2Q1ZB

Crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
185
Chain Sequence
TIRHHVSDALLTAYAAGTLSEAFSLVVATHLSLCDECRARAGALDAVGGSLMEETAPVALSEGSLASVMAQLDRQIADPRAPAPLADYVGRRLEDVRWRTLGGGVRQAILPTGGEAIARLLWIPGGQAVPDHGHRGLELTLVLQGAFRDETDRFGAGDIEIADQELEHTPVAERGLDCICLAATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved structural module regulates transcriptional responses to diverse stress signals in bacteria.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
molecule keywords RpoE, ECF SigE
total genus 36
structure length 185
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12973 Cupin_7 ChrR Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2q1zB01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q1zB02
5J7MA 4I0AA 4HVQA 1CAWB 2GC0A 3HT2A 1J1LA 1H1IA 2PQQA 1O7FA 4AVAA 4UBHA 2B9UA 3ST7A 2CAVA 3DN7A 3ETQA 3WW1A 4HVRA 4X6QB 4XFCA 5FPXA 5AVPA 1RL3A 5I8YA 1ZRCA 3NKTA 1G6NA 1XE8A 1TQ5A 4JV4A 4R8HA 4LULA 3FE5A 3KGLA 1RTVA 3NJZA 4FAHA 3CEWA 4ZU4A 2Q4SA 4HZFA 4IEXA 2XHKA 5T3NA 3KSCA 1ZRRA 1VP6A 3PNAA 2ET7A 4ZU7A 3E6BA 3CF6E 3H3UA 4Q29A 3OGJA 5KHGA 3E6CC 2Q0AA 1CAVA 4EV0A 5JAXA 4EWEA 1YFYA 4PIYA 2HKXA 4UBGA 5BY5A 4D7TA 3SXWA 3PVBB 3WW2A 4IETA 3G7DA 4J1XA 3RNSA 4P9GA 1J3PA 1OMIA 3H1YA 5E16A 4HN0A 1UCXA 2BYVE 3NVCA 2GC2A 1NXMA 2CGPA 3JZVA 3NW4A 4DINB 4ORFA 4E2GA 2XLFA 4HLTA 5FDBA 4KWJA 3HIFA 4XF1A 5C8WA 2XLGA 2XL9A 2XKPA 2K0GA 1EYBA 1UW8A 5CU1A 1GQGA 4FBFA 2I45A 4HSLA 3I54A 3H50A 5BXXA 4I02A 2BNMA 2Z69A 4XF3A 3EHKA 2PHDA 4KWLA 4CYDA 3M70A 4LLOA 3RDIA 2OZJA 4E2QA 3EQEA 3LOIA 2QDRA 3SCFA 2B8MA 5FLHA 3L2HA 5LEKA 1CAUB 1CX4A 2GU9A 4BH9A 4AXOA 1CAXA 2D5FA 2UYAA 1FT9A 4XFBA 3BALA 3MPBA 1WLTA 4JTOA 3H9AA 2H0VA 4ONUA 4EWDA 2D40A 3OTFA 4Z82A 4Z07A 1DGWA 3WW4A 2V09A 4N9IA 1ZZCA 1O4TA 3CL1A 4KWKA 3KGZA 2EAAA 4RD7A 2GC1A 2VECA 4MX3A 3WW3A 1UD1A 4IEZA 4F8AA 1Y9QA 1GQHA 5JSRA 1EY2A 3D0SA 3E6DA 3H7YA 3OCPA 3NSTA 3UKVA 3I59A 2IXLA 4KU8A 5BUVA 1NE4A 2UY8A 3DV8A 1DZRA 1YFXA 3N4MA 1L3JA 2O1QA 4QMAA 1UPIA 4F7ZA 4KU7A 1WGPA 3IIAA 3UKNA 3LAGA 4YARA 2CAUA 2Q30A 1Q5OA 1NYWA 3DL3A 4B29A 3HUGB 2IC1A 2UY9A 4IEWA 4O9EA 3U10A 4AVCA 3QACA 4E2SA 2OA2A 4XFGA 3RYRA 4AQ6A 1IPKA 4N9HA 2QCSB 2IXKA 4XF4A 3S0MA 2PA7A 2QNKA 4IESA 1CAUA 4IEVA 4ZU5A 4HBNA 4HMZA 2P17A 2K9ZA 3DKWA 4FAGA 3KCCA 4I3PA 5KHIA 3H1MA 1CAVB 4QGMA 2IXIA 1VR3A 2WC2A 4IEQA 1O3SA 2Q1ZB 3MZHA 4X6RB 2BNNA 4MGZE 5FPZA 5J3UA 1LR5A 4Q0QA 3PLQA 5JSPA 4NQWB 1HW5A 2ETEA 1ZZBA 4IEOA 2E9QA 1ZREA 5C6CA 4XF9A 4BYYA 3H7JA 1FI2A 4FT8A 3ELNA 3BCWA 4AVBA 3LA7A 3BPZA 1O5UA 1PMIA 1OD5A 1ZZ7A 3RYKA 2OYZA 4KL1A 4L11A 3IDCB 3D0JA 1YUDA 5FQ0B 2FQPA 3NL1A 2CV6A 4YNIA 4TLFA 3M3IA 4QX5A 1OFNA 1YHFA 2PAMA 3LA3A 3E5UA 1J58A 3RPQA 4PJYA 5I93A 4PIZA 4O9GA 3E5QA 4J1WA 2PTMA 3FWEA 2D5HA 3D82A 2DCTA 1PM7A 4YSFA 4BIFA 3H1WA 3EJKA 1O5LA 1VJ2A 4GULA 2BNOA 3CJXA 1DZTA 3SCHA 4K8FA 4I0BA 2H6BA 4MUVA 5FLJA 1RUOA 3S7EA 3U0ZA 3FZ3A 1U12A 1NE6A 3E97A 1X8MA 2ZKLA 4QXKA 5LEJA 1IPJA 3LA2A 1DGRA 4LUKA 5JSOA 1O3RA 3SHRA 1LB2A 1YLLA 4QM8A 2GC3A 5CADA 2PYTA 4I2OA 3FX3A 4XEZA 3QOPA 2VQAA 1YFWA 5JR7B 1EP0A 4Q0PA 4XFFA 1FXZA 4LTAA 2GH2A 1YFUA 3R6SA 5I0SA 4META 1ZX5A 5FLIA 4MGKE 5BV6A 5I0RA 5HI0A 3BB6A 4R52A 5FCCA 2Z2SB 1XE7A 3TNPB 4QM9A 3UKTA 2OPKA 4IEYA 5KBFA 1Y3TA 2BGCA 4I09A 4UXAA 2MPFA 1SFNA 3EO6A 2N7GA 3ZDSA 1RUNA 2XGXA 4IERA 1V70A 2ATFA 1X8EA 2XL7A 1O3TA 3E5XA 1SEFA 2FMYA 2B5HA 4MH0E 4LUMA 5J48A 1I6XA 4XFHA 1CAWA 4XETA 4A2UA 2XLAA 3ES4A 1LRHA 2H6CA 3OF1A 3I59B 3SMHA 3B02A 4HSJA 3ES1A 3C3VA 1OI6A 1ZRDA 2EVXA 1EPZA 5I8SA 5FQ0A 4AQ2A 5BPXA 4L2NA 1NZCA 3USSA 2GZWA 3ROUA 3SCGA 4MGYE 4EWAA 3ACLA 2XKOA 3FHIB 2EA7A 4H7LA 4QGNA 4MGIE 1X82A 3LZZA 3TNQA 3GBFA 4D7SA 2MNGA 1H1MA 4JTNA 4QGLA 2QVSB 3MDPA 2UYBA 2D93A 2PHLA 1J3QA 4PIXA 3U11A 1RGSA 5F1RA 1Q43A 3FFQA 5KHKA 2Y0OA 4JVAA 2GAUA 3HQXA 1ZZ9A 5JCTA 2VPVA 1J59A 1QWRA 1CGPA 3IBMA 1RC6A 4Q0UA 2IXCA 2O8QA 2OZ6A 4LA2A 3RYPA 2QJVA 3CLPA 2F4PA 4YYOA 4MV2A 4Q0VA 3HT1A 1Q3EA 2HJIA 3H3ZA 4HN1A 5I0TA 5I91A 3FJSA 3S7IA 4XF0A 3LWCA 4BHPA 4OFGA 3GYDA 3KMHA 1I5ZA 5E1RA 4HVOA 3EBRA 3BU7A 4EROA 5KHJA 2C0ZA 4WBBA 1ZRFA 5LRRA 3OD0A 2IXJA 4LA3A 3IDBB 4XFIA 1WA4A 4NVPA 4YRDA 1X7NA 1XRUA 5EFUA 1UIJA 1LKNA 1QY4A 1O3QA 5CVRA 5EZWA 1JUHA 2WFPA 1J3RA 1ZVFA 1YWKA 4MZUA 2PAKA 5D1IA 3CO2A 5K8SA 5LRSA 1ZZ8A 3MYXA 4I01A 1ZNPA 3RZZA 2MHFA 4WVZA 1CAXB 4Q0SA 2KXLA 4IEUA 3IWZA 1UIKA 5I0UA 3O14A 2IXHA 2PAEA 2BEOA 2ZCWA 4OLLA 4XFAA 3I7DA 1QXRA 1ZZ6A 4LEJA 5I8TA 4IEPA 5KHHA 1QXJA 1SQ4A 3VHRA 3H8UA 2PFWA 4WZCA 2ET1A
chains in the Genus database with same CATH superfamily
5FWEA 2EFWA 3WR0A 5LY1A 1J1LA 5EDNA 2B9UA 3ETQA 4M9SA 1W99A 2B46X 2QTWB 3PUHA 1OOPA 1C28A 5KR7A 3SEEA 1SG3A 5BPDA 3SC7X 5FZ0A 5D5WB 3JU9A 3NKTA 1U0JA 5BNQA 4CZZA 2A75A 4IV3B 1RTVA 3NJVA 3WP3A 2Y33A 1GLNA 2AEYA 1ZBA1 1REFA 2XHKA 2WRAA 3GZNB 2DYSH 1LHUA 2FUG2 1BR1A 4A6DA 3B7MA 3S8PA 2JIGA 2Q0OA 2D1VA 5EEAA 1GP6A 3VDDC 2JRMA 4ASNA 5DM7F 4PQ9A 5E1WA 4XVHA 4A0YA 4CXYA 3M7AA 4IGQA 2DTWA 2WWUA 2K9NA 1HXS3 1T2XA 4YW3A 1ZBA2 4ORFA 3BU0A 3X2QH 2FHRA 3PDQA 3LWFA 4O5VA 2WZPP 2QF7A 1LOFC 1NAEA 5FMBA 3N7JA 1SD5A 2BNMA 3VZMA 1IS5A 3OG2A 3AP6A 3I9V2 3NEUA 4JQRA 3G1LA 3U4SA 1WWXA 3F9KA 2IRFG 3SITA 4ZXKA 3WX5A 4Y5SA 5F04A 1Y8QB 1LHWA 4YM2A 2DDUA 2MH2A 4CU6A 4MHUA 1MD0A 3T2OA 3S1MJ 2V6CA 4RA0A 3RKWA 1PGW2 4W50A 3RMYA 3NNGA 2WB1A 3J8F2 2PMZN 3GHMA 3AZWA 1HB4A 4AI2A 2RMU2 3IH4A 3ZQLA 3WW3A 3ZXGA 4L92A 3RWKX 1EKEA 3JUUA 1EY2A 3OCPA 1T6BX 3UKVA 1BOBA 2CRGA 3SKJE 2QUFA 2TRTA 5ILSA 2FA5A 4NC7A 4FOYA 2K40A 1K83J 1JI6A 2Y0SN 4ZDLA 1Q5OA 4XOGA 3WF1A 1W9SA 4EZHA 2X51A 3N9OA 4CVUA 2EIBA 2H0BA 2VTXJ 1MBEA 4QQPA 1I5PA 1VRBA 3M3EA 1X19A 3KHCA 1OLME 1RUH2 3ZQFA 4GCVA 5BS6A 2PQSA 3L2YA 1CAVB 2JENA 1TT0A 1ETVA 1Y9MA 3LDBA 4CGZA 1LJ7A 2L9RA 4NQWA 1R081 3K2AA 2J1TA 2M34A 1ONAA 3LNQA 1AA7A 5JVTA 5FYYA 3ELNA 1W5TA 3CJIA 4CDUC 2QQ9A 3HRUA 3NNMA 3HRMA 1RHI2 1WQ2A 1R083 3VDDB 2JRTA 3CNAA 3KLSA 5C3RA 2YG0A 2WFF2 4BK4A 3AKPA 4C0BA 3WINE 4Q4V2 2LRPA 2VJIA 4PJJA 1OFNA 4AHXA 4RR3A 3IDEA 4XYXA 1AHSA 4NC6A 2EFOA 1V9U1 3LCPA 5GM0A 1UNBA 2QQBA 2W52A 2VULA 4GULA 1RR7A 1UELB 1G86A 5J47A 5CVJA 4JGYA 2X1CA 5ILVA 5FBZA 2J1SA 2D6NA 2X10A 1X8MA 2ZKLA 3AP5A 3UJQA 4QXKA 3LA2A 3WU1B 4LG0B 4XSXF 2DT6A 2GC3A 4HRIA 1TQPA 5LASA 1LOAA 3DPRC 4XDQA 3VDBA 1FPN3 1YFUA 2X1EA 3LFMA 3FXJA 2VW1A 5LHHA 1VBE2 1B4AA 5HI0A 2VXZA 4O3MA 2QQLA 4PBOA 1FV3A 1WHUA 3JRDA 2JECA 4Z1VA 1RUNA 3IC7A 2VQ0A 5E3NA 1VZ0A 3CC4I 4A0XA 2XL7A 1RJ7A 1UX6A 2A5ZA 2EH3A 2VZPA 4S2DA 4IV1C 4HLYA 4L5IA 3NAPA 4UF0A 3GNEA 3K75B 1OI6A 1JOBA 5HLTA 3BR5A 2DDBA 4D5CA 4D0PA 3WSOA 3KHBA 1W2AX 1H6XA 4KT6A 4XMIA 2DUPA 1JJ6C 3MW4A 3ERMA 3AL6A 3POJA 2VNRA 3TNQA 3WU0A 2L7KA 1DUXC 3AKQA 3IRQA 2YBSA 1WVRA 2EXIA 2Z4FA 3WGGA 1IAWA 5A6YA 3ZSMA 3IH2A 4I76A 1OR7A 4D7MA 4ON0A 2UXXA 3OSGA 2Y69H 2ME6A 1TMF2 1YNAA 1AR93 2O8QA 1YJKA 4HQMA 4HK8A 3WP6A 2HWB2 1YG2A 2F4PA 2XGCA 1HX6A 2UWCA 2BWCA 1E0EA 1HQNA 4B4QA 3FXUA 4BJ0A 3J81K 2K4BA 1QVUA 3FJSA 3I4MJ 4QQ2A 5J1RA 4UWDA 1UQXA 5DCMB 2CWMA 1ETQA 3O8GA 1EH6A 1R1UA 1W7PD 5BNOA 1IS6A 4XMYA 4HNUA 2GN7A 3COAC 4TZDA 3PIOF 2CH0A 4QB2A 5L9RA 3MF9A 4Y17A 1O4XA 1GFF2 1K78B 4BHCA 2ICWG 1R5ID 2K85A 2RS32 2COMA 1HV0A 4IKFA 3DXTA 2D7FA 1S0DA 1JHHA 1PIV3 2X29A 2HS5A 3CCJI 4RB2C 1R23A 3VBHA 2EALA 2JA5J 4E7HA 2G7HA 3OGVA 3MN2A 3POSA 1XDSA 1UOGA 2WZ8A 1U9OA 1H9TA 3CJQB 3DEEA 4DO0A 1O7FA 5ICCA 4NO4A 3ST7A 3AAFA 1R4MB 4QX8A 4XFCA 4Y33A 3T0BA 1U5TC 5A7NA 3FUQA 4YZ3A 1KA8A 3KV6A 2B7YA 2Z9OA 2VZQA 1YHQI 4LULA 2WS91 2VOKA 2QLZA 4BZ4A 4LMFA 2WIIB 3D5OA 3FK6A 2GXBA 1PIV1 3WP5A 3I97A 4QKBA 1RUJ2 5JPMB 3GZ5A 3OGJA 2QYOA 1SBEA 3KETA 1BW5A 1O4ZA 1LFUP 3KM5A 2KLOA 1EJ9A 4DY3A 4LLGF 3W2WA 4LB5A 3WW2A 5HVQC 4NBQA 4WXHA 3PVOA 3HKZN 2BYVE 2GC2A 4N43B 5LGUA 4DGWB 4LORA 2EQRA 2R5ZA 1GVDA 3HIFA 3WLUA 4JX4A 2M4KA 1R71A 2DAOA 1UW8A 3GM8A 1RUC1 1ND2A 5C5TA 2W95A 4Q8KA 4Y1XA 2P3KA 1ZG3A 4C90A 4NHLA 3F6OA 4XBNA 3WT3A 4GYGA 4KIGA 2R7XA 2DFEA 4P9FA 2GDFA 1GV5A 2L9LA 3HOSA 2VOVA 2ZGLA 2E7QA 1GQPA 4IXLA 1NH3A 4LHLA 5BNOC 1N77A 4U0WA 4WVMB 4ONUA 5FK7A 2G7UA 4Y26A 1H88C 4L0PA 2PBIA 2OW4A 5CFDB 1H2MA 2V09A 1ZZCA 5FYMA 4EGZA 2JUGA 2JWTA 4GYIA 1XG1A 5JHFA 2DVBA 2Y6KA 1Y9QA 3VHPA 5DD8A 3F23A 1W6OB 5IUQA 1RIOH 3LFUA 4LIUA 1TLHB 3DV8A 1B35A 3DFGA 1DDNA 3GHNA 2KDZA 2W1OA 1GWMA 5IPAA 3UKNA 1J75A 4PJLA 3DL3A 2VY0A 3FLRA 1D0ZA 2IC1A 5FMCA 1ETWA 3U10A 4AVCA 2K02A 2VBXA 3LB9A 2VJXA 4K7JA 3SEQA 1F2NA 4FPKA 4A7ZA 3MD2A 2B42B 2QNKA 1SVMA 3RWNA 4XLHA 1TT5B 1FMD1 4QPGC 1GWKA 3KCCA 1ZG5A 2XH6A 3MZHA 2BNNA 2XVKA 2XAGA 3AM2A 3WF3A 4RLFA 1DGRM 2Z42A 3TGNA 5IYYA 5JSPA 2BVLA 1XNDA 4JK1X 3LSGA 2R043 2KIFA 2ECBA 1ZBA3 4A0ZA 1PMIA 1SDDB 5H9SA 2EIKH 4XLPF 2O5RA 5CKQA 1A8DA 3J80Z 1B35B 4UFMA 2IBDA 3J7AY 3M3IA 3O1MA 4E7IA 4XDOA 4LO6B 3ZKUA 5C4WA 2D5HA 2FNPA 2DA6A 2C5DA 5LA9A 2GLOA 4K8FA 4P1WA 1V6LA 3K1PA 2ORXA 4W6XA 2RJKA 4C3IJ 2BERA 3QPTA 3TOBA 1OYIA 2IFRA 5FZOA 1IPJA 3PUQA 1Y8RB 4LO4B 5CEHA 1PO13 4RGRA 4FP2A 1R091 3CMAI 3LDRA 4A3DJ 2XAUA 4PI2A 1FXZA 3KZIC 4LKEA 2ESHA 4GWMA 3JRAA 3O1UA 4HF0A 1R093 3EETA 3HGGA 1CD3G 4L97A 1IUFA 3K4MA 1BM9A 1J0RA 3PIPF 3WNKA 3F8MA 2BGCA 3PMSA 1RMU3 3BJOA 3IAS2 2Y6FA 2N7GA 3V0AA 4XBFA 1XMXA 1F4HA 4GKXA 1HW1A 1YI2I 5C3EJ 4HL0A 1PO11 4M00A 3BPVA 4JZRA 3ES4A 3AXEA 4EN7B 1NCQB 2HWF1 1USSA 3GXOA 2YMZA 4URAA 1SMTA 4UFJA 2LKSA 1VE0A 2Y60A 4A3LJ 1KU7A 3FDYA 5CLSA 4N53C 1FJLA 2JVGA 2WADA 1PZ9A 3J4UH 4HW0A 1WPKA 3KLNA 2CO5A 3MDPA 1PVEA 5LGNA 4INDA 3DP7A 5FK8A 1MSEC 1LQ1A 4FXGB 4N4NB 4DQ2A 2KDOA 3RI4A 3VEPA 1NG0A 3TL4X 1PVXA 2M7BA 1W5CC 2EXKA 3RPUD 5DABA 3IL2A 4Q4V3 1K4SA 4EN8B 2RS52 3CIHA 2SBAA 1R36A 2HWF3 1BZWA 2FXAA 3I3LA 4D8MA 1QNTA 3G6EI 3MUZ1 3BTLA 2CHHA 2ZKNA 4MV2A 2G4IA 3ABTA 4V2WA 2OUMA 3U2RA 4JDOA 3U75A 1NCQA 3SXYA 3LMMA 2QQPA 4PDKA 2I5UA 2HEVF 1JKPC 4L8QA 2DVFA 1ULGA 2NMNA 3ZYBA 5SV8A 2W2IA 4M3DA 3RKQA 2W1WA 2LREA 2IAIA 4LA3A 5DG1A 1WA4A 4NVPA 3ZO0B 1QJEA 1Q1VA 2DUOA 1XNKA 2W39A 4XAEA 3RJ2X 4CUCA 4CXXA 2XUBA 4RLQA 1J3RA 3OYDA 2ZZJA 4MZUA 2E35A 4ZKTB 4IO9F 2HXIA 4KJZA 1R1ZA 3K69A 1ZZ8A 3ZFGB 3RTRA 2K9SA 2J5PA 3RZZA 1W3XA 2VE1A 1COV3 4IEUA 3IWZA 1YIJI 2HWB3 5F08A 3JRFA 1F31A 2ZCWA 5JXGA 3MVPA 3SYTA 3A0NA 3E1SA 4HBLA 2PFWA 3WGIA 2WNVA 3RKYA 3G2BA 1H1AA 3KV9A 1FY7A 1W6QB 3ASNH 1H1IA 4FPYA 2KA3A 1SCRA 4QXBA 2X1DA 1TC3C 5F32A 1RUI1 4XRFA 2M9HA 1ZRIA 3CMGA 4KH9A 2J1EA 3CJIC 4PCRA 4M9XA 1RI7A 2XC7A 5L9VA 2L7FP 2EIGA 2EV6A 2HI3A 4NHXA 5FO9B 4KWUA 1PK6A 4U7BA 3SEZA 2JDKA 4OUSA 1BJAA 1B6AA 3B9IA 3ZFGA 2Q0AA 1A34A 4PFPA 4QPGB 3ZQHA 2V1UA 2OVUA 3JD72 3VSKA 4WM8B 2L7ZA 2BU9A 1OCPA 3GUDA 1VNDA 3NJYA 4KNCA 4IE0A 2R4GA 2RNGA 4B3AA 3U07A 3VBOC 5F2WA 5FZ3A 2FCVA 1S5LC 5ERLA 1K45A 2GSYA 4HLTA 2Q2EA 3ZFFC 1TWFJ 1HQCA 2DUQA 1LFBA 2QWWA 3KS7A 4DYCA 3Q8FA 1UB9A 5F3GA 4JDMA 1ZBE2 1GQGA 4Q4ZF 3I54A 5E1ZB 4LOSA 2IA2A 3VBUC 1VIWB 2BJSA 2XHNA 4KWLA 4CYDA 4LLOA 2LR8A 1W9WA 3ZMTA 3HBLA 3W6VA 1ETKA 3FHNA 4CU8A 1IQDC 5FLHA 4W4ZA 3GGLA 3A22A 4HFSA 5AFBA 4BQ2A 5BNPC 2IVIB 5FZFA 5A33A 3USUB 1ZLJA 4B4PA 2UV1A 4UY8I 2KRHA 2YC0A 2RS33 4EWDA 1CF7A 3WQ0A 5BYNA 5CFDA 2EXJA 5CVIA 1QHHD 5D8AC 4MLOA 4PQQA 1MS8A 4GJZA 4OHYA 5JSRA 2YYOA 3D0SA 2EAKA 2IXLA 4BISA 3N4MA 2QSFX 1RYYA 4EZ4A 2VC0A 3AZZA 1HSTA 3T08A 2IWGB 2Q8KA 2GA2A 4IRGA 3KT7A 2OBPA 1HIXA 2KR2A 2PJRB 4E4DX 3J80K 2V4JC 4UOJA 5T5JA 3HAGA 2RS13 2R7VA 3CDIA 1WMDA 4ENKA 2ZEZA 3M8EA 1GLHA 1N1VA 1L7QA 1U8RA 5C33A 3KV4A 5C9AB 2QM3A 1H0MA 3A01A 1Z6RA 5HOOA 3A4UA 4LO8A 5FAXA 2A61A 2WAEA 2XJRA 3BZCA 5ICGA 2Q1ZB 2I8DA 3FBNB 2H27A 3D4KA 1Z9CA 5JVGF 2VBYA 2DODA 3BKZA 3JBG3 2D5VA 1G3TA 3PVEA 4RR3C 2VCMA 1STMA 4HPQA 1TL8A 5JXIA 1QBJA 2R5ZB 1OD5A 1AR62 4V19K 2EF6A 2WO3A 2MC3A 1FX7A 4AGRA 1XSRA 1VFCA 4EJRA 3BIWE 2M8GX 4G94A 1ZM1A 4A3IJ 3RQIA 1MZBA 2A6XA 3WNXA 2PMWB 3RPQA 2HQNA 5FYHA 1EUUA 2BV4A 2WYSA 2HPMA 4JQFA 3SCHA 5FXWA 1RUOA 4KYWA 2BBAA 1YJ9I 2GXGA 5K5RA 1JZ8A 1OQ1A 2WL1A 4HX8A 1OXCA 4ISRA 1AX2A 5CNAA 1QQP3 1LB2A 3MV11 1ZR2A 5JOWA 1UZWA 4PI0A 2VVDA 4MXWB 4QB1A 3S6PA 4XFFA 3C2GA 1LFPA 4P96A 2EZLA 1RVF2 2EINH 2F5VA 4A6OA 2JDZA 1DU3D 3TNPB 4D1QA 2P5BA 3X29B 3CCQI 1EV13 1MQTB 2VD7A 4IERA 4HV5A 2YS9A 2GIZA 2EILH 5FYSA 4JKMA 2NVTJ 4U88A 5C4WB 4X6AJ 2V1NA 2GMMA 3LEGA 2QZ8A 1CAWA 2DW4A 1J83A 2XF5A 3SMHA 3OF1A 4CP9B 3SFIA 5DUVA 4P9WA 1PO23 1UOBA 1BIBA 5JZGC 1EPZA 1B8IB 1FLIA 4Q4V1 1WCMJ 1LAJA 3KX2A 2K3FA 5FOJB 2FDFA 1UY1A 3LZZA 1JZ4A 3F3XA 4ZZDA 4XUOA 1OQYA 3TW7A 3W59A 3HPGA 5FKLA 4QGLA 2G1MA 4Y1YA 2PHLA 2O61A 5F1RA 1OUSA 2XPJA 4ARYA 1HQWA 1GVJA 2LC2A 3HQXA 3LSPA 1J59A 4E27A 1JHNA 5APAA 2OU2A 2DOEA 5CFCC 3OS1A 2G19A 3BTYA 1HXS2 3H0GJ 4DUXA 4HK9A 2P37A 3EUKL 2Y38A 2XDVA 1FYMA 1P8JA 4YYOA 3ZIWA 2BQPA 4TV7A 1NG6A 1SCSA 3VZKA 4Q0VA 3POWA 2DDAA 4DBRA 4XIDA 5FP3A 1W6MA 5I91A 2GIVA 2R0HA 2VKEA 2FBIA 5H6RA 3IV5A 1VQMI 4CXWA 2GNMA 1ZH5A 5E1RA 4OUMA 2F5FA 3BU7A 2IVMA 1PVC2 3B69A 4FTHA 1BL0A 5DAVA 1RUF1 1TP4A 2RG4A 5C44J 1HRI2 1XGMA 2XXZA 3GW2A 4DRVA 2DCJA 1SAXA 4AFAA 2ZGMA 1E3HA 1VQ8I 2BOIA 4BEHB 4EYUA 4X8NA 4P08A 5DAQA 1AYM3 5LZ6A 5FJHA 3TRSB 2C6SA 1NCRA 2W1QA 4MQVA 1ASJ2 4G4FA 1LPQA 1JHJA 4BM8A 1OQDA 1VMFA 1W2TA 4B4RA 1XNTA 4AI3A 3VHRA 4UB6C 1VBE1 5GZGA 2VQHA 1V5FA 3NAPB 3MI8A 2V26A 4OUEA 3BYWA 5FUNA 2CFXA 3V4GA 1H4GA 3OUJA 3WTTC 3DN7A 5FXVA 5FZ8A 4FP3A 1S8NA 4LBMA 3AKTA 2R1BA 3KP2A 1ZYRF 3V7RA 2RVAA 3I3QA 1IF1A 3CCYA 3TKYA 4OYUA 1KRIA 3KGLA 2YU3A 1LDKB 3BOWA 2ID3A 1S2KA 2LK2A 3ZRGA 4EQVA 2YB7A 2LS6A 4AIHA 2WAOA 1XSVA 4MTEA 2AUYA 4Q29A 3POEA 2DCZA 5F9TA 3K0LA 6PAXA 1JUPA 3OOXA 2CU5A 3LD8A 3HNMA 1X1BA 2XJQA 5A3PA 1JYTA 3UJOA 3NARA 4HANA 3VBFA 4NWVA 3PU8A 2WNVB 3JZVA 3LPGA 4O6JA 4M3EA 4PFOA 1R082 5JMCA 2XVCA 4BMEA 4SBVA 5IFTA 1V6KA 5C8WA 1ND3C 3IM0A 3ZMDA 1NK2P 4J19A 1ACIA 2F5CA 4XF3A 2YFUA 1W04A 1SLLA 5H6QA 2RV9A 4DIQA 3PIJA 1PNFA 3ZXFA 4UHTA 4LD5A 1QO0D 1JUIA 5IVCA 5JUVA 1QJX3 3HSFA 3NNJA 4PLMA 2P5LC 3MAJA 2BXZA 5DXDA 5LCWL 1KS5A 1MJ9A 1R49A 4DRRA 1IN5A 4B48A 1NUKA 3KP5A 4N9IA 3GTGJ 3VKFC 4I98B 1ORKA 4L5JA 1YOVB 1LEDA 2AO9A 1IDYA 1UD1A 4GWIA 4E8DA 3MF6A 1AX0A 3E6DA 1ZBE3 4IV3C 3QPSA 2Q2EB 2VZVA 3MIGA 4BQAA 1XU1A 2O1QA 1OC1A 3ABMH 3R0RA 4DMIA 4IHWA 4YARA 2CAUA 2WR9A 3P6BA 2R30A 2WS93 3PUAA 2BFUS 4D6SA 5GLWA 4AF9A 4XFGA 3CC2I 3AZXA 1UY3A 2QQAA 1AL0G 1PK6B 1JKOC 2XRLA 1T56A 1QIQA 3DECA 2VQGA 1DQ1A 1WCSA 3AJZA 1WCKA 2Y0SA 1AX1A 1GR3A 4M72A 3JD73 3AKSA 2VNOA 5J36A 5C3OA 3N7KA 2E9QA 1RUD1 3SH4A 2A3XA 1TTYA 2DA7A 3KT4A 4GB32 3HRTA 5F6FA 2BTVC 5DPNA 1YI9A 1C3HA 4UFKA 3M1CA 4DZJA 5A7SA 1YIOA 4LK1F 3ATGA 5A1LA 2FNAA 4XJ9A 5F5AA 5FYIA 4J1WA 3MIDA 1A5JA 2YY1A 1UHMA 3AL0B 4YELA 4NMIA 1GNYA 1OH4A 1JU4A 4OQ9A 2ZZQA 3FZ3A 2VKHA 1Z3XA 1DYKA 4GIQA 4WVMA 4E4ZA 2Z16A 4HX7A 1SD6A 4XKBA 3MIBA 4I2OA 5FROA 1QDCA 5ACA3 2VIXA 3GVAA 2ZEYA 2XUMA 4GALA 5J8FA 2WA0A 4XLEA 4A12A 1JYVA 5E20A 1HDPA 2JDNA 1IUYA 4META 4N53B 2QQUA 5BV6A 4AOCA 2JG9A 4R9AA 1HJGA 3PL0A 2OPKA 3A2KA 1MJBA 2MPFA 3BTXA 2F4OB 5IT9Z 5A32B 1V70A 3BR6A 2Q8CA 4XW3A 2IT0A 2RC4A 3DYMA 4XTMA 2D6LX 2IFWA 3DCFA 1B1BA 2E60A 1OCCH 4YFXF 2B9SA 2H6CA 2WTEA 4AEDB 3POBA 3SQOA 2VCBA 4DPNA 2L7MP 4UI9L 3K2OA 3W5MA 3FHIB 3N9LA 2WSVA 2HWD3 1T38A 1OA4A 1X82A 1N75A 4MQ9F 3JREA 1J7KA 3Q9OA 4ZPIA 4WXCA 4BQWA 2HVSA 4JTNA 1US3A 2JDHA 5EP9A 4PIXA 4QHZA 3S1RJ 3K48A 1A3KA 3OYGA 4H55A 4KGGA 3VV1A 1KXGA 1ZZ9A 3B94A 2GMEA 1S9HA 5LW9A 1V6OA 1VBD1 4LBJA 3LFIA 3HHGA 3OYBA 2QJVA 3LQQA 1Y4WA 1DQ2A 1JH5A 2ELHA 2W48A 2R32A 4HKLA 4URTA 4QX3A 4GB31 1YW8A 2HJIA 4FPLA 4BQQA 4XF0A 1R4NB 1DGWX 2BW8A 1SLIA 2WWSA 4RDUA 1AOYA 4QPIB 4N8MA 2OQ6A 1QQP2 1X50A 5ABJA 3GFLA 3ZKYA 4QPWA 1DCSA 4LOTA 1XQNA 5ABJB 4ZDPA 1SD4A 3WXPA 2GNDA 1XRUA 4EN6B 1T6SA 2DN0A 1O3QA 4LBLA 1R5GA 3I2FA 2WA3A 3CJIB 1ZVFA 2NP0A 1DU0A 1JYWA 1KU2A 2PAKA 1SZBA 1J5YA 3OPTA 5A1FA 4DEQA 4Q1RA 3VD9A 1CAXB 4Q0SA 1PUFB 2VOOA 2NOJB 3O14A 2VT2A 2QCOA 1QQP1 5BOXA 1HB1A 4FX4A 3GTLJ 3B5LB 4JX5A 3OOUA 2O8KA 4BXFA 1KQ0A 3LSRA 4UUTA 4P5OA 1GOGA 1WCUA 2J1RA 2FDIA 1HQLA 4B47A 2WT0A 2QZ3A 5FKMA 3HT2A 2RR11 2J42A 2I10A 3KT1A 2CAVA 2BP6A 4HVRA 2X05A 5J3LA 3OIOA 4GRIA 1H4HA 2EPFA 1ZRCA 3Q8BA 2R7RA 4R8HA 4P5YA 1JTXA 3HSEA 4YW7A 3M07A 1HKSA 4EJTA 1WH7A 4N43C 2W85A 5LB6A 3K2ZA 3WDYA 2BRTA 2GP5A 4OI0A 1U0AA 2ET7A 2X4HA 3MBWA 2DOFA 4B7EA 5KHGA 2MGQA 2VZ1A 4A3ZA 4M3CB 3LF7A 2Q8OA 5C5UA 1IG7A 4M3CA 4D6RA 1IKPA 2ZEWA 2V5YA 1S0EA 2E26A 4J1XA 1N1SA 3NAUA 1J3PA 3VBFB 5L36A 2FRHA 1LUJB 2KPMA 4RHV2 3VBSC 2ID4A 2WN2A 3UNGC 5KVRA 2JPCA 3O1RA 3SQNA 1SAUA 1C8NA 3GCMA 2LALA 1BQPA 1BCXA 1O4YA 3SZPA 5BNPA 4LR4A 1EH8A 4B3NA 2ARAA 2LY2A 2LFBA 2PHTA 2FBHA 2YFZA 5FZKA 2JB8A 1UZYA 1P4WA 2BY2A 4RHV1 1HKDA 4LIVA 2FBEA 1BVVA 1LDDA 1DP3A 3MPPG 3OV8A 3CP8A 4XUPA 2CQ7A 2JD9A 1OUXA 3CMYA 2FQ3A 4DZPA 4PGGA 2OTJI 1HXS1 2DFCA 4IL6C 1LNWA 3EDPA 2E51A 1D0YA 2FZ1A 2ZJ2A 4EJUA 3GZAA 2GWRA 2CQKA 3FMQA 5EEHA 3GZEA 4BWOA 2OX0A 4KU8A 1W06A 4C1XA 1AL23 1YFXA 4UFIA 1PNGA 2E5NA 2E1OA 4F7ZA 2HU9A 2F6BA 2QENA 3ECHA 3MIEA 1UOJA 4LT5A 5DUKA 3BG6A 3PUFA 3IIIA 2JA6J 5DV5A 2P2KA 2W1SA 1WI3A 3SFZA 5LBQA 3RYRA 3TEXA 1TNSA 1XS9A 1POQA 1W7PA 3PSFA 4HBNA 2JSCA 2N8GA 2M2EA 1DGRN 3PQKA 1XXNA 4QPGA 4YGEA 4WM8A 3HBZA 1GANA 3WTUC 5A6ZA 2IEKA 2W87A 4RQPC 2UU8A 1XCVA 1D7PM 2LF7A 4AIKA 3MO4A 2HKOA 1GBGA 3J9SA 4HONA 4L11A 5IYDJ 4XIKA 3RS6A 4F3QA 5FP9A 3WTZA 2CV6A 1M4WA 2VNVA 2C9AA 2PJPA 2VMIA 3LA3A 3E5UA 1CESA 3HQUA 4HOBA 2PTMA 4YGCA 1VBB1 2ACJA 2IJLA 1D5YA 2BNOA 1SHWB 1K7AA 2ZNYA 1YQ8A 4MUVA 1K78A 3GJBA 3USUA 3AG2H 1H6YA 2XAFA 2K9QA 3HOWJ 1OCOH 4P00B 4V2FA 3AYDA 5DUWA 1V4RA 3CF2A 1W6PB 1IS4A 5GAHJ 5JZGA 4JX0A 4A5MA 2XOMA 3GEZA 1E2XA 1MMAA 4XCBA 3MUY1 5GJ6A 2ZMEB 1MH4A 3VKMA 1U9NA 3R6SA 4GO1A 1VQNI 3VL8A 1MW7A 1UAAA 4A6EA 4RGKA 2E7AA 3R60A 3BB6A 1GU3A 3V42A 1B09A 9ANTA 3DXJF 2XB6C 1XNAA 4NHMA 2KIMA 2QKMB 3KEQA 5A32A 3PO2J 3OMYA 3KZ4C 4LHNA 4CCLA 1JI8A 3Q9VA 3C1DA 1MMSA 2ATFA 3QOEA 1XYNA 1SFPA 2DTZA 3ZSJA 2EV0A 1YI7A 3OGGA 5J48A 3ZOBA 2EZHA 2DMPA 5FY8A 1KITA 3MFKA 4E6KG 1HB2A 3NWTA 1UYPA 4NAMA 3WDXA 1DLLA 5DG2A 4DEVA 5F0CA 2HQ5A 1C8M3 1HA8A 2ZGSA 4MGIE 5E8AA 1JZ2A 2ZGRA 4OMYA 3AZVA 4QQOA 1H1MA 1FMWA 4KITB 3M7GA 2VE9A 1IZ3A 3QPHA 3DBLB 1TQMA 1LHVA 2P1BA 1ENXA 3BR0A 2OD5A 1I9RA 2ZGOA 2JE8A 1WJBA 2JDAA 4Q0UA 3NMBA 3VSLA 3M3OA 2R5YA 3AFKA 2EZIA 4AVSA 4IV3A 3R05A 3JQWA 3J7MA 1HCRA 1G9CA 1B72B 4U0VA 2VT3A 4Y20A 4DJAA 4BIOA 1Z7S3 1JOJA 1GYKA 2PQ8A 3LOCA 1I1SA 2FDKA 2LY1A 4BBRJ 1LHNA 4AAPA 4AI9A 3BOQA 5KHJA 2A3YA 2E2HJ 5LA1A 3IDBB 4XL9A 1MZ6A 5ACA2 3WY6A 4BE2A 2VJ4A 3HD8B 3RQ4A 4FTBA 1RUD2 4R4ZA 4A42A 1HDKA 2P81A 3ULQB 4ESFA 4M6XA 3THPA 2XONA 1YITI 4LNVA 1RUC2 2KXLA 1FOD1 5FKCA 2XF6A 4P9IA 3DTIA 1AXZA 1TNRA 1KFXL 4Z6YA 5I8TA 4IEPA 1RINA 4COZA 5HCFA 1Q8PA 2LDUA 3AB0A 2CNAA 1SFKA 2K9LA 1ND2C 1R5HA 4BQNA 1CAWB 3C7FA 2VH9A 1RB8G 2MC4A 3I3MA 5J4VA 1ZTRA 4HNTA 2JPBA 5HLGA 5CG8A 4OVEA 5DUUA 2JD4A 3CQOA 1GP5A 1ND3B 3A4CA 4G6QA 5IVBA 3I71A 3Q0WA 1GSLA 3FE5A 5FUPA 2TEPA 1ETYA 3WF2A 4D0QA 2WQ4A 5T3NA 3KSCA 3QODA 4WVWA 1QPMA 1C57A 1ZRRA 2B63J 1SD7A 2V72A 4ZU7A 2PHXA 2P6SA 2HVQA 2W91A 1R1A1 5FIXA 5H9RA 2WSUA 2V9VA 1ACCA 5FZGA 2NPIA 2Y9ZA 1D1CA 4OWRB 4D7TA 3SXWA 3E6MA 5FD5A 3O7OA 3PVBB 2D3RA 1V9U3 1WSUA 1EV11 2Z5WA 4XMAA 3ILRA 3POYA 3G7DA 5DZEA 2A1XA 2Y9YA 1OLQA 5F64A 3BUCA 4QD2A 3OBAA 4RAYA 4CUBA 1W6MB 5JDBA 3C2UA 4LKDA 4PLNA 1O7LA 3WTWC 4CCNA 2FOWA 3TW6A 2IS1A 2KRCA 4IUGA 2AZ5A 3VUOA 2A5YB 4YZ4A 5LHIA 3MKLA 2WZR3 3OPZA 2FJ1A 3OYCA 3W6JB 3LOIA 1DLCA 2XASA 4AHWA 4IJAA 5FO5A 5LA2A 1PGW1 1W9YA 1F1ZA 1JTZX 3BALA 4QX2A 3H9AA 3OBRA 5M0TA 3LSEA 3HJRA 3OTFA 4LK6A 3ELKA 1H2KA 4RR3B 1MIJA 2VOWA 3L9FA 3R4KA 3GTPJ 3JAMK 3KGZA 3ZN6A 5FO7B 1KQ8A 4L9VA 3KEOA 3UETA 2KZVA 1LVAA 4MGTA 4AZZA 1X1CA 3VL9A 4UF0B 1NE4A 1QH7A 3JB8A 1UPIA 3VLBB 2LLKA 1YJWI 1YQCA 4YW5A 1D4VB 1LU2A 2BVMA 4ZS3A 3HVDA 4CA0A 1G59A 2OAZA 1Z67A 3RZDJ 3F8CA 3QACA 4H3WA 2OA2A 2VMEA 4AQ6A 4N9HA 4F83A 4XF4A 4XHBA 4IVNA 5AIPA 1XB9A 4HMZA 3T0AA 4HX4A 2LKXA 1FOWA 2IXSA 3P1IA 1W0UA 1R1TA 1JGGA 4I3PA 1JZ5A 5ERIA 4YG2F 2W46A 4D6QA 4XUTA 2CSGA 4YFWA 3PTRB 4BMBA 4L99A 2CJJA 4BKXA 3RZLA 4Q0QA 4QXCA 5TISC 5FP4A 2MEV1 5CG9A 3W2VA 1BI3A 3ORJA 3ZSLA 4HAMA 5GZDA 3E7LA 4KN4X 2FX0A 2AXLA 3HL2A 1F43A 2R7DA 1SEUA 5FLXZ 2HDCA 3TB0A 4XCAA 4A5NA 1OCTC 2VCAA 1AR92 4OAYA 4YW6A 4HDVA 4C0HA 3IN9A 2A6HF 5F1JA 4KDPA 1S72I 1J58A 4GKYA 4PJYA 3D5SC 3ZQIA 4D3WA 3OYMA 4ATEA 2XG3A 5HXMA 2QQKA 3O1VA 1YX5A 3U14A 4I7HA 5KCMA 2EJRA 5J4YA 2UWAA 4NIAA 4KN7X 5IAVA 3MMYB 1PDNC 3K70C 2PLYA 1MBHA 2KIQA 1MQTC 3NV2A 1YLLA 4UUSA 1X1PA 2VQAA 1YFWA 2ZXWH 3MFCA 3HOTA 5JI7A 3CU7A 1POGA 2LVSA 2MEV3 2CS3A 2VVFA 3RSJA 1ZGWA 2FMLA 2NYXA 4R52A 3S32A 4QM9A 3VBUA 1CQ9A 1XYOA 3BG9A 5EJ3A 5F3IA 3EYYA 5DQ0A 1ZLKA 4BJ6C 3V8JA 4ZYHA 1TME3 4UXAA 1APNA 2ZGNA 1L7RA 2AR6A 3F8NA 4I6ZA 3GBGA 1UKGA 2B4KA 1RUE3 1KZHA 1G3SA 1JE8A 3M1EA 1BVP1 3VZNA 4RS5A 2VQUA 4ZY9A 4PJ0C 3QQAA 1MBJA 4CTEA 5F6KA 1QXPA 3VZLA 1N25A 3I59B 2PFBA 3ES1A 4UFHA 3K77A 1NLSA 1FNNA 1K61A 5FQ0A 3TP0A 3GFJA 3Q0UA 1XB4A 2EIEA 1B9NA 2GZWA 1W8FA 4RGGA 4BDYA 5ICFA 3IPVB 2LBFA 2Q5TA 3BZ6A 5M5WJ 2Y6JA 3H0OA 3I2HA 1WW6A 5LD2C 1NY71 5K9YA 3ZP5A 2P3IA 2VPRA 4S04A 2QFEA 2MD5A 2WJSA 3C7EA 1V00A 5ISLA 3N7LA 4AE2A 4LA2A 3RGBA 4DYQA 4DW6A 1U3EM 1H8TA 3NWKA 3A01B 4LBQA 1SVOA 2AQFA 5FFZA 2B9VA 4HN1A 3F8BA 3POGA 1EUTA 2C24A 5AFEA 3WHUA 1D3YA 3RVHA 3ZR8X 4E70A 4HVOA 2G9WA 2C0ZA 4QKFA 1ULYA 3BT9A 4BXUA 2YPDA 1ZA7A 4KISA 1FSHA 3OB8A 4IDZA 1OKRA 1WD3A 4XTPA 5IVVA 3DGTA 2BW3A 1LKNA 1W8UA 2E7TA 4JRLA 1CJDA 4LXLA 3L2WA 4R4XA 1V6JA 3FM5A 1LHOA 1O6UA 3THDA 2R7FA 5FB2A 1QU3A 4XPVA 4COWA 2D6OX 4MNUA 2BEOA 4DOZA 2FE3A 1W6NB 3I3EA 1B72A 3OYAA 4EEFG 4AEDA 1MACA 4Q4X2 4I0AA 4EGYA 4HVQA 2R0QC 2EFPA 2DPUA 1OSGA 4PF1A 3A23A 3ZM8A 4XKVA 1OOPC 4A3XA 5JI6A 2DA1A 2WS92 4QHBA 4AGGA 1LU1A 4UAPA 4N90A 3CMMA 1WLCA 3VHNA 5FMDA 4BS9A 3HKZA 2NVYJ 3OYKA 1AZDA 1E3OC 3HN3A 4B3XA 1K5JA 1QZEA 3OY9A 4QQLA 3E6BA 3WNOA 4M3GA 1I3QJ 3AP7A 4IF4A 2AH2A 3OR2C 3ESWB 2HKXA 1HC8A 1GZWA 1S2BA 2BDRA 1W39A 5A3UA 2R062 4LOCA 2BBVA 3IZOA 3C2BA 1Q8SA 3M4OJ 1X2NA 1KJLA 2JA8J 3AKRA 2EZKA 4JCKA 1UYZA 4H4KC 3V0BA 3ZQ7A 5L3FA 2XLGA 1OR7C 1G9FA 4I02A 2QBYB 4JGYC 1TEIA 2FD8A 2PHDA 2KIUA 3U9GA 2JMWA 2B8MA 3MW3A 3B9CA 4WV8A 2O8XA 3LQRA 4QSHA 1XJAA 1QMJA 2QSGX 3FHZA 1CAXA 1CR7A 1EPWA 2D5FA 1X4PA 2TUNA 1WLTA 2Y75A 2DT7B 1NA1C 4EJOA 1SLTA 5K5OA 3HEFA 1HN0A 4MGRA 2IGMA 5HV4A 3I0TA 1RUG3 5B4XA 2J1VA 3T1BA 3L9JT 4L5EA 4IEZA 1XNBA 2QKDA 5AC92 4AU7A 3KP3A 1ULFA 3RQ0A 2R071 5HNFA 1H9PA 2WZR2 1WJCA 4OOIA 4UVAA 1HBXG 4XUNA 4QPIA 3AG3H 2FDHA 4B29A 1MEC1 5EJCA 2FU4A 1JXNA 1MMNA 1AR71 3I2JA 3BDDA 3CZUA 3R4UA 1E5RA 1QZZA 4XOTA 1BC7C 2XQRA 1D8JA 3G1MA 4PT6A 2K9ZA 1MS0A 2DU9A 5T55A 3PFYA 1NCRB 4FAGA 1SACA 2M8EA 3KLOA 4LITA 1XD7A 3ONQA 2HZDA 4FPOB 4S0HB 3EB7A 3QYFA 2KHMA 4YW1A 2VLAA 2FMDA 2YU9J 2L54A 1AR83 2A6ZA 2WB1N 3M3CA 5J3UA 4UNOA 3KPHA 4AVTA 2YX4A 4QU2A 2CUEA 2CUFA 4BYYA 1FI2A 2YPRA 2HDDA 2O9LA 3K4NA 1AXYA 3HR9A 1JN2P 2A71A 1F9NA 4JQTA 1SLCA 2RS53 5T5OA 2X6XA 2BVBA 2ZMKA 3RMXA 1HLCA 4LHSA 3WNMA 3LEKA 2ZNZA 4KMFA 3FWEA 2XMLA 5H9QA 1WJ5A 1WW4A 4C3JJ 4ZONA 3CUQC 3ZN0A 1RHI1 3P3NA 3V56A 1XSQA 2ELKA 5IYCJ 1VQKI 3L1PA 4YFKF 1MVEA 1JUSA 3E97A 1NE6A 3Q5FA 1O3RA 2VBPA 3DU5A 3ILFA 3WNNA 2HWVA 2P7CB 2G0EA 3AMPA 2XUEA 1OVSA 4U2AA 2E71A 5FKBA 4CHUA 4WM7B 2H8WA 2PLV2 5KXCA 4CCKA 5EJ1B 3N36A 4Q48A 5DAXA 5BMZA 1WCDJ 4XQDA 4IW3A 5JXHA 4NR1A 1ULDA 1BIAA 3TO6A 3HYIA 5A3WA 3TP3A 1VALA 3ZR6A 2VZUA 2GQQA 3POIA 1NLRA 3IKWA 2RMU1 3IMNA 4IE6A 2FDGA 4D7NA 4CUAA 3LFKA 4Q26A 2JSPA 5FLVA 5FZDA 1MZ5A 3BTZA 4BE0A 1LVKA 4Q4W2 1MDMB 4QPIC 3KQRA 2VNGA 3WDVA 1WWYA 1VB2A 1T98A 2HBTA 4BXXJ 2NM1A 1Q56A 2XPUA 3WQ1A 1X1DA 4KT5C 3ZYGA 2VC9A 4RAFA 3T8TA 4QWNA 1SLAA 4EJWA 1C5IA 5FYCA 2HDWA 3GBFA 3ZR5A 2P0WA 4P9XA 1BOAA 4BNCA 1QJY2 3JRHA 3VDXA 3GBWA 2AXTC 5D8AA 2KD7A 4D69A 5JLXA 3FFQA 3KCYA 4XORA 5JCTA 1QOOA 4FTSA 4TLGA 2RVCA 5EGOB 5K7ZA 2IXCA 4RS5B 3AP4A 4AI8A 4N0BA 3RYPA 1COV2 4B1MA 4IHYA 5FMOL 4QPYA 1C5HA 2ZXJA 3OSFA 1G8WA 4AFCA 2V1DA 3LAJA 4YM1A 2W84A 5I0TA 5M3MJ 4OULA 4DS0A 2VBZA 3FKIJ 1QKQA 4YM0A 5LRRA 1RJ8A 4Y5Z0 2QQMA 3TN93 2K4JA 2LNBA 1UIJA 1GKBA 4BQOA 1K79A 3PNVA 4AFDA 5GZEA 1XPXA 2ZBJA 5DDJ3 1BBYA 4CUGA 1MR5A 2OQGA 1WBLA 1QZYA 2TDXA 4E8CA 1OF4A 4LB6B 4K20A 3HB9A 4RGSA 3RSNA 5I0UA 4TWTA 2DA2A 1BYHA 1OHFA 3BCAA 3CJTB 3H42B 4KUMA 3VBHC 1CX1A 4P14A 3WG2A 1SQ4A 3ZMOA 3KYDB 2DTRA 2EIJH 4OMZA 2A6VA 5L3GA 4CP2A 2IVJA 1Y6IA 3TN91 5LATA 2PQQA 2PMUA 1WFXA 5A7QA 5IJRA 5EPAA 3RCOA 4B43A 1UPSA 4X6QB 2ENRA 5JZGB 5T5LA 3MKZA 4JGZB 2AS5F 5I8YA 2UWBA 5FP7A 5A3TA 4JHZA 1QGLA 4CPBA 4IEXA 1R58A 2DBNA 2GOMA 1AHDP 5M5YJ 4UVBA 4PK4A 1RUI3 5FPAA 4CDQA 3VD4A 4UBGA 2JJ7A 3ZMZA 2DMQA 2DFIA 3RZJA 4DXRA 2VJJA 1J84A 4U0YA 5E16A 1GZ9A 5J1UA 1RVF1 4KICA 1H8TB 1NXMA 2LM3A 3NW4A 1OPOA 2R7QA 5LHGA 3VKOA 2K2SA 4FX0A 5IP9J 2QE3A 3CCSI 5LFAA 4A3JJ 3G6JB 4IL7A 5KXEA 2F17A 1HKTA 4QDSA 3RZOJ 1K6OA 1U2WA 2Z69A 2L5QA 3ZDVA 3W2AA 3OUIA 1QOSA 2IGOA 2NVQJ 1YLFA 4FPJA 3GTOJ 4LE3A 1WLWA 2DJNA 1PMJX 3L2HA 4KA4A 1HB3A 1HRV2 4NB5A 5HS7A 3ZX7A 3ZXAC 2ZAAA 4XFBA 4JOMA 1V5EA 1JYIA 4FCAA 2H09A 4ETSA 5FZCA 2L2OA 4Z07A 4ABZA 3TAYA 1UKRA 3ZIXA 1PGL1 3RI9A 1BI2A 3OS0A 2W08A 2MW8A 1POV1 2DBIA 2GC1A 3ON7A 2OCEA 2IGNA 1ZR4A 3BQZA 5C71A 1ENSA 3I4PA 2R7TA 1TVGA 4IHSA 4LMYA 1DZQA 4F3JA 4UV9A 2E34A 4Y4RA 3WG1A 4WXDA 1YFHA 1RNLA 1LOFA 3FXRA 1ND3A 2OUHA 1MGTA 5IT3A 2V9PA 1PX3A 2R93J 2DF7A 4IRIA 4XJWA 2ES3A 4AD9A 3IUOA 4MSVA 1PUFA 4JGZC 3DEWA 5IYBJ 4IQ4A 1C8M2 1O3SA 3VYRB 1T0FC 3C3WA 1GZWB 1IS3A 2LY9A 4F92B 2HWC2 3ZXDA 2BY1A 2L9SA 1Z91A 1LR5A 2Y48A 5IT6A 5C6CA 4FT8A 2YU1A 1W90A 4DXTA 4AQSA 1QU0A 3BQYA 3N9NA 2LUWA 1YUDA 1VQ6I 4GWJA 1AR81 4DYRA 4YGBA 4WCGA 1Z1DA 1QNWA 4Q47A 1AJOA 1ASJ1 2JICA 2PAMA 4A3CJ 1LGNA 2XQXA 5I93A 1I27A 2V1XA 5HV0A 1BN5A 2EV5A 1Y7BA 1G8XA 3LOBA 1X4OA 4OHWA 4R9CA 1QGPA 4HT1T 3CJXA 3IKTA 1EV7A 1HDDC 4CDQC 2B45X 3NRVA 1BA5A 3Q8AA 2K5CA 1WW5A 1AR82 2X0LA 3DYPA 5LEJA 1CZTA 1AVBA 3V65A 5FZ1A 5CADA 2VONA 5DDGA 2W1UA 3PUIA 1S1AA 3BTJA 3BG7A 1GV2A 2VKDA 5FO8B 3J8F1 2GH2A 4CDUA 3URFA 2E1MB 3M2MA 5ACA1 5DUIA 5JOXA 5FLIA 4CP0A 1XE0A 2ZHNA 3OYWB 3BWGA 3WODF 1JXSA 1Y56A 2VASA 4I09A 4G7HF 3ZLIA 1ASJ3 5HPOA 2CUJA 3KFWX 4LG0A 2VODA 3KP6A 3GFMA 3WGHA 1IXCA 2CMPA 1X8EA 1D0GA 2HOSA 2H1LA 3E5XA 4PHZA 2JXAA 1VQPI 1SEFA 1ZELA 4Q27A 2B5HA 4IHXA 2HNHA 4LUMA 1TZOA 2JJ6A 2L4MA 4DOUA 1H30A 2JKXA 2XLAA 2R7SA 1AYM1 4BJ5C 4FISA 2Y8KA 4LBNA 4KI5M 2VZSA 3LQCA 2M30A 2BXYA 1NOVA 3USSA 3A1YA 4BU2A 1FMD3 5EXOA 4QGNA 4P55A 5F27A 3HM5A 3FN9A 3LSIA 3NNLA 4BGDA 1KQRA 3IHUA 1RESA 2F48A 1C1LA 3IRRA 1JU3A 4MHRA 4XK4A 4B44A 4NDLA 2NVXJ 3K1NA 3BTCA 4ES8A 2HOEA 1H9WA 4NHJA 1V9U2 4CCDA 3LL7A 1O8PA 2WFF3 3HC7A 1KEXA 2OZ6A 2M0CA 3CLPA 4Q4W3 4IV1A 1ZGAA 2YU2A 3MLLA 3H3ZA 2VMCA 4XKWA 3DXUA 4NHKA 4XONA 1RC9A 1P7IA 3MZYA 3I8TA 2R073 1LECA 3LWCA 4BHPA 3L2VA 4UUSB 4O61A 3UGHA 3U1KA 3S93A 4ZYAA 4CDXA 5F7UA 3OWTA 1PVC1 1FOKA 2RR13 2ZX1A 3DEUA 5CVRA 4P5HA 4OHZA 2JN6A 2WKKA 3TEZA 2ELJA 3EPZA 2F4IA 4C9YA 1VAVA 4XBQA 3WNPA 2D3PA 1SBDA 2XB0X 4V2GA 2MHFA 3JQXA 3ZYPA 1ETXA 4D9JA 4F55A 2ZEXA 1ZHFA 2E1MC 4OI4A 4XAAA 1WW7A 4AYUA 1QXJA 1T95A 3BY6A 1SANA 3JSPA 3BZKA 3WVJA 5JOZA 4G12A 4XUQA 1REEA 1PVC3 4Q4Y3 1FTZA 1IG0A 4RFRB 5FUIA 5FPXA 1OA2A 1W6PA 2YUSA 3ABUA 1B59A 2WT1A 1TWHJ 1DHKB 3SEPA 4FAHA 1MNEA 1A04A 1UU6A 1XGOA 5L19A 1OLMA 3CCLI 2JEMA 3K10A 1K3IA 1RZ4A 5A70A 3PNAA 4JKLA 3CZ6A 4ZDOA 4PJMA 1X2MA 1GT0C 4L18B 4NAOA 2WFF1 2WAAA 5DN2A 3OUHA 3HXLA 2XBO2 3SH5A 3CCRI 5BNNA 1TME1 2UURA 3RZHA 3I4IA 2BGPA 1YRZA 3VBOA 3MWMA 4IOCF 2COBA 3WHTA 2ZABA 4Q5OA 5JHUA 4JX6A 2QQNA 5J96B 3S3NA 2EB7A 5D8KB 2CQXA 1LKXA 4ASMB 1VQOI 5E1XA 3CDHA 4AIJA 3EQEA 5FFXA 1OPMA 5D21A 3HQRA 4GMP3 2LTNA 1D5VA 2V9KA 4A3EJ 4XJAA 2CGNA 2B0LA 4Q4X1 5KNLA 2RAEA 4JTOA 1XMAA 4II2A 2ZJQF 2H0VA 1ND2B 1Z0XA 1HV1A 3KVBA 5EQUA 2VR4A 3WW4A 4K1YA 2P6CA 2ADUA 2D6KA 4YVSB 1O4TA 2BE5F 1U5XA 4YFZA 1XBFA 5IT9K 1H2LA 5JXJA 4B1LA 2GNBA 1OH3A 4F8AA 2FCUA 2WABA 1QA6A 2YBKA 1WCQA 2BGOA 3Q8CA 2DYCA 4CPBD 1BK1A 1ULCA 1GOHA 4NPRA 2UXNA 2XROA 2IS4A 1GICA 1FAYA 4HKOA 3DF8A 3LAGA 2FCTA 2DI3A 5FXZA 1NTCA 3WTXC 3I3DA 4N7UA 4WWCA 1KU3A 3A21A 3WDUA 2OTLI 4M0HA 2IXKA 2K7LA 3LSMA 2M4GA 2YBPA 3OD4A 2LRDA 2VKVA 3ILNA 2J1UA 1UWWA 4D5FA 2P8TA 1RUI2 2HWD2 4IEQA 3DKYA 4X6RB 1TMF1 4FHTA 1DPRA 5LA0A 2P34A 1TZLA 2XPWA 2EICA 5JMOA 2HTJA 3H7JA 3HNYM 2MA3A 1QVTA 4AVBA 3BPZA 2D98A 1B9MA 4AVVA 1ZZ7A 2JDUA 3RYKA 2PMHA 3IDCB 1IRGA 3TMOA 4QDRA 3K4JA 1PUEE 4BOWA 1G7YA 1NT0A 4FO9A 3K51A 4FXKB 1OKQA 2KM2A 1YHFA 2QBYA 3H9JA 1ULEA 1S55A 2P4EA 3LAPA 1BR2A 2M5WA 4XJUA 3LSHA 1WGXA 4O65A 5FPUA 1SVLA 4ISQA 3L2CA 3DPRB 1UG2A 3QP6A 3QBQA 2A07F 3I2IA 3U0ZA 4ZXEA 1PYVA 1W05A 1AR73 1U12A 1V3FA 3PJRA 5C8CA 1UG0A 3BJAA 4NJ4A 4BXSV 3O3KA 2WZR1 4W65A 3R4DB 4QM8A 4PDWB 2NXNB 3QOPA 2PHRA 1JGSA 3AP9A 4X0GA 3L00A 1MEC2 1ON2A 4COYA 4RBOA 5IAXA 3ACGA 1DF0A 3HOVJ 2HGCA 1TQIA 4XQWA 5L7OA 2XGEA 3V7CA 4M73A 4YIFA 1QJZA 4NN0A 2ARXA 1Y3TA 3HPHA 3OSDA 1UYXA 3TEDA 2FQ4A 5LGTA 1LGBA 2WNUA 5HDGA 1CIWA 3UGFA 1UN1A 1MBFA 3O1PA 4KBBA 5HDNA 1MS4A 3FM3A 2VUDA 2MH9A 3VOEA 5FPLA 1MH3A 1T33A 2LOOA 5JPNB 5GPCA 3T09A 4CEYC 4BJTA 4EN9B 5K0UC 2LROA 5I8SA 3HRSA 3LPFA 1O8SA 2KISA 4L2NA 3Q0VA 3FBYA 2EA7A 1YJNI 1V0AA 1ZKGA 4H7LA 1UY0A 3AYAA 3UL2A 1RXFA 4F91B 2G9GA 4ASLA 2ZX0A 3QH7A 4KFCA 4Q4Y1 4PGHA 2RDSA 5LK7B 4MO3M 1MNMC 5D5XB 5BNPB 1SFOJ 3F72A 1FOD3 2R063 3GCXA 2LTPA 1DDLA 2CSOA 4HQEA 3VBRB 2DVDA 1A6QA 1W03A 2XJVA 3ECQA 1E5IA 3DKXA 3H92A 5GTIC 4BEHA 2L4AA 2FEZA 1AU7A 3GYHX 2GMPA 3HOYJ 4F93B 2OXBA 3R0JA 2XF7A 3DBHB 3KMHA 2G9ZA 3QYEA 1Z6TA 2WO2A 3A0KA 4EROA 4RAGA 1PK6C 1Y9GA 3HHHA 4OQ8A 2IXJA 3L2RA 2ZACA 3OL3A 1QHDA 3DTKA 1X7NA 2DYRH 1QY4A 3RG0A 2JK3A 1NA1A 5K8SA 2IPQX 4HV6A 5CYVA 3MYXA 1XDUA 4PDWC 3L7WA 3K4CA 4OMDA 5A1AA 1RMU2 3U37A 1MJAA 5J98B 1RUF2 2NLRA 1YYVA 1Q8OA 5FPBA 2RDPA 1DYPA 4OHXA 5KHHA 4M6VA 1URXA 3WUDA 3SISA 2M7AA 1YQ5A 4LKFA 5J7MA 4MFDA 5D5UB 1ODDA 4RYDA 1F36A 5FV3A 4FQ4A 5LBFA 4FASD 1WMXA 1WBFA 1YS6A 3WTVC 2RR12 3ZFFB 2OS2A 4EJVA 2XV4S 1BEV1 2ID6A 5JLVA 4M0NA 2NNYA 5IW0A 4PUSA 3PMEA 1RUH3 1EF4A 3VBUB 3N05A 2CDOA 3ERED 1NA1B 1BEV3 2RQPA 2ERFA 1HJFA 1AL21 1IGOA 1H2NA 2E6VA 3WG7H 3I56I 1VMJA 5A7WA 2E53A 5FYBA 2HR3A 4OZOA 1JMUB 2ZSIB 3HN1A 3VBOB 3GWZA 5JOYA 1KDMA 2VTXA 1YIPA 5CBLA 1DYOA 3LEMA 1UCXA 3N35A 1DP0A 2X6WA 1FOYA 4GMP0 5K4LA 4DNYA 4AEMA 5IVYA 2EA2A 2XLFA 2DMNA 4H0EA 5E8IA 1TNFA 3SLIA 1VBB3 1IRFA 1BHGA 1OF3A 3KZYA 2K0GA 2E31A 4AFMA 1BR4A 1IQAA 3MQ0A 4FBFA 1AKHA 5DM6F 5BXXA 1LE8A 2VU9A 4OU0A 5IFPA 3SNMA 3EHKA 4CA9A 1DQ0A 5EEGA 3DYOA 4W97A 5J40A 4QT6A 3ZPOA 3QPLA 2ZXHA 2QDRA 4FFFA 2FDJA 3AXDA 3CP2A 1DPUA 5FGMA 1VQ9I 3RJRA 1JKQC 5DCFA 5EIYB 1T08B 2P6HA 4RGXA 3DLLF 4A93J 3TWIA 4IZZA 4MOAA 5FY1A 1WJFA 1VQLI 3BR3A 3SJMA 5GKAC 4K8RB 3TOJA 2V4AA 2VOPA 4LBQB 2VZOA 1GMMA 3MICA 3IP4B 5B5EC 4FPFA 3WUCA 4Z2WA 2Z5UA 1ULPA 1FNYA 4AW7A 4ENNA 3I59A 5FYZA 3ACFA 1JYCA 3FMGA 2C6YA 2A68F 4U7DA 5HLIA 1L3JA 1UZ0A 1YRNA 4K21A 3W6KB 3MLKA 3ETPA 2HPIA 1CF7B 1R1VA 3HJEA 5IWFA 2KRFA 1TE1B 2I2SA 1WZXA 4YIIA 3FUOA 4O9EA 3AFGA 5C9AC 2O7OA 4HLXA 3U1DA 3OY8A 2WNEA 1U8BA 3O6BB 3ZN4A 3ZN1A 3BJ6A 3BN6A 4YPJA 5A3OA 3U21A 4CDXC 3N9QA 2F6CA 3ZXEA 1R22A 1IOAA 4CDQB 2IXIA 3KE2A 2WC2A 1WJEA 2ZXQA 3OOPA 5FPZA 1QJU1 3H5NA 3MKYB 4PZJA 2NRAC 1S0IA 3AYEA 3DKQA 3G71I 2KFDA 3BCWA 1G9BA 4YIRX 1AL22 4CZCA 3Q8EA 4XJZA 3JRIA 4Y20B 3KF3A 1IXRC 2BY3A 3A0BC 3PVNA 5CQEA 2P3JA 3M9AA 5L73A 5IVJA 5KAIC 2AENA 3E5QA 4O9GA 4U87A 1ODNA 3F22A 5F39A 2BW3B 4LBKA 1MZEA 5K7FA 1JODA 2OZUA 5KK1A 3FXLA 4XZUG 2X48A 5GALA 5DTDA 2ME0A 2JDMA 2O6GE 4NE9A 1L0OC 2JDYA 1USTA 5FLMJ 4LUKA 2HH9A 1MS9A 2ZHMA 3I2DA 5F3CA 1AUYA 2PYTA 4XEZA 3H8XA 3J7YJ 3JBG2 4GZ9A 5J6XA 5JR7B 4Q0PA 2Y64A 1W6NA 4GWNA 2VQTA 1GUIA 3WEZA 5DDJ2 3A02A 5I0SA 3LSDA 2ZGUA 5JI9A 1IW7F 2D97A 3FBMA 4P9JA 2XJPA 2Q1FA 4MXVA 2O8OA 1POV3 1BC8C 1BW6A 3K4LA 4C1WA 1R1A2 4ZTJA 2BVVA 4IQPA 1UJ8A 2PN6A 2Y31A 1PMHX 2W0XA 2RS31 2YC4A 3VKLA 1AWCA 2YGLA 1Z3YA 4LGWA 2RS12 1A6IA 2FMYA 2MABA 2BOJA 2WNVC 1HW2A 4A2UA 1JS9A 5B4NA 5FZMA 3M3YJ 2EVXA 4DY5A 4GD4A 2HQRA 1Z7S2 3L2QA 1IG3A 1VPHA 4PDWA 1ZA4A 1OBNA 2JUCA 4R79A 3O1TA 2RM23 4HPKA 3U11A 1KGYA 2ZO4A 3V0BB 3I64A 1E3PA 5HS8A 1FBSA 1AR63 2WNUB 1YCIA 1TNTA 4FOWA 4CYCB 1SLBA 1WD4A 3VBRA 2YHJA 5GLZA 4FETA 2EFNA 4TYSA 2R92J 4NPLA 3UGGA 4ZYEA 1U5YA 5CZKA 1EAH2 1Z7LA 1Q3EA 1PJRA 1QJFA 4HF2A 1MS5A 5DZGA 1MS3A 5L3BA 3K4AA 3B3QE 3OIQA 2OQ7A 3MEXA 3D6EA 4L9JA 1OCRH 2IS2A 2Y2ZA 4Y1VA 3WQ7A 4CDWB 1FV2A 4BQ3A 2XJSA 3F8FA 4BLIA 1HOMA 4OIPF 4XQ4A 3V8KA 4IX7A 5L7OB 2WAQN 2TNFA 1YW9A 1RRJA 3W21A 2GNTA 3K46A 1FOD2 4I01A 3K3NA 4IGOA 4E7JA 4LO7A 2VG9A 3THTA 2V4VA 1K5MC 4I0WB 1UMIA 4GH4C 4OLLA 3W3CA 3I7DA 4CU7A 1UX7A 2WV0A 4G7ZF 4LJHA 3WOGA 3KB5A 5GP9A 3EQLF 1LJ9A 3MHZA 4IE5A 5JLWA 1PO22 4AYBA 3TO9A 4Z92B 1SFUA 1HRI3 5EYRA 2JIJA 1G6NA 3O0VA 1N47A 4BE3A 1KONA 3JTHA 1IO2A 3WV6A 3CEWA 1M1EB 2PN5A 4NUBA 2CWEA 1GZCA 3GMEA 5FZ4A 3B00A 5J1YA 2GOXB 1W0TA 1RUC3 2DCKA 2R041 3AVSA 2XWBB 4XIOA 4I30A 4EWEA 2K3PA 1CN1A 4FCYA 4PIYA 1OA3A 3UYJA 1TG7A 4LK7A 4G9SB 2WUHA 1W8TA 1ITYA 3I53A 1OMIA 4AI1A 3K9TA 3VODA 1LESA 4D94A 1W0OA 1G9AA 1J09A 4PSXA 3EUHC 5F0HA 4OCTA 4ZS2A 2WDBA 2WNUC 4WM8C 1UZZA 4XF1A 3WP4A 1AYN2 1X9TA 3OGSA 1UZCA 2VOTA 1CIYA 2ZMLA 3CTAA 2Y6HA 5K7PA 4E2QA 4YRVA 2VW0A 1U78A 3A7QA 2R7OA 4CCOA 2CY6A 2QDNA 1H9GA 1JKRC 3WF4A 5F6LB 3N9PA 5FRNA 3OYLA 5A7WB 2E1NA 3GCWA 5JIAA 1FPQA 2VMGA 4S2FA 3UK9A 5H2FC 1IN4A 4CE8A 1S7EA 5FZ6A 3M8LA 3CBNA 2VL4A 3U4XA 1R092 3CD6I 1J9IA 4RD7A 1QH6A 2ZX4A 2E33A 4RGUA 1PP7U 2RQQA 1C1FA 2DU1A 1A8MA 2VMFA 4B8XA 1K5MB 2QEXI 4M6YA 4OAZA 2LW8A 3IIAA 2W82A 2V5DA 5B66C 2Q30A 1TW2A 4RGAA 4CRQA 2LG4A 5FY4A 1NYWA 1JZ6A 1QDOA 2VVEA 3NO8A 3AMHA 1X9PA 3F2ZA 3H3LA 2PLV1 4FOQA 4BUPA 2QQJA 1AXKA 4K3UA 2PA7A 4ZU5A 2KL4A 1IC8A 3H1MA 2VZ3A 4QGMA 3HTSB 3D1NI 5EGOA 4YZ1A 2WO1A 5BNNB 4Z2YA 2JG9C 3RI8A 3QYBA 3D5RC 5T5PA 2D2WA 1BLZA 2LH9A 2EBIA 5C3QA 5KC6A 1TWCJ 2HWB1 2M87A 2ZAHA 2MEV2 1QEXA 4XOPA 3ZYJB 1RPWA 3WNLA 3K4ZA 2OYZA 3ZQCA 4HYEA 1U5TB 5FLXK 1K6YA 5FQ0B 3JD71 4EM1A 3NL1A 4LK0F 5GLTA 2X5IB 5A2QK 1XU2A 2XBO1 4TLFA 4X1EA 1N3QA 4OI1A 4QX5A 1TME2 4JGZA 5F2SA 2NN8A 4M3CF 4PIZA 1P6RA 5C3PA 3OBZA 4YGDA 3GZUC 5FKOA 3HGYA 5J8CA 1ZG1A 2OV7A 2NOGA 3KVAA 4QPOA 3JCIA 1OVPA 1DZTA 1H0BA 2QQVA 3ME2A 1I3AA 1I1EA 1D8KA 1DP7P 1BMV2 1BI1A 3AKZA 1DGRA 1JYXA 3FX3A 5FKNA 4CEYB 1MBKA 4J00A 1COV1 2M45A 3S3MA 2X8KA 1T8IA 4ZHNA 1XPWA 2R7UA 4II3A 3HOBA 4NPMA 4QDQA 2M0MA 4ZYGA 5IK7A 1XX5A 4BB3A 2IA1A 3HOZJ 1YRNB 2EA4A 2A6EF 4DQAA 3QLQA 3B73A 3JAMZ 1XTAA 3RJPA 3D8CA 3P5JA 3THCA 3R61A 5HLHA 4MYEA 2KQRA 3DPLC 1X3WB 5IVFA 2BHYA 1BBT2 2GH8A 2MLGA 2D3SA 4LQRA 5BPXA 3KP4A 1S0JA 3G4SI 4W6WA 3QAHA 2ZJRF 3LIGA 1WMEA 4BQ5A 4UV8A 2NZ9A 1F8VA 1JUMA 3N97A 4HPKB 4TTGA 2CYYA 4V2VA 3WE2A 3N3HA 5BNNC 2ZKZA 2XBO3 2E2IJ 1CGPA 1W1WE 2HWD1 4K9SA 5CQGA 1D4M3 2VMDA 1LDJA 1UMZA 4A3FJ 2RE9A 5A6QA 2E1CA 3BOPA 1LCLA 3F95A 4NC8A 1IN8A 4QHOA 1FEXA 3BR2A 2FZ2A 1T0FA 4L0ZB 1UXXX 2E63A 3ZVXA 3BODA 3WDTA 1VBA1 4IRHA 1S4CA 5FP8A 3CCVI 5FRAA 3UKGA 1RXGA 4XRSA 2ISYA 4AG4A 5ED4A 1XSDA 3VYUB 1SFXA 2Y0MA 4CDWA 3S15J 2EIDA 3C8XA 1UMHA 1VQ5I 1IKQA 2OF7A 1WA6X 2D45A 2X09A 1FC3A 4DFSA 1JUHA 1W8HA 4DB5A 5FY0A 5E88A 5FJ8J 3ZFGC 5D8LB 4CYCA 3NAPC 5IK8A 1D4M1 1I6HJ 1NXD1 5CVVA 4GMP1 1VLNA 1U5ZA 1UU5A 2AC1A 3NRUA 4LEJA 5CKNA 3CO6C 4M01A 4XBLA 4WZCA 1O59A 4RQPB 2W57A 4FTEA 1I3HA 1BI0A 1HSJA 1FZPB 5JFRA 1RUJ1 4AAXA 1MVQA 2A3SA 4HETA 4AVAA 1SFEA 2JB4A 1Y1WJ 3OYNA 4M3BA 1JZ7A 3GXUA 5GZFA 1P92A 1DGLA 4J25A 3FZVA 5C4XJ 3PNTA 1ENRA 3AMMA 5A80A 3KV5A 5FTTC 3HG9A 4ZU4A 1WMFA 1BBT1 4XM3A 1WLDA 2B39A 3NV3A 3VFZA 4QXHA 4JP0A 2IZWA 2ISZA 2F4MB 5FBJA 1VP6A 4KQ7A 3AFHA 1VBC3 3QP5A 4GQ7A 2CQQA 2ZGKA 2L0KA 2DWRA 3O8HA 3HOXJ 1V6MA 3UESA 2ARCA 1IRXA 5E79C 2DXIA 2CGPA 3GTMJ 5K7HA 2A73B 1R7JA 4ANJA 3PTYA 4EN0A 4RAZA 3K4BA 3ML6A 1OFSA 3O5SA 5E18F 5H9PA 5CU1A 2AHQA 3S2HJ 5AONA 1Z7S1 2HOTA 4AHZA 3H50A 1WKMA 4HEA2 3C7OA 4AM3A 5IY5H 3J7NA 1ZYBA 1W2OA 4N43A 3FIWA 2DOAA 2VPLA 5HS9A 1MZFA 2DU0A 2QZ2A 2Y6LA 2ZOEB 4XHXA 1CAUB 2EIMH 4P9UA 5E8GA 1YX3A 4AQTA 3C7GA 1CZVA 4XE9A 3MPBA 4FPEA 4X8PA 2DA4A 1Y0NA 2PEXA 2D40A 3WD5A 2WT2A 5D4SA 4P02B 2PLV3 4RFT0 2R7WA 4GDFA 1RVF3 3V8LA 3ZOIA 5AC91 3WHCA 4IV1B 3KF5A 1W8ZA 3H7YA 3CQZJ 2C26A 2ZJPF 1P2FA 3GO5A 2QQ8A 2UZKA 4J01A 4OI2A 4FE4A 2HWE2 2PMZA 5EYXA 2C4XA 2RJ2A 4EMSA 2OC6A 3HZJA 2NQYA 2BV6A 1YXWA 3FMRA 1S2EA 3FXOA 2Z99A 2F5EA 2IA0A 3TDUC 1MSFC 1W28A 3IB3A 4GJYA 4E7ZA 3WG3A 4YZ2A 4M74A 4IESA 1CAUA 4IEVA 5A3LA 5DZFA 5EG0A 3BTIA 3JRCA 4M4RA 4CU9A 3HMYA 2OQRA 1VTNC 2DMUA 4FQZA 1POV0 2OJED 3W5NA 1ZZBA 2STWA 1ZREA 2PHWA 4XF9A 4BACA 4AFBA 1XGNA 1YO5C 2ZGTA 3I2KA 1F35A 5BQTA 2FD5A 4CH7A 1W8NA 4RHV3 2DV9A 2E32A 3GFIA 1G4DA 3BGAA 4Y1UA 1SPPA 3UNPA 4K40A 1Z21A 1OCZH 4LBOA 3DUIA 2XGDA 3HTUA 1LE8B 1S0GA 1KYWA 4L9TA 3FLTA 4CEWA 4A3BJ 4Y1ZA 1VJ2A 4I0BA 4FFHA 1ONVA 3CCUI 4KBZA 4B4CA 4XLFA 1DQ6A 5DYMA 2VOXA 1V54H 3V7SA 5IHRA 2ZGPA 2X9DA 4AVPA 4WK8F 3J8F3 1PGSA 3N9MA 1RHI3 2CV0A 4AUXA 4NIGA 1HRI1 5EZHA 2M1BA 1YEWA 4Y52J 1J1TA 1F5FA 4E9KA 1W9TA 3BG5A 1D0HA 4IOAF 2L9NA 4AVZA 1L7LA 1SFNA 3ENRA 5A2QZ 1U5TA 1RUF3 4AEDC 3GF2A 2ESNA 2MD0A 2WLQA 5CIRA 3T1MA 5JR3A 4CCEA 4KG8A 4G7OF 2R3SA 2XJTA 5HCAA 4AGVA 3ZMUA 3APBA 3K3OA 1D1BA 3AYCA 4XICA 4BQ1A 4Q4W1 3I49A 2PG4A 4LBQD 5A6XA 1OYYA 3KD4A 2VTFA 4PJNA 3M1HA 4ZYDA 4RN5A 3ROUA 1FPN2 3V0AB 2CL2A 3ACLA 4G6TB 3P5BA 4Y7NJ 2VBBA 1TWAJ 2R0FA 4BQYA 2JDPA 5HODA 4D7SA 4YVSA 3JW4A 5D5VB 4YVWC 4CZSA 4XR6A 4Y15A 1LEAA 1BEV2 2UYBA 5IP6A 4BLJA 2D93A 1KQ9A 5EHDA 3VD7A 3D5LA 4DXZA 1JT6A 5KHKA 2P6TA 2Y0OA 1LOCA 2OT7A 1F5JA 4NIDA 5K0UA 1KYZA 1QHGA 5EJZB 1XSXA 1G9DA 5FWJA 1RC6A 2NS0A 2WY8Q 2WYFA 3RZMA 4Y5TA 2VUAA 4RA2A 3FXMA 4WVVA 4SLIA 5DDJ1 2MLKA 3HWJA 1S6LA 5ABJC 1VBB2 1ALYA 1ERDA 2RV8A 3TQNA 4GFBA 5J09A 4K2EA 3GYDA 2CW7A 1I5ZA 1I50J 3LSKA 2VQLA 2K86A 4Z2AA 3MW2A 4UW4A 4JKKA 4CCJA 2H1KA 5C70A 2DQRA 1D1AA 2O3FA 4IHVA 2ARBA 2W94A 5EFUA 2RHPA 4ET7A 2ECCA 4BQ4A 3LE0A 1HRV3 5D1IA 5IOZA 3ZYRA 4LG3A 3ZGKA 3LIHA 5A7OA 1QQIA 3WZ1A 5FRMA 3JBG1 4CCMA 2GA1A 5E17F 1XCBA 2RDRA 5KAFC 4CEWC 4QQHA 3W58A 5A3NA 5FY7A 3CHXA 2ET1A 1FP1D 3DPRA 2IS6A 1HXDA 2OPWA 2WLPA 2DLLA 4RB1A 2C1FA 4G9YA 4XJ8A 3RRDA 1LEBA 4OHVA 3TN92 4Q8LA 3J26N 3ZMNA 2QQWA 4IE7A 4JV4A 4DUWA 3LKJA 5CA6A 2ZTNA 2OKXA 2G9FA 3BVCA 1P4AA 4AWXB 2R7ZJ 3BLYA 3E3VA 3T8RA 3T3YA 1K42A 2DK5A 3T2TA 1IRZA 1PIV2 4AEJA 1FPN1 2BWAA 4COVA 5CVUA 1ZBE1 4MVTA 1QNYA 2HWC3 1W9FA 1Q8VA 4ZZ5A 3GLLA 1UAIA 2BOLA 5C4WC 1VI0A 1JTYA 2V79A 2PI0A 4UYBA 1RUE1 3NVCA 1W3VA 4DINB 1S0BA 4XN0A 4KWJA 1XOYA 2IP2A 1W2NA 3ZMSA 2WBKA 1LODA 1VRH3 2VM9A 2I45A 5FZLA 1P4XA 1BJZA 4XC9A 1X58A 4YVWA 1WJAA 3SDBA 2YSRA 1W4MA 1OFCX 2EWNA 3JR9A 3SCFA 3VB2A 3MV01 1H89C 3TO7A 5LEKA 1DG6A 2GALA 2V7FA 1RUD3 2LYCA 3A03A 2ZJCA 2JVHA 2GU9A 2VXJA 4BH9A 1S29A 1FT9A 3FKJA 4IE4A 4XNFA 2YDEA 2XVLA 3IDAA 4KG0A 2AACA 3ZYFA 3CUQA 5LK5A 3CL1A 4EVIA 4QB6A 1NQDA 2W24A 1EA3A 2VECA 2KJBA 4MX3A 4NRQA 5B2GB 3PQJA 1IPSA 5C4JJ 3OYHA 1IJWC 1YTYA 4RL7A 5DAWA 1R1A3 2ADEA 2R042 3CCMI 5BUVA 2W9XA 4AI0A 4EE2A 4XABA 2DFBA 5F37A 2A3WA 1LOBA 1OD3A 3SKVA 5E6HA 3NWSA 4IEWA 3HNBM 2DMTA 2D6MA 3VN4A 3T4HB 3IAPA 1FNZA 3FISA 1IPKA 3W20A 2QCSB 2F5DA 5E89A 1YIFA 5HNHA 1AR61 1JBCA 3AZYA 3ZQGA 4UT5A 4G3YC 1RUJ3 5KHIA 4UW6A 1VR3A 1FMD2 3IMMA 4QU1A 2RJLA 4MGZE 1ULOA 2EXHA 1YE9A 2WWYA 3S2WA 4C2MJ 3QRFF 1W5SA 1HW5A 1R64A 3O12A 4IEOA 1KGSA 3S1QJ 3WCSA 3ZPLA 2NMOA 3S5AA 2Z3YA 3TEWA 2A5WA 3GF6A 5E3LA 1VBD2 1RUG1 2FQPA 3VDAA 3TYJA 5FOBB 3O2PE 5HBAA 3JTGA 2RNJA 3FC0A 1U6GA 1W8OA 3OEAA 3C18A 2W3JA 2PX9A 2DCTA 4YSFA 1REDA 3EJKA 5FPVA 2QBXA 1YQ6A 2A6TA 2ZMEC 3ZFEA 3GJAA 4KNYA 4FI9A 3HEIA 5J37A 1EAH1 3FHQA 4ZC3A 1R9TJ 4ESJA 4XACA 2I07B 3SHRA 3H5AA 1W0PA 3PIGA 1F4KA 1K12A 1UHWA 1Y1VJ 4RB0A 5J1XA 1UF2C 2XIGA 3C7HA 1C0WA 4COUA 4GXLA 2CYFA 4R1HA 5DUXA 3BROA 1BKZA 1IDZA 2JA7J 1X36A 5FYUA 5GZCA 5ANNA 1ZX5A 5KC5A 1MDMA 5FCCA 2Z2SB 2WN3A 1IZ1A 1RKWA 3JXSA 2I74A 2HEWF 4CDXB 3MZ8A 3J7ZI 3KZZA 2HWE3 3C2HA 3DEMA 1ZGJA 4QWQA 3H8RA 3TBIA 3TOAA 2CV1A 2HEOA 2GM4A 3IWFA 5KXDA 1OQEA 1UZVA 1I6XA 1NHAA 1VB4A 2HWF2 3S5QA 4FE7A 1A31A 1O91A 2DA5A 2KKOA 5EG0B 1PO12 1S0CA 3C3VA 1MKMA 1MQTA 1N3PA 3MIFA 5C8CC 4YZ5A 1MMGA 3ASIA 4EWAA 3OYEA 2XKOA 4C2UA 1MPXA 1FSEA 4EQQA 3RZGA 2D43A 2XAJA 1Y43B 2HBUA 3I2OA 3ZSKA 2BHZA 4RSUA 2QVSB 4GXOA 3KEYA 4TN7A 1RGSA 3KWVA 3GTJJ 1UU4A 5E3OA 2F2EA 2Q8EA 4W6YA 1BMV1 2GXAA 2RS51 1Z05A 3ASOH 4Y3OA 2LBFB 3JB4C 1WZ2A 1IV8A 3A0HC 3BR1A 1JYNA 4YG3A 3OY8B 5BPIA 3S3OA 1KS4A 1KU9A 4JHTA 2D1HA 3SH3A 2MYSA 1YC61 4OFGA 1FIAA 4XN3A 2ILMA 4HG6B 3WF0A 2BY0A 1ZRFA 4WX9A 3OD0A 2CWSA 1G2HA 1UXZA 2HVRA 4UW5A 5HDKA 4CO8A 1BXHA 2IW5A 3K4KA 5FJKA 3DQVC 3VPRA 5KHDA 1JHFA 2W68A 3Q9SA 1Z0HA 5F5CA 1ZNPA 1BJQA 1E5SA 3SHFA 1YJLA 2NS7A 2RDQA 2X5IA 1NCRC 3MCZA 2JZYA 2IXHA 2PAEA 1PP8F 3FK7A 3DTEA 3K6GA 2DCYA 4MFEA 4HXCA 2NAZA 1M06G 2ZXIA 1GXQA 4A6SA 5DS9A 3AX4A 2WAQA 2ZS6B 3U78A 4CDGA 2GC0A 3MIHA 2RREA 3CESA 2RDNA 5FZHA 3PM1A 4DBQA 1DQUA 5HXVA 4S2GA 4BY1J 1OYWA 3NJZA 2L3DA 1E17A 4QPQA 4ES9A 3FHAA 2Q4SA 4HZFA 1JZ3A 4Y13A 5G04L 4A69C 3BI3A