV4A 3T0YA 2B46X 4M71A 4X8PA 4G8XA 1PK6A 1C8M2 3I54A 3NJVA 3SEQA 3WDYA 3C1DA 4OIRF 4BXUA 2Y9ZA 2Y34A 2XPJA 3JCUC 1HXS3 5L3FA 4WM8C 2VZSA 2Y6LA 4EJRA 4IRIA 3HPNA 2WLPA 1KXGA 3FHNA 4WM8A 1BK0A 4AVTA 3N35A 3QP6A 3HT2A 2A70A 4RLFA 3WODF 1W7PA 2M5WA 1JXSA 4N43C 4XQ4A 4IRHA 1WH7A 1RINA 2HDCA 1SC7A 2AXTC 2RE9A 3EJKA 3JRHA 4PF5A 4Q4V3 1JU3A 4CDWB 3SKVA 4P55A 4MIMA 4N43A 3H5AA 2J1UA 2XVLA 2VUAA 2R5YB 1XNDA 3CO2A 2CU5A 4K8FA 1O7LA 3TL4X 1S2EA 4AYBA 3ZYPA 3HSRA 1NY72 1DFQA 3ZMNA 4A42A 4E2QA 2XWJB 5TISC 3VBOB 1TQIA 3OYCA 1Z0XA 3DN7A 1RC9A 4XLFA 3POJA 2VLAA 5HS7A 3WE2A 1AR82 2LS6A 1HDKA 2FX0A 2MW8A 5CKMA 2CGOA 2DYRH 3FK6A 4Y20B 1ZVFA 1DHKB 4JP0A 3ZQCA 1WZXA 4UW3A 2SBAA 3OEAA 4A3ZA 3I7DA 2ZSHB 1LOFC 1DCSA 2L4MA 1TWHJ 2X53S 3PNAA 1V9U3 4HMZA 3KS7A 5IVFA 5GKAC 4Q47A 1DGWA 4MO3M 1LOFA 4CCLA 1WWYA 2NNYA 1TME2 5HCAA 1PZ8A 4X8NA 2JQ7A 2JB4A 2MLGA 2YPJA 2OCCH 5A32A 4X6AJ 3RQIA 3OYJA 4KN7X 3KETA 1BOAA 1XGNA 2PMUA 1GSLA 1L3LA 2XVGA 5DYMA 3NWTA 3T8RA 2Q30A 3MV01 3F9KA 4CU8A 3RZKA 5DEQA 2QVSB 1GP5A 3G6EI 3PQJA 5A3WA 2JENA 2NMNA 5A7SA 1O3QA 1LEDA 1AR61 1QGPA 4K20A 1OSGA 4AVCA 2CL2A 4YSFA 4RS5C 1I3QJ 1OLRA 2R7WA 1Y0NA 2HBTA 2VH9A 3HMYA 5E8AA 5H6RA 5F6KA 1OBNA 3DTEA 2CWMA 2VOVA 4RS5A 1QXJA 1S2KA 3U21A 3S2HJ 1YX3A 3PUFA 2Q8KA 5C8WA 3AC0A 3QQAA 3WQ7A 2D5HA 4XXPA 1H9TA 2QTWB 2BOLA 2ESNA 2QUFA 1AR63 2XVCA 2WQ4A 3FXQA 3CZ6A 4NQWA 3S14J 2PHDA 3NW4A 5HNFA 4Q8KA 5T5PA 5FLIA 2E2IJ 1IF1A 2HOTA 2VVEA 4YARA 2YX7A 3DQVC 3OYBA 1TBXA 1ZLKA 5B4XA 4QXBA 3TN92 5FP3A 1KQ0A 3UT0A 3S7IA 3HHHA 2MC4A 3LSGA 3WG3A 3CTAA 3KPHA 3ZFEC 4NR1A 2K4JA 2MFZA 2L9LA 3A21A 1OD3A 3KT7A 1ODDA 4P08A 4PFOA 4ENMA 2XGDA 1XNKA 3ZFEA 3P3NA 4NC7A 1S9HA 1US3A 3CUOA 1PMHX 1GNYA 5K7ZA 3K2ZA 3T2TA 1VQMI 3TOJA 3J8F3 2M9HA 1OA2A 1YIFA 1PNFA 4OOIA 5IT6A 1UZWA 3HR9A 3O1RA 2HU9A 2YSRA 4YRVA 3N97A 3O8HA 1VPHA 3MHZA 4UY8I 4CE8A 2C24A 2I2SA 2QSFX 5EGOA 4UW5A 4XR6A 3USUA 5LD2C 2R92J 3F8BA 4EWEA 3A02A 1EUUA 1ENSA 1UAAA 3R4SA 2WSVA 2DA3A 4H3WA 4NRMA 5I93A 1K3IA 4DOUA 3L2YA 1QQIA 2Y75A 2CGNA 2K02A 4M4PA 1ITYA 2IXHA 4NIIA 2JIJA 1CZTA 5E79C 1O5LA 2MD0A 1A35A 1HQNA 1LUJB 1CN1A 1DGRA 1SFUA 2RJ2A 4K7JA 5FY8A 4XN3A 1ZRCA 3ZFEB 3BJ6A 1LKNA 1XYNA 1AWCA 3LSTA 4ZC3A 3BG9A 2MLKA 1SVLA 4K1ZA 1WW4A 1FTTA 2WZR2 4Y4RA 3PUQA 2Y6JA 1T08B 3GZ5A 3OYHA 4HSTA 2IVJA 1SLBA 2ZPXA 5BY5A 5C33A 1MH3A 3DECA 4OQ9A 2MG4A 2HWB2 3OYWA 2JT1A 4IE0A 2XXZA 5EJ3A 3WG4A 3FLTA 1WW6A 4NC8A 4LR4A 4YW4A 2WN2A 4UUTA 1CF7B 3USUB 5DM7F 1ZKGA 1Y9MA 3DV8A 5JOXA 4Y22B 2ZSIB 3M4OJ 2IGNA 5JIUA 5K8SA 2F5CA 1MBEA 2V26A 3M3OA 5E88A 5K7HA 2B7YA 4R8HA 5LA0A 5EIYB 2ISZA 2A3YA 5JMOA 5JHFA 5F3IA 4Q4X2 4LBQB 4CCNA 3NJZA 2CW0F 2KP6A 4LIUA 2D5VA 2ENRA 4D0QA 5FK7A 3P7NA 1UOGA 5F64A 3R0RA 1IGNA 4YG0A 5T55A 2RC4A 3ZFFB 5TSWA 4CZSA 4AYBN 4XJWA 1WMFA 1G3WA 4NIAA 1D0HA 2ZHKA 2BRTA 4PJJA 4QT6A 2VNVA 1LU2A 2DDUA 2B5HA 4TTGA 2QGUA 3J7AY 4M9SA 1DQ0A 5FRNA 3KCCA 2W1OA 2GM4A 1SFKA 1NHAA 4QPGC 4PF1A 1NUKA 3PFIA 5HLTA 3RZLA 3OTFA 2VY0A 3I59B 4IEXA 3BWGA 5EG0B 5C3PA 2Y26A 4LB6B 3O0WA 2DV9A 2XLAA 3F8NA 2WO3A 2R3SA 4W6YA 4AU7A 2Z16A 2RR11 4AM3A 3F22A 5J1YA 5JWPA 3K4BA 1ETXA 1R58A 1HB1A 4NPLA 2PJPA 1YLLA 1AX2A 1WFXA 1MZBA 2RN7A 3THPA 3ZQIA 4BMEA 4OCTA 1J1LA 3KCXA 1ODMA 1DQUA 3E6MA 3ZFGB 4KN4X 2XROA 4I3PA 4O9EA 3SEZA 1WCQA 4J25A 1QWRA 1WCSA 1BK1A 2Y60A 2RR13 2UWMA 5KHJA 5BNPA 3LSEA 3J7YJ 2VTXA 2L2OA 1AZDA 4Q4ZF 2COMA 1RR7A 3HGGA 3MF9A 4QM9A 5IUQA 5GP9A 3POWA 1GOFA 2YG0A 4AG4A 1USTA 1ZG3A 3MKYB 2D97A 4CXYA 4JDNA 5C44J 3GALA 2FEZA 3WR0A 2ZFWA 2BFUL 4LORA 2XAFA 1FOD1 1QJEA 1JT0A 1V6MA 3MICA 4KT6A 2PYTA 3CU7A 2BP6A 2WY8Q 1PVC1 4DZPA 5A1LA 4QPGB 1NTCA 2OA4A 3IPVB 3IDAA 1UYXA 2EIDA 3VKOA 5FP4A 1MS8A 1CGPA 1I1GA 3VD5A 3RZOJ 2DBIA 1LRHA 3TMOA 3GF6A 1G9CA 3MI8A 3RKQA 1FOD3 1HJFA 1YI7A 2WYSA 3C8XA 3VHOA 5JVVA 3PU3A 5FYYA 1S29A 5HCHA 1OUSA 3WP5A 2A68F 1BMV1 2BDRA 4YZ4A 1K7AA 2J1SA 1PVC3 4K3UA 3JB8A 4CVUA 5FWEA 1TC3C 3UR3C 3HOSA 2VUCA 2WZEA 2PXJA 2VXDA 4XDPA 4UWDA 2VECA 3I0TA 1UU4A 1UIJA 3KQRA 4KIBA 4BOWA 1VIWB 2CV0A 1Q8VA 1F5FA 2R16A 2WWUA 5AONA 2Z3YA 4RMNA 3MMYB 5J96B 3A4UA 3EQEA 6PAXA 2MEV3 1HSTA 3PHMA 4EZHA 2ZHNA 5I0UA 4A2UA 5FLVA 3CCRI 3AZWA 1WMDA 1W0UA 1ASJ2 4QPOA 3OY8A 2VPLA 1FMD3 5DM6F 1IXCA 1Y1VJ 2OQGA 1IW7F 1T2XA 4HX4A 3VKLA 2QQAA 5D8AB 4PUSA 2PMZA 3U9GA 2L9NA 2YC2A 3HOTA 5CYYA 1HRV2 1OISA 4AEKA 3OYNA 3COAC 3N7LA 1VBB2 3LA3A 4YZ3A 1L3JA 3ZVXA 2HYJA 5C3RA 2TNFA 1OFCX 2D3PA 4ESFA 5EYYA 4NHKA 3PU8A 1WLCA 4KYWA 1YLFA 3ZR5A 2JXAA 2CSGA 2CQKA 1QY4A 3N7KA 1O3RA 3RMYA 1AXYA 5BMZA 2M8GX 4KNCA 2XOMA 2IPQX 2ET1A 3DPLC 3TAYA 1JTZX 1DGRN 2C26A 1XD7A 3VFZA 2HEWF 3VYUB 3M70A 3LEIA 4NHYA 2YV8A 5L3GA 4LULA 3KT1A 4UXNA 4K21A 2FDGA 4ATFA 1NH3A 4XM3A 3O0VA 4YVSC 4QXCA 3CCVI 2E9QA 1BW5A 2NLRA 2EV5A 3VBFC 2VD7A 2MHFA 5AFEA 4X6QB 5IYBJ 2DPUA 1US2A 3ZM8A 1LECA 1AL23 4OUMA 4DW6A 3OD0A 5FZEA 2LG4A 4ZYHA 2N7GA 2O0OA 4YVSA 1R00A 5HLGA 2O6GE 2DMUA 2JE7A 4YGDA 3AKSA 4PDWA 1FNZA 3MW3A 1X36A 1R1ZA 4JGYB 4CDQB 5BV6A 1R23A 3DXJF 3GZTB 3P6BA 2BHYA 4PQQA 2YBSA 3I8TA 2LMDA 5LGUA 2DT5A 3BTYA 1EAH2 5A6QA 3D1NI 5FMDA 3BIWE 2ET7A 5I0SA 4QD2A 3AYCA 2BBYA 1G2HA 2YGLA 3ACIA 3O8GA 1ACIA 1J84A 3ZGKA 4EJWA 4XFBA 3UGGA 4I09A 2G0EA 3KLSA 4WVZA 3OR1C 5FD6A 3ZXKA 4OINF 1AVBA 5J8CA 5CVJA 2M87A 2Q1ZB 1HV1A 3H1CA 3PIGA 1H0MA 5ANNA 2BNMA 1OH4A 1KDKA 2CYYA 2JA5J 2WS92 4NE9A 2BXYA 1RPWA 1JOPA 1G3SA 3A0HC 1P4WA 2YFUA 5KR7A 4PJLA 4L99A 1ND3C 3VZJA 5CVUA 2WAQN 1O3TA 3VBFB 3VD3A 4AL9A 3TW6A 1V3FA 5ED4A 1CAXA 2CUZA 4WVWA 4Y7NJ 4URTA 2CW8A 1T95A 4ASKA 1BI0A 5FGMA 1BBT3 1QJY3 1ETOA 3POBA 1ND3A 1TQPA 1OFNA 1N3QA 1ODNA 1IKQA 5FUIA 2J22A 2H1LA 4AXOA 1H9WA 4HVOA 2H6CA 4COZA 2JVHA 2UXXA 2L5QA 5E3MA 1ERDA 3BI3A 3KYLA 4IEZA 2ZTNA 5L3EA 4N9HA 1MSFC 1J0RA 1R22A 1HV0A 2DWRA 1Z6RA 3KMHA 1BN5A 2M4KA 3CO7C 3H7JA 5DXDA 1CD3G 3VZOA 2BW3B 4LLGF 2XJUA 1HOMA 2VQHA 1WQ2A 2OF7A 5JXHA 3K3OA 1NZIA 3S3NA 1G86A 2VZPA 1MIJA 3Q9OA 2ZX3A 3K4NA 1TQ5A 2XUMA 2K5CA 4HT1T 3VV1A 3FLRA 3VWBA 2EFOA 4XACA 2EXIA 4WVMB 1ULCA 3ZKUA 4K9SA 1SLLA 3FX3A 2IS4A 4DXZA 1GQHA 3I4MJ 4DPNA 3FKIJ 4XORA 2FD8A 2BU9A 4D6SA 2VCAA 2XJSA 2OXBA 1NE4A 4MNUA 1U6GA 5JLXA 1PDNC 4E4HA 1UOBA 4INDA 5J98B 4E9KA 2I5UA 1QU3A 2WN3A 2ZMNA 3BJOA 1OPOA 5BPIA 1PNGA 3B6AA 4JQRA 1G8WA 3Q0VA 5CG9A 4W97A 2VASA 3KLOA 4ESJA 3GZ6A 1GVJA 4F55A 2DBBA 2PN5A 4N4OB 1UU5A 1J1TA 4PLOA 1YQAA 2BY0A 2Z9OA 1R092 2EFWA 4Y3OA 4A93J 4XIDA 1HKSA 2HWE2 2VQ0A 4LE3A 2AGSA 1WGPA 2M7AA 3OOPA 2BPA2 2QBYA 3VD7A 2X6WA 5BNGA 3H9QA 3LEGA 3ZSEA 4A45A 2ZGSA 2CS3A 1PP8F 1BEV1 1JN2P 2RS13 3RWNA 1QF3A 4QHZA 1W5CC 2DO7A 1OC1A 1XGOA 2ADDA 4BACA 3IP4B 3I4NJ 3PJQA 1FP2A 1JU4A 5FPVA 1R9TJ 3I3BA 2DA5A 2FBHA 1XE0A 3DXUA 4GAZA 4AHWA 1AR92 1OMIA 1WGXA 3F6VA 2PMZN 2V73A 4HNUA 1K78A 1DYPA 2F4PA 2K3FA 5DAPA 2W57A 1ZHFA 5J48A 2F6CA 3HSEA 1S0EA 3WZ1A 2OCEA 3H9AA 3CDZB 1FTZA 4IUGA 1BEV3 3G1LA 4CRQA 1S55A 3LSHA 1PJRA 3VD9A 2ZA9A 2D7FA 5DUKA 2EBIA 3HBKA 2Z79A 4MGZE 5FLHA 3FHZA 2LKXA 1BR4A 3QU3A 2LH9A 1KGYA 1Q8OA 5KHGA 2G19A 2P37A 4JGZC 1LULA 4JTNA 4YW1A 1H88C 2GP5A 5L9RA 1SVOA 1XSXA 4JBAA 4I99C 3S0MA 1FEXA 1YIOA 3GJBA 4PSWA 4Z92B 4IDZA 5E89A 2EV6A 1G7YA 3WGHA 4M6VA 3CJIB 4A3GJ 3IUOA 1D4M2 5F6FA 2OS2A 3DEEA 2BGCA 2EVXA 2JMWA 3ZXDA 1D0YA 1GZCA 5FMCA 2BOIA 2RS32 3RYKA 4QAWA 3E5UA 4ISQA 4CCJA 2GMMA 4MGRA 5FK8A 2VC1A 4EWDA 3HHGA 4UF0B 5GAEJ 1YHFA 4JC1A 4UUSA 3GTQJ 4CDXC 1JI8A 1N75A 3CQZJ 2XB6C 2P5BA 4S2DA 2RS52 3KB5A 5K5OA 3PUSA 4DBQA 4CDXA 3RJPA 1Z7S2 1EH8A 3WLUA 1JYVA 5JHUA 2CUEA 3IN9A 1QPIA 1HKDA 4HG2A 3OOXA 3POFA 4FFFA 5H9RA 3MVPA 3FMSA 4ZDPA 2XUEA 4YFXF 3RSNA 3Q8FA 2VZUA 2VU9A 1YFHA 2WR9A 3BB6A 5AVPA 2Q0OA 4FFHA 1ZZ6A 2VZ1A 3TEWA 2DUPA 1X1CA 1QQP2 2JG8C 4WZCA 1Q8SA 2FDIA 3Q8CA 1ZELA 1LCLA 4JGZB 3ZSKA 1H2KA 1LOEA 3U07A 3POYA 5T5LA 2QM3A 4AVAA 2TEPA 1IPJA 3K51A 1VBE1 1AYN2 2OZ6A 3HRTA 1IN6A 1W2AX 2UXNA 3H8UA 2O8XA 4YPJA 3IWZA 3A0NA 3AL0B 4AYUA 5T5JA 3ABKH 1X1AA 4ZDLA 3HBZA 3I2IA 4LO4B 4ZTFA 4QWQA 2LY2A 2QCSB 1LNWA 4KIFA 2ZO4A 1YRNA 4CDXB 4IV1C 5DN2A 4RHV2 2VXJA 1XC5A 2X10A 3E1F1 5C3QA 1BIBA 1VBE3 2OPTA 3MUZ1 3ZQLA 5F0FA 3AMNA 4XURA 1MKMA 3QPSA 4IV1A 3CD6I 1HXS2 4W8JA 3ZSLA 2XL9A 2P0WA 5FLXK 1XNTA 1SLAA 4QXHA 1U2WA 4P9WA 4B7EA 1X4PA 4JYKA 5HDKA 4J01A 3S2WA 3ECOA 3O12A 3OL4A 1T8IA 3DPUA 2E33A 1U8RA 2HQRA 1ALYA 1ZREA 5ISLA 4DIQA 3IDBB 1GXQA 1UAIA 2RM21 1PM7A 4DRRA 2JG8B 5IATA 3HZJA 3R0JA 2R7OA 4LOSA 1U9NA 4AVBA 4Q4V2 2XLGA 3UKNA 3GTMJ 2AACA 1RYYA 4XAAA 1T2KA 4E7ZA 1FYKA 3G1MA 1KJRA 5F04A 3FN9A 4WM7C 1LFUP 1Z0HA 3ZN4A 5KCMA 2KZGA 1LOAA 4LK6A 4P14A 1C4RA 3G71I 3LFKA 4EEFG 1T6SA 2RM23 4WM7A 3IIIA 4WV8A 3JXSA 4KA4A 5EYRA 4YW6A 5GAHJ 1OCPA 3U1KA 2P3YA 4NN0A 2M4GA 2ME0A 5ILVA 1V00A 3ZXJA 5KAFC 1TWCJ 2QBXA 2ZKNA 3JRDA 4A6SA 3LSKA 2R7UA 1DGWY 1A8DA 2DU9A 2BWCA 1V9U2 4ZKTB 3O2PE 3OBTA 2O8KA 3POIA 3ZX7A 4PJNA 3T2OA 5C6CA 5J4VA 2GN3A 4HOBA 1ZK8A 3N9LA 3VDDC 3NAPB 4A5NA 1ONVA 3DYOA 3ZLIA 2PHFA 4RGSA 4U36A 3HTSB 1FI2A 2JRMA 5K0UB 3VDDA 1Q56A 5E3LA 1KA8A 3JCIA 1OF4A 2PA7A 2P8TA 4M3GA 2M1BA 1CPMA 3PUAA 1R1A1 5JPMB 5CISA 5IK7A 4BISA 3TKYA 2C6YA 2VJ4A 4OIOF 1VR3A 4MGYE 2C1FA 2FE3A 5FKOA 5L9VA 3VHRA 2EINH 1K83J 1IUFA 2R4GA 1RUC2 4WM7B 2WFF1 4P9FA 4U7BA 5LATA 1NA1B 1LEBA 3DBLB 1OLME 1MEC3 1ZYBA 5LEJA 5FB2A 3P9CA 1ZZCA 1ZH5A 1X33A 4Z6YA 3ALQA 3HWJA 2R6QA 1UG0A 2D6PA 4HVRA 1IQAA 3HXLA 4HKOA 1JKRC 4CCOA 4A7KA 3WDVA 4MQ9F 3VOEA 2QYOA 4U0WA 4M3CA 2JB8A 5LGNA 2WFF3 2JICA 2LY1A 4U0YA 1W99A 5IVVA 1EKEA 1W3XA 2LD5A 3IDCB 3PL8A 4YIIA 3BU7A 1D2QA 3SXYA 1UU6A 4FI9A 2CSOA 1J75A 3J80K 2V1NA 3WP6A 5FZ9A 5ANQA 5E3NA 2Y2ZA 2KQRA 3L2VA 1Z91A 3WTSC 4LLFA 4COWA 3NWKA 4M3EA 2WT0A 2YBKA 3WNKA 1LEAA 2X1DA 4A0YA 4BQ5A 1HXDA 1W8ZA 5CFDB 5F8PA 2GOXB 4E8DA 3AG2H 2X05A 2O9LA 3GYHX 1IQDC 3WQBA 4M72A 1R5HA 2QQBA 3BODA 1P2FA 5D5XB 4J1XA 2AXLA 2ZGPA 1CX4A 3K4KA 4TLGA 2ZEWA 2ZJCA 1CQ9A 3NRVA 5BPXA 3PNVA 2R7TA 2LM3A 4BDVB 1JYCA 2OW4A 1CIWA 2X51A 4DOZA 2K46A 3J8F2 4GMP1 4DBRA 3OSFA 1LFPA 2UWAA 4XOGA 2OTLI 1GYKA 3TOAA 2YUEA 4KG8A 2JA7J 3K3NA 2YGMA 5E1ZB 3JQWA 3IRRA 3U14A 4JTOA 3TOBA 4M3CB 2IW5A 1SBDA 4ZYDA 5JZGC 2F4LA 4BQQA 4XJ8A 2E1MC 1RUE2 3BR5A 2JD4A 2Z33A 1W1WE 5FIXA 3MLKA 3X2QH 1J3QA 5HPOA 1N1VA 4LFUA 2BVLA 3HPHA 4XUOA 5M3FJ 1OHFA 5FPAA 1N77A 3BPZA 3DUIA 2ZGUA 5GALA 3BTAA 3WNOA 2NP0A 3D5SC 1DP3A 1W90A 3KSCA 2JDZA 4MYEA 1PO11 1BJAA 3NVCA 1LGBA 4A3MJ 2IGKA 3L2UA 3OGJA 2W0XA 5KAIC 2X5IB 4M3CF 4H7LA 3GMEA 2O7OA 3KEYA 4K6BA 3EB7A 3C2GA 1KFXL 3WUDA 3WG9A 1WLWA 4IEYA 3I2KA 1XOYA 2E7QA 3L9JT 2O0YA 2UY8A 2KZVA 2DJNA 2VZOA 4MSVA 2JDMA 2OC6A 4BQ3A 2HEVF 4FPCA