2Q2AA

Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
241
Chain Sequence
SSGGDGGATKKKVVVGTDAAFAPFEYMQKGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPVKNALDLKGKTIGVQNATTGQEAAEKLFGKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPKNFASEYYGMIFPKNSELKAKVDEALKNVINSGKYTEIYKKWFGKEPKLDRLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ArtJ
publication title Crystal structures and mutational analysis of the arginine-, lysine-, histidine-binding protein ArtJ from Geobacillus stearothermophilus. Implications for interactions of ArtJ with its cognate ATP-binding cassette transporter, Art(MP)2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transport protein
total genus 80
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q2aA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2q2aA02
3H3GA 1EZPA 3Q27A 4GOTA 3FV2A 4FATA 4Q30B 3V8XB 1MXYA 4F3PA 2O7UA 4FEDA 4R6KA 3PPPA 3UP9A 5IKBA 3UN6A 1MQJA 5IAIA 3O29A 4NF4A 5B7DA 1AMFA 2D21A 2PBWA 3K6WA 4H1XA 1TFDA 1A55A 3RGYA 4IY5A 2Q2CA 4F29A 3PU5A 4KI0E 4FECA 5KDTA 4X1BA 3VXCA 5I2KA 4IO5A 3WAFA 2F7CA 4DXUA 1B2HA 2ALUA 4KYSA 2DQVA 1HSEA 1TT1A 3IOTA 4U1OA 4X9TA 4DXBA 1A8FA 4JSOA 1Z7NE 2I0BA 1PB9A 1JQFA 5H8QA 2I4CA 4F18A 1Y3PA 3KSJA 4E0WA 4PP0A 2AIXA 3SEUA 2A5TA 2PT2A 3KG2A 1SW1A 3A3CA 3IB0A 3GZGA 1QKAA 1SW2A 2Y7RA 2F7BA 1R9QA 1NNPA 2Y7WA 3KFMA 2DOJA 3THIA 4AB6A 5ITOA 4PFWA 4DCYA 4H67A 3MUQA 3CIJA 5DVJA 3MVXA 4RNSA 1MY1A 2Z8FA 4EQBA 1DPPA 5A5XB 2QS1A 4Z0IA 1EZOA 2IA4A 5AA4A 5CMMA 3PMVA 4ISUA 1IZ1A 3FXRA 5I58B 4GVOA 4HW8A 2UYEA 4H5FA 3KN7A 2XHDA 3U94A 3CVGA 3GBAA 3MZ9A 3ODBA 3PGFA 3Q26A 2YLNA 3IL1B 2ONRA 2F7AA 3T93B 3SKPA 4IGRA 1POTA 3S9NC 1ZJLA 3PUVE 3FVOA 2WKYA 3EQ1A 1MXUA 3UIFA 3H6VA 1PEBA 2ABHA 4OWDA 4PFUA 4HS7A 4GXSB 4LVQA 3MP6A 3IR1A 5DEXB 1B58A 3FGSA 1A8EA 4XXUA 2DWAA 1GV8A 3FUZA 1KWHA 3ZKKA 3ZS6A 5I56A 1NNTA 2R71A 3DP4A 1JW1A 4U4SA 2R9JA 5FTHA 3BFUA 4WEDA 4OXVA 1TFAA 3S9LC 4O3AA 3B6TA 3MVWA 4F2QA 2DSFA 1AL3A 4LZ7A 4BLAA 1QVSA 2ZYKA 4GRKA 4MBPA 2ZYNA 5H8HB 3MW0A 2REJA 2G29A 3T9HB 3IJOB 4QFOA 1N04A 4F22A 1N3WA 1O63A 1FTLA 4L17A 4YB7A 3T22A 3Q25A 3C32A 1LAFE 1JETA 4KCCA 1ATGA 2V3QA 1QUKA 2HFBA 3OO6A 4H6DA 4FEBA 4I8CA 2QJEA 2DVCA 2X7QA 2O7IA 3LSLA 3OO8A 1PB8A 1VE4A 3H6TA 3KEIA 4U4XA 3DP6A 4BDRA 4GFRA 3TCFA 1MQIA 3O9PA 2F5XA 2XD2A 4ZEDA 1MQHA 2H99A 1USYE 1OVBA 3RLFE 1LAXA 3S4UA 3TQLA 4I62A 3SDFA 3N26A 3CI8A 1NL5A 5JTYA 1H45A 3PUYE 1I6AA 1SYHA 5ELVA 1B3EA 1B5JA 1H3DA 1N84A 4RYAA 5TP9B 2RINA 5CMCA 4LZ5A 5LOMA 3OEMA 3PPNA 5EHSA 3TTLA 5ITPA 3PD9A 1NFTA 4YKJA 1FQDA 4G2ZA 4YAHX 2O6AA 1UTHA 3PMWA 4EDPA 3FZVA 3IOVA 5AA2A 4ZEBA 3RY3A 1MY2A 2Q88A 1S7YA 2QRYA 3VDFA 2OWSA 2P2AA 1B4HA 4OFJA 1BTJA 3FXQA 2DE2A 3P7IA 4YICA 3H7MA 3VLWA 2V3UA 1B3FA 4QFNA 2PT1A 3KOSA 3MPKA 4DZ1A 4P11A 1XC1A 3SETA 1Y4TA 1MXVA 4JXIA 5DYHA 2CZLA 1D9YA 3CG1A 1QULA 2ZYOA 3AXFA 3G3JA 3SESA 2V3TA 4KYDA 2ONKE 2QS4A 1SI0A 3LSWA 3KGCA 1MM6A 3K01A 4KCDA 2B3BA 4YKPA 1QJMA 4Q0CA 1I69A 1AOVA 1NH7A 2QS3A 1PB7A 2D3IA 3C33A 4LUBA 3KZGA 3USDA 1B4ZA 2UVJA 2Z8DA 4ZEKA 2XX8A 4XKNA 5FHOA 3K4UA 1B0HA 2UYFA 4FIMA 4G68C 2O1MA 5H8FB 3TTMA 2GH9A 1H44A 4EXKA 1O64A 5DVIA 1DPEA 3ONMA 2G93A 3FIRA 3OENA 5CMBA 4U2RA 5TPAB 1FTOA 3EHTA 5I57B 4NF8A 1MRPA 3BKIB 1MXXA 4DLDA 4M4GA 3N5LA 1B0LA 1SQYA 3TDJA 3DELB 1M5DA 3C31A 2HXWA 1EZ9A 4I9DA 2F6PA 3O28A 2O84X 1MH3A 3RPWA 3FJMA 4OZ9A 3HHFA 3U8QA 4OQOA 1NMUA 1F9BA 2R6GE 2GHBA 1I6QA 4N07A 3PMXA 3PPQA 4THIA 4GXAA 2F8DA 3T96B 3VXBA 1YPNA 3TEPA 4ELQA 1XOCA 1MXZA 1NNKA 3PV0E 2I58A 4C1UA 1US5A 1NH8A 1L5TA 2Y7PA 3EN3A 3KN3A 2H4IA 2H5YA 3FD3A 3L6GA 4NF6A 4RPNA 3C9HA 3RTWB 4LZ8A 2VOZA 3O66A 4WXJA 3B6WA 4YKIA 2VD3A 5FHNA 5ICQA 4NF5B 1JNFA 3IOUA 3C35A 1DTGA 1USYH 3QYTA 4ZEIA 2Y84A 3G3GA 3R6UA 1T0KA 2XX9A 4IGTA 1NNFA 1D4NA 5I2NA 1SDXA 4ZE9A 5B70A 1UTBB 3OXNA 2O68A 4IO2A 5J1DA 2I49A 4K3FA 1OMPA 1DSNA 5CRYA 3S2VA 3CFZA 1MPCA 1VFEA 3K6UA 3MZ1A 2YPNA 4OFLA 1TWYA 4BDMA 3B6QA 4OFOA 3K1PA 1MG1A 2RCAA 4MLVA 1IIWA 5HM4B 1BIYA 1N7XA 3MZBA 5CBRA 3TAJA 3C34A 1N0TA 1YTVA 2ZXTA 1Y4CA 1IITA 1M5EA 1B40A 1AIVA 2VD2A 1PBQA 4JWYA 3H6WA 3TODA 1ZU0A 3H6UA 1EH3A 1ZMGA 2XXPA 4U22A 5AE4A 1D9VA 1URSA 2HAVA 5ISUA 4C1TA 4TLLB 5H8NB 2UVGA 3MC2A 4ZDMA 3O97A 4HCWA 3BBRA 1JVXA 4XKPA 3IX1A 1HSJA 2OJTA 4MH5A 5AA2D 3K1NA 5CC2A 4POWA 1XVXA 1R9LA 1LB8A 5KCJA 1YCJA 1M5BA 4ELRA 1QUJA 3MQ9A 4OVJA 1MDP1 4ELOA 1RKMA 5JEIA 5DVFA 5A5XA 4AQ4A 1ZLQA 4ZS9A 3U93A 3K00A 2Z8EA 5I58A 1MH4A 3IAZA 1IXGA 5F7VA 5DT6A 3UK4A 4P0GA 1QW0A 2GFEA 2PX1A 2PYYA 1ZTYA 4QFLA 2Q89A 5M2VA 4G68B 1IEJA 4R73A 5HPQA 1FQCA 2XXUA 4GL0A 4EQ9A 3IK6B 1SVXB 1LFHA 2DYXA 1B7ZA 2F97A 4OEUA 1B9JA 3SEVA 2GRVA 3LBSA 3IB1A 1J1NA 2I6EA 4XKRA 2F6GA 1JEVA 3G3IA 4F3SA 1VSOA 4JBZA 1LBBA 5DEXA 1URDA 4ONYA 3K6XA 3MAMA 2NXOA 4XIGQ 3HHGA 1GGGA 2QSXA 3MVYA 1LCFA 1TXFA 4F1YA 4MFIA 1P1UA 4XKQA 3GXAA 4DXCA 3S9EA 1BLFA 1PBPA 1GVCA 1AH5A 3KJTA 2VP1A 3U72A 3LC8A 3OOAA 2ONSA 3O6GA 2B3FA 3EHUA 4EUOA 2M8CA 3OO9A 3SEYA 4F19A 2ZYMA 3UGWA 3H4ZA 3N6TA 4EF2A 4FAJA 5H8HA 2QMWA 3SEWA 1O7TA 1N76A 3LR1A 3M3FA 4LQ5A 3TZAA 4QHQA 3GBBA 1OQHA 1UTHB 4R9GA 2AYSA 2BJJX 1MY4A 2DE4A 3MP8A 4ESWA 3JV9A 3OO7A 4NEDA 2O69A 3S9MC 4Z7EA 4YKKA 1PC3A 1A40A 3T9XB 4G8HA 1MY3A 1RYXA 1JW5A 4H0WA 3IORA 4P0IA 3O6HA 4TOZA 1FQFA 1IXHA 4R72A 1VFDA 1XHYA 3TKDA 3HSTA 5K2YA 3HCQA 1LSTA 3G3HA 3IJXB 3JYRA 1SD3A 3VV5A 4U21A 2F36A 4F2OA 4I1DA 1ANFA 4QFPA 4TLMB 3TTNA 2ZNUA 3TFLA 4QRZA 3IB2A 4G77A 2OWTA 2THIA 3K6VA 4KQPA 2Z22A 1JEUA 1FTJA 4MLQA 4ZEFA 1M5CA 1EU8A 3PUXE 5FTIA 2B65A 3E13X 1DTZA 3H06B 1LB9A 4H8IA 2P0SA 4ESXA 2I3WA 2XXYA 2RC9A 4GD5A 5AA1A 1MPDA 4FE8A 2OLBA 4YZZA 4X48A 2I48A 5HBCA 1GTKA 3ECRA 3PUWE 1UQWA 1CB6A 2DP8A 2DWIA 3OD7A 3RQTA 3QAXA 4LONB 2REGA 1FW0A 1LGBC 3MP1A 4PETA 1S50A 4IB2A 3DP8A 4F3BA 3C4MA 3I3VA 3JZJA 4ZZAA 2LAOA 4R74A 1XT8A 4RPOA 5CMKA 3PPOA 1SYIA 1B6HA 4C0RA 4O3CA 3SERA 4TQUQ 2HQ0A 4G8NA 3RNNA 3R7XA 3TELA 2XXHA 1BKAA 3HV1A 3T9VA 4OEVA 1OQGA 3M8UA 1IXCA 2X26A 4BDNA 1WVJA 5I84A 1Y9UA 4DE8A 3QIMA 4NF4B 5I59A 4EQ7A 4H8JA 1B1XA 3QUJA 5JK4A 3TPAA 1Y3QA 4NF6B 3G3KA 1PDAA 3CRBA 1SW4A 3FASA 3Q29A 4EXLA 4RA1A 2UVIA 5KDTB 1UIUA 5I2KB 4BDLA 5H8FA 2F35A 3TCHA 4LATA 3MPLA 3L6HA 4WKMA 3RT8A 4R6YA 1R6ZA 1P1QA 3B7DA 4R9FA 2XXWA 2ZNSA 4RY1A 5I2NB 2HZLA 5H8QB 2XXQA 5TPAA 5I57A 2A5TB 3E4RA 3VLVA 2QL3A 5L9MA 3RT6B 3K02A 4IO3A 2DXYA 1BP5A 1FCKA 3VE1B 2W7YA 3CR9A 1Y3NA 3W9WA 5F1QA 5EYFA 2V93A 5L9SA 3O6IA 1NKXA 5L9OA 4RK9A 4QSDA 4R2FA 2XXIA 2V25A 4OHNA 4Q5TA 4U23A 3VVDA 3N94A 2F78A 2ZNTA 3I6VA 4M1VA 4F39A 2Y7IA 4RXLA 3VLUA 2NWJA 2DWHA 2OBGA 1UIVA 1P1WA 4PFYA 4QSCA 5AA4B 2V84A 3T9UA 1MPBA 3TCGA 1LBCA 1US4A 2YJPA 4FORA 3KBRA 4GF8A 3CFXA 4AB5A 1P1OA 2AL4A 2Q9TA 4YMAA 4DDDA 3TMGA 3HN0A 1JW4A 1XVYA 4QF9A 4NF5A 4OYVA 1II5A 2UVHA 3PD8A 5K2XA 1LFIA 4N6PA 5KCJB 4DCXA 1MQDA 5DTBA 4JWOA 3MVZA 3VVFA 2NOOA 3K0VA 2HCAA 1UTBA 1S9TA 1B52A 4DIGA 3CFLA 3OMBA 2XD3A 5EHMA 4F1VA 4GIZA 1WDNA 4HCYA 5L8DA 2NUVA 1CE2A 3WAEA 1OLAA 3OSQA 3V83A 4OERA 4WEPA 2X7PA 4YB5A 3KSXA 1B51A 5I56B 2FYIA 4PE5B 2XXXA 3QXMA 3MJNA 3KN8A 3HPIA 1MM7A 1B5IA 1OLCA 1SI1A 3U1OA 1Y20A 3FVKA 4OETA 3H03A 2DS9A 4LA9A 5BUUA 3W15C 4F1UA 4F3GA 1URGA 3QUFA 2UXAA 2FNCA 1LLSA 4H65A 2OZZA 2F34A 3K2DA 3RUMA 1ZKBA 1B3LA 4OTEA 3T66A 1MS7A 5H8NA 3MBPA 4RJZA 2OK2A 4X1DA 4POXA 2A5SA 1B7HA 4N13A 3EHSA 3UORA 2ESNA 4PQJA 3LUYA 4ZECA 4JSDA 1R1NA 1H76A 3OSRA 3GLBA 3C36A 1WODA 3R26A 3A09A 2RKMA 3W9VA 4HTGA 2E1SA 3VFJA 4OMBA 1FTMA 3FVNA 1HSLA 3VVEA 1B32A 1RYOA 3O2AA 3D4CA 1XS5A 2XXRA 3LSFB 3IO4A 2I3VA 3G7WA 4RK2A 2NVUB 5BWJA 1ZIUA 1B5HA 3BFTA 3TTRA 2DXRA 3IO6A 1D3KA 4YB6A 2XXVA 3QSLA 1N7WA 1Q35A 1IUDA 1FTKA 2DWJA 5JTYB 3LSXA 3FATA 4G68A 4O3BA 2E0SA 2XX7A 1MQGA 5FHMA 3FJ7A 2DE3A 3I5OA 2QPQA 4NE4A 3PPRA 2PVUA 2Q2AA 4KPTA 4NTLA 5H8SA 2CMOA 1B3HA 2RC7A 4FJPA 3CSBA 3E3KA 1N3XA 4XTCQ 3G3FA 2VHAA 3FJGA 1OIBA 2O1LA 5AA2B 1DMBA 1DOTA 3EPEA 2HAUA 2D5WA 3FVGA 1MY0A 1OVTA 4UA8A 1FQAA 2QS2A 2RCBA 4ND9A 2AL5A 3UA8A 4IO6A 2RF1A 1LAGE 4IO4A 3V89B 1LFGA 2QMXA 4MF3A 3V5AA 4E0XA 2KLFA 3TQWA 4YMBA 4KHZE 3FXUA 2Z23A 4G8MA 3EF7A 1A54A 3E9XA 4GWOA 4JDFA 1IXIA 4F31B 1QUIA 3MWBA 2H98A 3D4GA 3SEXA 3U92A 3HO7A 1H43A 1Y1MA 3RN8A 5TU0A 4OENA 3DM0A 2I4BA 4GQOA 3TYHA 4BDQA 4IY6A 1A99A 3A3UA 2O51A 3M3KA 4JB7A 2HZKA 3CG3A 1YAEA 4YU0A 5TP9A 2HEUA 4NWCA 2DVZA 3N6UA 4NMYA 1Z7ME 3K1MA 2PMSA 2GHAA 2OCUA 4R75A 1QKBA 4KYEA 3PUZE 3QK6A 1M5FA 4QSEA 4LQ2A 1FQBA 2ANJA 1B3GA 3ILUB 3CSGA 3F11A 1B7UA 1B46A 3RTFB 4NF8B 2XXTA 4IO7A 4QFKA 1B05A 2P1SA 4LP2B 2H25A 1A7LA 3KJ7A 4U1ZA 3TUSA 3KOTA 5I59B 5CM6A 1I6BA 5CI5A 1MXWA 4KR5A 4ECFA 1LAHE 3OELA 1POY1 1P1NA 4NWDA 4PFTA 4ZE8A 4JWXA 2FA7A 2RC8A 3ZKLA 1MDQA 4R2BA 4Q8RA 1GR2A 1Q1KA 3ZSFA 1B1HA 1VR5A 4KD5A 1SW5A 4OESA 3Q28A 3OEKA 5KZTA 4BDOA 3ILTB 2IEEA 4GL8A 1P99A 1ZBMA 5CBSA 5ICTA 1LCTA 1JVYA 4KFQA 4G4PA 3TTKA 1ELJA 2I0CA 3IOWA 2Q8JA 3M3LA 4UACA 5AA3A 4GLIA 1Y1ZA 3FV1A 4ZZEA 1IQ7A 4H5GA 3DLNA 2Y7KA 4EF1A 1SBPA 2ZMBA 4R6HA 4ELPA 1FQEA 2H9BA 2VGQA
chains in the Genus database with same CATH superfamily
3H3GA 1EZPA 3Q27A 4GOTA 3FV2A 4FATA 4Q30B 1FPEA 3V8XB 1MXYA 4F3PA 2O7UA 4FEDA 4R6KA 3PPPA 5IGAA 1IMCA 3UP9A 5IKBA 3UN6A 1MQJA 5IAIA 1FBPA 3O29A 4NF4A 5B7DA 1AMFA 2D21A 4JVCA 2PBWA 5ET6A 3K6WA 5ESYA 4H1XA 1TFDA 1A55A 3RGYA 4IY5A 2Q2CA 4F29A 3PU5A 4KI0E 4FECA 4OVSA 5KDTA 4X1BA 3VXCA 1NV2A 5I2KA 4IO5A 3WAFA 2F7CA 4DXUA 2WEFA 1B2HA 2ALUA 4KYSA 2DQVA 1HSEA 1NV7A 1TT1A 3IOTA 4U1OA 4X9TA 4GX6A 4DXBA 1A8FA 4JSOA 1Z7NE 2I0BA 1PB9A 1JQFA 5H8QA 2I4CA 2Q8MA 1DBZA 2WYPA 4AS4A 4F18A 1Y3PA 3KSJA 4E0WA 4PP0A 2AIXA 3SEUA 2A5TA 2PT2A 1IMDA 3KG2A 1SW1A 4OVQA 3A3CA 3IB0A 3GZGA 5LTCA 4I3EA 1QKAA 2XWIA 1SW2A 2Y7RA 4MNCA 2F7BA 1R9QA 1NNPA 1LBXA 2Y7WA 3KFMA 1IMAA 2DOJA 3THIA 4AB6A 5IZZA 5ITOA 4PFWA 4DCYA 4H67A 3MUQA 3CIJA 5DVJA 3MVXA 4RNSA 1MY1A 2Z8FA 4EQBA 1DPPA 5A5XB 2QS1A 4Z0IA 1EZOA 2IA4A 5AA4A 2L5VA 5CMMA 3PMVA 4ISUA 1IZ1A 3FXRA 5I58B 4GVOA 4HW8A 4P1LA 2UYEA 4H5FA 3KN7A 2XHDA 4GWWA 3U94A 3CVGA 3GBAA 4PC9A 1YXIA 3MZ9A 3ODBA 3PGFA 2P3VA 3Q26A 2YLNA 3IL1B 2QFLA 2ONRA 2F7AA 3T93B 3SKPA 2B4LA 4IGRA 1POTA 3S9NC 1BK4A 1ZJLA 3PUVE 3FVOA 2WKYA 3EQ1A 1MXUA 4PGNA 3UIFA 3H6VA 1PEBA 2ABHA 4OWDA 2Q74A 4PFUA 4HS7A 4GXSB 4LVQA 2VPOA 3MP6A 5A5LA 3IR1A 5DEXB 1DCUA 1B58A 3FGSA 1A8EA 4XXUA 2DWAA 1GV8A 3FUZA 1KWHA 3ZKKA 3ZS6A 5I56A 1NNTA 2R71A 3DP4A 1JW1A 3KBZA 4U4SA 2R9JA 2ZZXA 5EQ7A 5FTHA 3BFUA 4WEDA 4OXVA 1TFAA 3S9LC 4O3AA 3B6TA 3MVWA 4F2QA 2DSFA 1AL3A 4LZ7A 4BLAA 1QVSA 2ZYKA 4GRKA 4MBPA 2FBPA 2ZYNA 5H8HB 3MW0A 2REJA 2G29A 3T9HB 4PFBA 3IJOB 4QFOA 1N04A 4F22A 1N3WA 1O63A 3ROJA 1FTLA 4L17A 4YB7A 3KC0A 3T22A 3Q25A 3C32A 1LAFE 1JETA 4KCCA 1ATGA 4OVRA 2V3QA 3A29A 1QUKA 2HFBA 3OO6A 4H6DA 4FEBA 4I8CA 2QJEA 2DVCA 2X7QA 2O7IA 3LSLA 3OO8A 1PB8A 1VE4A 3IFAA 3H6TA 3KEIA 1FPGA 4U4XA 3DP6A 4BDRA 4GFRA 3TCFA 1MQIA 3O9PA 2F5XA 2XD2A 4ZEDA 1FRPA 1MQHA 2B4MA 2H99A 1USYE 1OVBA 4PBQA 3RLFE 1LAXA 3S4UA 3TQLA 4I62A 3SDFA 3N26A 3CI8A 1NL5A 5JTYA 4NGUA 1H45A 2FHYA 3PUYE 1XI6A 1I6AA 1SYHA 5ELVA 1B3EA 1B5JA 1H3DA 1N84A 4RYAA 4PDHA 5TP9B 2RINA 5CMCA 4LZ5A 5LOMA 3OEMA 1SPIA 3PPNA 5EHSA 3TTLA 5ITPA 3PD9A 4N81A 1NFTA 4YKJA 1FQDA 4G2ZA 4YAHX 2WBDA 2O6AA 1UTHA 3PMWA 4EDPA 3FZVA 3IOVA 5AA2A 4ZEBA 3RY3A 1MY2A 2Q88A 1S7YA 2QRYA 3VDFA 4OANA 2OWSA 2P2AA 1B4HA 4OFJA 1BTJA 3FXQA 2DE2A 3P7IA 4YICA 3H7MA 3VLWA 2PCRA 2V3UA 1B3FA 4QFNA 2PT1A 4P1EA 3KOSA 3MPKA 4DZ1A 4P11A 1XC1A 4GWYA 3SETA 1Y4TA 3HFUA 1MXVA 4JXIA 5DYHA 2CZLA 5FBPA 1D9YA 3CG1A 3ISPA 1QULA 2ZYOA 3AXFA 3G3JA 3SESA 2V3TA 4KYDA 2ONKE 2QS4A 1SI0A 3LSWA 3KGCA 1MM6A 3K01A 1RDZA 4XFEA 4KCDA 2B3BA 1YZ0A 4YKPA 1QJMA 4MX6A 4Q0CA 1I69A 4GBVA 1AOVA 1NH7A 2QS3A 1PB7A 2D3IA 3C33A 4LUBA 3KZGA 3USDA 1B4ZA 2UVJA 2Z8DA 4ZEKA 2XX8A 2FIXA 4XKNA 5FHOA 2VT5A 3K4UA 1B0HA 1FPIA 2UYFA 4FIMA 4G68C 4NHBA 1NV5A 1LBYA 2O1MA 4N15A 3NOHA 5H8FB 3TTMA 2GH9A 1H44A 1NUYA 4EXKA 1O64A 5DVIA 1DPEA 3ONMA 2G93A 3FIRA 3OENA 5CMBA 2XA5A 4U2RA 2WBBA 5TPAB 1FTOA 3EHTA 4PF6A 5I57B 4NF8A 1VDWA 1MRPA 3BKIB 1MXXA 4DLDA 4M4GA 3N5LA 1B0LA 4PE3A 1SQYA 3TDJA 3DELB 1M5DA 3C31A 2HXWA 1EZ9A 4I9DA 2F6PA 3O28A 2O84X 1MH3A 2BJIA 3RPWA 3FJMA 4OZ9A 3HHFA 1FBDA 3U8QA 4I3YA 4GX3A 1NMUA 4OQOA 1F9BA 2QVRA 2R6GE 2GHBA 4O94A 1I6QA 4N07A 4PFIA 3PMXA 3PPQA 4THIA 4GXAA 4OVTA 2F8DA 3T96B 3VXBA 1YPNA 1FPLA 3TEPA 4ELQA 1XOCA 1MXZA 1NNKA 3PV0E 2I58A 4C1UA 1US5A 3QMFA 1K9ZA 1NH8A 5F24A 1L5TA 2Y7PA 3EN3A 3KN3A 2H4IA 2H5YA 3FD3A 3L6GA 4NF6A 4RPNA 3C9HA 3RTWB 4LZ8A 5I5PA 3LV0A 1KZ8A 2VOZA 3O66A 4WXJA 3B6WA 4NX1A 4YKIA 2WYKA 2VD3A 1AWBA 5FHNA 5ICQA 4NF5B 1JNFA 3IOUA 3C35A 1DTGA 1USYH 3QYTA 4ZEIA 2Y84A 3G3GA 3R6UA 1T0KA 2XX9A 4IGTA 1NNFA 1D4NA 5I2NA 1SDXA 4ZE9A 2HPGA 5B70A 5I3SA 1UTBB 3OXNA 2O68A 4IO2A 5J1DA 1FBEA 2I49A 4K3FA 5IZ1A 2MKZA 1OMPA 1DSNA 5CRYA 3BIGA 3S2VA 3CFZA 1MPCA 1VFEA 3K6UA 3MZ1A 2YPNA 4OFLA 1TWYA 4BDMA 4PCDA 3B6QA 4OFOA 5DW8A 3K1PA 1MG1A 2RCAA 4X8RA 4MLVA 1IIWA 5HM4B 5EYGA 1BIYA 1N7XA 4KXPA 3MZBA 5CBRA 3TAJA 2GQ1A 2HXRA 1EYKA 1N0TA 3C34A 4MEVA 1YTVA 2ZXTA 1Y4CA 1IITA 1M5EA 1B40A 1AIVA 2VD2A 1PBQA 4JWYA 3H6WA 3TODA 1ZU0A 3H6UA 1EH3A 3SZPA 1ZMGA 2XXPA 4U22A 5AE4A 1D9VA 1URSA 2HAVA 5ISUA 4C1TA 4PDDA 1LBWA 4MNIA 4TLLB 5H8NB 2UVGA 3MC2A 4PTKA 4ZDMA 3O97A 4HCWA 3BBRA 1JVXA 4XKPA 3IX1A 1HSJA 2OJTA 4MH5A 4DI3D 5AA2D 3K1NA 5CC2A 4POWA 1XVXA 1R9LA 1LB8A 5KCJA 1YCJA 5I7IA 1M5BA 4PAFA 4ELRA 4MJOA 1QUJA 3MQ9A 4OVJA 3RPLB 1MDP1 4ELOA 1RKMA 5ET8A 5JEIA 1CNQA 5DVFA 5A5XA 4AQ4A 1ZLQA 5IZ3B 4ZS9A 3U93A 3B50A 3K00A 2Z8EA 5I58A 1MH4A 3IAZA 1IXGA 5F7VA 2R8TA 5DT6A 3UK4A 4P0GA 1QW0A 2GFEA 2PX1A 2PYYA 1ZTYA 4N6KA 4QFLA 2Q89A 5M2VA 4G68B 1IEJA 4R73A 5HPQA 1FQCA 1YYZA 2XXUA 4GL0A 4EQ9A 3IK6B 2XWVA 1SVXB 1LFHA 2DYXA 1B7ZA 2F97A 4NAPA 4OEUA 1B9JA 3SEVA 2GRVA 3LBSA 3IB1A 1J1NA 2I6EA 4HE0A 4XKRA 2F6GA 1JEVA 4PF8A 3G3IA 4NN3A 1FPJA 4F3SA 1VSOA 2KR0A 4JBZA 1LBBA 5DEXA 2XWKA 1URDA 4ONYA 3K6XA 4I40A 3MAMA 2NXOA 4XIGQ 3HHGA 1GGGA 2QSXA 3MVYA 1LCFA 1TXFA 4F1YA 1LBZA 4MFIA 1P1UA 4XKQA 3GXAA 4DXCA 3S9EA 1BLFA 1PBPA 1GVCA 1AH5A 4PAIA 3KJTA 2VP1A 3U72A 3U65A 3LC8A 3OOAA 2ONSA 3O6GA 2B3FA 3EHUA 4EUOA 4O7MA 2M8CA 3OO9A 3SEYA 4MMPA 4F19A 2ZYMA 3UGWA 3H4ZA 3N6TA 4EF2A 4FAJA 5H8HA 2QMWA 3SEWA 1O7TA 1N76A 3LR1A 3M3FA 4LQ5A 3TZAA 4QHQA 3GBBA 1OQHA 1UTHB 4R9GA 3KC1A 2AYSA 2BJJX 1MY4A 2DE4A 3MP8A 4ESWA 3JV9A 3OO7A 4GWUA 4O7IA 4NEDA 2O69A 2CZIA 3S9MC 4Z7EA 4YKKA 1PC3A 1A40A 3T9XB 4G8HA 1MY3A 1RYXA 1JW5A 4H0WA 3IORA 4P0IA 3O6HA 4TOZA 1FQFA 1IXHA 4R72A 1VFDA 1XHYA 3TKDA 3HSTA 5K2YA 3HCQA 1FPFA 1LSTA 4NQ8A 3G3HA 1QGXA 3IJXB 3JYRA 1SD3A 3VV5A 4U21A 4JVIA 2F36A 4F2OA 4I1DA 1ANFA 4QFPA 4TLMB 3TTNA 5EQ8A 2ZNUA 3TFLA 3LUZA 4QRZA 3IB2A 4G77A 2OWTA 2Y5KA 3E79A 2THIA 4OA4A 3K6VA 4KQPA 1NUWA 2Z22A 1JEUA 1FTJA 1RDYA 4NG7A 4MLQA 1JP4A 4ZEFA 1M5CA 1EU8A 3PUXE 5FTIA 2B65A 3E13X 1DTZA 3H06B 1LB9A 4H8IA 2P0SA 2F3DA 4ESXA 2WX9A 2I3WA 2XXYA 3B8BA 2RC9A 4PGPA 1NV6A 4GD5A 5AA1A 1MPDA 4FE8A 1NV4A 3E78A 2OLBA 4YZZA 4X48A 2I48A 5HBCA 1GTKA 3ECRA 3PUWE 3RYDA 1UQWA 4MNPA 1CB6A 2DP8A 2DWIA 3OD7A 3RQTA 3QAXA 4LONB 2REGA 1FW0A 1LGBC 3MP1A 4HXVA 4PETA 1S50A 4LN5A 4IB2A 3DP8A 4F3BA 3T1BA 3C4MA 3I3VA 3JZJA 4N17A 4ZZAA 2LAOA 4R74A 1XT8A 4RPOA 4MAGA 2PFYA 5CMKA 3PPOA 1SYIA 1B6HA 4C0RA 4O3CA 1FPBA 3SERA 4TQUQ 2HQ0A 4G8NA 3RNNA 3R7XA 3TELA 2XXHA 1BKAA 3HV1A 4N8YA 2QVVA 3T9VA 4OEVA 1OQGA 3M8UA 1IXCA 2X26A 4BDNA 1WVJA 5I84A 1Y9UA 4DE8A 3QIMA 4NF4B 5ET7A 5I59A 4EQ7A 4H8JA 4OVPA 1B1XA 5EYHA 3QUJA 5JK4A 3TPAA 1Y3QA 4NF6B 3G3KA 1NUXA 1PDAA 3CRBA 4PAKA 1SW4A 3FASA 3Q29A 4EXLA 4RA1A 2UVIA 4PBHA 5KDTB 1UIUA 5I2KB 1FBFA 4BDLA 3FXBA 5H8FA 2F35A 3TCHA 4LATA 3MPLA 3L6HA 4WKMA 3RT8A 4R6YA 1R6ZA 1P1QA 2KQZA 3B7DA 4R9FA 4N4UA 2XXWA 2ZNSA 4RY1A 5I2NB 2CZKA 3T0JA 2HZLA 5H8QB 2XXQA 5TPAA 5I57A 2A5TB 4N91A 3E4RA 3VLVA 2QL3A 5L9MA 3RT6B 3K02A 4IO3A 2DXYA 1BP5A 1FCKA 3VE1B 2W7YA 3CR9A 4QXDA 1Y3NA 3W9WA 2VPNA 5F1QA 5EYFA 2V93A 5L9SA 3O6IA 1NKXA 5L9OA 4RK9A 1IMFA 4QSDA 2XWOA 4R2FA 3IFCA 2XXIA 2V25A 4OHNA 4Q5TA 4U23A 3VVDA 3N94A 2F78A 2ZNTA 3I6VA 4M1VA 4XEQA 4F39A 2Y7IA 4RXLA 1IMEA 5IM2A 3VLUA 2NWJA 2DWHA 2OBGA 1UIVA 1P1WA 4PFYA 4QSCA 2OWZA 4HE2A 5AA4B 2V84A 3T9UA 1FPDA 1MPBA 3TCGA 1LBCA 1US4A 2FIEA 2YJPA 4FORA 3KBRA 4GF8A 3CFXA 4AB5A 1P1OA 4NF0A 2AL4A 2Q9TA 4YMAA 4DDDA 3TMGA 3HN0A 1JW4A 1XVYA 4QF9A 4NF5A 1NV3A 4OYVA 1II5A 2UVHA 3PD8A 5K2XA 1LFIA 2Y5LA 4N6PA 2P3NA 5KCJB 4DCXA 1MQDA 5DTBA 4JWOA 3MVZA 3VVFA 2NOOA 2HHMA 2FVZA 3K0VA 2F3BA 1UTBA 2HCAA 1S9TA 1B52A 4DIGA 3CFLA 3MYUA 3OMBA 2XD3A 5EHMA 4F1VA 4GIZA 5LDZA 1WDNA 4HCYA 5L8DA 2NUVA 1CE2A 3EKIA 3WAEA 1OLAA 2OX3A 1FTAA 3OSQA 3V83A 4OERA 4XF5A 4WEPA 2X7PA 4YB5A 3KSXA 1B51A 5I56B 2FYIA 4PE5B 1IMBA 2XXXA 3QXMA 3MJNA 2JJKA 3KN8A 4N6DA 3HPIA 1MM7A 1B5IA 1OLCA 1SI1A 4HE1A 1LBVA 3GYYA 3U1OA 4X04A 4H46A 1Y20A 3FVKA 5EQAA 4OETA 3H03A 2DS9A 4LA9A 5BUUA 3W15C 4F1UA 4F3GA 1URGA 3QUFA 2UXAA 4MCOA 2FNCA 1LLSA 4H65A 2CZHA 2OZZA 2F34A 3K2DA 4AS5A 1FBCA 3RUMA 2QVUA 1ZKBA 1B3LA 4OTEA 3T66A 1MS7A 1Q9DA 5H8NA 3MBPA 4RJZA 2OK2A 4X1DA 4POXA 2A5SA 1B7HA 4N13A 3EHSA 1NI9A 3UORA 1DK4A 2ESNA 4PQJA 3LUYA 4ZECA 4JSDA 1R1NA 1H76A 5J16A 3OSRA 3GLBA 4GWZA 3C36A 1WODA 3R26A 3A09A 2RKMA 3W9VA 4HTGA 2E1SA 3VFJA 4OMBA 2CEYA 1FTMA 3FVNA 1HSLA 4DI4B 2ZZWA 3RPLA 1B32A 3VVEA 4FBPA 4MIJA 4GX4A 2CEXA 4N8GA 1RYOA 3O2AA 3D4CA 1EYIA 5IZ3A 1XS5A 2XXRA 3LSFB 4IR8A 3IO4A 2I3VA 1FJ6A 3G7WA 4RK2A 2NVUB 5BWJA 1ZIUA 1B5HA 3BFTA 3TTRA 2DXRA 3IO6A 1D3KA 5ET5A 4YB6A 2XXVA 3QSLA 1N7WA 1Q35A 1IUDA 1FTKA 2DWJA 5JTYB 3LSXA 3FATA 4G68A 4O3BA 2E0SA 2XX7A 4MHFA 1MQGA 5FHMA 3FJ7A 1INPA 2DE3A 3I5OA 4JVDA 2QPQA 4NE4A 3PPRA 2PVUA 2Q2AA 4KPTA 4NTLA 5H8SA 2CMOA 1B3HA 2RC7A 4P47A 4FJPA 3CSBA 3E3KA 1N3XA 4XTCQ 3G3FA 2VHAA 1RDXA 3FJGA 1G0HA 1OIBA 2O1LA 5AA2B 1DMBA 2DDKA 1DOTA 3EPEA 3PTYA 2HAUA 2D5WA 3FBPA 3FVGA 4GWSA 1MY0A 1OVTA 4UA8A 1FQAA 2QS2A 2RCBA 4ND9A 2AL5A 3UA8A 4IO6A 2RF1A 1LAGE 3BIHA 4IO4A 3V89B 1LFGA 3CHGA 4P8BA 2QMXA 5T3JA 4MF3A 3V5AA 4E0XA 2KLFA 3TQWA 4YMBA 4KHZE 1NV0A 3FXUA 2Z23A 4G8MA 3EF7A 1A54A 3E9XA 4GWOA 4JDFA 1IXIA 1QUIA 3MWBA 2H98A 3D4GA 3SEXA 3U92A 4F31B 3HO7A 1H43A 1Y1MA 3RN8A 5TU0A 4OENA 3DM0A 2I4BA 4GQOA 3TYHA 4BDQA 4IY6A 4PFRA 1A99A 3A3UA 2O51A 4O8MA 3M3KA 4JB7A 4G61A 2HZKA 3CG3A 4P56A 1YAEA 4YU0A 5TP9A 2HEUA 4P3LA 4NWCA 1FBHA 2DVZA 3N6UA 4NMYA 1Z7ME 3K1MA 4UABA 2PMSA 1D9QA 2GHAA 2OCUA 2ZZVA 4R75A 1EYJA 1QKBA 4KYEA 3MSTA 2XXKA 3PUZE 3QK6A 4P9KA 1M5FA 4QSEA 4LQ2A 1K9YA 1FQBA 2ANJA 1B3GA 3ILUB 3CSGA 3F11A 1B7UA 1B46A 3RTFB 4NF8B 2XXTA 4IO7A 4QFKA 1B05A 1LEVA 2P1SA 4LP2B 1FBGA 2H25A 1A7LA 3KJ7A 4U1ZA 3TUSA 3KOTA 5I59B 5CM6A 1I6BA 5CI5A 1MXWA 4KR5A 4ECFA 1LAHE 3OELA 1POY1 4GBWA 1P1NA 4NWDA 4PFTA 4ZE8A 5EQ9A 2PFZA 1NV1A 4JWXA 2FA7A 2RC8A 3ZKLA 1MDQA 4R2BA 4Q8RA 1GR2A 1Q1KA 3ZSFA 1FJ9A 1B1HA 1VR5A 4KD5A 1SW5A 4OESA 3Q28A 4H45A 3OEKA 5KZTA 1NUZA 4BDOA 3ILTB 2IEEA 4GWXA 4GL8A 1P99A 1ZBMA 5CBSA 1KA1A 5ICTA 1LCTA 1JVYA 4KFQA 1FSAA 2V4CA 4G4PA 3TTKA 1ELJA 2I0CA 3IOWA 2Q8JA 3M3LA 4UACA 5AA3A 4GLIA 1Y1ZA 3FV1A 1FPKA 4ZZEA 1IQ7A 4H5GA 3DLNA 2Y7KA 4EF1A 1SBPA 2ZMBA 1KA0A 4R6HA 4ELPA 1FQEA 4QBAA 1G0IA 3D1RA 2H9BA 2VGQA
chains in the Genus database with same CATH topology
3H3GA 1EZPA 3Q27A 4GOTA 3FV2A 4FATA 4Q30B 3V8XB 1MXYA 4F3PA 2O7UA 4FEDA 4R6KA 3PPPA 3UP9A 5IKBA 3UN6A 1MQJA 5IAIA 3O29A 4NF4A 5B7DA 1AMFA 2D21A 2PBWA 3K6WA 4H1XA 1TFDA 1A55A 3RGYA 4IY5A 2Q2CA 4F29A 3PU5A 4KI0E 4FECA 5KDTA 4X1BA 3VXCA 5I2KA 4IO5A 3WAFA 2F7CA 4DXUA 1B2HA 2ALUA 4KYSA 2DQVA 1HSEA 1TT1A 3IOTA 4U1OA 4X9TA 4DXBA 1A8FA 4JSOA 1Z7NE 2I0BA 1PB9A 1JQFA 5H8QA 2I4CA 4F18A 1Y3PA 3KSJA 4E0WA 4PP0A 2AIXA 3SEUA 2A5TA 2PT2A 3KG2A 1SW1A 3A3CA 3IB0A 3GZGA 1QKAA 1SW2A 2Y7RA 2F7BA 1R9QA 1NNPA 2Y7WA 3KFMA 2DOJA 3THIA 4AB6A 5ITOA 4PFWA 4DCYA 4H67A 3MUQA 3CIJA 5DVJA 3MVXA 4RNSA 1MY1A 2Z8FA 4EQBA 1DPPA 5A5XB 2QS1A 4Z0IA 1EZOA 2IA4A 5AA4A 5CMMA 3PMVA 4ISUA 1IZ1A 3FXRA 5I58B 4GVOA 4HW8A 2UYEA 4H5FA 3KN7A 2XHDA 3U94A 3CVGA 3GBAA 3MZ9A 3ODBA 3PGFA 3Q26A 2YLNA 3IL1B 2ONRA 2F7AA 3T93B 3SKPA 4IGRA 1POTA 3S9NC 1ZJLA 3PUVE 3FVOA 2WKYA 3EQ1A 1MXUA 3UIFA 3H6VA 1PEBA 2ABHA 4OWDA 4PFUA 4HS7A 4GXSB 4LVQA 3MP6A 3IR1A 5DEXB 1B58A 3FGSA 1A8EA 4XXUA 2DWAA 1GV8A 3FUZA 1KWHA 3ZKKA 3ZS6A 5I56A 1NNTA 2R71A 3DP4A 1JW1A 4U4SA 2R9JA 5FTHA 3BFUA 4WEDA 4OXVA 1TFAA 3S9LC 4O3AA 3B6TA 3MVWA 4F2QA 2DSFA 1AL3A 4LZ7A 4BLAA 1QVSA 2ZYKA 4GRKA 4MBPA 2ZYNA 5H8HB 3MW0A 2REJA 2G29A 3T9HB 3IJOB 4QFOA 1N04A 4F22A 1N3WA 1O63A 1FTLA 4L17A 4YB7A 3T22A 3Q25A 3C32A 1LAFE 1JETA 4KCCA 1ATGA 2V3QA 1QUKA 2HFBA 3OO6A 4H6DA 4FEBA 4I8CA 2QJEA 2DVCA 2X7QA 2O7IA 3LSLA 3OO8A 1PB8A 1VE4A 3H6TA 3KEIA 4U4XA 3DP6A 4BDRA 4GFRA 3TCFA 1MQIA 3O9PA 2F5XA 2XD2A 4ZEDA 1MQHA 2H99A 1USYE 1OVBA 3RLFE 1LAXA 3S4UA 3TQLA 4I62A 3SDFA 3N26A 3CI8A 1NL5A 5JTYA 1H45A 3PUYE 1I6AA 1SYHA 5ELVA 1B3EA 1B5JA 1H3DA 1N84A 4RYAA 5TP9B 2RINA 5CMCA 4LZ5A 5LOMA 3OEMA 3PPNA 5EHSA 3TTLA 5ITPA 3PD9A 1NFTA 4YKJA 1FQDA 4G2ZA 4YAHX 2O6AA 1UTHA 3PMWA 4EDPA 3FZVA 3IOVA 5AA2A 4ZEBA 3RY3A 1MY2A 2Q88A 1S7YA 2QRYA 3VDFA 2OWSA 2P2AA 1B4HA 4OFJA 1BTJA 3FXQA 2DE2A 3P7IA 4YICA 3H7MA 3VLWA 2V3UA 1B3FA 4QFNA 2PT1A 3KOSA 3MPKA 4DZ1A 4P11A 1XC1A 3SETA 1Y4TA 1MXVA 4JXIA 5DYHA 2CZLA 1D9YA 3CG1A 1QULA 2ZYOA 3AXFA 3G3JA 3SESA 2V3TA 4KYDA 2ONKE 2QS4A 1SI0A 3LSWA 3KGCA 1MM6A 3K01A 4KCDA 2B3BA 4YKPA 1QJMA 4Q0CA 1I69A 1AOVA 1NH7A 2QS3A 1PB7A 2D3IA 3C33A 4LUBA 3KZGA 3USDA 1B4ZA 2UVJA 2Z8DA 4ZEKA 2XX8A 4XKNA 5FHOA 3K4UA 1B0HA 2UYFA 4FIMA 4G68C 2O1MA 5H8FB 3TTMA 2GH9A 1H44A 4EXKA 1O64A 5DVIA 1DPEA 3ONMA 2G93A 3FIRA 3OENA 5CMBA 4U2RA 5TPAB 1FTOA 3EHTA 5I57B 4NF8A 1MRPA 3BKIB 1MXXA 4DLDA 4M4GA 3N5LA 1B0LA 1SQYA 3TDJA 3DELB 1M5DA 3C31A 2HXWA 1EZ9A 4I9DA 2F6PA 3O28A 2O84X 1MH3A 3RPWA 3FJMA 4OZ9A 3HHFA 3U8QA 4OQOA 1NMUA 1F9BA 2R6GE 2GHBA 1I6QA 4N07A 3PMXA 3PPQA 4THIA 4GXAA 2F8DA 3T96B 3VXBA 1YPNA 3TEPA 4ELQA 1XOCA 1MXZA 1NNKA 3PV0E 2I58A 4C1UA 1US5A 1NH8A 1L5TA 2Y7PA 3EN3A 3KN3A 2H4IA 2H5YA 3FD3A 3L6GA 4NF6A 4RPNA 3C9HA 3RTWB 4LZ8A 2VOZA 3O66A 4WXJA 3B6WA 4YKIA 2VD3A 5FHNA 5ICQA 4NF5B 1JNFA 3IOUA 3C35A 1DTGA 1USYH 3QYTA 4ZEIA 2Y84A 3G3GA 3R6UA 1T0KA 2XX9A 4IGTA 1NNFA 1D4NA 5I2NA 1SDXA 4ZE9A 5B70A 1UTBB 3OXNA 2O68A 4IO2A 5J1DA 2I49A 4K3FA 1OMPA 1DSNA 5CRYA 3S2VA 3CFZA 1MPCA 1VFEA 3K6UA 3MZ1A 2YPNA 4OFLA 1TWYA 4BDMA 3B6QA 4OFOA 3K1PA 1MG1A 2RCAA 4MLVA 1IIWA 5HM4B 1BIYA 1N7XA 3MZBA 5CBRA 3TAJA 3C34A 1N0TA 1YTVA 2ZXTA 1Y4CA 1IITA 1M5EA 1B40A 1AIVA 2VD2A 1PBQA 4JWYA 3H6WA 3TODA 1ZU0A 3H6UA 1EH3A 1ZMGA 2XXPA 4U22A 5AE4A 1D9VA 1URSA 2HAVA 5ISUA 4C1TA 4TLLB 5H8NB 2UVGA 3MC2A 4ZDMA 3O97A 4HCWA 3BBRA 1JVXA 4XKPA 3IX1A 1HSJA 2OJTA 4MH5A 5AA2D 3K1NA 5CC2A 4POWA 1XVXA 1R9LA 1LB8A 5KCJA 1YCJA 1M5BA 4ELRA 1QUJA 3MQ9A 4OVJA 1MDP1 4ELOA 1RKMA 5JEIA 5DVFA 5A5XA 4AQ4A 1ZLQA 4ZS9A 3U93A 3K00A 2Z8EA 5I58A 1MH4A 3IAZA 1IXGA 5F7VA 5DT6A 3UK4A 4P0GA 1QW0A 2GFEA 2PX1A 2PYYA 1ZTYA 4QFLA 2Q89A 5M2VA 4G68B 1IEJA 4R73A 5HPQA 1FQCA 2XXUA 4GL0A 4EQ9A 3IK6B 1SVXB 1LFHA 2DYXA 1B7ZA 2F97A 4OEUA 1B9JA 3SEVA 2GRVA 3LBSA 3IB1A 1J1NA 2I6EA 4XKRA 2F6GA 1JEVA 3G3IA 4F3SA 1VSOA 4JBZA 1LBBA 5DEXA 1URDA 4ONYA 3K6XA 3MAMA 2NXOA 4XIGQ 3HHGA 1GGGA 2QSXA 3MVYA 1LCFA 1TXFA 4F1YA 4MFIA 1P1UA 4XKQA 3GXAA 4DXCA 3S9EA 1BLFA 1PBPA 1GVCA 1AH5A 3KJTA 2VP1A 3U72A 3LC8A 3OOAA 2ONSA 3O6GA 2B3FA 3EHUA 4EUOA 2M8CA 3OO9A 3SEYA 4F19A 2ZYMA 3UGWA 3H4ZA 3N6TA 4EF2A 4FAJA 5H8HA 2QMWA 3SEWA 1O7TA 1N76A 3LR1A 3M3FA 4LQ5A 3TZAA 4QHQA 3GBBA 1OQHA 1UTHB 4R9GA 2AYSA 2BJJX 1MY4A 2DE4A 3MP8A 4ESWA 3JV9A 3OO7A 4NEDA 2O69A 3S9MC 4Z7EA 4YKKA 1PC3A 1A40A 3T9XB 4G8HA 1MY3A 1RYXA 1JW5A 4H0WA 3IORA 4P0IA 3O6HA 4TOZA 1FQFA 1IXHA 4R72A 1VFDA 1XHYA 3TKDA 3HSTA 5K2YA 3HCQA 1LSTA 3G3HA 3IJXB 3JYRA 1SD3A 3VV5A 4U21A 2F36A 4F2OA 4I1DA 1ANFA 4QFPA 4TLMB 3TTNA 2ZNUA 3TFLA 4QRZA 3IB2A 4G77A 2OWTA 2THIA 3K6VA 4KQPA 2Z22A 1JEUA 1FTJA 4MLQA 4ZEFA 1M5CA 1EU8A 3PUXE 5FTIA 2B65A 3E13X 1DTZA 3H06B 1LB9A 4H8IA 2P0SA 4ESXA 2I3WA 2XXYA 2RC9A 4GD5A 5AA1A 1MPDA 4FE8A 2OLBA 4YZZA 4X48A 2I48A 5HBCA 1GTKA 3ECRA 3PUWE 1UQWA 1CB6A 2DP8A 2DWIA 3OD7A 3RQTA 3QAXA 4LONB 2REGA 1FW0A 1LGBC 3MP1A 4PETA 1S50A 4IB2A 3DP8A 4F3BA 3C4MA 3I3VA 3JZJA 4ZZAA 2LAOA 4R74A 1XT8A 4RPOA 5CMKA 3PPOA 1SYIA 1B6HA 4C0RA 4O3CA 3SERA 4TQUQ 2HQ0A 4G8NA 3RNNA 3R7XA 3TELA 2XXHA 1BKAA 3HV1A 3T9VA 4OEVA 1OQGA 3M8UA 1IXCA 2X26A 4BDNA 1WVJA 5I84A 1Y9UA 4DE8A 3QIMA 4NF4B 5I59A 4EQ7A 4H8JA 1B1XA 3QUJA 5JK4A 3TPAA 1Y3QA 4NF6B 3G3KA 1PDAA 3CRBA 1SW4A 3FASA 3Q29A 4EXLA 4RA1A 2UVIA 5KDTB 1UIUA 5I2KB 4BDLA 5H8FA 2F35A 3TCHA 4LATA 3MPLA 3L6HA 4WKMA 3RT8A 4R6YA 1R6ZA 1P1QA 3B7DA 4R9FA 2XXWA 2ZNSA 4RY1A 5I2NB 2HZLA 5H8QB 2XXQA 5TPAA 5I57A 2A5TB 3E4RA 3VLVA 2QL3A 5L9MA 3RT6B 3K02A 4IO3A 2DXYA 1BP5A 1FCKA 3VE1B 2W7YA 3CR9A 1Y3NA 3W9WA 5F1QA 5EYFA 2V93A 5L9SA 3O6IA 1NKXA 5L9OA 4RK9A 4QSDA 4R2FA 2XXIA 2V25A 4OHNA 4Q5TA 4U23A 3VVDA 3N94A 2F78A 2ZNTA 3I6VA 4M1VA 4F39A 2Y7IA 4RXLA 3VLUA 2NWJA 2DWHA 2OBGA 1UIVA 1P1WA 4PFYA 4QSCA 5AA4B 2V84A 3T9UA 1MPBA 3TCGA 1LBCA 1US4A 2YJPA 4FORA 3KBRA 4GF8A 3CFXA 4AB5A 1P1OA 2AL4A 2Q9TA 4YMAA 4DDDA 3TMGA 3HN0A 1JW4A 1XVYA 4QF9A 4NF5A 4OYVA 1II5A 2UVHA 3PD8A 5K2XA 1LFIA 4N6PA 5KCJB 4DCXA 1MQDA 5DTBA 4JWOA 3MVZA 3VVFA 2NOOA 3K0VA 2HCAA 1UTBA 1S9TA 1B52A 4DIGA 3CFLA 3OMBA 2XD3A 5EHMA 4F1VA 4GIZA 1WDNA 4HCYA 5L8DA 2NUVA 1CE2A 3WAEA 1OLAA 3OSQA 3V83A 4OERA 4WEPA 2X7PA 4YB5A 3KSXA 1B51A 5I56B 2FYIA 4PE5B 2XXXA 3QXMA 3MJNA 3KN8A 3HPIA 1MM7A 1B5IA 1OLCA 1SI1A 3U1OA 1Y20A 3FVKA 4OETA 3H03A 2DS9A 4LA9A 5BUUA 3W15C 4F1UA 4F3GA 1URGA 3QUFA 2UXAA 2FNCA 1LLSA 4H65A 2OZZA 2F34A 3K2DA 3RUMA 1ZKBA 1B3LA 4OTEA 3T66A 1MS7A 5H8NA 3MBPA 4RJZA 2OK2A 4X1DA 4POXA 2A5SA 1B7HA 4N13A 3EHSA 3UORA 2ESNA 4PQJA 3LUYA 4ZECA 4JSDA 1R1NA 1H76A 3OSRA 3GLBA 3C36A 1WODA 3R26A 3A09A 2RKMA 3W9VA 4HTGA 2E1SA 3VFJA 4OMBA 1FTMA 3FVNA 1HSLA 3VVEA 1B32A 1RYOA 3O2AA 3D4CA 1XS5A 2XXRA 3LSFB 3IO4A 2I3VA 3G7WA 4RK2A 2NVUB 5BWJA 1ZIUA 1B5HA 3BFTA 3TTRA 2DXRA 3IO6A 1D3KA 4YB6A 2XXVA 3QSLA 1N7WA 1Q35A 1IUDA 1FTKA 2DWJA 5JTYB 3LSXA 3FATA 4G68A 4O3BA 2E0SA 2XX7A 1MQGA 5FHMA 3FJ7A 2DE3A 3I5OA 2QPQA 4NE4A 3PPRA 2PVUA 2Q2AA 4KPTA 4NTLA 5H8SA 2CMOA 1B3HA 2RC7A 4FJPA 3CSBA 3E3KA 1N3XA 4XTCQ 3G3FA 2VHAA 3FJGA 1OIBA 2O1LA 5AA2B 1DMBA 1DOTA 3EPEA 2HAUA 2D5WA 3FVGA 1MY0A 1OVTA 4UA8A 1FQAA 2QS2A 2RCBA 4ND9A 2AL5A 3UA8A 4IO6A 2RF1A 1LAGE 4IO4A 3V89B 1LFGA 2QMXA 4MF3A 3V5AA 4E0XA 2KLFA 3TQWA 4YMBA 4KHZE 3FXUA 2Z23A 4G8MA 3EF7A 1A54A 3E9XA 4GWOA 4JDFA 1IXIA 4F31B 1QUIA 3MWBA 2H98A 3D4GA 3SEXA 3U92A 3HO7A 1H43A 1Y1MA 3RN8A 5TU0A 4OENA 3DM0A 2I4BA 4GQOA 3TYHA 4BDQA 4IY6A 1A99A 3A3UA 2O51A 3M3KA 4JB7A 2HZKA 3CG3A 1YAEA 4YU0A 5TP9A 2HEUA 4NWCA 2DVZA 3N6UA 4NMYA 1Z7ME 3K1MA 2PMSA 2GHAA 2OCUA 4R75A 1QKBA 4KYEA 3PUZE 3QK6A 1M5FA 4QSEA 4LQ2A 1FQBA 2ANJA 1B3GA 3ILUB 3CSGA 3F11A 1B7UA 1B46A 3RTFB 4NF8B 2XXTA 4IO7A 4QFKA 1B05A 2P1SA 4LP2B 2H25A 1A7LA 3KJ7A 4U1ZA 3TUSA 3KOTA 5I59B 5CM6A 1I6BA 5CI5A 1MXWA 4KR5A 4ECFA 1LAHE 3OELA 1POY1 1P1NA 4NWDA 4PFTA 4ZE8A 4JWXA 2FA7A 2RC8A 3ZKLA 1MDQA 4R2BA 4Q8RA 1GR2A 1Q1KA 3ZSFA 1B1HA 1VR5A 4KD5A 1SW5A 4OESA 3Q28A 3OEKA 5KZTA 4BDOA 3ILTB 2IEEA 4GL8A 1P99A 1ZBMA 5CBSA 5ICTA 1LCTA 1JVYA 4KFQA 4G4PA 3TTKA 1ELJA 2I0CA 3IOWA 2Q8JA 3M3LA 4UACA 5AA3A 4GLIA 1Y1ZA 3FV1A 4ZZEA 1IQ7A 4H5GA 3DLNA 2Y7KA 4EF1A 1SBPA 2ZMBA 4R6HA 4ELPA 1FQEA 2H9BA 2VGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3G A;  1EZP A;  3Q27 A;  4GOT A;  3FV2 A;  4FAT A;  4Q30 B;  3V8X B;  1MXY A;  4F3P A;  2O7U A;  4FED A;  4R6K A;  3PPP A;  3UP9 A;  5IKB A;  3UN6 A;  1MQJ A;  5IAI A;  3O29 A;  4NF4 A;  5B7D A;  1AMF A;  2D21 A;  2PBW A;  3K6W A;  4H1X A;  1TFD A;  1A55 A;  3RGY A;  4IY5 A;  2Q2C A;  4F29 A;  3PU5 A;  4KI0 E;  4FEC A;  5KDT A;  4X1B A;  3VXC A;  5I2K A;  4IO5 A;  3WAF A;  2F7C A;  4DXU A;  1B2H A;  2ALU A;  4KYS A;  2DQV A;  1HSE A;  1TT1 A;  3IOT A;  4U1O A;  4X9T A;  4DXB A;  1A8F A;  4JSO A;  1Z7N E;  2I0B A;  1PB9 A;  1JQF A;  5H8Q A;  2I4C A;  4F18 A;  1Y3P A;  3KSJ A;  4E0W A;  4PP0 A;  2AIX A;  3SEU A;  2A5T A;  2PT2 A;  3KG2 A;  1SW1 A;  3A3C A;  3IB0 A;  3GZG A;  1QKA A;  1SW2 A;  2Y7R A;  2F7B A;  1R9Q A;  1NNP A;  2Y7W A;  3KFM A;  2DOJ A;  3THI A;  4AB6 A;  5ITO A;  4PFW A;  4DCY A;  4H67 A;  3MUQ A;  3CIJ A;  5DVJ A;  3MVX A;  4RNS A;  1MY1 A;  2Z8F A;  4EQB A;  1DPP A;  5A5X B;  2QS1 A;  4Z0I A;  1EZO A;  2IA4 A;  5AA4 A;  5CMM A;  3PMV A;  4ISU A;  1IZ1 A;  3FXR A;  5I58 B;  4GVO A;  4HW8 A;  2UYE A;  4H5F A;  3KN7 A;  2XHD A;  3U94 A;  3CVG A;  3GBA A;  3MZ9 A;  3ODB A;  3PGF A;  3Q26 A;  2YLN A;  3IL1 B;  2ONR A;  2F7A A;  3T93 B;  3SKP A;  4IGR A;  1POT A;  3S9N C;  1ZJL A;  3PUV E;  3FVO A;  2WKY A;  3EQ1 A;  1MXU A;  3UIF A;  3H6V A;  1PEB A;  2ABH A;  4OWD A;  4PFU A;  4HS7 A;  4GXS B;  4LVQ A;  3MP6 A;  3IR1 A;  5DEX B;  1B58 A;  3FGS A;  1A8E A;  4XXU A;  2DWA A;  1GV8 A;  3FUZ A;  1KWH A;  3ZKK A;  3ZS6 A;  5I56 A;  1NNT A;  2R71 A;  3DP4 A;  1JW1 A;  4U4S A;  2R9J A;  5FTH A;  3BFU A;  4WED A;  4OXV A;  1TFA A;  3S9L C;  4O3A A;  3B6T A;  3MVW A;  4F2Q A;  2DSF A;  1AL3 A;  4LZ7 A;  4BLA A;  1QVS A;  2ZYK A;  4GRK A;  4MBP A;  2ZYN A;  5H8H B;  3MW0 A;  2REJ A;  2G29 A;  3T9H B;  3IJO B;  4QFO A;  1N04 A;  4F22 A;  1N3W A;  1O63 A;  1FTL A;  4L17 A;  4YB7 A;  3T22 A;  3Q25 A;  3C32 A;  1LAF E;  1JET A;  4KCC A;  1ATG A;  2V3Q A;  1QUK A;  2HFB A;  3OO6 A;  4H6D A;  4FEB A;  4I8C A;  2QJE A;  2DVC A;  2X7Q A;  2O7I A;  3LSL A;  3OO8 A;  1PB8 A;  1VE4 A;  3H6T A;  3KEI A;  4U4X A;  3DP6 A;  4BDR A;  4GFR A;  3TCF A;  1MQI A;  3O9P A;  2F5X A;  2XD2 A;  4ZED A;  1MQH A;  2H99 A;  1USY E;  1OVB A;  3RLF E;  1LAX A;  3S4U A;  3TQL A;  4I62 A;  3SDF A;  3N26 A;  3CI8 A;  1NL5 A;  5JTY A;  1H45 A;  3PUY E;  1I6A A;  1SYH A;  5ELV A;  1B3E A;  1B5J A;  1H3D A;  1N84 A;  4RYA A;  5TP9 B;  2RIN A;  5CMC A;  4LZ5 A;  5LOM A;  3OEM A;  3PPN A;  5EHS A;  3TTL A;  5ITP A;  3PD9 A;  1NFT A;  4YKJ A;  1FQD A;  4G2Z A;  4YAH X;  2O6A A;  1UTH A;  3PMW A;  4EDP A;  3FZV A;  3IOV A;  5AA2 A;  4ZEB A;  3RY3 A;  1MY2 A;  2Q88 A;  1S7Y A;  2QRY A;  3VDF A;  2OWS A;  2P2A A;  1B4H A;  4OFJ A;  1BTJ A;  3FXQ A;  2DE2 A;  3P7I A;  4YIC A;  3H7M A;  3VLW A;  2V3U A;  1B3F A;  4QFN A;  2PT1 A;  3KOS A;  3MPK A;  4DZ1 A;  4P11 A;  1XC1 A;  3SET A;  1Y4T A;  1MXV A;  4JXI A;  5DYH A;  2CZL A;  1D9Y A;  3CG1 A;  1QUL A;  2ZYO A;  3AXF A;  3G3J A;  3SES A;  2V3T A;  4KYD A;  2ONK E;  2QS4 A;  1SI0 A;  3LSW A;  3KGC A;  1MM6 A;  3K01 A;  4KCD A;  2B3B A;  4YKP A;  1QJM A;  4Q0C A;  1I69 A;  1AOV A;  1NH7 A;  2QS3 A;  1PB7 A;  2D3I A;  3C33 A;  4LUB A;  3KZG A;  3USD A;  1B4Z A;  2UVJ A;  2Z8D A;  4ZEK A;  2XX8 A;  4XKN A;  5FHO A;  3K4U A;  1B0H A;  2UYF A;  4FIM A;  4G68 C;  2O1M A;  5H8F B;  3TTM A;  2GH9 A;  1H44 A;  4EXK A;  1O64 A;  5DVI A;  1DPE A;  3ONM A;  2G93 A;  3FIR A;  3OEN A;  5CMB A;  4U2R A;  5TPA B;  1FTO A;  3EHT A;  5I57 B;  4NF8 A;  1MRP A;  3BKI B;  1MXX A;  4DLD A;  4M4G A;  3N5L A;  1B0L A;  1SQY A;  3TDJ A;  3DEL B;  1M5D A;  3C31 A;  2HXW A;  1EZ9 A;  4I9D A;  2F6P A;  3O28 A;  2O84 X;  1MH3 A;  3RPW A;  3FJM A;  4OZ9 A;  3HHF A;  3U8Q A;  4OQO A;  1NMU A;  1F9B A;  2R6G E;  2GHB A;  1I6Q A;  4N07 A;  3PMX A;  3PPQ A;  4THI A;  4GXA A;  2F8D A;  3T96 B;  3VXB A;  1YPN A;  3TEP A;  4ELQ A;  1XOC A;  1MXZ A;  1NNK A;  3PV0 E;  2I58 A;  4C1U A;  1US5 A;  1NH8 A;  1L5T A;  2Y7P A;  3EN3 A;  3KN3 A;  2H4I A;  2H5Y A;  3FD3 A;  3L6G A;  4NF6 A;  4RPN A;  3C9H A;  3RTW B;  4LZ8 A;  2VOZ A;  3O66 A;  4WXJ A;  3B6W A;  4YKI A;  2VD3 A;  5FHN A;  5ICQ A;  4NF5 B;  1JNF A;  3IOU A;  3C35 A;  1DTG A;  1USY H;  3QYT A;  4ZEI A;  2Y84 A;  3G3G A;  3R6U A;  1T0K A;  2XX9 A;  4IGT A;  1NNF A;  1D4N A;  5I2N A;  1SDX A;  4ZE9 A;  5B70 A;  1UTB B;  3OXN A;  2O68 A;  4IO2 A;  5J1D A;  2I49 A;  4K3F A;  1OMP A;  1DSN A;  5CRY A;  3S2V A;  3CFZ A;  1MPC A;  1VFE A;  3K6U A;  3MZ1 A;  2YPN A;  4OFL A;  1TWY A;  4BDM A;  3B6Q A;  4OFO A;  3K1P A;  1MG1 A;  2RCA A;  4MLV A;  1IIW A;  5HM4 B;  1BIY A;  1N7X A;  3MZB A;  5CBR A;  3TAJ A;  3C34 A;  1N0T A;  1YTV A;  2ZXT A;  1Y4C A;  1IIT A;  1M5E A;  1B40 A;  1AIV A;  2VD2 A;  1PBQ A;  4JWY A;  3H6W A;  3TOD A;  1ZU0 A;  3H6U A;  1EH3 A;  1ZMG A;  2XXP A;  4U22 A;  5AE4 A;  1D9V A;  1URS A;  2HAV A;  5ISU A;  4C1T A;  4TLL B;  5H8N B;  2UVG A;  3MC2 A;  4ZDM A;  3O97 A;  4HCW A;  3BBR A;  1JVX A;  4XKP A;  3IX1 A;  1HSJ A;  2OJT A;  4MH5 A;  5AA2 D;  3K1N A;  5CC2 A;  4POW A;  1XVX A;  1R9L A;  1LB8 A;  5KCJ A;  1YCJ A;  1M5B A;  4ELR A;  1QUJ A;  3MQ9 A;  4OVJ A;  1MDP 1;  4ELO A;  1RKM A;  5JEI A;  5DVF A;  5A5X A;  4AQ4 A;  1ZLQ A;  4ZS9 A;  3U93 A;  3K00 A;  2Z8E A;  5I58 A;  1MH4 A;  3IAZ A;  1IXG A;  5F7V A;  5DT6 A;  3UK4 A;  4P0G A;  1QW0 A;  2GFE A;  2PX1 A;  2PYY A;  1ZTY A;  4QFL A;  2Q89 A;  5M2V A;  4G68 B;  1IEJ A;  4R73 A;  5HPQ A;  1FQC A;  2XXU A;  4GL0 A;  4EQ9 A;  3IK6 B;  1SVX B;  1LFH A;  2DYX A;  1B7Z A;  2F97 A;  4OEU A;  1B9J A;  3SEV A;  2GRV A;  3LBS A;  3IB1 A;  1J1N A;  2I6E A;  4XKR A;  2F6G A;  1JEV A;  3G3I A;  4F3S A;  1VSO A;  4JBZ A;  1LBB A;  5DEX A;  1URD A;  4ONY A;  3K6X A;  3MAM A;  2NXO A;  4XIG Q;  3HHG A;  1GGG A;  2QSX A;  3MVY A;  1LCF A;  1TXF A;  4F1Y A;  4MFI A;  1P1U A;  4XKQ A;  3GXA A;  4DXC A;  3S9E A;  1BLF A;  1PBP A;  1GVC A;  1AH5 A;  3KJT A;  2VP1 A;  3U72 A;  3LC8 A;  3OOA A;  2ONS A;  3O6G A;  2B3F A;  3EHU A;  4EUO A;  2M8C A;  3OO9 A;  3SEY A;  4F19 A;  2ZYM A;  3UGW A;  3H4Z A;  3N6T A;  4EF2 A;  4FAJ A;  5H8H A;  2QMW A;  3SEW A;  1O7T A;  1N76 A;  3LR1 A;  3M3F A;  4LQ5 A;  3TZA A;  4QHQ A;  3GBB A;  1OQH A;  1UTH B;  4R9G A;  2AYS A;  2BJJ X;  1MY4 A;  2DE4 A;  3MP8 A;  4ESW A;  3JV9 A;  3OO7 A;  4NED A;  2O69 A;  3S9M C;  4Z7E A;  4YKK A;  1PC3 A;  1A40 A;  3T9X B;  4G8H A;  1MY3 A;  1RYX A;  1JW5 A;  4H0W A;  3IOR A;  4P0I A;  3O6H A;  4TOZ A;  1FQF A;  1IXH A;  4R72 A;  1VFD A;  1XHY A;  3TKD A;  3HST A;  5K2Y A;  3HCQ A;  1LST A;  3G3H A;  3IJX B;  3JYR A;  1SD3 A;  3VV5 A;  4U21 A;  2F36 A;  4F2O A;  4I1D A;  1ANF A;  4QFP A;  4TLM B;  3TTN A;  2ZNU A;  3TFL A;  4QRZ A;  3IB2 A;  4G77 A;  2OWT A;  2THI A;  3K6V A;  4KQP A;  2Z22 A;  1JEU A;  1FTJ A;  4MLQ A;  4ZEF A;  1M5C A;  1EU8 A;  3PUX E;  5FTI A;  2B65 A;  3E13 X;  1DTZ A;  3H06 B;  1LB9 A;  4H8I A;  2P0S A;  4ESX A;  2I3W A;  2XXY A;  2RC9 A;  4GD5 A;  5AA1 A;  1MPD A;  4FE8 A;  2OLB A;  4YZZ A;  4X48 A;  2I48 A;  5HBC A;  1GTK A;  3ECR A;  3PUW E;  1UQW A;  1CB6 A;  2DP8 A;  2DWI A;  3OD7 A;  3RQT A;  3QAX A;  4LON B;  2REG A;  1FW0 A;  1LGB C;  3MP1 A;  4PET A;  1S50 A;  4IB2 A;  3DP8 A;  4F3B A;  3C4M A;  3I3V A;  3JZJ A;  4ZZA A;  2LAO A;  4R74 A;  1XT8 A;  4RPO A;  5CMK A;  3PPO A;  1SYI A;  1B6H A;  4C0R A;  4O3C A;  3SER A;  4TQU Q;  2HQ0 A;  4G8N A;  3RNN A;  3R7X A;  3TEL A;  2XXH A;  1BKA A;  3HV1 A;  3T9V A;  4OEV A;  1OQG A;  3M8U A;  1IXC A;  2X26 A;  4BDN A;  1WVJ A;  5I84 A;  1Y9U A;  4DE8 A;  3QIM A;  4NF4 B;  5I59 A;  4EQ7 A;  4H8J A;  1B1X A;  3QUJ A;  5JK4 A;  3TPA A;  1Y3Q A;  4NF6 B;  3G3K A;  1PDA A;  3CRB A;  1SW4 A;  3FAS A;  3Q29 A;  4EXL A;  4RA1 A;  2UVI A;  5KDT B;  1UIU A;  5I2K B;  4BDL A;  5H8F A;  2F35 A;  3TCH A;  4LAT A;  3MPL A;  3L6H A;  4WKM A;  3RT8 A;  4R6Y A;  1R6Z A;  1P1Q A;  3B7D A;  4R9F A;  2XXW A;  2ZNS A;  4RY1 A;  5I2N B;  2HZL A;  5H8Q B;  2XXQ A;  5TPA A;  5I57 A;  2A5T B;  3E4R A;  3VLV A;  2QL3 A;  5L9M A;  3RT6 B;  3K02 A;  4IO3 A;  2DXY A;  1BP5 A;  1FCK A;  3VE1 B;  2W7Y A;  3CR9 A;  1Y3N A;  3W9W A;  5F1Q A;  5EYF A;  2V93 A;  5L9S A;  3O6I A;  1NKX A;  5L9O A;  4RK9 A;  4QSD A;  4R2F A;  2XXI A;  2V25 A;  4OHN A;  4Q5T A;  4U23 A;  3VVD A;  3N94 A;  2F78 A;  2ZNT A;  3I6V A;  4M1V A;  4F39 A;  2Y7I A;  4RXL A;  3VLU A;  2NWJ A;  2DWH A;  2OBG A;  1UIV A;  1P1W A;  4PFY A;  4QSC A;  5AA4 B;  2V84 A;  3T9U A;  1MPB A;  3TCG A;  1LBC A;  1US4 A;  2YJP A;  4FOR A;  3KBR A;  4GF8 A;  3CFX A;  4AB5 A;  1P1O A;  2AL4 A;  2Q9T A;  4YMA A;  4DDD A;  3TMG A;  3HN0 A;  1JW4 A;  1XVY A;  4QF9 A;  4NF5 A;  4OYV A;  1II5 A;  2UVH A;  3PD8 A;  5K2X A;  1LFI A;  4N6P A;  5KCJ B;  4DCX A;  1MQD A;  5DTB A;  4JWO A;  3MVZ A;  3VVF A;  2NOO A;  3K0V A;  2HCA A;  1UTB A;  1S9T A;  1B52 A;  4DIG A;  3CFL A;  3OMB A;  2XD3 A;  5EHM A;  4F1V A;  4GIZ A;  1WDN A;  4HCY A;  5L8D A;  2NUV A;  1CE2 A;  3WAE A;  1OLA A;  3OSQ A;  3V83 A;  4OER A;  4WEP A;  2X7P A;  4YB5 A;  3KSX A;  1B51 A;  5I56 B;  2FYI A;  4PE5 B;  2XXX A;  3QXM A;  3MJN A;  3KN8 A;  3HPI A;  1MM7 A;  1B5I A;  1OLC A;  1SI1 A;  3U1O A;  1Y20 A;  3FVK A;  4OET A;  3H03 A;  2DS9 A;  4LA9 A;  5BUU A;  3W15 C;  4F1U A;  4F3G A;  1URG A;  3QUF A;  2UXA A;  2FNC A;  1LLS A;  4H65 A;  2OZZ A;  2F34 A;  3K2D A;  3RUM A;  1ZKB A;  1B3L A;  4OTE A;  3T66 A;  1MS7 A;  5H8N A;  3MBP A;  4RJZ A;  2OK2 A;  4X1D A;  4POX A;  2A5S A;  1B7H A;  4N13 A;  3EHS A;  3UOR A;  2ESN A;  4PQJ A;  3LUY A;  4ZEC A;  4JSD A;  1R1N A;  1H76 A;  3OSR A;  3GLB A;  3C36 A;  1WOD A;  3R26 A;  3A09 A;  2RKM A;  3W9V A;  4HTG A;  2E1S A;  3VFJ A;  4OMB A;  1FTM A;  3FVN A;  1HSL A;  3VVE A;  1B32 A;  1RYO A;  3O2A A;  3D4C A;  1XS5 A;  2XXR A;  3LSF B;  3IO4 A;  2I3V A;  3G7W A;  4RK2 A;  2NVU B;  5BWJ A;  1ZIU A;  1B5H A;  3BFT A;  3TTR A;  2DXR A;  3IO6 A;  1D3K A;  4YB6 A;  2XXV A;  3QSL A;  1N7W A;  1Q35 A;  1IUD A;  1FTK A;  2DWJ A;  5JTY B;  3LSX A;  3FAT A;  4G68 A;  4O3B A;  2E0S A;  2XX7 A;  1MQG A;  5FHM A;  3FJ7 A;  2DE3 A;  3I5O A;  2QPQ A;  4NE4 A;  3PPR A;  2PVU A;  2Q2A A;  4KPT A;  4NTL A;  5H8S A;  2CMO A;  1B3H A;  2RC7 A;  4FJP A;  3CSB A;  3E3K A;  1N3X A;  4XTC Q;  3G3F A;  2VHA A;  3FJG A;  1OIB A;  2O1L A;  5AA2 B;  1DMB A;  1DOT A;  3EPE A;  2HAU A;  2D5W A;  3FVG A;  1MY0 A;  1OVT A;  4UA8 A;  1FQA A;  2QS2 A;  2RCB A;  4ND9 A;  2AL5 A;  3UA8 A;  4IO6 A;  2RF1 A;  1LAG E;  4IO4 A;  3V89 B;  1LFG A;  2QMX A;  4MF3 A;  3V5A A;  4E0X A;  2KLF A;  3TQW A;  4YMB A;  4KHZ E;  3FXU A;  2Z23 A;  4G8M A;  3EF7 A;  1A54 A;  3E9X A;  4GWO A;  4JDF A;  1IXI A;  4F31 B;  1QUI A;  3MWB A;  2H98 A;  3D4G A;  3SEX A;  3U92 A;  3HO7 A;  1H43 A;  1Y1M A;  3RN8 A;  5TU0 A;  4OEN A;  3DM0 A;  2I4B A;  4GQO A;  3TYH A;  4BDQ A;  4IY6 A;  1A99 A;  3A3U A;  2O51 A;  3M3K A;  4JB7 A;  2HZK A;  3CG3 A;  1YAE A;  4YU0 A;  5TP9 A;  2HEU A;  4NWC A;  2DVZ A;  3N6U A;  4NMY A;  1Z7M E;  3K1M A;  2PMS A;  2GHA A;  2OCU A;  4R75 A;  1QKB A;  4KYE A;  3PUZ E;  3QK6 A;  1M5F A;  4QSE A;  4LQ2 A;  1FQB A;  2ANJ A;  1B3G A;  3ILU B;  3CSG A;  3F11 A;  1B7U A;  1B46 A;  3RTF B;  4NF8 B;  2XXT A;  4IO7 A;  4QFK A;  1B05 A;  2P1S A;  4LP2 B;  2H25 A;  1A7L A;  3KJ7 A;  4U1Z A;  3TUS A;  3KOT A;  5I59 B;  5CM6 A;  1I6B A;  5CI5 A;  1MXW A;  4KR5 A;  4ECF A;  1LAH E;  3OEL A;  1POY 1;  1P1N A;  4NWD A;  4PFT A;  4ZE8 A;  4JWX A;  2FA7 A;  2RC8 A;  3ZKL A;  1MDQ A;  4R2B A;  4Q8R A;  1GR2 A;  1Q1K A;  3ZSF A;  1B1H A;  1VR5 A;  4KD5 A;  1SW5 A;  4OES A;  3Q28 A;  3OEK A;  5KZT A;  4BDO A;  3ILT B;  2IEE A;  4GL8 A;  1P99 A;  1ZBM A;  5CBS A;  5ICT A;  1LCT A;  1JVY A;  4KFQ A;  4G4P A;  3TTK A;  1ELJ A;  2I0C A;  3IOW A;  2Q8J A;  3M3L A;  4UAC A;  5AA3 A;  4GLI A;  1Y1Z A;  3FV1 A;  4ZZE A;  1IQ7 A;  4H5G A;  3DLN A;  2Y7K A;  4EF1 A;  1SBP A;  2ZMB A;  4R6H A;  4ELP A;  1FQE A;  2H9B A;  2VGQ A; 
#chains in the Genus database with same CATH topology
 3H3G A;  1EZP A;  3Q27 A;  4GOT A;  3FV2 A;  4FAT A;  4Q30 B;  1FPE A;  3V8X B;  1MXY A;  4F3P A;  2O7U A;  4FED A;  4R6K A;  3PPP A;  5IGA A;  1IMC A;  3UP9 A;  5IKB A;  3UN6 A;  1MQJ A;  5IAI A;  1FBP A;  3O29 A;  4NF4 A;  5B7D A;  1AMF A;  2D21 A;  4JVC A;  2PBW A;  5ET6 A;  3K6W A;  5ESY A;  4H1X A;  1TFD A;  1A55 A;  3RGY A;  4IY5 A;  2Q2C A;  4F29 A;  3PU5 A;  4KI0 E;  4FEC A;  4OVS A;  5KDT A;  4X1B A;  3VXC A;  1NV2 A;  5I2K A;  4IO5 A;  3WAF A;  2F7C A;  4DXU A;  2WEF A;  1B2H A;  2ALU A;  4KYS A;  2DQV A;  1HSE A;  1NV7 A;  1TT1 A;  3IOT A;  4U1O A;  4X9T A;  4GX6 A;  4DXB A;  1A8F A;  4JSO A;  1Z7N E;  2I0B A;  1PB9 A;  1JQF A;  5H8Q A;  2I4C A;  2Q8M A;  1DBZ A;  2WYP A;  4AS4 A;  4F18 A;  1Y3P A;  3KSJ A;  4E0W A;  4PP0 A;  2AIX A;  3SEU A;  2A5T A;  2PT2 A;  1IMD A;  3KG2 A;  1SW1 A;  4OVQ A;  3A3C A;  3IB0 A;  3GZG A;  5LTC A;  4I3E A;  1QKA A;  2XWI A;  1SW2 A;  2Y7R A;  4MNC A;  2F7B A;  1R9Q A;  1NNP A;  1LBX A;  2Y7W A;  3KFM A;  1IMA A;  2DOJ A;  3THI A;  4AB6 A;  5IZZ A;  5ITO A;  4PFW A;  4DCY A;  4H67 A;  3MUQ A;  3CIJ A;  5DVJ A;  3MVX A;  4RNS A;  1MY1 A;  2Z8F A;  4EQB A;  1DPP A;  5A5X B;  2QS1 A;  4Z0I A;  1EZO A;  2IA4 A;  5AA4 A;  2L5V A;  5CMM A;  3PMV A;  4ISU A;  1IZ1 A;  3FXR A;  5I58 B;  4GVO A;  4HW8 A;  4P1L A;  2UYE A;  4H5F A;  3KN7 A;  2XHD A;  4GWW A;  3U94 A;  3CVG A;  3GBA A;  4PC9 A;  1YXI A;  3MZ9 A;  3ODB A;  3PGF A;  2P3V A;  3Q26 A;  2YLN A;  3IL1 B;  2QFL A;  2ONR A;  2F7A A;  3T93 B;  3SKP A;  2B4L A;  4IGR A;  1POT A;  3S9N C;  1BK4 A;  1ZJL A;  3PUV E;  3FVO A;  2WKY A;  3EQ1 A;  1MXU A;  4PGN A;  3UIF A;  3H6V A;  1PEB A;  2ABH A;  4OWD A;  2Q74 A;  4PFU A;  4HS7 A;  4GXS B;  4LVQ A;  2VPO A;  3MP6 A;  5A5L A;  3IR1 A;  5DEX B;  1DCU A;  1B58 A;  3FGS A;  1A8E A;  4XXU A;  2DWA A;  1GV8 A;  3FUZ A;  1KWH A;  3ZKK A;  3ZS6 A;  5I56 A;  1NNT A;  2R71 A;  3DP4 A;  1JW1 A;  3KBZ A;  4U4S A;  2R9J A;  2ZZX A;  5EQ7 A;  5FTH A;  3BFU A;  4WED A;  4OXV A;  1TFA A;  3S9L C;  4O3A A;  3B6T A;  3MVW A;  4F2Q A;  2DSF A;  1AL3 A;  4LZ7 A;  4BLA A;  1QVS A;  2ZYK A;  4GRK A;  4MBP A;  2FBP A;  2ZYN A;  5H8H B;  3MW0 A;  2REJ A;  2G29 A;  3T9H B;  4PFB A;  3IJO B;  4QFO A;  1N04 A;  4F22 A;  1N3W A;  1O63 A;  3ROJ A;  1FTL A;  4L17 A;  4YB7 A;  3KC0 A;  3T22 A;  3Q25 A;  3C32 A;  1LAF E;  1JET A;  4KCC A;  1ATG A;  4OVR A;  2V3Q A;  3A29 A;  1QUK A;  2HFB A;  3OO6 A;  4H6D A;  4FEB A;  4I8C A;  2QJE A;  2DVC A;  2X7Q A;  2O7I A;  3LSL A;  3OO8 A;  1PB8 A;  1VE4 A;  3IFA A;  3H6T A;  3KEI A;  1FPG A;  4U4X A;  3DP6 A;  4BDR A;  4GFR A;  3TCF A;  1MQI A;  3O9P A;  2F5X A;  2XD2 A;  4ZED A;  1FRP A;  1MQH A;  2B4M A;  2H99 A;  1USY E;  1OVB A;  4PBQ A;  3RLF E;  1LAX A;  3S4U A;  3TQL A;  4I62 A;  3SDF A;  3N26 A;  3CI8 A;  1NL5 A;  5JTY A;  4NGU A;  1H45 A;  2FHY A;  3PUY E;  1XI6 A;  1I6A A;  1SYH A;  5ELV A;  1B3E A;  1B5J A;  1H3D A;  1N84 A;  4RYA A;  4PDH A;  5TP9 B;  2RIN A;  5CMC A;  4LZ5 A;  5LOM A;  3OEM A;  1SPI A;  3PPN A;  5EHS A;  3TTL A;  5ITP A;  3PD9 A;  4N81 A;  1NFT A;  4YKJ A;  1FQD A;  4G2Z A;  4YAH X;  2WBD A;  2O6A A;  1UTH A;  3PMW A;  4EDP A;  3FZV A;  3IOV A;  5AA2 A;  4ZEB A;  3RY3 A;  1MY2 A;  2Q88 A;  1S7Y A;  2QRY A;  3VDF A;  4OAN A;  2OWS A;  2P2A A;  1B4H A;  4OFJ A;  1BTJ A;  3FXQ A;  2DE2 A;  3P7I A;  4YIC A;  3H7M A;  3VLW A;  2PCR A;  2V3U A;  1B3F A;  4QFN A;  2PT1 A;  4P1E A;  3KOS A;  3MPK A;  4DZ1 A;  4P11 A;  1XC1 A;  4GWY A;  3SET A;  1Y4T A;  3HFU A;  1MXV A;  4JXI A;  5DYH A;  2CZL A;  5FBP A;  1D9Y A;  3CG1 A;  3ISP A;  1QUL A;  2ZYO A;  3AXF A;  3G3J A;  3SES A;  2V3T A;  4KYD A;  2ONK E;  2QS4 A;  1SI0 A;  3LSW A;  3KGC A;  1MM6 A;  3K01 A;  1RDZ A;  4XFE A;  4KCD A;  2B3B A;  1YZ0 A;  4YKP A;  1QJM A;  4MX6 A;  4Q0C A;  1I69 A;  4GBV A;  1AOV A;  1NH7 A;  2QS3 A;  1PB7 A;  2D3I A;  3C33 A;  4LUB A;  3KZG A;  3USD A;  1B4Z A;  2UVJ A;  2Z8D A;  4ZEK A;  2XX8 A;  2FIX A;  4XKN A;  5FHO A;  2VT5 A;  3K4U A;  1B0H A;  1FPI A;  2UYF A;  4FIM A;  4G68 C;  4NHB A;  1NV5 A;  1LBY A;  2O1M A;  4N15 A;  3NOH A;  5H8F B;  3TTM A;  2GH9 A;  1H44 A;  1NUY A;  4EXK A;  1O64 A;  5DVI A;  1DPE A;  3ONM A;  2G93 A;  3FIR A;  3OEN A;  5CMB A;  2XA5 A;  4U2R A;  2WBB A;  5TPA B;  1FTO A;  3EHT A;  4PF6 A;  5I57 B;  4NF8 A;  1VDW A;  1MRP A;  3BKI B;  1MXX A;  4DLD A;  4M4G A;  3N5L A;  1B0L A;  4PE3 A;  1SQY A;  3TDJ A;  3DEL B;  1M5D A;  3C31 A;  2HXW A;  1EZ9 A;  4I9D A;  2F6P A;  3O28 A;  2O84 X;  1MH3 A;  2BJI A;  3RPW A;  3FJM A;  4OZ9 A;  3HHF A;  1FBD A;  3U8Q A;  4I3Y A;  4GX3 A;  1NMU A;  4OQO A;  1F9B A;  2QVR A;  2R6G E;  2GHB A;  4O94 A;  1I6Q A;  4N07 A;  4PFI A;  3PMX A;  3PPQ A;  4THI A;  4GXA A;  4OVT A;  2F8D A;  3T96 B;  3VXB A;  1YPN A;  1FPL A;  3TEP A;  4ELQ A;  1XOC A;  1MXZ A;  1NNK A;  3PV0 E;  2I58 A;  4C1U A;  1US5 A;  3QMF A;  1K9Z A;  1NH8 A;  5F24 A;  1L5T A;  2Y7P A;  3EN3 A;  3KN3 A;  2H4I A;  2H5Y A;  3FD3 A;  3L6G A;  4NF6 A;  4RPN A;  3C9H A;  3RTW B;  4LZ8 A;  5I5P A;  3LV0 A;  1KZ8 A;  2VOZ A;  3O66 A;  4WXJ A;  3B6W A;  4NX1 A;  4YKI A;  2WYK A;  2VD3 A;  1AWB A;  5FHN A;  5ICQ A;  4NF5 B;  1JNF A;  3IOU A;  3C35 A;  1DTG A;  1USY H;  3QYT A;  4ZEI A;  2Y84 A;  3G3G A;  3R6U A;  1T0K A;  2XX9 A;  4IGT A;  1NNF A;  1D4N A;  5I2N A;  1SDX A;  4ZE9 A;  2HPG A;  5B70 A;  5I3S A;  1UTB B;  3OXN A;  2O68 A;  4IO2 A;  5J1D A;  1FBE A;  2I49 A;  4K3F A;  5IZ1 A;  2MKZ A;  1OMP A;  1DSN A;  5CRY A;  3BIG A;  3S2V A;  3CFZ A;  1MPC A;  1VFE A;  3K6U A;  3MZ1 A;  2YPN A;  4OFL A;  1TWY A;  4BDM A;  4PCD A;  3B6Q A;  4OFO A;  5DW8 A;  3K1P A;  1MG1 A;  2RCA A;  4X8R A;  4MLV A;  1IIW A;  5HM4 B;  5EYG A;  1BIY A;  1N7X A;  4KXP A;  3MZB A;  5CBR A;  3TAJ A;  2GQ1 A;  2HXR A;  1EYK A;  1N0T A;  3C34 A;  4MEV A;  1YTV A;  2ZXT A;  1Y4C A;  1IIT A;  1M5E A;  1B40 A;  1AIV A;  2VD2 A;  1PBQ A;  4JWY A;  3H6W A;  3TOD A;  1ZU0 A;  3H6U A;  1EH3 A;  3SZP A;  1ZMG A;  2XXP A;  4U22 A;  5AE4 A;  1D9V A;  1URS A;  2HAV A;  5ISU A;  4C1T A;  4PDD A;  1LBW A;  4MNI A;  4TLL B;  5H8N B;  2UVG A;  3MC2 A;  4PTK A;  4ZDM A;  3O97 A;  4HCW A;  3BBR A;  1JVX A;  4XKP A;  3IX1 A;  1HSJ A;  2OJT A;  4MH5 A;  4DI3 D;  5AA2 D;  3K1N A;  5CC2 A;  4POW A;  1XVX A;  1R9L A;  1LB8 A;  5KCJ A;  1YCJ A;  5I7I A;  1M5B A;  4PAF A;  4ELR A;  4MJO A;  1QUJ A;  3MQ9 A;  4OVJ A;  3RPL B;  1MDP 1;  4ELO A;  1RKM A;  5ET8 A;  5JEI A;  1CNQ A;  5DVF A;  5A5X A;  4AQ4 A;  1ZLQ A;  5IZ3 B;  4ZS9 A;  3U93 A;  3B50 A;  3K00 A;  2Z8E A;  5I58 A;  1MH4 A;  3IAZ A;  1IXG A;  5F7V A;  2R8T A;  5DT6 A;  3UK4 A;  4P0G A;  1QW0 A;  2GFE A;  2PX1 A;  2PYY A;  1ZTY A;  4N6K A;  4QFL A;  2Q89 A;  5M2V A;  4G68 B;  1IEJ A;  4R73 A;  5HPQ A;  1FQC A;  1YYZ A;  2XXU A;  4GL0 A;  4EQ9 A;  3IK6 B;  2XWV A;  1SVX B;  1LFH A;  2DYX A;  1B7Z A;  2F97 A;  4NAP A;  4OEU A;  1B9J A;  3SEV A;  2GRV A;  3LBS A;  3IB1 A;  1J1N A;  2I6E A;  4HE0 A;  4XKR A;  2F6G A;  1JEV A;  4PF8 A;  3G3I A;  4NN3 A;  1FPJ A;  4F3S A;  1VSO A;  2KR0 A;  4JBZ A;  1LBB A;  5DEX A;  2XWK A;  1URD A;  4ONY A;  3K6X A;  4I40 A;  3MAM A;  2NXO A;  4XIG Q;  3HHG A;  1GGG A;  2QSX A;  3MVY A;  1LCF A;  1TXF A;  4F1Y A;  1LBZ A;  4MFI A;  1P1U A;  4XKQ A;  3GXA A;  4DXC A;  3S9E A;  1BLF A;  1PBP A;  1GVC A;  1AH5 A;  4PAI A;  3KJT A;  2VP1 A;  3U72 A;  3U65 A;  3LC8 A;  3OOA A;  2ONS A;  3O6G A;  2B3F A;  3EHU A;  4EUO A;  4O7M A;  2M8C A;  3OO9 A;  3SEY A;  4MMP A;  4F19 A;  2ZYM A;  3UGW A;  3H4Z A;  3N6T A;  4EF2 A;  4FAJ A;  5H8H A;  2QMW A;  3SEW A;  1O7T A;  1N76 A;  3LR1 A;  3M3F A;  4LQ5 A;  3TZA A;  4QHQ A;  3GBB A;  1OQH A;  1UTH B;  4R9G A;  3KC1 A;  2AYS A;  2BJJ X;  1MY4 A;  2DE4 A;  3MP8 A;  4ESW A;  3JV9 A;  3OO7 A;  4GWU A;  4O7I A;  4NED A;  2O69 A;  2CZI A;  3S9M C;  4Z7E A;  4YKK A;  1PC3 A;  1A40 A;  3T9X B;  4G8H A;  1MY3 A;  1RYX A;  1JW5 A;  4H0W A;  3IOR A;  4P0I A;  3O6H A;  4TOZ A;  1FQF A;  1IXH A;  4R72 A;  1VFD A;  1XHY A;  3TKD A;  3HST A;  5K2Y A;  3HCQ A;  1FPF A;  1LST A;  4NQ8 A;  3G3H A;  1QGX A;  3IJX B;  3JYR A;  1SD3 A;  3VV5 A;  4U21 A;  4JVI A;  2F36 A;  4F2O A;  4I1D A;  1ANF A;  4QFP A;  4TLM B;  3TTN A;  5EQ8 A;  2ZNU A;  3TFL A;  3LUZ A;  4QRZ A;  3IB2 A;  4G77 A;  2OWT A;  2Y5K A;  3E79 A;  2THI A;  4OA4 A;  3K6V A;  4KQP A;  1NUW A;  2Z22 A;  1JEU A;  1FTJ A;  1RDY A;  4NG7 A;  4MLQ A;  1JP4 A;  4ZEF A;  1M5C A;  1EU8 A;  3PUX E;  5FTI A;  2B65 A;  3E13 X;  1DTZ A;  3H06 B;  1LB9 A;  4H8I A;  2P0S A;  2F3D A;  4ESX A;  2WX9 A;  2I3W A;  2XXY A;  3B8B A;  2RC9 A;  4PGP A;  1NV6 A;  4GD5 A;  5AA1 A;  1MPD A;  4FE8 A;  1NV4 A;  3E78 A;  2OLB A;  4YZZ A;  4X48 A;  2I48 A;  5HBC A;  1GTK A;  3ECR A;  3PUW E;  3RYD A;  1UQW A;  4MNP A;  1CB6 A;  2DP8 A;  2DWI A;  3OD7 A;  3RQT A;  3QAX A;  4LON B;  2REG A;  1FW0 A;  1LGB C;  3MP1 A;  4HXV A;  4PET A;  1S50 A;  4LN5 A;  4IB2 A;  3DP8 A;  4F3B A;  3T1B A;  3C4M A;  3I3V A;  3JZJ A;  4N17 A;  4ZZA A;  2LAO A;  4R74 A;  1XT8 A;  4RPO A;  4MAG A;  2PFY A;  5CMK A;  3PPO A;  1SYI A;  1B6H A;  4C0R A;  4O3C A;  1FPB A;  3SER A;  4TQU Q;  2HQ0 A;  4G8N A;  3RNN A;  3R7X A;  3TEL A;  2XXH A;  1BKA A;  3HV1 A;  4N8Y A;  2QVV A;  3T9V A;  4OEV A;  1OQG A;  3M8U A;  1IXC A;  2X26 A;  4BDN A;  1WVJ A;  5I84 A;  1Y9U A;  4DE8 A;  3QIM A;  4NF4 B;  5ET7 A;  5I59 A;  4EQ7 A;  4H8J A;  4OVP A;  1B1X A;  5EYH A;  3QUJ A;  5JK4 A;  3TPA A;  1Y3Q A;  4NF6 B;  3G3K A;  1NUX A;  1PDA A;  3CRB A;  4PAK A;  1SW4 A;  3FAS A;  3Q29 A;  4EXL A;  4RA1 A;  2UVI A;  4PBH A;  5KDT B;  1UIU A;  5I2K B;  1FBF A;  4BDL A;  3FXB A;  5H8F A;  2F35 A;  3TCH A;  4LAT A;  3MPL A;  3L6H A;  4WKM A;  3RT8 A;  4R6Y A;  1R6Z A;  1P1Q A;  2KQZ A;  3B7D A;  4R9F A;  4N4U A;  2XXW A;  2ZNS A;  4RY1 A;  5I2N B;  2CZK A;  3T0J A;  2HZL A;  5H8Q B;  2XXQ A;  5TPA A;  5I57 A;  2A5T B;  4N91 A;  3E4R A;  3VLV A;  2QL3 A;  5L9M A;  3RT6 B;  3K02 A;  4IO3 A;  2DXY A;  1BP5 A;  1FCK A;  3VE1 B;  2W7Y A;  3CR9 A;  4QXD A;  1Y3N A;  3W9W A;  2VPN A;  5F1Q A;  5EYF A;  2V93 A;  5L9S A;  3O6I A;  1NKX A;  5L9O A;  4RK9 A;  1IMF A;  4QSD A;  2XWO A;  4R2F A;  3IFC A;  2XXI A;  2V25 A;  4OHN A;  4Q5T A;  4U23 A;  3VVD A;  3N94 A;  2F78 A;  2ZNT A;  3I6V A;  4M1V A;  4XEQ A;  4F39 A;  2Y7I A;  4RXL A;  1IME A;  5IM2 A;  3VLU A;  2NWJ A;  2DWH A;  2OBG A;  1UIV A;  1P1W A;  4PFY A;  4QSC A;  2OWZ A;  4HE2 A;  5AA4 B;  2V84 A;  3T9U A;  1FPD A;  1MPB A;  3TCG A;  1LBC A;  1US4 A;  2FIE A;  2YJP A;  4FOR A;  3KBR A;  4GF8 A;  3CFX A;  4AB5 A;  1P1O A;  4NF0 A;  2AL4 A;  2Q9T A;  4YMA A;  4DDD A;  3TMG A;  3HN0 A;  1JW4 A;  1XVY A;  4QF9 A;  4NF5 A;  1NV3 A;  4OYV A;  1II5 A;  2UVH A;  3PD8 A;  5K2X A;  1LFI A;  2Y5L A;  4N6P A;  2P3N A;  5KCJ B;  4DCX A;  1MQD A;  5DTB A;  4JWO A;  3MVZ A;  3VVF A;  2NOO A;  2HHM A;  2FVZ A;  3K0V A;  2F3B A;  1UTB A;  2HCA A;  1S9T A;  1B52 A;  4DIG A;  3CFL A;  3MYU A;  3OMB A;  2XD3 A;  5EHM A;  4F1V A;  4GIZ A;  5LDZ A;  1WDN A;  4HCY A;  5L8D A;  2NUV A;  1CE2 A;  3EKI A;  3WAE A;  1OLA A;  2OX3 A;  1FTA A;  3OSQ A;  3V83 A;  4OER A;  4XF5 A;  4WEP A;  2X7P A;  4YB5 A;  3KSX A;  1B51 A;  5I56 B;  2FYI A;  4PE5 B;  1IMB A;  2XXX A;  3QXM A;  3MJN A;  2JJK A;  3KN8 A;  4N6D A;  3HPI A;  1MM7 A;  1B5I A;  1OLC A;  1SI1 A;  4HE1 A;  1LBV A;  3GYY A;  3U1O A;  4X04 A;  4H46 A;  1Y20 A;  3FVK A;  5EQA A;  4OET A;  3H03 A;  2DS9 A;  4LA9 A;  5BUU A;  3W15 C;  4F1U A;  4F3G A;  1URG A;  3QUF A;  2UXA A;  4MCO A;  2FNC A;  1LLS A;  4H65 A;  2CZH A;  2OZZ A;  2F34 A;  3K2D A;  4AS5 A;  1FBC A;  3RUM A;  2QVU A;  1ZKB A;  1B3L A;  4OTE A;  3T66 A;  1MS7 A;  1Q9D A;  5H8N A;  3MBP A;  4RJZ A;  2OK2 A;  4X1D A;  4POX A;  2A5S A;  1B7H A;  4N13 A;  3EHS A;  1NI9 A;  3UOR A;  1DK4 A;  2ESN A;  4PQJ A;  3LUY A;  4ZEC A;  4JSD A;  1R1N A;  1H76 A;  5J16 A;  3OSR A;  3GLB A;  4GWZ A;  3C36 A;  1WOD A;  3R26 A;  3A09 A;  2RKM A;  3W9V A;  4HTG A;  2E1S A;  3VFJ A;  4OMB A;  2CEY A;  1FTM A;  3FVN A;  1HSL A;  4DI4 B;  2ZZW A;  3RPL A;  1B32 A;  3VVE A;  4FBP A;  4MIJ A;  4GX4 A;  2CEX A;  4N8G A;  1RYO A;  3O2A A;  3D4C A;  1EYI A;  5IZ3 A;  1XS5 A;  2XXR A;  3LSF B;  4IR8 A;  3IO4 A;  2I3V A;  1FJ6 A;  3G7W A;  4RK2 A;  2NVU B;  5BWJ A;  1ZIU A;  1B5H A;  3BFT A;  3TTR A;  2DXR A;  3IO6 A;  1D3K A;  5ET5 A;  4YB6 A;  2XXV A;  3QSL A;  1N7W A;  1Q35 A;  1IUD A;  1FTK A;  2DWJ A;  5JTY B;  3LSX A;  3FAT A;  4G68 A;  4O3B A;  2E0S A;  2XX7 A;  4MHF A;  1MQG A;  5FHM A;  3FJ7 A;  1INP A;  2DE3 A;  3I5O A;  4JVD A;  2QPQ A;  4NE4 A;  3PPR A;  2PVU A;  2Q2A A;  4KPT A;  4NTL A;  5H8S A;  2CMO A;  1B3H A;  2RC7 A;  4P47 A;  4FJP A;  3CSB A;  3E3K A;  1N3X A;  4XTC Q;  3G3F A;  2VHA A;  1RDX A;  3FJG A;  1G0H A;  1OIB A;  2O1L A;  5AA2 B;  1DMB A;  2DDK A;  1DOT A;  3EPE A;  3PTY A;  2HAU A;  2D5W A;  3FBP A;  3FVG A;  4GWS A;  1MY0 A;  1OVT A;  4UA8 A;  1FQA A;  2QS2 A;  2RCB A;  4ND9 A;  2AL5 A;  3UA8 A;  4IO6 A;  2RF1 A;  1LAG E;  3BIH A;  4IO4 A;  3V89 B;  1LFG A;  3CHG A;  4P8B A;  2QMX A;  5T3J A;  4MF3 A;  3V5A A;  4E0X A;  2KLF A;  3TQW A;  4YMB A;  4KHZ E;  1NV0 A;  3FXU A;  2Z23 A;  4G8M A;  3EF7 A;  1A54 A;  3E9X A;  4GWO A;  4JDF A;  1IXI A;  1QUI A;  3MWB A;  2H98 A;  3D4G A;  3SEX A;  3U92 A;  4F31 B;  3HO7 A;  1H43 A;  1Y1M A;  3RN8 A;  5TU0 A;  4OEN A;  3DM0 A;  2I4B A;  4GQO A;  3TYH A;  4BDQ A;  4IY6 A;  4PFR A;  1A99 A;  3A3U A;  2O51 A;  4O8M A;  3M3K A;  4JB7 A;  4G61 A;  2HZK A;  3CG3 A;  4P56 A;  1YAE A;  4YU0 A;  5TP9 A;  2HEU A;  4P3L A;  4NWC A;  1FBH A;  2DVZ A;  3N6U A;  4NMY A;  1Z7M E;  3K1M A;  4UAB A;  2PMS A;  1D9Q A;  2GHA A;  2OCU A;  2ZZV A;  4R75 A;  1EYJ A;  1QKB A;  4KYE A;  3MST A;  2XXK A;  3PUZ E;  3QK6 A;  4P9K A;  1M5F A;  4QSE A;  4LQ2 A;  1K9Y A;  1FQB A;  2ANJ A;  1B3G A;  3ILU B;  3CSG A;  3F11 A;  1B7U A;  1B46 A;  3RTF B;  4NF8 B;  2XXT A;  4IO7 A;  4QFK A;  1B05 A;  1LEV A;  2P1S A;  4LP2 B;  1FBG A;  2H25 A;  1A7L A;  3KJ7 A;  4U1Z A;  3TUS A;  3KOT A;  5I59 B;  5CM6 A;  1I6B A;  5CI5 A;  1MXW A;  4KR5 A;  4ECF A;  1LAH E;  3OEL A;  1POY 1;  4GBW A;  1P1N A;  4NWD A;  4PFT A;  4ZE8 A;  5EQ9 A;  2PFZ A;  1NV1 A;  4JWX A;  2FA7 A;  2RC8 A;  3ZKL A;  1MDQ A;  4R2B A;  4Q8R A;  1GR2 A;  1Q1K A;  3ZSF A;  1FJ9 A;  1B1H A;  1VR5 A;  4KD5 A;  1SW5 A;  4OES A;  3Q28 A;  4H45 A;  3OEK A;  5KZT A;  1NUZ A;  4BDO A;  3ILT B;  2IEE A;  4GWX A;  4GL8 A;  1P99 A;  1ZBM A;  5CBS A;  1KA1 A;  5ICT A;  1LCT A;  1JVY A;  4KFQ A;  1FSA A;  2V4C A;  4G4P A;  3TTK A;  1ELJ A;  2I0C A;  3IOW A;  2Q8J A;  3M3L A;  4UAC A;  5AA3 A;  4GLI A;  1Y1Z A;  3FV1 A;  1FPK A;  4ZZE A;  1IQ7 A;  4H5G A;  3DLN A;  2Y7K A;  4EF1 A;  1SBP A;  2ZMB A;  1KA0 A;  4R6H A;  4ELP A;  1FQE A;  4QBA A;  1G0I A;  3D1R A;  2H9B A;  2VGQ A; 
#chains in the Genus database with same CATH homology
 3H3G A;  1EZP A;  3Q27 A;  4GOT A;  3FV2 A;  4FAT A;  4Q30 B;  3V8X B;  1MXY A;  4F3P A;  2O7U A;  4FED A;  4R6K A;  3PPP A;  3UP9 A;  5IKB A;  3UN6 A;  1MQJ A;  5IAI A;  3O29 A;  4NF4 A;  5B7D A;  1AMF A;  2D21 A;  2PBW A;  3K6W A;  4H1X A;  1TFD A;  1A55 A;  3RGY A;  4IY5 A;  2Q2C A;  4F29 A;  3PU5 A;  4KI0 E;  4FEC A;  5KDT A;  4X1B A;  3VXC A;  5I2K A;  4IO5 A;  3WAF A;  2F7C A;  4DXU A;  1B2H A;  2ALU A;  4KYS A;  2DQV A;  1HSE A;  1TT1 A;  3IOT A;  4U1O A;  4X9T A;  4DXB A;  1A8F A;  4JSO A;  1Z7N E;  2I0B A;  1PB9 A;  1JQF A;  5H8Q A;  2I4C A;  4F18 A;  1Y3P A;  3KSJ A;  4E0W A;  4PP0 A;  2AIX A;  3SEU A;  2A5T A;  2PT2 A;  3KG2 A;  1SW1 A;  3A3C A;  3IB0 A;  3GZG A;  1QKA A;  1SW2 A;  2Y7R A;  2F7B A;  1R9Q A;  1NNP A;  2Y7W A;  3KFM A;  2DOJ A;  3THI A;  4AB6 A;  5ITO A;  4PFW A;  4DCY A;  4H67 A;  3MUQ A;  3CIJ A;  5DVJ A;  3MVX A;  4RNS A;  1MY1 A;  2Z8F A;  4EQB A;  1DPP A;  5A5X B;  2QS1 A;  4Z0I A;  1EZO A;  2IA4 A;  5AA4 A;  5CMM A;  3PMV A;  4ISU A;  1IZ1 A;  3FXR A;  5I58 B;  4GVO A;  4HW8 A;  2UYE A;  4H5F A;  3KN7 A;  2XHD A;  3U94 A;  3CVG A;  3GBA A;  3MZ9 A;  3ODB A;  3PGF A;  3Q26 A;  2YLN A;  3IL1 B;  2ONR A;  2F7A A;  3T93 B;  3SKP A;  4IGR A;  1POT A;  3S9N C;  1ZJL A;  3PUV E;  3FVO A;  2WKY A;  3EQ1 A;  1MXU A;  3UIF A;  3H6V A;  1PEB A;  2ABH A;  4OWD A;  4PFU A;  4HS7 A;  4GXS B;  4LVQ A;  3MP6 A;  3IR1 A;  5DEX B;  1B58 A;  3FGS A;  1A8E A;  4XXU A;  2DWA A;  1GV8 A;  3FUZ A;  1KWH A;  3ZKK A;  3ZS6 A;  5I56 A;  1NNT A;  2R71 A;  3DP4 A;  1JW1 A;  4U4S A;  2R9J A;  5FTH A;  3BFU A;  4WED A;  4OXV A;  1TFA A;  3S9L C;  4O3A A;  3B6T A;  3MVW A;  4F2Q A;  2DSF A;  1AL3 A;  4LZ7 A;  4BLA A;  1QVS A;  2ZYK A;  4GRK A;  4MBP A;  2ZYN A;  5H8H B;  3MW0 A;  2REJ A;  2G29 A;  3T9H B;  3IJO B;  4QFO A;  1N04 A;  4F22 A;  1N3W A;  1O63 A;  1FTL A;  4L17 A;  4YB7 A;  3T22 A;  3Q25 A;  3C32 A;  1LAF E;  1JET A;  4KCC A;  1ATG A;  2V3Q A;  1QUK A;  2HFB A;  3OO6 A;  4H6D A;  4FEB A;  4I8C A;  2QJE A;  2DVC A;  2X7Q A;  2O7I A;  3LSL A;  3OO8 A;  1PB8 A;  1VE4 A;  3H6T A;  3KEI A;  4U4X A;  3DP6 A;  4BDR A;  4GFR A;  3TCF A;  1MQI A;  3O9P A;  2F5X A;  2XD2 A;  4ZED A;  1MQH A;  2H99 A;  1USY E;  1OVB A;  3RLF E;  1LAX A;  3S4U A;  3TQL A;  4I62 A;  3SDF A;  3N26 A;  3CI8 A;  1NL5 A;  5JTY A;  1H45 A;  3PUY E;  1I6A A;  1SYH A;  5ELV A;  1B3E A;  1B5J A;  1H3D A;  1N84 A;  4RYA A;  5TP9 B;  2RIN A;  5CMC A;  4LZ5 A;  5LOM A;  3OEM A;  3PPN A;  5EHS A;  3TTL A;  5ITP A;  3PD9 A;  1NFT A;  4YKJ A;  1FQD A;  4G2Z A;  4YAH X;  2O6A A;  1UTH A;  3PMW A;  4EDP A;  3FZV A;  3IOV A;  5AA2 A;  4ZEB A;  3RY3 A;  1MY2 A;  2Q88 A;  1S7Y A;  2QRY A;  3VDF A;  2OWS A;  2P2A A;  1B4H A;  4OFJ A;  1BTJ A;  3FXQ A;  2DE2 A;  3P7I A;  4YIC A;  3H7M A;  3VLW A;  2V3U A;  1B3F A;  4QFN A;  2PT1 A;  3KOS A;  3MPK A;  4DZ1 A;  4P11 A;  1XC1 A;  3SET A;  1Y4T A;  1MXV A;  4JXI A;  5DYH A;  2CZL A;  1D9Y A;  3CG1 A;  1QUL A;  2ZYO A;  3AXF A;  3G3J A;  3SES A;  2V3T A;  4KYD A;  2ONK E;  2QS4 A;  1SI0 A;  3LSW A;  3KGC A;  1MM6 A;  3K01 A;  4KCD A;  2B3B A;  4YKP A;  1QJM A;  4Q0C A;  1I69 A;  1AOV A;  1NH7 A;  2QS3 A;  1PB7 A;  2D3I A;  3C33 A;  4LUB A;  3KZG A;  3USD A;  1B4Z A;  2UVJ A;  2Z8D A;  4ZEK A;  2XX8 A;  4XKN A;  5FHO A;  3K4U A;  1B0H A;  2UYF A;  4FIM A;  4G68 C;  2O1M A;  5H8F B;  3TTM A;  2GH9 A;  1H44 A;  4EXK A;  1O64 A;  5DVI A;  1DPE A;  3ONM A;  2G93 A;  3FIR A;  3OEN A;  5CMB A;  4U2R A;  5TPA B;  1FTO A;  3EHT A;  5I57 B;  4NF8 A;  1MRP A;  3BKI B;  1MXX A;  4DLD A;  4M4G A;  3N5L A;  1B0L A;  1SQY A;  3TDJ A;  3DEL B;  1M5D A;  3C31 A;  2HXW A;  1EZ9 A;  4I9D A;  2F6P A;  3O28 A;  2O84 X;  1MH3 A;  3RPW A;  3FJM A;  4OZ9 A;  3HHF A;  3U8Q A;  4OQO A;  1NMU A;  1F9B A;  2R6G E;  2GHB A;  1I6Q A;  4N07 A;  3PMX A;  3PPQ A;  4THI A;  4GXA A;  2F8D A;  3T96 B;  3VXB A;  1YPN A;  3TEP A;  4ELQ A;  1XOC A;  1MXZ A;  1NNK A;  3PV0 E;  2I58 A;  4C1U A;  1US5 A;  1NH8 A;  1L5T A;  2Y7P A;  3EN3 A;  3KN3 A;  2H4I A;  2H5Y A;  3FD3 A;  3L6G A;  4NF6 A;  4RPN A;  3C9H A;  3RTW B;  4LZ8 A;  2VOZ A;  3O66 A;  4WXJ A;  3B6W A;  4YKI A;  2VD3 A;  5FHN A;  5ICQ A;  4NF5 B;  1JNF A;  3IOU A;  3C35 A;  1DTG A;  1USY H;  3QYT A;  4ZEI A;  2Y84 A;  3G3G A;  3R6U A;  1T0K A;  2XX9 A;  4IGT A;  1NNF A;  1D4N A;  5I2N A;  1SDX A;  4ZE9 A;  5B70 A;  1UTB B;  3OXN A;  2O68 A;  4IO2 A;  5J1D A;  2I49 A;  4K3F A;  1OMP A;  1DSN A;  5CRY A;  3S2V A;  3CFZ A;  1MPC A;  1VFE A;  3K6U A;  3MZ1 A;  2YPN A;  4OFL A;  1TWY A;  4BDM A;  3B6Q A;  4OFO A;  3K1P A;  1MG1 A;  2RCA A;  4MLV A;  1IIW A;  5HM4 B;  1BIY A;  1N7X A;  3MZB A;  5CBR A;  3TAJ A;  3C34 A;  1N0T A;  1YTV A;  2ZXT A;  1Y4C A;  1IIT A;  1M5E A;  1B40 A;  1AIV A;  2VD2 A;  1PBQ A;  4JWY A;  3H6W A;  3TOD A;  1ZU0 A;  3H6U A;  1EH3 A;  1ZMG A;  2XXP A;  4U22 A;  5AE4 A;  1D9V A;  1URS A;  2HAV A;  5ISU A;  4C1T A;  4TLL B;  5H8N B;  2UVG A;  3MC2 A;  4ZDM A;  3O97 A;  4HCW A;  3BBR A;  1JVX A;  4XKP A;  3IX1 A;  1HSJ A;  2OJT A;  4MH5 A;  5AA2 D;  3K1N A;  5CC2 A;  4POW A;  1XVX A;  1R9L A;  1LB8 A;  5KCJ A;  1YCJ A;  1M5B A;  4ELR A;  1QUJ A;  3MQ9 A;  4OVJ A;  1MDP 1;  4ELO A;  1RKM A;  5JEI A;  5DVF A;  5A5X A;  4AQ4 A;  1ZLQ A;  4ZS9 A;  3U93 A;  3K00 A;  2Z8E A;  5I58 A;  1MH4 A;  3IAZ A;  1IXG A;  5F7V A;  5DT6 A;  3UK4 A;  4P0G A;  1QW0 A;  2GFE A;  2PX1 A;  2PYY A;  1ZTY A;  4QFL A;  2Q89 A;  5M2V A;  4G68 B;  1IEJ A;  4R73 A;  5HPQ A;  1FQC A;  2XXU A;  4GL0 A;  4EQ9 A;  3IK6 B;  1SVX B;  1LFH A;  2DYX A;  1B7Z A;  2F97 A;  4OEU A;  1B9J A;  3SEV A;  2GRV A;  3LBS A;  3IB1 A;  1J1N A;  2I6E A;  4XKR A;  2F6G A;  1JEV A;  3G3I A;  4F3S A;  1VSO A;  4JBZ A;  1LBB A;  5DEX A;  1URD A;  4ONY A;  3K6X A;  3MAM A;  2NXO A;  4XIG Q;  3HHG A;  1GGG A;  2QSX A;  3MVY A;  1LCF A;  1TXF A;  4F1Y A;  4MFI A;  1P1U A;  4XKQ A;  3GXA A;  4DXC A;  3S9E A;  1BLF A;  1PBP A;  1GVC A;  1AH5 A;  3KJT A;  2VP1 A;  3U72 A;  3LC8 A;  3OOA A;  2ONS A;  3O6G A;  2B3F A;  3EHU A;  4EUO A;  2M8C A;  3OO9 A;  3SEY A;  4F19 A;  2ZYM A;  3UGW A;  3H4Z A;  3N6T A;  4EF2 A;  4FAJ A;  5H8H A;  2QMW A;  3SEW A;  1O7T A;  1N76 A;  3LR1 A;  3M3F A;  4LQ5 A;  3TZA A;  4QHQ A;  3GBB A;  1OQH A;  1UTH B;  4R9G A;  2AYS A;  2BJJ X;  1MY4 A;  2DE4 A;  3MP8 A;  4ESW A;  3JV9 A;  3OO7 A;  4NED A;  2O69 A;  3S9M C;  4Z7E A;  4YKK A;  1PC3 A;  1A40 A;  3T9X B;  4G8H A;  1MY3 A;  1RYX A;  1JW5 A;  4H0W A;  3IOR A;  4P0I A;  3O6H A;  4TOZ A;  1FQF A;  1IXH A;  4R72 A;  1VFD A;  1XHY A;  3TKD A;  3HST A;  5K2Y A;  3HCQ A;  1LST A;  3G3H A;  3IJX B;  3JYR A;  1SD3 A;  3VV5 A;  4U21 A;  2F36 A;  4F2O A;  4I1D A;  1ANF A;  4QFP A;  4TLM B;  3TTN A;  2ZNU A;  3TFL A;  4QRZ A;  3IB2 A;  4G77 A;  2OWT A;  2THI A;  3K6V A;  4KQP A;  2Z22 A;  1JEU A;  1FTJ A;  4MLQ A;  4ZEF A;  1M5C A;  1EU8 A;  3PUX E;  5FTI A;  2B65 A;  3E13 X;  1DTZ A;  3H06 B;  1LB9 A;  4H8I A;  2P0S A;  4ESX A;  2I3W A;  2XXY A;  2RC9 A;  4GD5 A;  5AA1 A;  1MPD A;  4FE8 A;  2OLB A;  4YZZ A;  4X48 A;  2I48 A;  5HBC A;  1GTK A;  3ECR A;  3PUW E;  1UQW A;  1CB6 A;  2DP8 A;  2DWI A;  3OD7 A;  3RQT A;  3QAX A;  4LON B;  2REG A;  1FW0 A;  1LGB C;  3MP1 A;  4PET A;  1S50 A;  4IB2 A;  3DP8 A;  4F3B A;  3C4M A;  3I3V A;  3JZJ A;  4ZZA A;  2LAO A;  4R74 A;  1XT8 A;  4RPO A;  5CMK A;  3PPO A;  1SYI A;  1B6H A;  4C0R A;  4O3C A;  3SER A;  4TQU Q;  2HQ0 A;  4G8N A;  3RNN A;  3R7X A;  3TEL A;  2XXH A;  1BKA A;  3HV1 A;  3T9V A;  4OEV A;  1OQG A;  3M8U A;  1IXC A;  2X26 A;  4BDN A;  1WVJ A;  5I84 A;  1Y9U A;  4DE8 A;  3QIM A;  4NF4 B;  5I59 A;  4EQ7 A;  4H8J A;  1B1X A;  3QUJ A;  5JK4 A;  3TPA A;  1Y3Q A;  4NF6 B;  3G3K A;  1PDA A;  3CRB A;  1SW4 A;  3FAS A;  3Q29 A;  4EXL A;  4RA1 A;  2UVI A;  5KDT B;  1UIU A;  5I2K B;  4BDL A;  5H8F A;  2F35 A;  3TCH A;  4LAT A;  3MPL A;  3L6H A;  4WKM A;  3RT8 A;  4R6Y A;  1R6Z A;  1P1Q A;  3B7D A;  4R9F A;  2XXW A;  2ZNS A;  4RY1 A;  5I2N B;  2HZL A;  5H8Q B;  2XXQ A;  5TPA A;  5I57 A;  2A5T B;  3E4R A;  3VLV A;  2QL3 A;  5L9M A;  3RT6 B;  3K02 A;  4IO3 A;  2DXY A;  1BP5 A;  1FCK A;  3VE1 B;  2W7Y A;  3CR9 A;  1Y3N A;  3W9W A;  5F1Q A;  5EYF A;  2V93 A;  5L9S A;  3O6I A;  1NKX A;  5L9O A;  4RK9 A;  4QSD A;  4R2F A;  2XXI A;  2V25 A;  4OHN A;  4Q5T A;  4U23 A;  3VVD A;  3N94 A;  2F78 A;  2ZNT A;  3I6V A;  4M1V A;  4F39 A;  2Y7I A;  4RXL A;  3VLU A;  2NWJ A;  2DWH A;  2OBG A;  1UIV A;  1P1W A;  4PFY A;  4QSC A;  5AA4 B;  2V84 A;  3T9U A;  1MPB A;  3TCG A;  1LBC A;  1US4 A;  2YJP A;  4FOR A;  3KBR A;  4GF8 A;  3CFX A;  4AB5 A;  1P1O A;  2AL4 A;  2Q9T A;  4YMA A;  4DDD A;  3TMG A;  3HN0 A;  1JW4 A;  1XVY A;  4QF9 A;  4NF5 A;  4OYV A;  1II5 A;  2UVH A;  3PD8 A;  5K2X A;  1LFI A;  4N6P A;  5KCJ B;  4DCX A;  1MQD A;  5DTB A;  4JWO A;  3MVZ A;  3VVF A;  2NOO A;  3K0V A;  2HCA A;  1UTB A;  1S9T A;  1B52 A;  4DIG A;  3CFL A;  3OMB A;  2XD3 A;  5EHM A;  4F1V A;  4GIZ A;  1WDN A;  4HCY A;  5L8D A;  2NUV A;  1CE2 A;  3WAE A;  1OLA A;  3OSQ A;  3V83 A;  4OER A;  4WEP A;  2X7P A;  4YB5 A;  3KSX A;  1B51 A;  5I56 B;  2FYI A;  4PE5 B;  2XXX A;  3QXM A;  3MJN A;  3KN8 A;  3HPI A;  1MM7 A;  1B5I A;  1OLC A;  1SI1 A;  3U1O A;  1Y20 A;  3FVK A;  4OET A;  3H03 A;  2DS9 A;  4LA9 A;  5BUU A;  3W15 C;  4F1U A;  4F3G A;  1URG A;  3QUF A;  2UXA A;  2FNC A;  1LLS A;  4H65 A;  2OZZ A;  2F34 A;  3K2D A;  3RUM A;  1ZKB A;  1B3L A;  4OTE A;  3T66 A;  1MS7 A;  5H8N A;  3MBP A;  4RJZ A;  2OK2 A;  4X1D A;  4POX A;  2A5S A;  1B7H A;  4N13 A;  3EHS A;  3UOR A;  2ESN A;  4PQJ A;  3LUY A;  4ZEC A;  4JSD A;  1R1N A;  1H76 A;  3OSR A;  3GLB A;  3C36 A;  1WOD A;  3R26 A;  3A09 A;  2RKM A;  3W9V A;  4HTG A;  2E1S A;  3VFJ A;  4OMB A;  1FTM A;  3FVN A;  1HSL A;  3VVE A;  1B32 A;  1RYO A;  3O2A A;  3D4C A;  1XS5 A;  2XXR A;  3LSF B;  3IO4 A;  2I3V A;  3G7W A;  4RK2 A;  2NVU B;  5BWJ A;  1ZIU A;  1B5H A;  3BFT A;  3TTR A;  2DXR A;  3IO6 A;  1D3K A;  4YB6 A;  2XXV A;  3QSL A;  1N7W A;  1Q35 A;  1IUD A;  1FTK A;  2DWJ A;  5JTY B;  3LSX A;  3FAT A;  4G68 A;  4O3B A;  2E0S A;  2XX7 A;  1MQG A;  5FHM A;  3FJ7 A;  2DE3 A;  3I5O A;  2QPQ A;  4NE4 A;  3PPR A;  2PVU A;  2Q2A A;  4KPT A;  4NTL A;  5H8S A;  2CMO A;  1B3H A;  2RC7 A;  4FJP A;  3CSB A;  3E3K A;  1N3X A;  4XTC Q;  3G3F A;  2VHA A;  3FJG A;  1OIB A;  2O1L A;  5AA2 B;  1DMB A;  1DOT A;  3EPE A;  2HAU A;  2D5W A;  3FVG A;  1MY0 A;  1OVT A;  4UA8 A;  1FQA A;  2QS2 A;  2RCB A;  4ND9 A;  2AL5 A;  3UA8 A;  4IO6 A;  2RF1 A;  1LAG E;  4IO4 A;  3V89 B;  1LFG A;  2QMX A;  4MF3 A;  3V5A A;  4E0X A;  2KLF A;  3TQW A;  4YMB A;  4KHZ E;  3FXU A;  2Z23 A;  4G8M A;  3EF7 A;  1A54 A;  3E9X A;  4GWO A;  4JDF A;  1IXI A;  4F31 B;  1QUI A;  3MWB A;  2H98 A;  3D4G A;  3SEX A;  3U92 A;  3HO7 A;  1H43 A;  1Y1M A;  3RN8 A;  5TU0 A;  4OEN A;  3DM0 A;  2I4B A;  4GQO A;  3TYH A;  4BDQ A;  4IY6 A;  1A99 A;  3A3U A;  2O51 A;  3M3K A;  4JB7 A;  2HZK A;  3CG3 A;  1YAE A;  4YU0 A;  5TP9 A;  2HEU A;  4NWC A;  2DVZ A;  3N6U A;  4NMY A;  1Z7M E;  3K1M A;  2PMS A;  2GHA A;  2OCU A;  4R75 A;  1QKB A;  4KYE A;  3PUZ E;  3QK6 A;  1M5F A;  4QSE A;  4LQ2 A;  1FQB A;  2ANJ A;  1B3G A;  3ILU B;  3CSG A;  3F11 A;  1B7U A;  1B46 A;  3RTF B;  4NF8 B;  2XXT A;  4IO7 A;  4QFK A;  1B05 A;  2P1S A;  4LP2 B;  2H25 A;  1A7L A;  3KJ7 A;  4U1Z A;  3TUS A;  3KOT A;  5I59 B;  5CM6 A;  1I6B A;  5CI5 A;  1MXW A;  4KR5 A;  4ECF A;  1LAH E;  3OEL A;  1POY 1;  1P1N A;  4NWD A;  4PFT A;  4ZE8 A;  4JWX A;  2FA7 A;  2RC8 A;  3ZKL A;  1MDQ A;  4R2B A;  4Q8R A;  1GR2 A;  1Q1K A;  3ZSF A;  1B1H A;  1VR5 A;  4KD5 A;  1SW5 A;  4OES A;  3Q28 A;  3OEK A;  5KZT A;  4BDO A;  3ILT B;  2IEE A;  4GL8 A;  1P99 A;  1ZBM A;  5CBS A;  5ICT A;  1LCT A;  1JVY A;  4KFQ A;  4G4P A;  3TTK A;  1ELJ A;  2I0C A;  3IOW A;  2Q8J A;  3M3L A;  4UAC A;  5AA3 A;  4GLI A;  1Y1Z A;  3FV1 A;  4ZZE A;  1IQ7 A;  4H5G A;  3DLN A;  2Y7K A;  4EF1 A;  1SBP A;  2ZMB A;  4R6H A;  4ELP A;  1FQE A;  2H9B A;  2VGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...