2Q2PA

Beta-lactoglobulin (reverse native)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
152
structure length
152
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title An asymmetric dimer of beta-lactoglobulin in a low humidity crystal form-Structural changes that accompany partial dehydration and protein action.
pubmed doi rcsb
molecule tags Transport protein
total genus 31
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2q2pA00
1A3YA 2JU3A 2WQAE 1FEMA 3FW5A 1A57A 4ZHFA 3P6DA 2AT3X 2WSJA 3B2KA 4TJZA 2YG2A 1LIBA 3P6HA 2WQ9A 5LJKA 5HA1A 1OBPA 3HK1A 2CZUA 2FWVA 2AT5X 2QO5A 2WEWA 4A60A 4QYPA 4ALBA 1DC9A 3FEKA 4TKHA 4M7MA 3KZAA 4ZHGA 4IAXA 5HCEC 4YKOA 5EEDA 4A1HA 2N93A 3EMMA 3WXQA 1KXOA 2NNQA 5HAEA 5LKEA 3WJCA 3CBCA 1E00A 2ANSA 3C76X 3CBSA 3I17A 5HZ8A 2NNDA 5HA0A 1X71A 1ZNKA 4MVKA 3BRNA 1DZJA 1ADLA 3GAQA 5H8TA 4AZQA 1DV9A 4I3DA 3STKA 4ZH9A 1CBRA 2FS6A 3CMPA 2L5PA 4ALOA 2QO4A 1GXAA 1MX8A 5FENA 1G7NA 1KT4A 2GTFX 2OVDA 2FR3A 1YWCA 1ZRYA 3TGAA 3MBTA 1KZXA 5F6ZA 3S26A 3P6GA 4ZGUA 1G74A 1GT4A 3BY0A 3PEDA 1KOIA 1OEEA 2HNXA 1O1UA 3AKNA 3O22A 3PP6A 2OVEA 1SY2A 2HLVA 1KT3A 4ZHDA 2ASNX 4EEJA 3MVFA 3NPOA 3ZUOA 1YWBA 4QGWA 1X8PA 3Q6LA 3TGBA 3KFHA 1FELA 3STMX 1GKAB 2OVAA 3D95A 3BX7A 3WJGA 1SXXA 2WEXA 3EM0A 4ORXA 3IA8A 4GH7A 2KT4B 5DPQA 1CBSA 3EBWA 3FELA 4GRJA 4XMHA 2JU8A 3UEXA 5C0NA 5HZQA 2HMBA 1O8VA 3APVA 4Y0PA 3VG7A 4D6BA 3EBKA 1BEBA 1A2DA 2X46A 4TKBA 5IO7A 2FS7A 1T68X 2A0AA 4IB8A 4YBPA 1UZ2X 4AZRA 1YWAA 3FA8A 3KFIA 2R74A 2W2BA 1R0UA 1HMTA 4IAWA 3FLLA 4IB6A 1KGLA 2RCQA 2G79A 2A2GA 1QFVA 5AQ6A 4YFQA 1HQPA 1MX7A 5IO6A 4HFOA 4OS3A 1X8QA 4BVMA 2R56A 5K06A 2G7BA 3PPTA 1X8OA 2A13A 4IB9A 1LPJA 1YP6A 4DQ4A 1XCAA 2CBSA 1T0VA 1OBUA 4NLJA 5KIDA 5CE4A 3ZQ3A 5LJBA 3RSWA 4NYQA 1X8NA 3KQ0A 1DFVA 1EPAA 1GT3A 1U0XA 1GGLA 1VYGA 2QM9A 4PSQA 4GKCA 4YMYA 1BM5A 4YKMA 5D47A 3NP1A 4NP1A 3WJBA 2W2FA 4QGVA 3APXA 1JYJA 5JR8A 3DSZA 4LKPA 1X8UA 2A2UA 1AELA 1IIUA 3IFBA 5L8OA 1MVGA 3APUA 5LJEA 1O1VA 3CQRA 4OMWA 5HCCC 3C78X 4XMDA 3JSQA 1PM1X 2FLJA 1X89A 2AT0X 3P6EA 1LIEA 2P8GA 1AQBA 1SXUA 1NGLA 1HN2A 1QY0A 4ORSA 3BLGA 2MM3A 4BQUA 2JOZA 1EIIA 3PECA 1B0OA 4YH0A 4OS0A 4YDAA 2X45A 5IO5A 4QGXA 2IFBA 5HTDA 2MO5A 1UREA 5HZ5A 3FA7A 5HCDC 2KTDA 1EW3A 5D4AA 5EDCA 1CBIA 5BVSA 2OFMX 3K3LA 3F9DA 1MUPA 1KT7A 1EUOA 1E06A 3O19A 2L9CA 3BU9A 2RCTA 4ORWA 5H9LA 1VYFA 1BWYA 5L8IA 3APWA 4HPBA 3VG4A 1SA8A 5HZ9A 4YGGA 4GETA 3U03A 4EFGA 1DZMA 1QQSA 5EZ2A 3PH5A 2FT9A 4AZMA 1ZNHA 1BRPA 4IB7A 1NP1A 4EXZA 3UEWA 3HWDA 4I9SA 3CR6A 3JS1A 3VG5A 2Q2PA 3FIQA 3NQ9A 1DZKA 4IMOA 1GKAA 3FENA 2POAA 2AMMX 1ZNDA 2BLGA 4R0BA 1YP7A 1TXLA 4LKTA 5F6BA 1E02A 4YGHA 2F73A 1SY0A 1EXSA 4Y0QA 3P6CA 1SXYA 1KZWA 4I3CA 1LF7A 2L67A 2WR6A 1IKEA 4NNTA 3WVMA 2GJ5A 3C77X 2MJIA 1GX9A 1ZNGA 3D97A 4YFPA 3VG2A 1T8VA 5BVTA 3QKGA 1GX8A 1LNMA 1IKJA 1QABE 4RUNA 1PEEA 3KFGA 4ORYA 5HWZA 5DG4A 1PBOA 1EQDA 3WBGA 2XKLA 2R73A 1RLBE 4OMXA 1FE3A 1Z24A 5H9NA 1A18A 4HPAA 2AT8X 4ORRA 3WJEA 1I06A 5F1EA 3NX1A 1DF3A 2ACPX 3HWFA 5KICA 2Q4NA 4LZUA 4XMFA 1LICA 1FTPA 1JJJA 1JZUA 4IBAA 1ERBA 1RBPA 4HPCA 1ACDA 4EDEA 5H9KA 5F7GA 2AL0X 4YBUA 1KQWA 4YCEA 4MVLA 2ACOA 3NQ3A 4O9SA 1S2PA 4AYHA 1XKIA 4AZOA 5EEEA 4GE1A 1G85A 1E5PA 3VG6A 3TGCA 1S44A 5D48A 4TQ2A 3U0DA 4ZFXA 1GT5A 2FR2A 3BU1A 3P6FA 3KFFA 5B29A 5LJDA 2LBVA 4WFVA 4XMEA 1SY1A 4D6AA 5L8NA 1N0SA 4GNWA 2O62A 1QFTA 3HWEA 4YCHA 4I3BA 4N7DA 4NLIA 1HBPA 2RD7C 4ZR2A 1G5WA 1U17A 1QY2A 1SY3A 3FA6A 1GM6A 1KT6A 3I0AA 1ALBA 3DTQA 1GT1A 4M6SA 2JU7A 4GNYA 4XMCA 4TLJA 1JYDA 2CZTA 4UU3A 1P6PA 1LFOA 4IMNA 1BBPA 1D2UA 2GC9A 2WUTA 5LKFA 3WJFA 3U9PC 1ICNA 1OBQA 5H9AA 1JBHA 1HBQA 2L68A 1KT5A 2AKQA 2QO6A 4UU2A 1D3SA 3UEVA 1JJXA 1BSYA 4NNSA 5D8JA 4A8ZA 5HBSA 4ZCBA 1LIFA 2NP1A 2CM4A 3FR4A 1TVQA 2LKKA 4ZH6A 3FR2A 1IFCA 2E4JA 2OZQA 4QZUA 3D96A 3L4RA 2AH7X 4ARHA 4ODDA 1BRQA 1EALA 1ICMA 5LJHA 1HMSA 3BSZE 1EIOA 4AW8A 3O2YA 4OS8A 3NX2A 3NADA 1JV4A 1LKEA 5FFHA 2LFOA 4YDBA 1YUPA 3TZSA 3NR3A 4A1YA 3ELXA 4MVIA 4YFRA 5KHPA 3BDRA 3FMZA 1IFBA 3STNA 1AB0A 2FTBA 2FRSA 3FEPA 4ZHHA 2CM9A 3VG3A 4AZNA 1BSOA 2HYSA 4XMGA 3T1DA 1U18A 1YWDA 1SXWA 1QY1A 4YGZA 3ZUIA 3HWGA 1QG5A 3UEUA 2OFRX 4TKJA 4QYNA 2NNEA 4I9RA 4TNNA 3FR5A 2WWPA 3B2IA 1I4UA 4K19A 1OPAA 4CK4A 1DZPA 1CBQA 1I05A 1L6MA 1MDCA 4AZPA 4Y0RA 2Q2MA 5LJGA 3CWKA 1I04A 1OEJA 3BX8A 1IW2A 1TW4A 4WBKA 3AKMA 3PH6A 4BOEA 1H91A 2G78A 2LBAA 1OEKA 4ZJ0A 1HMRA 1BSQA 1BJ7A 4ZHCA 1B4MA 5D45A 2CBRA 1CJ5A 2RQ0A 2Q9SA 3FW4A 4N7CA 1B8EA 1EPBA 4DQ3A 1B56A 3B2JA 1QWDA 1LIDA 2DM5A 2ALLX 2AT6X 1CRBA 2HZRA 1TOWA 3SAOA 1FENA 4NYRA 1YIVA 3WJDA 2XSTA 3F8AA 1ERXA 1VPRA 1AVGI 4WFUA 1ML7A 3B2LA 1FDQA 1S7DA 4HPDA 1ZNEA 2JN3A 3TF6A 1ZNLA 2K23A 3ELZA 1BLRA 1NP4A 1OPBA 4QAEA 5EPQA 2A3FX 3B2HA 5HTEA 2HZQA 3G7XA 4ORUA 3EYCA 2PY1A 2Q39A 3CQNA 4QZTA 5HZ6A 1PMPA 5EDBA 3FA9A 5BVQA 5LJCA 4LZVA 5B27A 2K62A 4RUUA 4Y0SA 3RZYA 4ES7A 3BS2A 2LB6A 5FAZA 4KIIA 2RA6A 2EU7X 3OJYC 2QOSC 1TOUA 1KQXA 2W2AA 5F58A
chains in the Genus database with same CATH superfamily
1A3YA 1NQNA 3HOLA 2JU3A 1NDJA 4BX6A 2MHDA 1FEMA 2WQAE 3FW5A 2RTGB 3JQOA 3UAQA 4ZHFA 4EQAC 3P6DA 1A57A 2AT3X 2WSJA 2Z4HA 3B2KA 3SZIA 4TJZA 2YG2A 3ZW2A 1LIBA 2BS5A 4DNEA 3P6HA 2WQ9A 5LJKA 1VWJB 5HA1A 1OBPA 3HK1A 2CZUA 2X55A 1BM5A 2FWVA 2AT5X 2QO5A 2WEWA 5B10O 4A60A 3VE1A 4QYPA 4ALBA 4BBOA 2C1SA 4Z2VA 1DC9A 3FEKA 4ML7B 4TKHA 4O4SA 1VWDB 2RTCB 4KT5A 2OY8A 3KZAA 4IAXA 4M7MA 4MEEA 5HCEC 4ZHGA 2BT9A 4YKOA 5FQ6E 5EEDA 4A1HA 2N93A 3EMMA 1PBYA 1KXOA 2NNQA 3WXQA 5HAEA 1UYNX 5LKEA 3WJCA 3CBCA 1E00A 4O4XA 2ANSA 1VWHB 3C76X 3VHHA 3CBSA 3I17A 2VFBA 5HZ8A 2NNDA 3P02A 5HA0A 1X71A 4YMYA 1Y0GA 1ZNKA 4MVKA 3BRNA 1DZJA 1ADLA 2G5LA 3GAQA 1MOYA 1SWEA 5H8TA 4AZQA 5FQ7E 4I3DA 3WZPA 1DV9A 3STKA 4ZH9A 1CBRA 2FS6A 3CMPA 3S5VA 3WOVA 1SWCA 2L5PA 2RTEB 2QO4A 4ALOA 1GXAA 4ZGFA 2GH7A 1MX8A 1SREA 5FENA 1G7NA 1KT4A 1MM9A 2GTFX 3PQUA 4Y5DA 1RXJA 2OVDA 3EW1A 1DF8A 1YWCA 1ZRYA 2FR3A 2KTSA 3RE5A 1SWDA 3TGAA 1UYOX 3MBTA 5F6ZA 3S26A 3P6GA 1KZXA 1VWPB 4ZGUA 1G74A 1GT4A 3BY0A 3PEDA 2OFAA 1KOIA 1OEEA 2HNXA 4L3RA 1O1UA 3AKNA 3O22A 3PP6A 5B5FA 5IRUA 4CDEA 5C0NA 4GDAA 2VDFA 2KW1A 2QCBA 2OVEA 1SY2A 2HLVA 4OKAA 1KT3A 4ZHDA 2Y3FA 2ASNX 4O4OA 4BCSA 4EEJA 3MVFA 3NPOA 3ZUOA 2IZKA 2IZHB 1Y53X 1LUQA 1YWBA 4QGWA 2RTAA 2OY1O 1X8PA 3Q6LA 3TGBA 3KFHA 1FELA 1JIWI 1LELA 3RDSA 2F01A 3STMX 1GKAB 2OVAA 3D95A 4BGFA 3BX7A 3WJGA 2UYWA 1SXXA 1W4TA 2QMIA 4HWMA 2WEXA 3EM0A 4MISA 4ORXA 3X00A 2DJFA 3RDMA 3IA8A 4GH7A 2KT4B 4U8UN 1Y55X 1CBSA 1SWNA 3EBWA 3FELA 4GRJA 2JU8A 4XMHA 5DPQA 3UEXA 4CV7A 5HZQA 2HMBA 1O8VA 3APVA 4Y0PA 1STPA 2OYBO 3VG7A 2RTIB 4D6BA 3EBKA 2RN4A 1BEBA 1HXZA 1A2DA 2X46A 4TKBA 5IO7A 2FS7A 1T68X 2A0AA 4IB8A 4O3ZA 4YBPA 1UZ2X 4AZRA 1YWAA 2UZ2A 3FA8A 3KFIA 4JHQA 2R74A 4L1NA 3RE6A 1JJUA 3WYQA 2IZDB 2W2BA 4B55A 1R0UA 1HMTA 2AF5A 4IAWA 1VWKB 3ZUIA 3FLLA 4IB6A 1KGLA 2RCQA 2G79A 2A2GA 4QQ1A 1SMPI 4JO6A 1QFVA 5AQ6A 1Y52X 2CAMA 1N43A 4YFQA 1HQPA 1KFFA 2X8SA 3PK2A 1MX7A 3SZHA 5IXGA 5IO6A 4HFOA 1STSB 1X8QA 2IZEB 4OS3A 4BVMA 2R56A 2OY7A 4BX7A 5K06A 2G7BA 3PPTA 1X8OA 2A13A 4IB9A 1LPJA 1YP6A 1HXLA 4PJ2A 4DQ4A 1XCAA 2Y3EA 2CBSA 1T0VA 4GGTA 1OBUA 4NLJA 1VWFB 5KIDA 1WBIA 5CE4A 2FKJA 5FQ8E 3ZQ3A 5LJBA 3RSWA 4NYQA 1X8NA 3AEHA 3KQ0A 4O3YA 1DFVA 1EPAA 1GT3A 1U0XA 1GGLA 1VYGA 2QM9A 3D4RA 4GKCA 2DJGA 4PSQA 4YKMA 1AVEA 3NP1A 4NP1A 5D47A 5B3MO 3WJBA 1VWBB 2W2FA 4QGVA 3APXA 1JYJA 4CPHB 5JR8A 2AVIA 3DSZA 5B11O 4LKPA 1X8UA 2A2UA 4I60A 1AELA 2RTQB 1IIUA 3V8UA 3IFBA 1SWHA 5K68A 3RY2A 5L8OA 1MVGA 3APUA 5LJEA 1O1VA 4C5PA 4GGRA 3CQRA 4OMWA 5HCCC 3C78X 4XMDA 4U3QA 2BS6A 1SRFA 3ZZVA 3JSQA 1PM1X 2WPUA 2FLJA 1X89A 2AT0X 3P6EA 3HTYA 1LIEA 2P8GA 4WHIA 1AQBA 4JGLA 1SRHA 1SWPA 1SXUA 1NGLA 1HN2A 1QY0A 2FHNX 2JGSA 4ORSA 5F58A 3BLGA 2MM3A 3LHNA 4BQUA 4COTA 2IZBA 2JOZA 3PECA 2OF8A 1EIIA 1B0OA 2I5ZO 5BYPA 4YH0A 4OS0A 3FYFA 4YDAA 3GE2A 3HOEA 2X45A 2OL7A 4NV8A 4U9CA 5IO5A 4QGXA 2IFBA 5HTDA 2MO5A 1UREA 1SRIA 4KH8A 5HZ5A 1I78A 3FA7A 3WYPA 2OFBA 5HCDC 2KTDA 1LDOA 1EW3A 1N9MA 1SLFB 1K3BA 1SWKA 1JJXA 1Y9TA 4CDFA 4FQBB 3FDCA 3H3IA 3OBLA 5D4AA 1CBIA 1SRGA 5EDCA 5AJCA 5BVSA 3RDOA 2OFMX 1W6FA 3K3LA 3F9DA 2RTJA 2C4IA 1MUPA 1NC9A 4LQZA 1KT7A 1JMZA 1AVDA 1EUOA 5B2AO 1E06A 3O19A 2L9CA 3BU9A 2RCTA 3VU1A 4ORWA 1RAVA 1KL3A 5H9LA 1VYFA 1SRJA 1RSTB 1BWYA 5L8IA 2IZIA 3APWA 4HPBA 3SOTA 3S60A 3VG4A 1SA8A 5HZ9A 4YGGA 4GETA 3U03A 4EFGA 2G8CO 1DZMA 5L3YA 1QQSA 4MIRA 3PDFA 5EZ2A 3PH5A 2FT9A 4AZMA 4CDCA 1ZNHA 1BRPA 3RDUA 4IB7A 2YMSA 1NP1A 2FGSA 3MG5A 4EXZA 3UEWA 3HWDA 2FKGA 4I9SA 3CR6A 3JS1A 4MVEA 3VG5A 2Q2PA 3FIQA 3NQ9A 5CHKA 1DZKA 4IMOA 1GKAA 4Z27A 3FENA 2POAA 2AMMX 2BSZA 1ZNDA 2BLGA 4R0BA 1JMXA 1N9YA 1SLGB 1YP7A 1TXLA 2A8GA 4LKTA 4YVBA 2QOMA 5F6BA 1E02A 3NQKA 2OY5O 1PTSA 1VWNB 4YGHA 2F73A 4FGIB 1SY0A 3VHIA 1EXSA 2IZLB 4U46A 4Y0QA 3P6CA 1SXYA 1KZWA 4I3CA 1LF7A 2L67A 1LCVA 5IRWA 2WR6A 1IKEA 4NNTA 3WVMA 2GJ5A 3C77X 5F2BA 2MJIA 1SWRA 1GX9A 1VWGB 1ZNGA 1LCZA 3D97A 3NBXX 4YFPA 3QQ2A 3T6LA 3VG2A 4Z2OA 1T8VA 3ZW0A 4BJ8A 2IZAA 5BVTA 3QKGA 1E2TA 1GX8A 1LNMA 1IKJA 1QABE 2MWHA 4RUNA 3WZOA 1PEEA 3KFGA 4ORYA 3T2XA 5HWZA 5DG4A 1PBOA 2RTHB 1EQDA 1NBXA 3EW2A 4BX5B 3KVNA 3WBGA 2XKLA 2R73A 4I6SA 1SWUA 1RLBE 1VWMB 1FE3A 1Z24A 2VFCA 2X34A 4OMXA 3HPEA 4JNJA 5H9NA 1A18A 3SLTA 2RTMA 2X8FA 4HPAA 2AT8X 4ORRA 3WJEA 1I06A 5F1EA 3NX1A 1DF3A 2ACPX 3HWFA 4KC8A 5KICA 4CPFA 1SWLA 4O4UA 1SWFA 2Q4NA 4LZUA 4XMFA 1I9HA 2OVSA 1LICA 4Z28A 3WZNA 1FTPA 1JJJA 1JZUA 3S5XA 4I95A 4IBAA 1ERBA 1RBPA 3T2WA 5B5GA 2IZGB 2RTLA 1SWOA 1ACDA 1RSUB 4HPCA 1SWGA 4U8UO 4EDEA 5H9KA 5F7GA 2AL0X 4YBUA 3E3CA 1KQWA 4YCEA 4MVLA 2ACOA 1VWRB 3NQ3A 4O9SA 3OD9A 1S2PA 2RTBB 4AYHA 1XKIA 4CPHA 4AZOA 5EEEA 3RDXA 2X8TA 1G85A 1E5PA 3N91A 4GE1A 3VG6A 3TGCA 4BX7B 1S44A 5D48A 4TQ2A 3U0DA 4ZFXA 3F6ZB 3VPJE 1GT5A 2FR2A 3BU1A 3P6FA 3KFFA 1KL5A 5B29A 5LJDA 2LBVA 4Z6JA 4WFVA 4XMEA 1SY1A 3CKFA 3RBYA 2RTDB 4D6AA 5L8NA 1N0SA 4GNWA 2O62A 3ZW1B 1QFTA 5IRAA 3HWEA 4YCHA 4I3BA 4N7DA 4NLIA 2X56A 1HBPA 2RD7C 2GTLN 4GJSA 4OELA 4ZR2A 1G5WA 1U17A 1QY2A 2RTNB 1SY3A 1LDQA 1GM6A 1KT6A 3FA6A 3I0AA 4GD9A 4BX6B 3WZQA 1ALBA 3DTQA 1GT1A 4M6SA 2JU7A 2X32A 4Y59A 4GNYA 4CPIA 4XMCA 4TLJA 1JYDA 5AJBA 1MEPA 2CZTA 4UU3A 3PQSA 3RWXA 1P6PA 1LFOA 4FBVA 4IMNA 4EKVA 1BBPA 4ID2A 4QNIA 1D2UA 2GC9A 2WUTA 1K24A 4GU8A 5LKFA 3WJFA 3AUMO 2JW1A 3U9PC 1ICNA 1OBQA 5H9AA 1JBHA 1HBQA 2L68A 1KT5A 2A5BA 2AKQA 2QO6A 1D3SA 4UU2A 4NV7A 1BSYA 3MM0A 4NNSA 5D8JA 3UEVA 5HBSA 4A8ZA 2OL6O 4U8UM 4ZCBA 1LIFA 2NP1A 2F09A 2CM4A 5JD2A 3FR4A 4O3XB 1TVQA 2LKKA 4ZH6A 3VHMA 3LTWA 3FR2A 1IFCA 4IRWA 2KD2A 1N4JA 2E4JA 2OZQA 2OF9A 2ZSCA 4QZUA 3D96A 2Z4IA 3L4RA 2AH7X 4ARHA 4ODDA 1BRQA 4FBRA 5K67A 2ZAIA 1ICMA 5LJHA 1EALA 1HMSA 3BSZE 3Q34A 1EIOA 4GUZA 4AW8A 3O2YA 2GTLO 3VE2A 4OS8A 3NX2A 3ZWEA 3NADA 1JV4A 1LKEA 5FFHA 2LFOA 4YDBA 1YUPA 4Z2PA 1VWOB 3TZSA 2X4MA 3NR3A 1STRB 3ELXA 4INNA 1VWIB 4A1YA 1EI5A 2ZAGA 4CPEA 4MVIA 4YFRA 5KHPA 2RTOB 3BDRA 3FMZA 1IFBA 3STNA 5AEOA 1AB0A 1W5RA 2FTBA 2FRSA 3EC5A 3FEPA 2CM9A 4ZHHA 2BC3A 3VG3A 4AZNA 1BSOA 4GDZA 2HYSA 2RTKA 4XMGA 1FJ1E 3VGWA 3FIDA 3T1DA 1U18A 1VWEB 2MF6A 3RDQA 1YWDA 4KC7A 3RY1A 1N7YA 1QY1A 1SXWA 1SWJA 3HWGA 1HQQA 1QG5A 4YGZA 3UEUA 1IJ8A 1HY2A 2OFRX 2RTFB 4QYNA 4TKJA 2NNEA 1OSPO 4I9RA 2OL8O 3CKGA 3FR5A 2WWPA 4TNNA 3D9WA 3B2IA 3RKGA 3ZI8A 1I4UA 4K19A 1OPAA 4CK4A 1DZPA 2IZCB 1CBQA 1I05A 1L6MA 1MDCA 4AZPA 3SZJA 4Y0RA 2Q2MA 5LJGA 2BHVA 1I04A 1OEJA 3BX8A 3CWKA 1IW2A 1TW4A 4WBKA 3AKMA 1LCWA 3PH6A 4OEMA 4BOEA 1H91A 1SWAA 2G78A 2I5VO 2LBAA 4BX5A 1OEKA 4ZJ0A 1HMRA 3OE3A 1JQPA 5CYBA 1BSQA 3P24A 1BJ7A 4ZHCA 1B4MA 5D45A 4GZVA 2CBRA 1CJ5A 2RQ0A 2Q9SA 4GK9A 4KCAA 1VWCB 3FW4A 1B8EA 1KL4A 4N7CA 1SWTA 4FBOA 1EPBA 4CSBA 1B56A 1SLEB 2GTLM 4DQ3A 3B2JA 4QRLA 4ON1A 1QWDA 1LIDA 4DCBA 2DM5A 2FHLA 2ALLX 3ZW0B 2IZJA 1MK5A 1CRBA 1VWQB 2AT6X 1TOWA 2C1QA 2HZRA 1FENA 2IZFB 3SAOA 1VWAB 4NYRA 2A5CA 1YIVA 3WJDA 2XSTA 3F8AA 1ERXA 1VPRA 4IABA 3T6FA 4GJVA 4O49A 1AVGI 5CSEA 4WFUA 2RTRB 1SLDB 3SLJA 1ML7A 1VWLB 4NW4A 3B2LA 1SWSA 2Y32A 1FDQA 1S7DA 2RTPB 4HPDA 1ZNEA 1WUBA 4O3WA 2JN3A 3TF6A 1ZNLA 2K23A 3ELZA 1BLRA 1NP4A 1OPBA 4QAEA 5EPQA 2A3FX 3B2HA 5HTEA 2HZQA 3G7XA 4ORUA 3EYCA 2PY1A 2Q39A 3CQNA 4GGZA 4QZTA 3SLOA 2PI3O 1SWQA 5HZ6A 1SWBA 1PMPA 5EDBA 3FA9A 1RXHA 2HKDA 5BVQA 5LJCA 4LZVA 1RXKA 1GX3A 1VYOA 2K62A 2M4LA 4RUUA 5B27A 4Y0SA 3RZYA 1NQMA 3ZW1A 4CDDA 3BS2A 2LB6A 5FAZA 4KIIA 4ES7A 2RA6A 3LV4A 2EU7X 3MX7A 3OJYC 2QOSC 1TOUA 1KQXA 2JMBA 2W2AA 1Y9LA 2LA7A
chains in the Genus database with same CATH topology
1A3YA 3HOLA 2JU3A 2MHDA 1FEMA 2WQAE 3FW5A 3JQOA 1A57A 3UAQA 4ZHFA 4EQAC 3P6DA 2AT3X 2WSJA 2Z4HA 3B2KA 4TJZA 2YG2A 3ZW2A 1LIBA 2BS5A 3P6HA 2WQ9A 5LJKA 5HA1A 1OBPA 3HK1A 2CZUA 2FWVA 2AT5X 2QO5A 2WEWA 4A60A 3VE1A 4QYPA 4ALBA 1DC9A 3FEKA 4ML7B 4TKHA 4O4SA 4KT5A 4M7MA 3KZAA 4ZHGA 4IAXA 5HCEC 2BT9A 4YKOA 5FQ6E 5EEDA 4A1HA 2N93A 3EMMA 3WXQA 1KXOA 2NNQA 5HAEA 5LKEA 3WJCA 3CBCA 1E00A 4O4XA 2ANSA 3C76X 3CBSA 3I17A 5HZ8A 2NNDA 3P02A 5HA0A 1X71A 4YMYA 1ZNKA 4MVKA 3BRNA 1DZJA 1ADLA 3GAQA 5H8TA 4AZQA 5FQ7E 4I3DA 1DV9A 3STKA 4ZH9A 1CBRA 2FS6A 3CMPA 3S5VA 3WOVA 2L5PA 4ALOA 2QO4A 4ZGFA 1GXAA 1MX8A 5FENA 1G7NA 1KT4A 2GTFX 3PQUA 2OVDA 2FR3A 1YWCA 1ZRYA 2KTSA 3TGAA 3MBTA 1KZXA 5F6ZA 3S26A 3P6GA 4ZGUA 1G74A 1GT4A 3BY0A 3PEDA 1KOIA 1OEEA 2HNXA 4L3RA 1O1UA 3AKNA 3O22A 3PP6A 2KW1A 2OVEA 1SY2A 2HLVA 1KT3A 4ZHDA 4O4OA 2ASNX 4EEJA 3MVFA 3NPOA 3ZUOA 1YWBA 4QGWA 1X8PA 3Q6LA 3TGBA 3KFHA 1FELA 1JIWI 3STMX 1GKAB 2OVAA 3D95A 3BX7A 3WJGA 1SXXA 2QMIA 4HWMA 2WEXA 3EM0A 4MISA 4ORXA 3IA8A 4GH7A 2KT4B 4U8UN 5DPQA 1CBSA 3EBWA 3FELA 4GRJA 4XMHA 2JU8A 3UEXA 5C0NA 4CV7A 5HZQA 2HMBA 1O8VA 3APVA 4Y0PA 3VG7A 4D6BA 3EBKA 2RN4A 1BEBA 1A2DA 2X46A 4TKBA 5IO7A 2FS7A 1T68X 2A0AA 4IB8A 4O3ZA 4YBPA 1UZ2X 4AZRA 1YWAA 3FA8A 3KFIA 2R74A 4L1NA 2W2BA 1R0UA 1HMTA 4IAWA 3FLLA 4IB6A 1KGLA 2RCQA 2G79A 2A2GA 4QQ1A 1SMPI 1QFVA 5AQ6A 4YFQA 1HQPA 2X8SA 1MX7A 5IO6A 4HFOA 4OS3A 1X8QA 4BVMA 2R56A 5K06A 2G7BA 3PPTA 1X8OA 2A13A 4IB9A 1LPJA 1YP6A 4PJ2A 4DQ4A 1XCAA 2CBSA 1T0VA 1OBUA 4NLJA 5KIDA 5CE4A 5FQ8E 3ZQ3A 5LJBA 3RSWA 4NYQA 1X8NA 3KQ0A 4O3YA 1DFVA 1EPAA 1GT3A 1U0XA 1GGLA 1VYGA 2QM9A 3D4RA 4GKCA 4PSQA 5AEOA 4YKMA 5D47A 3NP1A 4NP1A 3WJBA 1BM5A 2W2FA 4QGVA 3APXA 1JYJA 5JR8A 3DSZA 4LKPA 1X8UA 2A2UA 1AELA 1IIUA 3V8UA 3IFBA 5L8OA 1MVGA 3APUA 5LJEA 1O1VA 3CQRA 4OMWA 5HCCC 3C78X 4XMDA 4U3QA 2BS6A 3ZZVA 3JSQA 1PM1X 2FLJA 1X89A 2AT0X 3P6EA 3HTYA 1LIEA 2P8GA 4WHIA 1AQBA 4JGLA 1SXUA 1NGLA 1HN2A 1QY0A 4ORSA 5F58A 3BLGA 2MM3A 3LHNA 4BQUA 4COTA 2JOZA 1EIIA 3PECA 1B0OA 5BYPA 4YH0A 4OS0A 3FYFA 4YDAA 3GE2A 3HOEA 2X45A 4U9CA 5IO5A 4QGXA 2IFBA 5HTDA 2MO5A 1UREA 4KH8A 5HZ5A 3FA7A 5HCDC 2KTDA 1EW3A 1Y9TA 4FQBB 3H3IA 3OBLA 5D4AA 5EDCA 1CBIA 5AJCA 5BVSA 2OFMX 3K3LA 3F9DA 1MUPA 4LQZA 1KT7A 1EUOA 1E06A 3O19A 2L9CA 3BU9A 2RCTA 3VU1A 4ORWA 5H9LA 1VYFA 1BWYA 5L8IA 3APWA 4HPBA 3SOTA 3S60A 3VG4A 1SA8A 5HZ9A 4YGGA 4GETA 3U03A 4EFGA 1DZMA 1QQSA 4MIRA 5EZ2A 3PH5A 2FT9A 4AZMA 1ZNHA 1BRPA 4IB7A 2YMSA 1NP1A 4EXZA 3UEWA 3HWDA 4I9SA 3CR6A 3JS1A 4MVEA 3VG5A 2Q2PA 3FIQA 3NQ9A 1DZKA 4IMOA 1GKAA 3FENA 2POAA 2AMMX 1ZNDA 2BLGA 4R0BA 1YP7A 1TXLA 4LKTA 5F6BA 1E02A 3NQKA 4YGHA 2F73A 4FGIB 1SY0A 1EXSA 4Y0QA 3P6CA 1SXYA 1KZWA 4I3CA 1LF7A 2L67A 2WR6A 1IKEA 4NNTA 3WVMA 2GJ5A 3C77X 2MJIA 1GX9A 1ZNGA 3D97A 3NBXX 4YFPA 3VG2A 1T8VA 3ZW0A 5BVTA 3QKGA 1GX8A 1LNMA 1IKJA 1QABE 2MWHA 4RUNA 1PEEA 3KFGA 4ORYA 5HWZA 5DG4A 1PBOA 1EQDA 3WBGA 2XKLA 2R73A 4I6SA 1RLBE 4OMXA 1FE3A 1Z24A 5H9NA 1A18A 2X8FA 4HPAA 2AT8X 4ORRA 3WJEA 1I06A 5F1EA 3NX1A 1DF3A 2ACPX 3HWFA 4KC8A 5KICA 4O4UA 2Q4NA 4LZUA 4XMFA 2OVSA 1LICA 1FTPA 1JJJA 1JZUA 3S5XA 4I95A 4IBAA 1ERBA 1RBPA 4HPCA 1ACDA 4U8UO 4EDEA 5H9KA 5F7GA 2AL0X 4YBUA 3E3CA 1KQWA 4YCEA 4MVLA 2ACOA 3NQ3A 4O9SA 3OD9A 1S2PA 4AYHA 1XKIA 4AZOA 5EEEA 2X8TA 1G85A 1E5PA 3N91A 4GE1A 3VG6A 3TGCA 1S44A 5D48A 4TQ2A 3U0DA 4ZFXA 3F6ZB 3VPJE 1GT5A 2FR2A 3BU1A 3P6FA 3KFFA 5B29A 5LJDA 2LBVA 4WFVA 4XMEA 1SY1A 3RBYA 4D6AA 5L8NA 1N0SA 4GNWA 2O62A 3ZW1B 1QFTA 3HWEA 4YCHA 4I3BA 4N7DA 4NLIA 1HBPA 2RD7C 2GTLN 4ZR2A 1G5WA 1U17A 1QY2A 1SY3A 3FA6A 1GM6A 1KT6A 3I0AA 1ALBA 3DTQA 1GT1A 4M6SA 2JU7A 4GNYA 4XMCA 4TLJA 1JYDA 5AJBA 2CZTA 4UU3A 3PQSA 3RWXA 1P6PA 1LFOA 4FBVA 4IMNA 1BBPA 4ID2A 4QNIA 1D2UA 2GC9A 2WUTA 4GU8A 5LKFA 3WJFA 3U9PC 2JW1A 1ICNA 1OBQA 5H9AA 1JBHA 1HBQA 2L68A 1KT5A 2AKQA 2QO6A 4UU2A 1D3SA 3UEVA 1JJXA 1BSYA 4NNSA 5D8JA 4A8ZA 5HBSA 4U8UM 4ZCBA 1LIFA 2NP1A 2F09A 2CM4A 3FR4A 4O3XB 1TVQA 2LKKA 4ZH6A 3FR2A 1IFCA 2KD2A 2E4JA 2OZQA 4QZUA 3D96A 2Z4IA 3L4RA 2AH7X 4ARHA 4ODDA 1BRQA 4FBRA 1EALA 2ZAIA 1ICMA 5LJHA 1HMSA 3BSZE 1EIOA 4AW8A 3O2YA 2GTLO 3VE2A 4OS8A 3NX2A 3ZWEA 3NADA 1JV4A 1LKEA 5FFHA 2LFOA 4YDBA 1YUPA 3TZSA 3NR3A 4INNA 3ELXA 4A1YA 1EI5A 2ZAGA 4MVIA 4YFRA 5KHPA 3BDRA 3FMZA 1IFBA 3STNA 1AB0A 2FTBA 2FRSA 3FEPA 4ZHHA 2CM9A 3VG3A 4AZNA 1BSOA 4GDZA 2HYSA 4XMGA 3T1DA 1U18A 1YWDA 4KC7A 1SXWA 1QY1A 4YGZA 3ZUIA 3HWGA 1QG5A 3UEUA 2OFRX 4TKJA 4QYNA 2NNEA 4I9RA 4TNNA 3RKGA 3FR5A 2WWPA 3B2IA 3ZI8A 1I4UA 4K19A 1OPAA 4CK4A 1DZPA 1CBQA 1I05A 1L6MA 1MDCA 4AZPA 4Y0RA 2Q2MA 5LJGA 2BHVA 1I04A 1OEJA 3BX8A 3CWKA 1IW2A 1TW4A 4WBKA 3AKMA 3PH6A 4BOEA 1H91A 2G78A 2LBAA 1OEKA 4ZJ0A 1HMRA 3OE3A 5CYBA 1BSQA 3P24A 1BJ7A 4ZHCA 1B4MA 5D45A 4GZVA 2CBRA 1CJ5A 2RQ0A 2Q9SA 4GK9A 4KCAA 3FW4A 4N7CA 1B8EA 4CSBA 4FBOA 1EPBA 4DQ3A 1B56A 2GTLM 3B2JA 4QRLA 4ON1A 1QWDA 1LIDA 2DM5A 3ZW0B 2ALLX 2AT6X 1CRBA 2HZRA 1TOWA 3SAOA 1FENA 4NYRA 1YIVA 3WJDA 2XSTA 3F8AA 1ERXA 1VPRA 4IABA 4O49A 1AVGI 4WFUA 1ML7A 4NW4A 3B2LA 1FDQA 1S7DA 4HPDA 4O3WA 1ZNEA 2JN3A 3TF6A 1ZNLA 2K23A 3ELZA 1BLRA 1NP4A 1OPBA 4QAEA 5EPQA 2A3FX 3B2HA 5HTEA 2HZQA 3G7XA 4ORUA 3EYCA 2PY1A 2Q39A 3CQNA 4QZTA 5HZ6A 1PMPA 5EDBA 3FA9A 5BVQA 5LJCA 4LZVA 2M4LA 5B27A 2K62A 4RUUA 3ZW1A 4Y0SA 3RZYA 4ES7A 3BS2A 2LB6A 5FAZA 4KIIA 2RA6A 3LV4A 2EU7X 3MX7A 3OJYC 2QOSC 1TOUA 1KQXA 2JMBA 2W2AA 1Y9LA 2LA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3Y A;  2JU3 A;  2WQA E;  1FEM A;  3FW5 A;  1A57 A;  4ZHF A;  3P6D A;  2AT3 X;  2WSJ A;  3B2K A;  4TJZ A;  2YG2 A;  1LIB A;  3P6H A;  2WQ9 A;  5LJK A;  5HA1 A;  1OBP A;  3HK1 A;  2CZU A;  2FWV A;  2AT5 X;  2QO5 A;  2WEW A;  4A60 A;  4QYP A;  4ALB A;  1DC9 A;  3FEK A;  4TKH A;  4M7M A;  3KZA A;  4ZHG A;  4IAX A;  5HCE C;  4YKO A;  5EED A;  4A1H A;  2N93 A;  3EMM A;  3WXQ A;  1KXO A;  2NNQ A;  5HAE A;  5LKE A;  3WJC A;  3CBC A;  1E00 A;  2ANS A;  3C76 X;  3CBS A;  3I17 A;  5HZ8 A;  2NND A;  5HA0 A;  1X71 A;  1ZNK A;  4MVK A;  3BRN A;  1DZJ A;  1ADL A;  3GAQ A;  5H8T A;  4AZQ A;  1DV9 A;  4I3D A;  3STK A;  4ZH9 A;  1CBR A;  2FS6 A;  3CMP A;  2L5P A;  4ALO A;  2QO4 A;  1GXA A;  1MX8 A;  5FEN A;  1G7N A;  1KT4 A;  2GTF X;  2OVD A;  2FR3 A;  1YWC A;  1ZRY A;  3TGA A;  3MBT A;  1KZX A;  5F6Z A;  3S26 A;  3P6G A;  4ZGU A;  1G74 A;  1GT4 A;  3BY0 A;  3PED A;  1KOI A;  1OEE A;  2HNX A;  1O1U A;  3AKN A;  3O22 A;  3PP6 A;  2OVE A;  1SY2 A;  2HLV A;  1KT3 A;  4ZHD A;  2ASN X;  4EEJ A;  3MVF A;  3NPO A;  3ZUO A;  1YWB A;  4QGW A;  1X8P A;  3Q6L A;  3TGB A;  3KFH A;  1FEL A;  3STM X;  1GKA B;  2OVA A;  3D95 A;  3BX7 A;  3WJG A;  1SXX A;  2WEX A;  3EM0 A;  4ORX A;  3IA8 A;  4GH7 A;  2KT4 B;  5DPQ A;  1CBS A;  3EBW A;  3FEL A;  4GRJ A;  4XMH A;  2JU8 A;  3UEX A;  5C0N A;  5HZQ A;  2HMB A;  1O8V A;  3APV A;  4Y0P A;  3VG7 A;  4D6B A;  3EBK A;  1BEB A;  1A2D A;  2X46 A;  4TKB A;  5IO7 A;  2FS7 A;  1T68 X;  2A0A A;  4IB8 A;  4YBP A;  1UZ2 X;  4AZR A;  1YWA A;  3FA8 A;  3KFI A;  2R74 A;  2W2B A;  1R0U A;  1HMT A;  4IAW A;  3FLL A;  4IB6 A;  1KGL A;  2RCQ A;  2G79 A;  2A2G A;  1QFV A;  5AQ6 A;  4YFQ A;  1HQP A;  1MX7 A;  5IO6 A;  4HFO A;  4OS3 A;  1X8Q A;  4BVM A;  2R56 A;  5K06 A;  2G7B A;  3PPT A;  1X8O A;  2A13 A;  4IB9 A;  1LPJ A;  1YP6 A;  4DQ4 A;  1XCA A;  2CBS A;  1T0V A;  1OBU A;  4NLJ A;  5KID A;  5CE4 A;  3ZQ3 A;  5LJB A;  3RSW A;  4NYQ A;  1X8N A;  3KQ0 A;  1DFV A;  1EPA A;  1GT3 A;  1U0X A;  1GGL A;  1VYG A;  2QM9 A;  4PSQ A;  4GKC A;  4YMY A;  1BM5 A;  4YKM A;  5D47 A;  3NP1 A;  4NP1 A;  3WJB A;  2W2F A;  4QGV A;  3APX A;  1JYJ A;  5JR8 A;  3DSZ A;  4LKP A;  1X8U A;  2A2U A;  1AEL A;  1IIU A;  3IFB A;  5L8O A;  1MVG A;  3APU A;  5LJE A;  1O1V A;  3CQR A;  4OMW A;  5HCC C;  3C78 X;  4XMD A;  3JSQ A;  1PM1 X;  2FLJ A;  1X89 A;  2AT0 X;  3P6E A;  1LIE A;  2P8G A;  1AQB A;  1SXU A;  1NGL A;  1HN2 A;  1QY0 A;  4ORS A;  3BLG A;  2MM3 A;  4BQU A;  2JOZ A;  1EII A;  3PEC A;  1B0O A;  4YH0 A;  4OS0 A;  4YDA A;  2X45 A;  5IO5 A;  4QGX A;  2IFB A;  5HTD A;  2MO5 A;  1URE A;  5HZ5 A;  3FA7 A;  5HCD C;  2KTD A;  1EW3 A;  5D4A A;  5EDC A;  1CBI A;  5BVS A;  2OFM X;  3K3L A;  3F9D A;  1MUP A;  1KT7 A;  1EUO A;  1E06 A;  3O19 A;  2L9C A;  3BU9 A;  2RCT A;  4ORW A;  5H9L A;  1VYF A;  1BWY A;  5L8I A;  3APW A;  4HPB A;  3VG4 A;  1SA8 A;  5HZ9 A;  4YGG A;  4GET A;  3U03 A;  4EFG A;  1DZM A;  1QQS A;  5EZ2 A;  3PH5 A;  2FT9 A;  4AZM A;  1ZNH A;  1BRP A;  4IB7 A;  1NP1 A;  4EXZ A;  3UEW A;  3HWD A;  4I9S A;  3CR6 A;  3JS1 A;  3VG5 A;  2Q2P A;  3FIQ A;  3NQ9 A;  1DZK A;  4IMO A;  1GKA A;  3FEN A;  2POA A;  2AMM X;  1ZND A;  2BLG A;  4R0B A;  1YP7 A;  1TXL A;  4LKT A;  5F6B A;  1E02 A;  4YGH A;  2F73 A;  1SY0 A;  1EXS A;  4Y0Q A;  3P6C A;  1SXY A;  1KZW A;  4I3C A;  1LF7 A;  2L67 A;  2WR6 A;  1IKE A;  4NNT A;  3WVM A;  2GJ5 A;  3C77 X;  2MJI A;  1GX9 A;  1ZNG A;  3D97 A;  4YFP A;  3VG2 A;  1T8V A;  5BVT A;  3QKG A;  1GX8 A;  1LNM A;  1IKJ A;  1QAB E;  4RUN A;  1PEE A;  3KFG A;  4ORY A;  5HWZ A;  5DG4 A;  1PBO A;  1EQD A;  3WBG A;  2XKL A;  2R73 A;  1RLB E;  4OMX A;  1FE3 A;  1Z24 A;  5H9N A;  1A18 A;  4HPA A;  2AT8 X;  4ORR A;  3WJE A;  1I06 A;  5F1E A;  3NX1 A;  1DF3 A;  2ACP X;  3HWF A;  5KIC A;  2Q4N A;  4LZU A;  4XMF A;  1LIC A;  1FTP A;  1JJJ A;  1JZU A;  4IBA A;  1ERB A;  1RBP A;  4HPC A;  1ACD A;  4EDE A;  5H9K A;  5F7G A;  2AL0 X;  4YBU A;  1KQW A;  4YCE A;  4MVL A;  2ACO A;  3NQ3 A;  4O9S A;  1S2P A;  4AYH A;  1XKI A;  4AZO A;  5EEE A;  4GE1 A;  1G85 A;  1E5P A;  3VG6 A;  3TGC A;  1S44 A;  5D48 A;  4TQ2 A;  3U0D A;  4ZFX A;  1GT5 A;  2FR2 A;  3BU1 A;  3P6F A;  3KFF A;  5B29 A;  5LJD A;  2LBV A;  4WFV A;  4XME A;  1SY1 A;  4D6A A;  5L8N A;  1N0S A;  4GNW A;  2O62 A;  1QFT A;  3HWE A;  4YCH A;  4I3B A;  4N7D A;  4NLI A;  1HBP A;  2RD7 C;  4ZR2 A;  1G5W A;  1U17 A;  1QY2 A;  1SY3 A;  3FA6 A;  1GM6 A;  1KT6 A;  3I0A A;  1ALB A;  3DTQ A;  1GT1 A;  4M6S A;  2JU7 A;  4GNY A;  4XMC A;  4TLJ A;  1JYD A;  2CZT A;  4UU3 A;  1P6P A;  1LFO A;  4IMN A;  1BBP A;  1D2U A;  2GC9 A;  2WUT A;  5LKF A;  3WJF A;  3U9P C;  1ICN A;  1OBQ A;  5H9A A;  1JBH A;  1HBQ A;  2L68 A;  1KT5 A;  2AKQ A;  2QO6 A;  4UU2 A;  1D3S A;  3UEV A;  1JJX A;  1BSY A;  4NNS A;  5D8J A;  4A8Z A;  5HBS A;  4ZCB A;  1LIF A;  2NP1 A;  2CM4 A;  3FR4 A;  1TVQ A;  2LKK A;  4ZH6 A;  3FR2 A;  1IFC A;  2E4J A;  2OZQ A;  4QZU A;  3D96 A;  3L4R A;  2AH7 X;  4ARH A;  4ODD A;  1BRQ A;  1EAL A;  1ICM A;  5LJH A;  1HMS A;  3BSZ E;  1EIO A;  4AW8 A;  3O2Y A;  4OS8 A;  3NX2 A;  3NAD A;  1JV4 A;  1LKE A;  5FFH A;  2LFO A;  4YDB A;  1YUP A;  3TZS A;  3NR3 A;  4A1Y A;  3ELX A;  4MVI A;  4YFR A;  5KHP A;  3BDR A;  3FMZ A;  1IFB A;  3STN A;  1AB0 A;  2FTB A;  2FRS A;  3FEP A;  4ZHH A;  2CM9 A;  3VG3 A;  4AZN A;  1BSO A;  2HYS A;  4XMG A;  3T1D A;  1U18 A;  1YWD A;  1SXW A;  1QY1 A;  4YGZ A;  3ZUI A;  3HWG A;  1QG5 A;  3UEU A;  2OFR X;  4TKJ A;  4QYN A;  2NNE A;  4I9R A;  4TNN A;  3FR5 A;  2WWP A;  3B2I A;  1I4U A;  4K19 A;  1OPA A;  4CK4 A;  1DZP A;  1CBQ A;  1I05 A;  1L6M A;  1MDC A;  4AZP A;  4Y0R A;  2Q2M A;  5LJG A;  3CWK A;  1I04 A;  1OEJ A;  3BX8 A;  1IW2 A;  1TW4 A;  4WBK A;  3AKM A;  3PH6 A;  4BOE A;  1H91 A;  2G78 A;  2LBA A;  1OEK A;  4ZJ0 A;  1HMR A;  1BSQ A;  1BJ7 A;  4ZHC A;  1B4M A;  5D45 A;  2CBR A;  1CJ5 A;  2RQ0 A;  2Q9S A;  3FW4 A;  4N7C A;  1B8E A;  1EPB A;  4DQ3 A;  1B56 A;  3B2J A;  1QWD A;  1LID A;  2DM5 A;  2ALL X;  2AT6 X;  1CRB A;  2HZR A;  1TOW A;  3SAO A;  1FEN A;  4NYR A;  1YIV A;  3WJD A;  2XST A;  3F8A A;  1ERX A;  1VPR A;  1AVG I;  4WFU A;  1ML7 A;  3B2L A;  1FDQ A;  1S7D A;  4HPD A;  1ZNE A;  2JN3 A;  3TF6 A;  1ZNL A;  2K23 A;  3ELZ A;  1BLR A;  1NP4 A;  1OPB A;  4QAE A;  5EPQ A;  2A3F X;  3B2H A;  5HTE A;  2HZQ A;  3G7X A;  4ORU A;  3EYC A;  2PY1 A;  2Q39 A;  3CQN A;  4QZT A;  5HZ6 A;  1PMP A;  5EDB A;  3FA9 A;  5BVQ A;  5LJC A;  4LZV A;  5B27 A;  2K62 A;  4RUU A;  4Y0S A;  3RZY A;  4ES7 A;  3BS2 A;  2LB6 A;  5FAZ A;  4KII A;  2RA6 A;  2EU7 X;  3OJY C;  2QOS C;  1TOU A;  1KQX A;  2W2A A;  5F58 A; 
#chains in the Genus database with same CATH topology
 1A3Y A;  1NQN A;  3HOL A;  2JU3 A;  1NDJ A;  4BX6 A;  2MHD A;  1FEM A;  2WQA E;  3FW5 A;  2RTG B;  3JQO A;  3UAQ A;  4ZHF A;  4EQA C;  3P6D A;  1A57 A;  2AT3 X;  2WSJ A;  2Z4H A;  3B2K A;  3SZI A;  4TJZ A;  2YG2 A;  3ZW2 A;  1LIB A;  2BS5 A;  4DNE A;  3P6H A;  2WQ9 A;  5LJK A;  1VWJ B;  5HA1 A;  1OBP A;  3HK1 A;  2CZU A;  2X55 A;  1BM5 A;  2FWV A;  2AT5 X;  2QO5 A;  2WEW A;  5B10 O;  4A60 A;  3VE1 A;  4QYP A;  4ALB A;  4BBO A;  2C1S A;  4Z2V A;  1DC9 A;  3FEK A;  4ML7 B;  4TKH A;  4O4S A;  1VWD B;  2RTC B;  4KT5 A;  2OY8 A;  3KZA A;  4IAX A;  4M7M A;  4MEE A;  5HCE C;  4ZHG A;  2BT9 A;  4YKO A;  5FQ6 E;  5EED A;  4A1H A;  2N93 A;  3EMM A;  1PBY A;  1KXO A;  2NNQ A;  3WXQ A;  5HAE A;  1UYN X;  5LKE A;  3WJC A;  3CBC A;  1E00 A;  4O4X A;  2ANS A;  1VWH B;  3C76 X;  3VHH A;  3CBS A;  3I17 A;  2VFB A;  5HZ8 A;  2NND A;  3P02 A;  5HA0 A;  1X71 A;  4YMY A;  1Y0G A;  1ZNK A;  4MVK A;  3BRN A;  1DZJ A;  1ADL A;  2G5L A;  3GAQ A;  1MOY A;  1SWE A;  5H8T A;  4AZQ A;  5FQ7 E;  4I3D A;  3WZP A;  1DV9 A;  3STK A;  4ZH9 A;  1CBR A;  2FS6 A;  3CMP A;  3S5V A;  3WOV A;  1SWC A;  2L5P A;  2RTE B;  2QO4 A;  4ALO A;  1GXA A;  4ZGF A;  2GH7 A;  1MX8 A;  1SRE A;  5FEN A;  1G7N A;  1KT4 A;  1MM9 A;  2GTF X;  3PQU A;  4Y5D A;  1RXJ A;  2OVD A;  3EW1 A;  1DF8 A;  1YWC A;  1ZRY A;  2FR3 A;  2KTS A;  3RE5 A;  1SWD A;  3TGA A;  1UYO X;  3MBT A;  5F6Z A;  3S26 A;  3P6G A;  1KZX A;  1VWP B;  4ZGU A;  1G74 A;  1GT4 A;  3BY0 A;  3PED A;  2OFA A;  1KOI A;  1OEE A;  2HNX A;  4L3R A;  1O1U A;  3AKN A;  3O22 A;  3PP6 A;  5B5F A;  5IRU A;  4CDE A;  5C0N A;  4GDA A;  2VDF A;  2KW1 A;  2QCB A;  2OVE A;  1SY2 A;  2HLV A;  4OKA A;  1KT3 A;  4ZHD A;  2Y3F A;  2ASN X;  4O4O A;  4BCS A;  4EEJ A;  3MVF A;  3NPO A;  3ZUO A;  2IZK A;  2IZH B;  1Y53 X;  1LUQ A;  1YWB A;  4QGW A;  2RTA A;  2OY1 O;  1X8P A;  3Q6L A;  3TGB A;  3KFH A;  1FEL A;  1JIW I;  1LEL A;  3RDS A;  2F01 A;  3STM X;  1GKA B;  2OVA A;  3D95 A;  4BGF A;  3BX7 A;  3WJG A;  2UYW A;  1SXX A;  1W4T A;  2QMI A;  4HWM A;  2WEX A;  3EM0 A;  4MIS A;  4ORX A;  3X00 A;  2DJF A;  3RDM A;  3IA8 A;  4GH7 A;  2KT4 B;  4U8U N;  1Y55 X;  1CBS A;  1SWN A;  3EBW A;  3FEL A;  4GRJ A;  2JU8 A;  4XMH A;  5DPQ A;  3UEX A;  4CV7 A;  5HZQ A;  2HMB A;  1O8V A;  3APV A;  4Y0P A;  1STP A;  2OYB O;  3VG7 A;  2RTI B;  4D6B A;  3EBK A;  2RN4 A;  1BEB A;  1HXZ A;  1A2D A;  2X46 A;  4TKB A;  5IO7 A;  2FS7 A;  1T68 X;  2A0A A;  4IB8 A;  4O3Z A;  4YBP A;  1UZ2 X;  4AZR A;  1YWA A;  2UZ2 A;  3FA8 A;  3KFI A;  4JHQ A;  2R74 A;  4L1N A;  3RE6 A;  1JJU A;  3WYQ A;  2IZD B;  2W2B A;  4B55 A;  1R0U A;  1HMT A;  2AF5 A;  4IAW A;  1VWK B;  3ZUI A;  3FLL A;  4IB6 A;  1KGL A;  2RCQ A;  2G79 A;  2A2G A;  4QQ1 A;  1SMP I;  4JO6 A;  1QFV A;  5AQ6 A;  1Y52 X;  2CAM A;  1N43 A;  4YFQ A;  1HQP A;  1KFF A;  2X8S A;  3PK2 A;  1MX7 A;  3SZH A;  5IXG A;  5IO6 A;  4HFO A;  1STS B;  1X8Q A;  2IZE B;  4OS3 A;  4BVM A;  2R56 A;  2OY7 A;  4BX7 A;  5K06 A;  2G7B A;  3PPT A;  1X8O A;  2A13 A;  4IB9 A;  1LPJ A;  1YP6 A;  1HXL A;  4PJ2 A;  4DQ4 A;  1XCA A;  2Y3E A;  2CBS A;  1T0V A;  4GGT A;  1OBU A;  4NLJ A;  1VWF B;  5KID A;  1WBI A;  5CE4 A;  2FKJ A;  5FQ8 E;  3ZQ3 A;  5LJB A;  3RSW A;  4NYQ A;  1X8N A;  3AEH A;  3KQ0 A;  4O3Y A;  1DFV A;  1EPA A;  1GT3 A;  1U0X A;  1GGL A;  1VYG A;  2QM9 A;  3D4R A;  4GKC A;  2DJG A;  4PSQ A;  4YKM A;  1AVE A;  3NP1 A;  4NP1 A;  5D47 A;  5B3M O;  3WJB A;  1VWB B;  2W2F A;  4QGV A;  3APX A;  1JYJ A;  4CPH B;  5JR8 A;  2AVI A;  3DSZ A;  5B11 O;  4LKP A;  1X8U A;  2A2U A;  4I60 A;  1AEL A;  2RTQ B;  1IIU A;  3V8U A;  3IFB A;  1SWH A;  5K68 A;  3RY2 A;  5L8O A;  1MVG A;  3APU A;  5LJE A;  1O1V A;  4C5P A;  4GGR A;  3CQR A;  4OMW A;  5HCC C;  3C78 X;  4XMD A;  4U3Q A;  2BS6 A;  1SRF A;  3ZZV A;  3JSQ A;  1PM1 X;  2WPU A;  2FLJ A;  1X89 A;  2AT0 X;  3P6E A;  3HTY A;  1LIE A;  2P8G A;  4WHI A;  1AQB A;  4JGL A;  1SRH A;  1SWP A;  1SXU A;  1NGL A;  1HN2 A;  1QY0 A;  2FHN X;  2JGS A;  4ORS A;  5F58 A;  3BLG A;  2MM3 A;  3LHN A;  4BQU A;  4COT A;  2IZB A;  2JOZ A;  3PEC A;  2OF8 A;  1EII A;  1B0O A;  2I5Z O;  5BYP A;  4YH0 A;  4OS0 A;  3FYF A;  4YDA A;  3GE2 A;  3HOE A;  2X45 A;  2OL7 A;  4NV8 A;  4U9C A;  5IO5 A;  4QGX A;  2IFB A;  5HTD A;  2MO5 A;  1URE A;  1SRI A;  4KH8 A;  5HZ5 A;  1I78 A;  3FA7 A;  3WYP A;  2OFB A;  5HCD C;  2KTD A;  1LDO A;  1EW3 A;  1N9M A;  1SLF B;  1K3B A;  1SWK A;  1JJX A;  1Y9T A;  4CDF A;  4FQB B;  3FDC A;  3H3I A;  3OBL A;  5D4A A;  1CBI A;  1SRG A;  5EDC A;  5AJC A;  5BVS A;  3RDO A;  2OFM X;  1W6F A;  3K3L A;  3F9D A;  2RTJ A;  2C4I A;  1MUP A;  1NC9 A;  4LQZ A;  1KT7 A;  1JMZ A;  1AVD A;  1EUO A;  5B2A O;  1E06 A;  3O19 A;  2L9C A;  3BU9 A;  2RCT A;  3VU1 A;  4ORW A;  1RAV A;  1KL3 A;  5H9L A;  1VYF A;  1SRJ A;  1RST B;  1BWY A;  5L8I A;  2IZI A;  3APW A;  4HPB A;  3SOT A;  3S60 A;  3VG4 A;  1SA8 A;  5HZ9 A;  4YGG A;  4GET A;  3U03 A;  4EFG A;  2G8C O;  1DZM A;  5L3Y A;  1QQS A;  4MIR A;  3PDF A;  5EZ2 A;  3PH5 A;  2FT9 A;  4AZM A;  4CDC A;  1ZNH A;  1BRP A;  3RDU A;  4IB7 A;  2YMS A;  1NP1 A;  2FGS A;  3MG5 A;  4EXZ A;  3UEW A;  3HWD A;  2FKG A;  4I9S A;  3CR6 A;  3JS1 A;  4MVE A;  3VG5 A;  2Q2P A;  3FIQ A;  3NQ9 A;  5CHK A;  1DZK A;  4IMO A;  1GKA A;  4Z27 A;  3FEN A;  2POA A;  2AMM X;  2BSZ A;  1ZND A;  2BLG A;  4R0B A;  1JMX A;  1N9Y A;  1SLG B;  1YP7 A;  1TXL A;  2A8G A;  4LKT A;  4YVB A;  2QOM A;  5F6B A;  1E02 A;  3NQK A;  2OY5 O;  1PTS A;  1VWN B;  4YGH A;  2F73 A;  4FGI B;  1SY0 A;  3VHI A;  1EXS A;  2IZL B;  4U46 A;  4Y0Q A;  3P6C A;  1SXY A;  1KZW A;  4I3C A;  1LF7 A;  2L67 A;  1LCV A;  5IRW A;  2WR6 A;  1IKE A;  4NNT A;  3WVM A;  2GJ5 A;  3C77 X;  5F2B A;  2MJI A;  1SWR A;  1GX9 A;  1VWG B;  1ZNG A;  1LCZ A;  3D97 A;  3NBX X;  4YFP A;  3QQ2 A;  3T6L A;  3VG2 A;  4Z2O A;  1T8V A;  3ZW0 A;  4BJ8 A;  2IZA A;  5BVT A;  3QKG A;  1E2T A;  1GX8 A;  1LNM A;  1IKJ A;  1QAB E;  2MWH A;  4RUN A;  3WZO A;  1PEE A;  3KFG A;  4ORY A;  3T2X A;  5HWZ A;  5DG4 A;  1PBO A;  2RTH B;  1EQD A;  1NBX A;  3EW2 A;  4BX5 B;  3KVN A;  3WBG A;  2XKL A;  2R73 A;  4I6S A;  1SWU A;  1RLB E;  1VWM B;  1FE3 A;  1Z24 A;  2VFC A;  2X34 A;  4OMX A;  3HPE A;  4JNJ A;  5H9N A;  1A18 A;  3SLT A;  2RTM A;  2X8F A;  4HPA A;  2AT8 X;  4ORR A;  3WJE A;  1I06 A;  5F1E A;  3NX1 A;  1DF3 A;  2ACP X;  3HWF A;  4KC8 A;  5KIC A;  4CPF A;  1SWL A;  4O4U A;  1SWF A;  2Q4N A;  4LZU A;  4XMF A;  1I9H A;  2OVS A;  1LIC A;  4Z28 A;  3WZN A;  1FTP A;  1JJJ A;  1JZU A;  3S5X A;  4I95 A;  4IBA A;  1ERB A;  1RBP A;  3T2W A;  5B5G A;  2IZG B;  2RTL A;  1SWO A;  1ACD A;  1RSU B;  4HPC A;  1SWG A;  4U8U O;  4EDE A;  5H9K A;  5F7G A;  2AL0 X;  4YBU A;  3E3C A;  1KQW A;  4YCE A;  4MVL A;  2ACO A;  1VWR B;  3NQ3 A;  4O9S A;  3OD9 A;  1S2P A;  2RTB B;  4AYH A;  1XKI A;  4CPH A;  4AZO A;  5EEE A;  3RDX A;  2X8T A;  1G85 A;  1E5P A;  3N91 A;  4GE1 A;  3VG6 A;  3TGC A;  4BX7 B;  1S44 A;  5D48 A;  4TQ2 A;  3U0D A;  4ZFX A;  3F6Z B;  3VPJ E;  1GT5 A;  2FR2 A;  3BU1 A;  3P6F A;  3KFF A;  1KL5 A;  5B29 A;  5LJD A;  2LBV A;  4Z6J A;  4WFV A;  4XME A;  1SY1 A;  3CKF A;  3RBY A;  2RTD B;  4D6A A;  5L8N A;  1N0S A;  4GNW A;  2O62 A;  3ZW1 B;  1QFT A;  5IRA A;  3HWE A;  4YCH A;  4I3B A;  4N7D A;  4NLI A;  2X56 A;  1HBP A;  2RD7 C;  2GTL N;  4GJS A;  4OEL A;  4ZR2 A;  1G5W A;  1U17 A;  1QY2 A;  2RTN B;  1SY3 A;  1LDQ A;  1GM6 A;  1KT6 A;  3FA6 A;  3I0A A;  4GD9 A;  4BX6 B;  3WZQ A;  1ALB A;  3DTQ A;  1GT1 A;  4M6S A;  2JU7 A;  2X32 A;  4Y59 A;  4GNY A;  4CPI A;  4XMC A;  4TLJ A;  1JYD A;  5AJB A;  1MEP A;  2CZT A;  4UU3 A;  3PQS A;  3RWX A;  1P6P A;  1LFO A;  4FBV A;  4IMN A;  4EKV A;  1BBP A;  4ID2 A;  4QNI A;  1D2U A;  2GC9 A;  2WUT A;  1K24 A;  4GU8 A;  5LKF A;  3WJF A;  3AUM O;  2JW1 A;  3U9P C;  1ICN A;  1OBQ A;  5H9A A;  1JBH A;  1HBQ A;  2L68 A;  1KT5 A;  2A5B A;  2AKQ A;  2QO6 A;  1D3S A;  4UU2 A;  4NV7 A;  1BSY A;  3MM0 A;  4NNS A;  5D8J A;  3UEV A;  5HBS A;  4A8Z A;  2OL6 O;  4U8U M;  4ZCB A;  1LIF A;  2NP1 A;  2F09 A;  2CM4 A;  5JD2 A;  3FR4 A;  4O3X B;  1TVQ A;  2LKK A;  4ZH6 A;  3VHM A;  3LTW A;  3FR2 A;  1IFC A;  4IRW A;  2KD2 A;  1N4J A;  2E4J A;  2OZQ A;  2OF9 A;  2ZSC A;  4QZU A;  3D96 A;  2Z4I A;  3L4R A;  2AH7 X;  4ARH A;  4ODD A;  1BRQ A;  4FBR A;  5K67 A;  2ZAI A;  1ICM A;  5LJH A;  1EAL A;  1HMS A;  3BSZ E;  3Q34 A;  1EIO A;  4GUZ A;  4AW8 A;  3O2Y A;  2GTL O;  3VE2 A;  4OS8 A;  3NX2 A;  3ZWE A;  3NAD A;  1JV4 A;  1LKE A;  5FFH A;  2LFO A;  4YDB A;  1YUP A;  4Z2P A;  1VWO B;  3TZS A;  2X4M A;  3NR3 A;  1STR B;  3ELX A;  4INN A;  1VWI B;  4A1Y A;  1EI5 A;  2ZAG A;  4CPE A;  4MVI A;  4YFR A;  5KHP A;  2RTO B;  3BDR A;  3FMZ A;  1IFB A;  3STN A;  5AEO A;  1AB0 A;  1W5R A;  2FTB A;  2FRS A;  3EC5 A;  3FEP A;  2CM9 A;  4ZHH A;  2BC3 A;  3VG3 A;  4AZN A;  1BSO A;  4GDZ A;  2HYS A;  2RTK A;  4XMG A;  1FJ1 E;  3VGW A;  3FID A;  3T1D A;  1U18 A;  1VWE B;  2MF6 A;  3RDQ A;  1YWD A;  4KC7 A;  3RY1 A;  1N7Y A;  1QY1 A;  1SXW A;  1SWJ A;  3HWG A;  1HQQ A;  1QG5 A;  4YGZ A;  3UEU A;  1IJ8 A;  1HY2 A;  2OFR X;  2RTF B;  4QYN A;  4TKJ A;  2NNE A;  1OSP O;  4I9R A;  2OL8 O;  3CKG A;  3FR5 A;  2WWP A;  4TNN A;  3D9W A;  3B2I A;  3RKG A;  3ZI8 A;  1I4U A;  4K19 A;  1OPA A;  4CK4 A;  1DZP A;  2IZC B;  1CBQ A;  1I05 A;  1L6M A;  1MDC A;  4AZP A;  3SZJ A;  4Y0R A;  2Q2M A;  5LJG A;  2BHV A;  1I04 A;  1OEJ A;  3BX8 A;  3CWK A;  1IW2 A;  1TW4 A;  4WBK A;  3AKM A;  1LCW A;  3PH6 A;  4OEM A;  4BOE A;  1H91 A;  1SWA A;  2G78 A;  2I5V O;  2LBA A;  4BX5 A;  1OEK A;  4ZJ0 A;  1HMR A;  3OE3 A;  1JQP A;  5CYB A;  1BSQ A;  3P24 A;  1BJ7 A;  4ZHC A;  1B4M A;  5D45 A;  4GZV A;  2CBR A;  1CJ5 A;  2RQ0 A;  2Q9S A;  4GK9 A;  4KCA A;  1VWC B;  3FW4 A;  1B8E A;  1KL4 A;  4N7C A;  1SWT A;  4FBO A;  1EPB A;  4CSB A;  1B56 A;  1SLE B;  2GTL M;  4DQ3 A;  3B2J A;  4QRL A;  4ON1 A;  1QWD A;  1LID A;  4DCB A;  2DM5 A;  2FHL A;  2ALL X;  3ZW0 B;  2IZJ A;  1MK5 A;  1CRB A;  1VWQ B;  2AT6 X;  1TOW A;  2C1Q A;  2HZR A;  1FEN A;  2IZF B;  3SAO A;  1VWA B;  4NYR A;  2A5C A;  1YIV A;  3WJD A;  2XST A;  3F8A A;  1ERX A;  1VPR A;  4IAB A;  3T6F A;  4GJV A;  4O49 A;  1AVG I;  5CSE A;  4WFU A;  2RTR B;  1SLD B;  3SLJ A;  1ML7 A;  1VWL B;  4NW4 A;  3B2L A;  1SWS A;  2Y32 A;  1FDQ A;  1S7D A;  2RTP B;  4HPD A;  1ZNE A;  1WUB A;  4O3W A;  2JN3 A;  3TF6 A;  1ZNL A;  2K23 A;  3ELZ A;  1BLR A;  1NP4 A;  1OPB A;  4QAE A;  5EPQ A;  2A3F X;  3B2H A;  5HTE A;  2HZQ A;  3G7X A;  4ORU A;  3EYC A;  2PY1 A;  2Q39 A;  3CQN A;  4GGZ A;  4QZT A;  3SLO A;  2PI3 O;  1SWQ A;  5HZ6 A;  1SWB A;  1PMP A;  5EDB A;  3FA9 A;  1RXH A;  2HKD A;  5BVQ A;  5LJC A;  4LZV A;  1RXK A;  1GX3 A;  1VYO A;  2K62 A;  2M4L A;  4RUU A;  5B27 A;  4Y0S A;  3RZY A;  1NQM A;  3ZW1 A;  4CDD A;  3BS2 A;  2LB6 A;  5FAZ A;  4KII A;  4ES7 A;  2RA6 A;  3LV4 A;  2EU7 X;  3MX7 A;  3OJY C;  2QOS C;  1TOU A;  1KQX A;  2JMB A;  2W2A A;  1Y9L A;  2LA7 A; 
#chains in the Genus database with same CATH homology
 1A3Y A;  3HOL A;  2JU3 A;  2MHD A;  1FEM A;  2WQA E;  3FW5 A;  3JQO A;  1A57 A;  3UAQ A;  4ZHF A;  4EQA C;  3P6D A;  2AT3 X;  2WSJ A;  2Z4H A;  3B2K A;  4TJZ A;  2YG2 A;  3ZW2 A;  1LIB A;  2BS5 A;  3P6H A;  2WQ9 A;  5LJK A;  5HA1 A;  1OBP A;  3HK1 A;  2CZU A;  2FWV A;  2AT5 X;  2QO5 A;  2WEW A;  4A60 A;  3VE1 A;  4QYP A;  4ALB A;  1DC9 A;  3FEK A;  4ML7 B;  4TKH A;  4O4S A;  4KT5 A;  4M7M A;  3KZA A;  4ZHG A;  4IAX A;  5HCE C;  2BT9 A;  4YKO A;  5FQ6 E;  5EED A;  4A1H A;  2N93 A;  3EMM A;  3WXQ A;  1KXO A;  2NNQ A;  5HAE A;  5LKE A;  3WJC A;  3CBC A;  1E00 A;  4O4X A;  2ANS A;  3C76 X;  3CBS A;  3I17 A;  5HZ8 A;  2NND A;  3P02 A;  5HA0 A;  1X71 A;  4YMY A;  1ZNK A;  4MVK A;  3BRN A;  1DZJ A;  1ADL A;  3GAQ A;  5H8T A;  4AZQ A;  5FQ7 E;  4I3D A;  1DV9 A;  3STK A;  4ZH9 A;  1CBR A;  2FS6 A;  3CMP A;  3S5V A;  3WOV A;  2L5P A;  4ALO A;  2QO4 A;  4ZGF A;  1GXA A;  1MX8 A;  5FEN A;  1G7N A;  1KT4 A;  2GTF X;  3PQU A;  2OVD A;  2FR3 A;  1YWC A;  1ZRY A;  2KTS A;  3TGA A;  3MBT A;  1KZX A;  5F6Z A;  3S26 A;  3P6G A;  4ZGU A;  1G74 A;  1GT4 A;  3BY0 A;  3PED A;  1KOI A;  1OEE A;  2HNX A;  4L3R A;  1O1U A;  3AKN A;  3O22 A;  3PP6 A;  2KW1 A;  2OVE A;  1SY2 A;  2HLV A;  1KT3 A;  4ZHD A;  4O4O A;  2ASN X;  4EEJ A;  3MVF A;  3NPO A;  3ZUO A;  1YWB A;  4QGW A;  1X8P A;  3Q6L A;  3TGB A;  3KFH A;  1FEL A;  1JIW I;  3STM X;  1GKA B;  2OVA A;  3D95 A;  3BX7 A;  3WJG A;  1SXX A;  2QMI A;  4HWM A;  2WEX A;  3EM0 A;  4MIS A;  4ORX A;  3IA8 A;  4GH7 A;  2KT4 B;  4U8U N;  5DPQ A;  1CBS A;  3EBW A;  3FEL A;  4GRJ A;  4XMH A;  2JU8 A;  3UEX A;  5C0N A;  4CV7 A;  5HZQ A;  2HMB A;  1O8V A;  3APV A;  4Y0P A;  3VG7 A;  4D6B A;  3EBK A;  2RN4 A;  1BEB A;  1A2D A;  2X46 A;  4TKB A;  5IO7 A;  2FS7 A;  1T68 X;  2A0A A;  4IB8 A;  4O3Z A;  4YBP A;  1UZ2 X;  4AZR A;  1YWA A;  3FA8 A;  3KFI A;  2R74 A;  4L1N A;  2W2B A;  1R0U A;  1HMT A;  4IAW A;  3FLL A;  4IB6 A;  1KGL A;  2RCQ A;  2G79 A;  2A2G A;  4QQ1 A;  1SMP I;  1QFV A;  5AQ6 A;  4YFQ A;  1HQP A;  2X8S A;  1MX7 A;  5IO6 A;  4HFO A;  4OS3 A;  1X8Q A;  4BVM A;  2R56 A;  5K06 A;  2G7B A;  3PPT A;  1X8O A;  2A13 A;  4IB9 A;  1LPJ A;  1YP6 A;  4PJ2 A;  4DQ4 A;  1XCA A;  2CBS A;  1T0V A;  1OBU A;  4NLJ A;  5KID A;  5CE4 A;  5FQ8 E;  3ZQ3 A;  5LJB A;  3RSW A;  4NYQ A;  1X8N A;  3KQ0 A;  4O3Y A;  1DFV A;  1EPA A;  1GT3 A;  1U0X A;  1GGL A;  1VYG A;  2QM9 A;  3D4R A;  4GKC A;  4PSQ A;  5AEO A;  4YKM A;  5D47 A;  3NP1 A;  4NP1 A;  3WJB A;  1BM5 A;  2W2F A;  4QGV A;  3APX A;  1JYJ A;  5JR8 A;  3DSZ A;  4LKP A;  1X8U A;  2A2U A;  1AEL A;  1IIU A;  3V8U A;  3IFB A;  5L8O A;  1MVG A;  3APU A;  5LJE A;  1O1V A;  3CQR A;  4OMW A;  5HCC C;  3C78 X;  4XMD A;  4U3Q A;  2BS6 A;  3ZZV A;  3JSQ A;  1PM1 X;  2FLJ A;  1X89 A;  2AT0 X;  3P6E A;  3HTY A;  1LIE A;  2P8G A;  4WHI A;  1AQB A;  4JGL A;  1SXU A;  1NGL A;  1HN2 A;  1QY0 A;  4ORS A;  5F58 A;  3BLG A;  2MM3 A;  3LHN A;  4BQU A;  4COT A;  2JOZ A;  1EII A;  3PEC A;  1B0O A;  5BYP A;  4YH0 A;  4OS0 A;  3FYF A;  4YDA A;  3GE2 A;  3HOE A;  2X45 A;  4U9C A;  5IO5 A;  4QGX A;  2IFB A;  5HTD A;  2MO5 A;  1URE A;  4KH8 A;  5HZ5 A;  3FA7 A;  5HCD C;  2KTD A;  1EW3 A;  1Y9T A;  4FQB B;  3H3I A;  3OBL A;  5D4A A;  5EDC A;  1CBI A;  5AJC A;  5BVS A;  2OFM X;  3K3L A;  3F9D A;  1MUP A;  4LQZ A;  1KT7 A;  1EUO A;  1E06 A;  3O19 A;  2L9C A;  3BU9 A;  2RCT A;  3VU1 A;  4ORW A;  5H9L A;  1VYF A;  1BWY A;  5L8I A;  3APW A;  4HPB A;  3SOT A;  3S60 A;  3VG4 A;  1SA8 A;  5HZ9 A;  4YGG A;  4GET A;  3U03 A;  4EFG A;  1DZM A;  1QQS A;  4MIR A;  5EZ2 A;  3PH5 A;  2FT9 A;  4AZM A;  1ZNH A;  1BRP A;  4IB7 A;  2YMS A;  1NP1 A;  4EXZ A;  3UEW A;  3HWD A;  4I9S A;  3CR6 A;  3JS1 A;  4MVE A;  3VG5 A;  2Q2P A;  3FIQ A;  3NQ9 A;  1DZK A;  4IMO A;  1GKA A;  3FEN A;  2POA A;  2AMM X;  1ZND A;  2BLG A;  4R0B A;  1YP7 A;  1TXL A;  4LKT A;  5F6B A;  1E02 A;  3NQK A;  4YGH A;  2F73 A;  4FGI B;  1SY0 A;  1EXS A;  4Y0Q A;  3P6C A;  1SXY A;  1KZW A;  4I3C A;  1LF7 A;  2L67 A;  2WR6 A;  1IKE A;  4NNT A;  3WVM A;  2GJ5 A;  3C77 X;  2MJI A;  1GX9 A;  1ZNG A;  3D97 A;  3NBX X;  4YFP A;  3VG2 A;  1T8V A;  3ZW0 A;  5BVT A;  3QKG A;  1GX8 A;  1LNM A;  1IKJ A;  1QAB E;  2MWH A;  4RUN A;  1PEE A;  3KFG A;  4ORY A;  5HWZ A;  5DG4 A;  1PBO A;  1EQD A;  3WBG A;  2XKL A;  2R73 A;  4I6S A;  1RLB E;  4OMX A;  1FE3 A;  1Z24 A;  5H9N A;  1A18 A;  2X8F A;  4HPA A;  2AT8 X;  4ORR A;  3WJE A;  1I06 A;  5F1E A;  3NX1 A;  1DF3 A;  2ACP X;  3HWF A;  4KC8 A;  5KIC A;  4O4U A;  2Q4N A;  4LZU A;  4XMF A;  2OVS A;  1LIC A;  1FTP A;  1JJJ A;  1JZU A;  3S5X A;  4I95 A;  4IBA A;  1ERB A;  1RBP A;  4HPC A;  1ACD A;  4U8U O;  4EDE A;  5H9K A;  5F7G A;  2AL0 X;  4YBU A;  3E3C A;  1KQW A;  4YCE A;  4MVL A;  2ACO A;  3NQ3 A;  4O9S A;  3OD9 A;  1S2P A;  4AYH A;  1XKI A;  4AZO A;  5EEE A;  2X8T A;  1G85 A;  1E5P A;  3N91 A;  4GE1 A;  3VG6 A;  3TGC A;  1S44 A;  5D48 A;  4TQ2 A;  3U0D A;  4ZFX A;  3F6Z B;  3VPJ E;  1GT5 A;  2FR2 A;  3BU1 A;  3P6F A;  3KFF A;  5B29 A;  5LJD A;  2LBV A;  4WFV A;  4XME A;  1SY1 A;  3RBY A;  4D6A A;  5L8N A;  1N0S A;  4GNW A;  2O62 A;  3ZW1 B;  1QFT A;  3HWE A;  4YCH A;  4I3B A;  4N7D A;  4NLI A;  1HBP A;  2RD7 C;  2GTL N;  4ZR2 A;  1G5W A;  1U17 A;  1QY2 A;  1SY3 A;  3FA6 A;  1GM6 A;  1KT6 A;  3I0A A;  1ALB A;  3DTQ A;  1GT1 A;  4M6S A;  2JU7 A;  4GNY A;  4XMC A;  4TLJ A;  1JYD A;  5AJB A;  2CZT A;  4UU3 A;  3PQS A;  3RWX A;  1P6P A;  1LFO A;  4FBV A;  4IMN A;  1BBP A;  4ID2 A;  4QNI A;  1D2U A;  2GC9 A;  2WUT A;  4GU8 A;  5LKF A;  3WJF A;  3U9P C;  2JW1 A;  1ICN A;  1OBQ A;  5H9A A;  1JBH A;  1HBQ A;  2L68 A;  1KT5 A;  2AKQ A;  2QO6 A;  4UU2 A;  1D3S A;  3UEV A;  1JJX A;  1BSY A;  4NNS A;  5D8J A;  4A8Z A;  5HBS A;  4U8U M;  4ZCB A;  1LIF A;  2NP1 A;  2F09 A;  2CM4 A;  3FR4 A;  4O3X B;  1TVQ A;  2LKK A;  4ZH6 A;  3FR2 A;  1IFC A;  2KD2 A;  2E4J A;  2OZQ A;  4QZU A;  3D96 A;  2Z4I A;  3L4R A;  2AH7 X;  4ARH A;  4ODD A;  1BRQ A;  4FBR A;  1EAL A;  2ZAI A;  1ICM A;  5LJH A;  1HMS A;  3BSZ E;  1EIO A;  4AW8 A;  3O2Y A;  2GTL O;  3VE2 A;  4OS8 A;  3NX2 A;  3ZWE A;  3NAD A;  1JV4 A;  1LKE A;  5FFH A;  2LFO A;  4YDB A;  1YUP A;  3TZS A;  3NR3 A;  4INN A;  3ELX A;  4A1Y A;  1EI5 A;  2ZAG A;  4MVI A;  4YFR A;  5KHP A;  3BDR A;  3FMZ A;  1IFB A;  3STN A;  1AB0 A;  2FTB A;  2FRS A;  3FEP A;  4ZHH A;  2CM9 A;  3VG3 A;  4AZN A;  1BSO A;  4GDZ A;  2HYS A;  4XMG A;  3T1D A;  1U18 A;  1YWD A;  4KC7 A;  1SXW A;  1QY1 A;  4YGZ A;  3ZUI A;  3HWG A;  1QG5 A;  3UEU A;  2OFR X;  4TKJ A;  4QYN A;  2NNE A;  4I9R A;  4TNN A;  3RKG A;  3FR5 A;  2WWP A;  3B2I A;  3ZI8 A;  1I4U A;  4K19 A;  1OPA A;  4CK4 A;  1DZP A;  1CBQ A;  1I05 A;  1L6M A;  1MDC A;  4AZP A;  4Y0R A;  2Q2M A;  5LJG A;  2BHV A;  1I04 A;  1OEJ A;  3BX8 A;  3CWK A;  1IW2 A;  1TW4 A;  4WBK A;  3AKM A;  3PH6 A;  4BOE A;  1H91 A;  2G78 A;  2LBA A;  1OEK A;  4ZJ0 A;  1HMR A;  3OE3 A;  5CYB A;  1BSQ A;  3P24 A;  1BJ7 A;  4ZHC A;  1B4M A;  5D45 A;  4GZV A;  2CBR A;  1CJ5 A;  2RQ0 A;  2Q9S A;  4GK9 A;  4KCA A;  3FW4 A;  4N7C A;  1B8E A;  4CSB A;  4FBO A;  1EPB A;  4DQ3 A;  1B56 A;  2GTL M;  3B2J A;  4QRL A;  4ON1 A;  1QWD A;  1LID A;  2DM5 A;  3ZW0 B;  2ALL X;  2AT6 X;  1CRB A;  2HZR A;  1TOW A;  3SAO A;  1FEN A;  4NYR A;  1YIV A;  3WJD A;  2XST A;  3F8A A;  1ERX A;  1VPR A;  4IAB A;  4O49 A;  1AVG I;  4WFU A;  1ML7 A;  4NW4 A;  3B2L A;  1FDQ A;  1S7D A;  4HPD A;  4O3W A;  1ZNE A;  2JN3 A;  3TF6 A;  1ZNL A;  2K23 A;  3ELZ A;  1BLR A;  1NP4 A;  1OPB A;  4QAE A;  5EPQ A;  2A3F X;  3B2H A;  5HTE A;  2HZQ A;  3G7X A;  4ORU A;  3EYC A;  2PY1 A;  2Q39 A;  3CQN A;  4QZT A;  5HZ6 A;  1PMP A;  5EDB A;  3FA9 A;  5BVQ A;  5LJC A;  4LZV A;  2M4L A;  5B27 A;  2K62 A;  4RUU A;  3ZW1 A;  4Y0S A;  3RZY A;  4ES7 A;  3BS2 A;  2LB6 A;  5FAZ A;  4KII A;  2RA6 A;  3LV4 A;  2EU7 X;  3MX7 A;  3OJY C;  2QOS C;  1TOU A;  1KQX A;  2JMB A;  2W2A A;  1Y9L A;  2LA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...