2Q2KA

Structure of nucleic-acid binding protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
KETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Segrosome structure revealed by a complex of ParR with centromere DNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*AP*GP*TP*AP*TP*AP*(5IU)P*AP*CP*(5IU)P*AP*GP*TP*AP
total genus 8
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.90 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 2q2kA00
2Q2KA
chains in the Genus database with same CATH superfamily
2B43A 3SFGA 2WVFA 2H3AA 2BJ7A 3VW4A 2BJ1A 3SFUA 2WVDA 1OHNA 3GXQA 3UPFA 3NO7A 3H87C 3OD2A 1Q5VA 3NAIA 4MJWA 2AY0A 2JXGA 1U9PA 2CAXA 2HZVA 1ARRA 1SH2A 3H5XA 4D8JA 2RBFA 4QPXA 3FT7A 2K6LA 2AN7A 1IRQA 2CKWA 2WVBA 3UQSA 2UUTA 3IR7A 3BSOA 2JXIA 2KKEA 2KELA 1P94A 2BNWA 3UR0A 4AAIA 4LRVA 2WK4A 2K29A 1BDVA 4O4RA 3LJPA 1EA4A 2A2BA 4LQ9A 1BAZA 2BJ8A 2BA3A 1BDTA 2Q2KA 4LQ3A 2HZAA 3VEBA 1NLAA 4NRUA 4FXEA 3H5YA 2WVCA 3LGHA 3G5OA 2UUWA 4NRTA 2ADLA 1QTGA 2H1OE 3NNEA 1SH3A 1OG7A 2K1OA 1SH0A 3VEAA 1X93A 3BSNA 4ME7E 1ARQA 2WVEA 2CAJA 1MNTA 2BJ3A 2BSQE 3NAHA 2BNZA 2CA9A 3QIDA 4HV0A 2GPEA 1SIWA 2CADA 2KOEA 2CPGA 2BJ9A 1B28A 2K5JA 1B01A 2JXHA 2K9IA 2JBVA 1Q16A 1PARA 1MYLA 1MYKA 3QOQA 3FMTA
chains in the Genus database with same CATH topology
2AN7A 2Q2KA 4LQ3A 3BSNA 2B43A 3SFGA 2H3AA 2CKWA 3UQSA 2UUTA 4NRUA 3SFUA 3NAHA 3IR7A 3BSOA 3H5YA 1OHNA 2KKEA 3G5OA 3UPFA 3NO7A 3QIDA 1SIWA 2UUWA 3NAIA 4NRTA 2KOEA 4LRVA 2WK4A 4MJWA 2ADLA 4AAIA 3UR0A 4O4RA 3NNEA 3LJPA 2A2BA 4LQ9A 1SH3A 1OG7A 1SH2A 3H5XA 2JBVA 1Q16A 4QPXA 1SH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2K A; 
#chains in the Genus database with same CATH topology
 2B43 A;  3SFG A;  2WVF A;  2H3A A;  2BJ7 A;  3VW4 A;  2BJ1 A;  3SFU A;  2WVD A;  1OHN A;  3GXQ A;  3UPF A;  3NO7 A;  3H87 C;  3OD2 A;  1Q5V A;  3NAI A;  4MJW A;  2AY0 A;  2JXG A;  1U9P A;  2CAX A;  2HZV A;  1ARR A;  1SH2 A;  3H5X A;  4D8J A;  2RBF A;  4QPX A;  3FT7 A;  2K6L A;  2AN7 A;  1IRQ A;  2CKW A;  2WVB A;  3UQS A;  2UUT A;  3IR7 A;  3BSO A;  2JXI A;  2KKE A;  2KEL A;  1P94 A;  2BNW A;  3UR0 A;  4AAI A;  4LRV A;  2WK4 A;  2K29 A;  1BDV A;  4O4R A;  3LJP A;  1EA4 A;  2A2B A;  4LQ9 A;  1BAZ A;  2BJ8 A;  2BA3 A;  1BDT A;  2Q2K A;  4LQ3 A;  2HZA A;  3VEB A;  1NLA A;  4NRU A;  4FXE A;  3H5Y A;  2WVC A;  3LGH A;  3G5O A;  2UUW A;  4NRT A;  2ADL A;  1QTG A;  2H1O E;  3NNE A;  1SH3 A;  1OG7 A;  2K1O A;  1SH0 A;  3VEA A;  1X93 A;  3BSN A;  4ME7 E;  1ARQ A;  2WVE A;  2CAJ A;  1MNT A;  2BJ3 A;  2BSQ E;  3NAH A;  2BNZ A;  2CA9 A;  3QID A;  4HV0 A;  2GPE A;  1SIW A;  2CAD A;  2KOE A;  2CPG A;  2BJ9 A;  1B28 A;  2K5J A;  1B01 A;  2JXH A;  2K9I A;  2JBV A;  1Q16 A;  1PAR A;  1MYL A;  1MYK A;  3QOQ A;  3FMT A; 
#chains in the Genus database with same CATH homology
 2AN7 A;  2Q2K A;  4LQ3 A;  3BSN A;  2B43 A;  3SFG A;  2H3A A;  2CKW A;  3UQS A;  2UUT A;  4NRU A;  3SFU A;  3NAH A;  3IR7 A;  3BSO A;  3H5Y A;  1OHN A;  2KKE A;  3G5O A;  3UPF A;  3NO7 A;  3QID A;  1SIW A;  2UUW A;  3NAI A;  4NRT A;  2KOE A;  4LRV A;  2WK4 A;  4MJW A;  2ADL A;  4AAI A;  3UR0 A;  4O4R A;  3NNE A;  3LJP A;  2A2B A;  4LQ9 A;  1SH3 A;  1OG7 A;  1SH2 A;  3H5X A;  2JBV A;  1Q16 A;  4QPX A;  1SH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...