2Q2RA

Trypanosoma cruzi glucokinase in complex with beta-d-glucose and adp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
373
structure length
370
Chain Sequence
APAGSHMNIKELSLHELCEELKTPAWNAPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRKDITEIIEFFNEIIELMPASVMKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKALFPPGHSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLVLAPGTGLGSSLIYYNPQHIVVPLELGSQTLPMRKDIDYIQTLHAELKLFPNYENMVSGAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPLTIVLVGDNIVNNAFFYRNPQNLKEMHHEALNHEMERFGFQSRVSYLRQKKLLNLNLMGCYRCGLDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Trypanosoma cruzi Glucokinase Reveals Features Determining Oligomerization and Anomer Specificity of Hexose-phosphorylating Enzymes.
pubmed doi rcsb
molecule keywords Glucokinase 1, putative
molecule tags Transferase
source organism Trypanosoma cruzi
total genus 124
structure length 370
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.1.2: Glucokinase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02685 Glucokinase Glucokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2q2rA01
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 2q2rA02
4FWMA 4BVOA 4EFHA 5AQMA 3CQXA 4H5NA 1U2VB 4PL8A 4BRAA 5KQ8A 4BC5A 2V52B 4CZHA 1BG3A 3FZMA 4BR5A 3UKUB 3VETA 4PL7A 1KAYA 4M63C 2E2NA 1Z6RA 3QMLA 3D7EO 4H0YB 1NGBA 4QS8A 4QS7A 2QWQA 2E20A 2CH5A 5AQKA 2AP1A 3H1QA 2AA4A 2YHXA 3SMSA 1BOTO 5AQYA 3CJ9A 2P9SB 3A0IX 5F2RA 2E1ZA 5E26A 4L3QA 4FO0A 1DKGD 1V4SA 3D2EB 3LDOA 1RDWX 1HKBA 4YDUA 1HUXA 4B1VA 5AZIA 3EKSA 1E4FT 3VENA 3HM8A 3RSEB 3GL1A 4CBUA 3WUHA 1SQKA 3SMPA 3JXUA 3DAWA 2D0PA 4CZJA 3VEXA 3ZETA 3BP8A 4PKIA 4CBXA 1D4XA 4EHUA 3CERA 5AZJA 4EHTA 1NGDA 1TYQA 5LJWA 4JD2A 4BRMA 3W3DA 3O08A 1WUAA 2E2OA 3O8MA 3L0QA 1YAGA 4AM7A 4H03B 4H0TB 1K8KB 1ZBSA 3ULEB 4BR9A 2HF4A 3D2FB 4H0OA 1U6ZA 1QQMA 1BUPA 4CI6A 3LDQA 2BUPA 4RTFD 5FPDA 3CIPA 5FPNA 2P9IB 3I33A 5FPMA 4F9OA 3VPZA 5JMVA 3WXIA 3A8YA 4FWQA 3DXKA 1JCEA 3WEEB 3CJCA 3MCPA 3P4IA 2Q97A 4ISFA 4GY2B 5KPZA 2P9PB 5BN9A 5KPRA 3IDHA 4ISGA 3WQTA 1SAZA 3LL3A 1HKGA 3VGMA 4H5TA 4MO4A 4KBOA 1C0FA 3KVGA 3FE1A 1E4GT 4BGAA 3ZX0A 2P9NA 1ATNA 3F9MA 3WXKA 3DJCA 2Q0RA 2YJEA 4IJNA 4E1JA 2Q1NA 2Q36A 4FWPA 3U4LA 5AQHA 4A2AA 1BA1A 2QW9A 2EWSA 2YHYA 2BTFA 5AQQA 2HMPA 5TKYA 3HI0A 3S41A 4B1YB 3VOVA 1Y64A 1DEJA 2F9TA 4EIAA 5AQTA 5AZIB 2QWOA 5AQIA 5BRHA 2VCPA 3CI5A 4H0VB 3UB5A 4JHDA 3BF3A 2E2QA 1ZC6A 1C0GA 2Q0UA 3LM9A 1NGEA 4GNIA 4B1WB 3MN6A 5AQLA 2UYTA 3JS6A 5AQFA 3U8XA 4CZKA 4FOIA 1GLEG 1TYQB 3H46O 3QBWA 2FLOA 4JD2B 1ESVA 3IMXA 3L6QA 3R6MA 2FF3B 2PBDA 2P9UA 1NGJA 2V51B 2D1KA 2HOEA 4JAXA 3WT0A 2GTDA 2YHWA 5BN8A 3C7NA 2ASPA 5JLHA 5AFUA 3H3OB 4BRNA 4CBWA 5F1XA 1NM1A 4H0XB 2A3ZA 4CD1A 1QQOA 5ADXA 3VESA 4DQ8A 3GE1A 2CGLA 2ZGYA 3CJAA 4AM6A 4BRPA 4K43A 3FZFA 4RCHA 5AQRA 1XC3A 1XUPO 3GG4A 3IFRA 5AQZA 5AQWA 5AQVA 3VGKA 2YJFA 3ZEUA 2P9KA 2QWMA 2KHOA 3AAQA 1RGIA 4XEIA 3EO3A 3MDQA 2A41A 3A5NC 1HLUA 1HX1A 4BVPA 3CHWA 4H5WA 2W40A 3A5OC 2A5XA 5LJVA 4MLHA 5AQJA 4DCHA 4BQZA 3U9DA 3M1FA 3O80A 2P9NB 4K41A 5KPTA 1KAZA 1ZXOA 3I8BA 4NB4A 3LDLA 2A42A 2PAVA 4FWLA 4DHYA 3R8EA 1BWFO 3FR0A 1BA0A 3AARA 3VEYA 2GUPA 3MN7A 1LCUA 4Z94A 4I6MA 2QWNA 4FPAA 1NBWA 1NWKA 3W0LA 3O4WA 1QHAA 4ISEA 4FOEA 4BQLA 4M7XA 3M6GA 4BRGA 1NMDA 2WUSA 1JCFA 2ZF5O 2E1YA 2NZTA 1NGFA 2H3GX 4FL9A 4XH5A 1HPMA 2FSJA 2F9WA 1TUUA 1OKJA 2P9SA 1S22A 1HKCA 1NGAA 4JHDB 1RFQA 4BR0A 3U9ZA 4BRCA 1X3MA 2GWJA 3ZX2A 4BG9A 5EXWA 5FPEA 3L4IA 4H5VA 4FSVA 4BC2A 4WYBA 3SLCA 2FF6A 4FWKA 2ASOA 5EOYA 3ENOA 5AQUA 2QWRA 1X3NA 5JLFA 4B1ZA 2P9UB 1BO5O 3BEXA 3MN5A 4IJAA 4LC9B 3VEOA 3WXJA 2ASMA 3C7NB 3CJ7A 4O5FA 2A6AA 3VF6A 4BC3A 5BPLA 4BRLA 4IXCA 3ZX3A 5EVZA 2FXUA 2CGKA 2QXLA 5AFUH 4RWTA 1J6ZA 2E8AA 2Q2RA 3QFUA 5E84A 3EN9A 1GLLO 3ENHA 3VEWA 1ATSA 2CH6A 1V4TA 3VF2A 4B1XB 4DB3A 5ADXH 2D0OA 5BRFA 2IVPA 3ZEUB 2P9KB 4HWIA 3DXMA 3KZBA 2YI1A 3O5BA 2E88A 1NGGA 5AQOA 3ZETB 4WQ5C 1MA9B 5AQPA 5JICA 3B8AX 3QICA 4YDUC 1P8ZA 3SK3A 1EQYA 5AZJB 3CQYA 5BREA 1T6DA 1BU6O 3AAPA 4BC4A 3CJBA 3TPQA 3LDPA 1X9JA 3IUCA 3QFPA 5BRDA 5KQDA 4H5RA 3O6WA 3H6EA 1T6CA 1YUWA 3FLCO 3UE5A 2GELA 2P9PA 3LM2A 1GLBG 3KHYA 4K42A 1HJOA 4CZMA 4FWNA 2GEMA 2HF3A 4CJ7A 5BPNA 3MK6A 3QDKA 3HBTA 3O1BA 3VEVA 3TU5A 2DPNA 4QS9A 1BDGA 4I6MB 3UKRA 3BUZB 4BRHA 1KXPA 2FSKA 3FZLA 2ZGZA 4IWVA 1SZ2A 2P9LA 3DXKB 1NGCA 3HZ6A 2V7YA 4BGBA 4BG8A 3ID8A 1LOTB 2E2PA 4IZ9A 3FZHA 3VF4A 4CZEA 5BR9A 1GLDG 4BROA 2OANA 4EAHD 4XH4A 3H3NO 1GLAG 3AY9A 3EL2A 4WQ5A 5I9EB 5AQNA 4CZLA 5AQSA 4A61A 1MDUB 1MWKA 4PKHA 1WOQA 3MN9A 4CZIA 4M7YA 4HTLA 1DGKN 1YXQA 1U2VA 2J4RA 1NGIA 1TUYA 5AQXA 4FWRA 3DWLA 5LY3A 3EKUA 4JN4A 4BREA 5AR0A 2V7ZA 3UKUA 4BRDA 2IVOA 1GLFO 2D4WA 2ZWHA 4XH1A 1Q18A 3QB0A 5AQGA 3GOIA 4BRFA 1QZ6A 1S3XA 1CZAN 4WQ4C 1NGHA 4H0PA 3WXLA 4MO5A 5EY4A 1GLJO 3ATVA 4A62A 4BR7A 3CETA 5CE3A 3DXMB 3J8AA 1R59O 3SJHA 3M3ZA 2QM1A 3VEZA 2QWPA 3WQUA 3D2EA 1QZ5A 2VWBA 4FWOA 4O8KA 1IJJA 2CGJA 1GLCG 4MLEA 1G99A 2VYPA 4K25A 3RSEA 1H1VA 4BRQA 1KAXA 2GWKA 3ATUA 2I7NA 4CZFA 5BPMA 3A5MC 1QQNA 4CZGA 5B8HA 1YVNA 3FFKB 4C23A 4CD3A 5ELZA 2A40A 3O1WA 3FZKA 4IO8A 2NLXA 1NLVA 2IIRA 4J8FA 3A5LC 1Z05A 3H1VX 3LDNA 4B1UB 3C0BA 2QWLA 3MMVA 3UKRB 1K8KA 1IG8A 3R9PA 3ULEA 3H45C 3D2FA 4JNEA 4Y0WA 3VGLA 1JCGA 2P9LB 1T44A 3FGUA 4WQ4A 2FSNA 4FWSA 4PKGA 4BRKA 1XQSC 3QBXA 3G25A 3HTVA 3GBTA 2IVNA 4BR2A 4BR4A 2P9IA 2NRHA 2W41A 1ATRA 3VERA 4FPBA 2Q31A 2YCHA 5EX5A 4NO7A 3OHRA 4A2BA 3GDQA 5F0XA 4B9QA 3CJ1A 3EZWA 3HSCA 3WEEA 4BRIA 2ITMA 1MWMA 2I7PA 3BF1A
chains in the Genus database with same CATH superfamily
1WSIA 3NE6A 1C1CA 4H5NA 3ZSOA 4FZZA 1HMVA 1LV5A 1RT7A 4CZHA 3FZMA 4B9MA 4BR5A 4JKBA 4M63C 2E2NA 1Z6RA 4E7HA 1KCFA 2ZD1A 4QS7A 2QWQA 2CH5A 1JLAA 1U45A 3SMSA 5C25A 5LMUK 2P9SB 4WFAL 4JI3K 3J7YP 3TAFA 1VSFA 1L3SA 3NHGA 3I56N 1X9SA 1TKDA 3LDOA 3PIPL 1RDWX 4YDUA 4B1VA 1HUXA 4CGIA 5KRSA 5FRMA 3TI0A 1ASUA 3HM8A 2RE2A 3RSEB 4JK7A 1TKZA 3VQ5A 4CZJA 4F2RA 4F4KA 4Z4GA 5AZJA 3CPWM 4JLHA 1NGDA 3VQ8A 1TYQA 2F7TA 2LSNA 3W3DA 1RTHA 4CGJA 4AM7A 4DTRA 3AVJA 3ZSQA 4DFPA 2BDPA 4HUFA 4FJ5A 1T05A 4DR5K 4ILJA 1VQPN 4DQIA 4X66K 3WNHA 2F4VK 3A8YA 5SWMA 4CK1A 4X64K 1UAXA 3M8QA 2NUBA 5FRNA 3DM2A 5CR4A 4GVEA 4J2BA 4NCBA 1VAZA 3LZIA 3S9HA 3CFPA 3LL3A 1HKGA 3VGMA 1KVBA 4E7KA 3K5MA 3KVGA 1S1VA 5AJ3K 3FE1A 3C6TA 3OYIA 3VQ6A 2Q1NA 2ZJPL 2Q36A 2UXCK 1SUQA 4AF1A 3IRXA 4CJQA 3D45A 1C0MA 4ZHRA 3THXA 4A2AA 1BA1A 3LPTA 1KTQA 3CF5L 4GV3A 2D5RA 5GAEP 3DRSA 5AQQA 4B9TA 2FBTA 4EIAA 1JXEA 1S6QA 3AVBA 3G6EN 1RDUA 2NRZA 3HVRA 2Q0UA 2O4IA 4NLBA 4C1NI 4B1WB 4GNIA 1RNHA 4IG0A 3KK2A 4FYDA 3CCMN 3V4IA 1GLEG 3QBWA 3TTFA 4JD2B 1ESVA 3L6QA 3TAQA 2FF3B 3BZCA 3JYTA 3C65A 1NK7A 2HOEA 4KHQA 1QVFM 3WT0A 2GTDA 2YHWA 3AVMA 2ASPA 3L3UA 4B3RK 4DU1A 4JKGA 5JS1A 3VA3A 1RT3A 1QQOA 2HBJA 3F73A 4HHTA 3SYZA 3GE1A 2ZGYA 4AM6A 4BRPA 3BY5A 1XUPO 1IO2A 4ZTFA 3IFRA 5AQWA 3VGKA 5AQVA 3ZT2A 3PX0A 3ZEUA 3AAQA 1RGIA 1CXQA 4LFCK 3EO3A 3A5NC 4BVPA 4FZYA 2W40A 3BDPA 3A5OC 4OPAA 5LJVA 3CD6N 1K9MO 2O8EB 3NF6A 2P9NB 3ZSZA 1XI1A 4OGEA 2HBLA 2KZMA 1DT9A 4NB4A 1C6VA 2KZZA 4FLXA 3SNNA 3LDLA 2PAVA 1FXXA 3OJSA 2AJQA 4E1NA 2ATQA 4C8KA 1JLCA 3FR0A 1BA0A 4O0JA 3VEYA 3PV8A 2OYQA 1UA0A 4JI0K 1LCUA 1VSDA 4Z94A 4I6MA 1NWKA 1N34K 3O4WA 1QHAA 2IGIA 4DTJA 4ISEA 3M6GA 4CEFA 2E1YA 2O8FB 3P83D 1BGXT 3THWA 1EKEA 1QTMA 4E7JA 1HKCA 4JHDB 1X3MA 3HOTA 1TK5A 1JLFA 2O4GA 3AVFA 3TABA 3L4IA 4J2AA 4FSVA 3VTHA 3K0SA 1NK9A 5HLFA 3KK7A 3ENOA 4GMJB 5AQUA 2O8CB 5JLFA 1S1TA 4CJSA 4KRFA 1S1UA 4LC9B 5IWAK 2ASMA 4RW7A 1TKXA 3MAQA 1BI4B 2A6AA 1C0TA 2KFZA 2DTUA 2R7YA 1S1XA 3VF6A 4BC3A 4KHPK 2B6AA 3OYFA 4BRLA 3C94A 5EVZA 4E1MA 3S3MA 1NNEA 3C6UA 3RMCA 4RWTA 1XMOK 4ICLA 3EN9A 1ZYQA 1RILA 1ATSA 4RW8A 3HPOA 2I5JA 1L3VA 1QHTA 4B1XB 1WBBA 4JI1K 2Y1JA 5BRFA 2OZSA 1WSJA 4HWIA 4DUZK 2E88A 1OH8A 1EXQA 3LP2A 5AQOA 3ZETB 1CZ9A 2F96A 5BREA 1EQYA 3AAPA 4JK9A 4DSEA 5KQDA 5BRDA 3E9PA 3D6RA 1T6CA 3CMAN 3UE5A 3MXMA 1GLBG 5LMNK 2VGMA 4KI6A 2GEMA 3DMJA 2HF3A 4CJ7A 2HHSA 2E5LK 1WB9A 1WSGA 3MCAB 3QNNA 4DF8A 5HP1A 4CJ4A 3MXJA 3UKRA 1RT4A 1I39A 1OH5A 3RR8A 1HYVA 4CJ3A 1KD1O 4IWVA 1SZ2A 1NGCA 2BANA 2F8TA 4F2SA 3OBYA 1VQ7N 4PA1A 1K6YA 4O8UA 4IZ9A 3SBTA 3FZHA 4CZEA 4OO1J 4XH4A 2HVHA 1GLAG 3AY9A 5H1SQ 4CJRA 5I9EB 1RTDA 3MECA 5AQNA 4BACA 4A5BA 1MDUB 4DR3K 3AVIA 4OLAA 1U4BA 3QEVA 1YXQA 1RBVA 3MEGA 1XNQK 5LY3A 3HP9A 1RDAA 3EKUA 1W97L 2IVOA 1VSHA 2OPRA 2E6LA 2OTLN 1IV0A 1Q18A 3QB0A 4CJVA 4LF5K 4CIEA 4CJ5A 3SUNA 4CEDA 3HVTA 3QEXA 4YOXA 4MO5A 1GLJO 2FBVA 5CE3A 3DXMB 4B9LA 1R59O 3VQ7A 3LZJA 1TK0A 3MEDA 1BQMA 3NMUA 4FWOA 5D3GA 1IJJA 2CGJA 1GLCG 2VYPA 4FK0A 3U3YA 4CW7B 3ATUA 1TVRA 2I7NA 4CZFA 4AILC 5GAHP 3A5MC 4CZGA 4C8OA 1YVNA 1DTQA 4W5OA 4IOCL 3DI6A 4RG8A 3FZKA 4IO8A 4H4MA 3PX4A 3H1VX 1Z05A 3CCQN 5JVHL 4C8NA 2IC3A 3IS9A 5HOOA 3C0BA 1M1KO 2HVIA 3QEIA 3ULEA 2HBKA 2YV0X 4N5SA 1JCGA 1D8YA 2DFFA 2NRRA 1XQSC 2IS3A 3G25A 1J9AA 4U7BA 4BR2A 3TTCA 4BR4A 4LFAK 3DLLL 3SCXA 1ATRA 4FPBA 2YCHA 1NK6A 4BRIA 3EZWA 3HSCA 3WEEA 5HRSA 2HHQA 2ITMA 4OLBA 2I7PA 3K5LA 3V9UA 1WAJA 4FWMA 3ITHA 4BVOA 4EFHA 3CQXA 1IKVA 1U2VB 5KQ8A 4W5RA 3QIOA 1BG3A 3VETA 4IFVA 4CHOA 4H0YB 3OS2A 4DLGA 3KLEA 1NJIO 3RMAA 3AVCA 3THYB 3DLGA 3L3VA 2DFEA 4LF8K 3DLRA 1IKWA 3A2FA 4CK3A 2UU9K 4E19A 2XRIA 4OPJA 1BOTO 3KIOA 4KHNA 3HXMA 3A0IX 1LAVA 3KK3A 2E1ZA 5C24A 4KB0A 3KJVA 2NRVA 5E26A 4FO0A 1T3VA 1DKGD 1RBRA 5LL6Z 1V4SA 1SV5A 3D2EB 4EZ9A 4OKJA 2HNZA 3OYMA 1T8EA 5AZIA 1JLEA 4CBUA 3BZKA 3KWIA 3WUHA 4CEEA 4M42A 4N41A 3JXUA 3DAWA 4CHYA 3RVCA 1D4XA 2GUIA 4DFMA 1FJGK 1YT3A 4Z4CA 1FW6A 2YKMA 4BRMA 3O08A 1IKXA 1WUAA 1Q9YA 2P1JA 4H03B 4H0TB 2QA4N 1EX4A 3T1YK 2HB5A 2HF4A 3M5RA 1BUPA 3QLHA 1X9WA 3J7AP 3LDQA 2BUPA 3OY9A 4NYNA 4MQ3A 5K14A 4PWDA 3CIPA 1LW0A 5FPNA 2P9IB 3I33A 1W2BM 1WSEA 4F9OA 5JMVA 3WXIA 1ZBHA 1N36K 4M3RA 5C10A 3B6PA 4LY7A 4CHNA 1JCEA 3LP1A 1RT6A 4QAGA 3CXCM 5KPRA 2P9PB 3IDHA 4ISGA 3S3NA 3AA5X 4MO4A 4KBOA 4FVUA 2O8BA 4DQQA 1HQUA 3OYGA 3VMFB 3SAHA 4PY5A 3AVHA 1ATNA 3J7ZO 4CJPA 2Q0RA 4IEEA 4IJNA 4C1NK 3VQDA 1VQON 2KQ2A 3TAMA 5AQHA 1VQ9N 4KH6A 5CYMA 3V9WA 2QW9A 1FKPA 2YHYA 3ID6A 4DQPA 2BTFA 1HNVA 4M45A 3T1HK 3VOVA 1DEJA 2X6SA 3KKRA 4MDAA 4R79A 3JSMA 1E3MA 4CJKA 3OYEA 2QWOA 5AQIA 3O3GA 4CFBA 1QS4A 3CI5A 3VQEA 5CZ2A 3RMDA 4QCLA 1ZC6A 3ZT3A 5AQFA 3JS6A 3U8XA 1TYQB 3H46O 3NCIA 3R6MA 1ZBUA 2P9UA 1NGJA 2V51B 5C2FA 2OA8A 5DMRA 4BDPA 3C7NA 1BIZA 5AFUA 4DFKA 1NM1A 4CJWA 4H0XB 4ELUA 4YHHK 4DWIA 5ADXA 3E01A 1OVYA 4RCHA 2W6KA 4DV6K 1RDDA 3QIPA 3SBGA 2ZM6K 3EYZA 4DTNA 5C15A 2XY7A 5AQZA 2G8HA 3QEPA 2P9KA 2QWMA 2ITGA 4A57A 2KHOA 3CCEN 4W5NA 3T19A 5KI6A 4FW1A 4B3SK 4X62K 4FJMA 2WONA 2Q3SA 5KGXA 3ULDA 4IDHA 4BQZA 1HNWK 1RT2A 3V9SA 3CG7A 3RRGA 1ZXOA 3I8BA 1NJZA 3ZYYX 1Q86O 3HP6A 4FJJA 4JV5K 3I55N 4KAZA 2YKNA 4FJ9A 3THXB 4G9ZA 4BWJA 4FPAA 3W0LA 4DV7K 3OVNA 2P51A 4BQLA 3G0ZA 4M7XA 1HR0K 4BRGA 1NMDA 1JL1A 1NK5A 5HBMA 3EY1A 2FSJA 1FK9A 1TUUA 2P9SA 3OYDA 3IG1A 1NGAA 2O8DA 4BR0A 1OH6A 3U9ZA 4BG9A 5FPEA 4TSXA 3LDSA 2XY6A 4IOAL 4JRQA 4H5VA 3TSPA 1SL1A 3SLCA 1WNSA 2FF6A 4FWKA 3AO5A 2WBNA 1RCHA 1VRTA 4HUGA 4CJEA 1TKTA 1BO5O 3WXJA 3CJ7A 5CHIA 2BE2A 4AHCA 2QXLA 1VK0A 1WSFA 3SPYA 1J6ZA 3CC7N 2Q2RA 1S6PA 5E84A 2YHAA 1GLLO 3VEWA 4LFBK 3V1OA 3U6FA 4GV9A 3F5TA 2CH6A 1V4TA 1T03A 3K5OA 3ZEUB 3KZBA 4GW6A 3O5BA 3NGYA 4PQUA 1L3TA 1NGGA 4WQ5C 1MA9B 3K5NA 3B8AX 3M8PA 4NCAA 4N56A 1X1PA 1VQ4N 1EWRA 4BC4A 3CJBA 5MLCQ 2YX6A 4KFBA 3LDPA 1X9JA 3WXMB 3PY8A 3D0PA 1JL2A 4H5RA 2OTJN 4ILHA 1EO1A 2JGUA 1TAUA 3EE8A 1HJOA 4CZMA 2W42A 2XHBA 5HRNA 1TV6A 3MWPA 3MK6A 2VWJA 5HRRA 1QSLA 2Z1GA 3O1BA 3VEVA 4JYAK 3CM5A 3TU5A 4WFBL 2DPNA 1YVUA 4I6MB 5IT9O 1DTTA 3OYBA 3BUZB 4DV4K 2FSKA 1TGOA 1TL1A 2D0CA 2GV9A 2P9LA 3DXKB 2V7YA 3V9XA 1CZBA 4BG8A 3VTIA 3THWB 5TKWA 3I8DA 1LOTB 3G4SN 3K57A 3MWTA 5GADP 2OANA 1Y97A 4EAHD 4DSKA 3H3NO 4Z4EA 2FBXA 4DLEA 3CPEA 4KHWA 4WQ5A 2OZMA 1QSSA 4KKOA 5DK5A 4FXDA 1T7PA 3OYNA 2VG7A 1MWKA 1WOQA 4CZIA 1I3AA 3ZSXA 1DGKN 2DY4A 3NBPA 4FM2A 3V81A 5AQXA 3THVA 4FWRA 3PSFA 4BDZA 1SKWA 3UKUA 4BRDA 4CE9A 3KTQA 2VG6A 4OKKA 1ASVA 3ALYA 1IBMK 3LP3A 4BRFA 1CZAN 3CCVN 5GAGP 3CFOA 1VQLN 4H0PA 4M3YA 4Q0BA 3VQ4A 5GIOA 2A1SA 1KSPA 2VG5A 5SZTA 3PSIA 3L8BA 1N5YA 1QZ5A 2VWBA 4DSFA 4MFBA 4O8KA 4DR1K 4YOUA 1OVQA 2E6MA 5C42A 4K25A 4DSLA 4CF8A 1H1VA 3O9TA 5J2MA 1KAXA 2GWKA 4DR2K 4EP5A 3MXIA 3FFKB 4CD3A 2RF2A 4HVJA 3NFAA 5ELZA 3O1WA 4XIUA 3M8RA 3VQBA 1XMQK 1JLGA 3LDNA 3ZSVA 3CMEN 1VSLA 2QWLA 1YTAA 3UKRB 1K8KA 2UUBK 3R9PA 1QE1A 4YNQA 3DLBA 3H45C 3D2FA 3F9KA 3VGLA 2NRWA 4OGCA 4KREA 3FGUA 2FSNA 4L8RB 3LAMA 3OHRA 3DYAA 3GDQA 4B9QA 3CJ1A 4H4OA 4CEAA 3ZX2A 1NOZA 5KRTA 1SKSA 1G15A 5AQMA 4YOYA 2KFNA 4JRPA 3O9UA 4PL8A 4BRAA 3VQCA 2V52B 3HT3A 4GVMA 1KVCA 1KAYA 2G8UA 2UXDK 1HPZA 2A1RA 3QMLA 3D7EO 3CCJN 1NGBA 4DU4A 1IBLK 3NVKA 2E20A 1DLOA 1A5WA 3OYKA 3H1QA 5CZ1A 3AA3A 5BR8K 1W0HA 1Q8IA 3CJ9A 3OYCA 2VQFK 5F2RA 3CCSN 4KHSA 3E1YA 1A5XA 4YFUA 3NVMA 5HL7L 1HKBA 1IKYA 1O1WA 3P5JA 3NGIA 2HNYA 3VENA 3LWLA 1SQKA 4K8ZA 2OPSA 1Z26A 2HW3A 2D0PA 4UY8O 3ZETA 2QKKA 4CBXA 4DV1K 4G1QA 4KO0A 1ZBLA 1XWLA 2PZSA 3PX6A 3CYMA 5LJWA 3O8MA 4FW2A 1YAGA 4PHTX 4LH4A 3ULEB 4WE1A 4WFNL 4BR9A 4H0OA 4I2QA 4OJRA 4FJ8A 1U6ZA 4CI6A 1UA1A 4FK2A 4GKKK 1NK4A 3HK2A 3SUPA 1HYZA 1KFDA 5FPMA 4IDKA 3B6OA 2G8IA 1F21A 2Z1HA 3SAGA 4YOVA 3TANA 3WEEB 3CJCA 3MCPA 1O13A 2HBMA 2YNHA 2E4LA 3KWGA 4BWMA 1NMNA 2Q97A 4GY2B 5KPZA 5T7BA 3QESA 3V1RA 3NF9A 3WQTA 1SAZA 5HROA 3M8SA 4H5TA 1LWCA 4BDYA 1N8RO 4X65K 1C0FA 4F8RA 2HHUA 4FLWA 1E4GT 4BGAA 3F9MA 3WXKA 4K0KK 3AO1A 2YJEA 4E1JA 4CEZA 1RT1A 4JI5K 3AGKA 5CY4A 2QTDA 3S3OA 5TKYA 1VQKN 3HI0A 4HCCA 2F9TA 1EETA 5AZIB 3L2UA 4KTQA 2UUCK 4B3OA 1NKEA 2VCPA 3UB5A 1BCMA 3BF3A 4CFDA 2XY8A 1C0GA 5DM7L 1M90O 1NGEA 4CF0A 3MN6A 2ZJRL 4FM1A 5AQLA 2G8FA 5J2QA 2UYTA 4AHSA 5E41A 4I9QA 4GV6A 4CERA 3LP0A 3P31A 2FLOA 3AO3A 2PBDA 4M3XA 4JAXA 4NLCA 3L2WA 2VQEK 2EHGA 4CBWA 5F1XA 3K58A 3NH1A 2A3ZA 4C8MA 4AHVA 2GX9A 3NAEA 2CGLA 3CJAA 3O9RA 4K43A 3KLIA 3G10A 5M1PA 5AQRA 2GBZA 4CEQA 2VWKA 5FLXO 3HSTB 1NK8A 4IFYA 1VHXA 5J2NA 3MDQA 3F2KA 2X78A 1HLUA 1HX1A 1YHQN 4C8LA 4JEPA 1B92A 4DTXA 1WLJA 3TAEA 2O8BB 2A5XA 4YOTA 3KD1E 4DCHA 1WSHA 3U9DA 3O80A 4O55A 3RR7A 4K41A 5KPTA 3K9KA 2HHVA 4FWLA 2A42A 4DHYA 2NNWA 4B08A 1BWFO 1YF5L 3AARA 2GUPA 3MN7A 2JWLA 3DRPA 2QWNA 2WFBA 1NBWA 3ZSWA 4CCHA 4NYFA 4IFEA 4FOEA 4RW6A 4BY9C 4B8AB 1JCFA 4IEIA 2NZTA 4I7FA 2H3GX 1BHLA 4FL9A 4XH5A 3TWHA 2F9WA 1OKJA 2Y1IA 1S22A 3CCUN 1WBDA 4BRCA 1NJWA 1IG9A 4CGGA 3DOLA 4BC2A 4OVLA 1C1BA 1J54A 1RDCA 4CJUA 4DTUA 3P38A 2QWRA 1X3NA 3AO4A 2RHKA 2G8VA 2P9UB 4M3WA 4IJAA 3O3FA 1BCOA 3PO5A 1D5AA 3VEOA 4HCBA 3WNEA 3C7NB 2RN2A 4O5FA 5BPLA 4FJGA 3G71N 4IXCA 1VQNN 3ZX3A 4WF9L 5AFUH 2PYJA 3QFUA 1BL3A 3OYHA 4W5TA 1NOYA 3VF2A 4DB3A 5ADXH 2IOCA 4DQRA 2D0OA 2HHWA 2P9KB 4E7IA 3WNFA 2YI1A 1KC8O 2KKZA 4DV2K 4DFJA 5AQPA 2B5JA 4YDUC 5AZJB 3CQYA 1T6DA 4LF6K 2X6NA 1NKBA 3VQQA 4CVNE 3TPQA 1D9FA 3K9JA 4O0IA 3QFPA 1YJ9N 3O6WA 3H6EA 1YUWA 1ZBFA 2UUAK 4BE2A 2P9PA 4K42A 3KHYA 4B9NA 1U47A 2KTQA 1RBTA 4E89A 3C6HA 4JS5A 2FBYA 1I94K 3QDKA 1B9FA 3VQAA 1YJNN 3TSUA 2YNFA 1BDGA 5KTQA 1KLMA 4JS4A 3SUQA 3SPZA 4BRHA 3FZLA 4KPYA 1NK0A 3HZ6A 4LSNA 4BGBA 4AHRA 4ID1A 3ID8A 1TAQA 4BE0A 4MDBA 4OPKA 3RTVA 2O8DB 5BR9A 5M1NA 2PY5A 3P1GA 1BQNA 3IAYA 1SL2A 5AQSA 4A61A 4OX9K 4DR7K 3MX5A 4PKHA 1GOBA 3MN9A 1NGIA 3SJJA 4M3ZA 1LAWA 3KD5E 2ZWHA 4XH1A 3SQ1A 5AQGA 4FK4A 2XO7A 4JKEA 1S3XA 3KLGA 3E9OA 3NF8A 3AVGA 4FLZA 2YHBA 1NGHA 4DQSA 3WXLA 3ATVA 3WNGA 4A62A 3NDKA 1U49A 3J8AA 3M3ZA 2QM1A 3QERA 2QWPA 4KH4A 3UIQA 5C2DA 4NXMK 3WQUA 3TTDA 2DFHA 2IAJA 3RSEA 4JKAA 3PUFA 2QXFA 3HRGA 4BRQA 4DV0K 4DTSA 2HHHK 4KHYA 1SS6A 5BPMA 1RBSA 1RDBA 1QQNA 1NJXA 3NH0A 4JK8A 5JVGL 1TL3A 1HNZK 2A40A 3L2VA 4JKGB 3ZT0A 3AV9A 1VSIA 3OJUA 1QVGM 4DV5K 1NLVA 4J8FA 3A5LC 4B1UB 4GKJK 5FDLA 1K8AO 3MMVA 1SKRA 4JI8K 2HHTA 1IG8A 4IO9L 4FJKA 1NU0A 4JNEA 2UXBK 4Y0WA 4KH5A 1B9DA 2HHXA 2P9LB 5C12A 1VQ8N 3Q7BA 4FWSA 3SZ2A 4PKGA 4BRKA 1SL0A 3HTVA 2IVNA 1Q9XA 4E0DA 3HL8A 3QETA 3TSQA 2W41A 3OBWA 3LPUA 4DMNA 4NO7A 1BISA 3SAFA 3TAGA 1JLQA 4DV3K 5F0XA 1LWFA 4V19S 1YITN 4N47A 1KRPA 1S9GA 1RTIA 2XY5A 4BC5A 4E3SA 2HSTA 4DUYK 3UKUB 4PL7A 3CCLN 4CHQA 3C6AA 3ENBA 4LD0A 2RKIA 2P5GA 4NCGA 1N32K 5I42A 5CYQA 1LW2A 3ZSRA 4QS8A 1ASWA 3AVLA 2NRTA 5AQKA 4DG1A 4RW4A 2AP1A 3LANA 2AA4A 2YHXA 1Q81O 5AQYA 2G8KA 1S72N 5I3UA 4DF4A 1LWEA 3O4NA 5KGWA 3K59A 4FJIA 4L3QA 3OYLA 4CK2A 3H08A 2QI2A 4IBNA 4FZXC 3R1XA 3EKSA 4CEBA 1E4FT 3IKMA 3OS1A 3GL1A 3DLKA 3SMPA 1EWQA 3T69A 1K73O 2YNGA 3BP8A 4PKIA 4B9VA 1JXBA 4EHUA 3CERA 3FFIA 4CF2A 4EHTA 3N4PA 4FJNA 4HUEA 4JD2A 4A59A 2E2OA 4Z0UA 3L0QA 4Z4FA 1K8KB 2BH1A 4RW9A 4LF4K 1ZBSA 3SQ0A 3AGRA 3AA2A 3D2FB 1QQMA 4Y1DA 3I0RA 4CF9A 1YI2N 4RTFD 5FPDA 3QO9A 3V9ZA 1VSEA 3O4QA 3T7ZA 3VPZA 2WC9A 4FWQA 3DXKA 3VQPA 3P4IA 4ISFA 2NRXA 5BN9A 3KLHA 3HM9A 2P5OA 3QINA 3TAPA 3OS0A 5J2PA 1C1AA 1W9HA 1RTJA 4U67L 2FC0A 3Q7CA 4R5PA 1VQMN 2O8EA 4UQGA 3ZX0A 1VQ6N 2P9NA 3SV4A 3DJCA 3ISNC 3LWMA 1YIJN 4K8XA 4FWPA 3U4LA 3V6DA 1VRUA 2EWSA 2HMPA 3S41A 4B1YB 1KQSM 1Y64A 4CFCA 3L4QA 2G8WA 4M3TA 4JI2K 4F3TA 5AQTA 4Z4IA 1S9EA 2O8FA 2D0AA 2B4JA 4FLTA 5BRHA 1P90A 1HYSA 4H0VB 4JI6K 1NKCA 1L5UA 2OPPA 4JHDA 2E2QA 3K2PA 3E66A 3LM9A 5GIPA 2QEXN 4M41A 1S5JA 3JAMO 4DTMA 4CZKA 1Z25A 4FOIA 4PUOA 2O8CA 3IMXA 5A2QO 4E7LA 4CJFA 3SQ2A 4ID5A 4DS4A 3CQ8A 1ILYA 2D1KA 3OW2M 3DLHA 1JKHA 2BGGA 5BN8A 4FJXA 1BI4A 3PIOL 5JLHA 3H3OB 4BRNA 4H8KA 4CD1A 1HRHA 3VESA 4KHUA 2VGNA 4DQ8A 3ZSYA 4J2EA 3AO2A 4QOZB 2W6LA 3FZFA 1D9DA 1XC3A 3TR8A 1UWBA 3GG4A 2ETJA 2YJFA 4Z4HA 3OA9A 3BGRA 4XEIA 1Q82O 2A41A 2X74A 1KVAA 1J5OA 4KV8A 4ELVA 3CHWA 4H5WA 3HO1A 3EE9A 4FJLA 4MLHA 5AQJA 4AH9A 1XNRK 4CIGA 3RRHA 3NH2A 3M1FA 4B9UA 3J80O 4CGHA 1KAZA 1KLNA 1X9MA 5M1QA 2JLEA 2WTUA 3R8EA 5M1FA 4YY3K 3EZ5A 4B3MK 3DOKA 1VQ5N 4CFAA 2HNDA 4LF9K 3OYAA 2QK9A 3ASMA 4DTPA 4B9SA 1JLBA 3HYFA 2WUSA 1EP4A 2ZF5O 3L2QA 1NGFA 1HPMA 4JKHA 3ZCMA 4DS5A 3AVKA 1RFQA 4M3UA 2GWJA 5EXWA 3N4QA 4I2PA 4O44A 3ZT1A 1HQEA 4WYBA 3AA4A 3VN5A 2ASOA 3O9QA 1XHXA 5EOYA 4CIFA 4DSJA 1J5EK 3P39A 4B1ZA 3BEXA 4FVMA 4LSLA 3MN5A 4B3TK 4J2DA 1MU2A 3MEEA 4DU3A 4FLVA 3SI6A 1R0AA 4FM0A 1ITGA 4CESA 5GINA 3CCRN 2KW4A 1GOCA 1N33K 4OPHA 2FXUA 2CGKA 1W7AA 1VSKA 4YORA 5J1EA 4ZTJA 4AHUA 2E8AA 3DRRA 3ENHA 4KTZA 4KB1A 4CHPA 1C0UA 3HPGA 2WOMA 3QEWA 4FJ7A 4EP4A 2IVPA 1Q7YO 3DXMA 4WCEL 1HNIA 4JKFA 4CHZA 4AQYK 3T3FA 3C95A 5JICA 3QICA 3SK3A 1P8ZA 5FROA 3HOSA 3VQ9A 1BU6O 3MX2A 3LAKA 4NXNK 3OTOK 4ELTA 3IUCA 3HPHA 5JS2A 1XHZA 4ILGB 2Z1IA 4FLUA 1JJ2M 3FLCO 3U3GA 2GELA 3LM2A 3PLAA 4DKWA 4FWNA 4Q5VA 5BPNA 4O5BA 1NJYA 3HBTA 3LALA 2Z1JA 4CF1A 3R3LA 1VSMA 4QS9A 1KXPA 3DLEA 3KK1A 1TK8A 2ZGZA 4DR4K 1QSYA 3PO4A 1S1WA 4O4GA 4W5QA 4JI4K 2E2PA 3VF4A 3NF7A 1GLDG 3AVAA 4BROA 4FLYA 4LH5A 1IBKK 3KKSA 3EL2A 4DTOA 1NG9A 4CGDA 2ZQBA 4CZLA 1HNXK 4M7YA 4HTLA 1KFSA 1U04A 1U2VA 3J81O 2IDOA 2J4RA 1TUYA 4JKDA 3DWLA 3OYJA 3SV3A 4DR6K 5HRPA 4JN4A 4BREA 5AR0A 1J53A 2V7ZA 3CC4N 5M1OA 1RT5A 1QQCA 4YOWA 1GLFO 1VSJA 2OPQA 3EEQA 2D4WA 4HTUA 4IKFA 2PYLA 3ZLJA 1WAFA 1XC9A 4N76A 4CGFA 2F8SA 3ZT4A 3GOIA 3THYA 1QZ6A 1OH7A 3TARA 4B8CA 2PFUA 4KTWA 4WQ4C 4IOXA 2JWKA 1YJWN 3L2RA 3T1AA 1U48A 5EY4A 1A5VA 2HMIA 4BR7A 3CETA 3SJHA 3VEZA 1GOAA 3V1QA 5C0YA 3D2EA 1ZBIA 3CC2N 2EX3A 2D0BA 1WN7A 1YTUA 4MLEA 1G99A 3CFRA 2QKBA 3CM6A 4CJTA 1IH7A 1L3UA 4F3OA 5M1KA 3RMBA 1CLQA 4DSIA 3O3HA 4JI7K 5B8HA 4CECA 4KI4A 3QNOA 4C23A 3NGZA 3E9LA 3RWUA 3SUOA 2KLAA 2NLXA 2IIRA 1RBUA 4I9LA 4EZ6A 5EU7A 3HJFA 4Y1CA 2YNIA 4FJHA 4A5AA 4CEOA 1T44A 2OCEA 3AVNA 3KLFA 4WQ4A 1REVA 2RPIA 3QBXA 3O9SA 4JKCA 3GBTA 4IG3A 1UOCA 4OKEA 4LF7K 1HJRA 3I0SA 4BE1A 3SQ4A 2P9IA 3VA0A 5DM6L 2NRHA 3VERA 4FCYA 2Q31A 5EX5A 1BIUA 1N6QA 4A2BA 4AHTA 2ZE2A 2ZJQL 1CXUA 1FKOA 1MWMA 4CJLA 3VEXA 3BF1A
chains in the Genus database with same CATH topology
1YITN 4FWMA 4BVOA 4EFHA 5AQMA 4YOYA 3CQXA 4H5NA 1U2VB 3O9UA 4PL8A 4BRAA 5KQ8A 4BC5A 2V52B 4CZHA 1BG3A 3FZMA 2HSTA 4BR5A 3UKUB 3VETA 4PL7A 3CCLN 1KAYA 3C6AA 3ENBA 4JKBA 4M63C 2E2NA 1Z6RA 3QMLA 3D7EO 3CCJN 4H0YB 1NGBA 1NJIO 4QS8A 3NVKA 4QS7A 2NRTA 2QWQA 2E20A 2CH5A 5AQKA 2AP1A 3H1QA 2AA4A 2YHXA 1Q81O 3SMSA 1BOTO 5AQYA 1S72N 3CJ9A 2P9SB 3A0IX 4WFAL 5F2RA 3CCSN 2E1ZA 3E1YA 2NRVA 5E26A 4L3QA 4FO0A 1T3VA 1DKGD 1V4SA 3D2EB 2QI2A 3I56N 3NVMA 3LDOA 3PIPL 1RDWX 5HL7L 1HKBA 4YDUA 1HUXA 3R1XA 5AZIA 4B1VA 3EKSA 1E4FT 3VENA 3HM8A 2RE2A 3IKMA 3RSEB 4JK7A 3GL1A 4CBUA 3KWIA 3WUHA 1SQKA 3SMPA 3JXUA 3DAWA 3T69A 2D0PA 3RVCA 4CZJA 1K73O 3VEXA 4UY8O 3ZETA 3BP8A 4PKIA 4CBXA 1D4XA 4EHUA 3CERA 5AZJA 4EHTA 3N4PA 3CPWM 1NGDA 1TYQA 5LJWA 2F7TA 4JD2A 4BRMA 3W3DA 4A59A 3O08A 1WUAA 2E2OA 3O8MA 3L0QA 1YAGA 4AM7A 4H03B 4H0TB 4PHTX 2QA4N 1K8KB 2BH1A 1ZBSA 3ULEB 4WFNL 4BR9A 3AGRA 2HF4A 3D2FB 4H0OA 1U6ZA 3M5RA 1QQMA 1BUPA 4CI6A 1YI2N 3LDQA 2BUPA 4RTFD 4ILJA 1VQPN 5FPDA 3CIPA 5FPNA 2P9IB 3I33A 5FPMA 3T7ZA 1W2BM 4F9OA 3VPZA 5JMVA 3WXIA 3A8YA 2WC9A 4FWQA 3SAGA 5C10A 4YOVA 3DXKA 1JCEA 3WEEB 3CJCA 3MCPA 1O13A 2HBMA 3P4IA 4GVEA 5CR4A 3CXCM 3KWGA 2Q97A 4ISFA 4GY2B 2NRXA 2P9PB 5BN9A 5KPZA 5KPRA 3IDHA 1VAZA 4ISGA 3WQTA 1SAZA 3LL3A 1HKGA 3VGMA 4H5TA 4U67L 4MO4A 4KBOA 4FVUA 1N8RO 3Q7CA 1VQMN 1C0FA 3KVGA 3VMFB 3FE1A 1E4GT 4BGAA 3SAHA 3ZX0A 1VQ6N 2P9NA 1ATNA 3F9MA 3J7ZO 3WXKA 3DJCA 2Q0RA 4IEEA 2YJEA 4IJNA 4E1JA 4C1NK 1VQON 2Q1NA 2ZJPL 2Q36A 1YIJN 4AF1A 4FWPA 3AGKA 3U4LA 5AQHA 1VQ9N 2QTDA 4A2AA 4KH6A 1BA1A 3CF5L 2QW9A 4GV3A 2EWSA 2YHYA 3ID6A 5GAEP 2BTFA 5AQQA 2HMPA 5TKYA 1VQKN 3HI0A 3S41A 4B1YB 1KQSM 3VOVA 1Y64A 1DEJA 3L4QA 2F9TA 4MDAA 4EIAA 4R79A 5AQTA 5AZIB 2QWOA 5AQIA 5BRHA 1P90A 2VCPA 3CI5A 3G6EN 4H0VB 3UB5A 4JHDA 3BF3A 1RDUA 2E2QA 1ZC6A 2NRZA 1C0GA 2Q0UA 5DM7L 3E66A 1M90O 4NLBA 3LM9A 1NGEA 4GNIA 4B1WB 4C1NI 3MN6A 5GIPA 2ZJRL 5AQLA 2UYTA 3JS6A 5AQFA 3U8XA 2QEXN 4GV6A 3CCMN 4CZKA 4FOIA 1GLEG 1TYQB 3H46O 3P31A 3QBWA 2FLOA 4JD2B 1ESVA 3IMXA 3TTFA 3L6QA 3R6MA 2FF3B 2PBDA 2P9UA 1NGJA 2V51B 1ILYA 3C65A 5C2FA 2D1KA 2HOEA 4JAXA 4NLCA 3OW2M 1QVFM 3WT0A 2GTDA 2YHWA 5BN8A 3C7NA 2ASPA 3PIOL 5JLHA 5AFUA 3H3OB 4BRNA 4CBWA 5F1XA 1NM1A 4JKGA 4H0XB 2A3ZA 4CD1A 1QQOA 2HBJA 5ADXA 2GX9A 3VESA 2VGNA 4DQ8A 3GE1A 2CGLA 2ZGYA 3CJAA 4AM6A 4BRPA 3O9RA 4K43A 5M1PA 1OVYA 3FZFA 4RCHA 5AQRA 3SBGA 1XC3A 1XUPO 3GG4A 5C15A 3IFRA 5AQZA 5AQWA 5AQVA 3VGKA 2YJFA 3ZEUA 2P9KA 2QWMA 3OA9A 4A57A 2KHOA 3AAQA 1RGIA 4XEIA 3CCEN 1Q82O 3EO3A 3MDQA 2A41A 3F2KA 3A5NC 1HLUA 1HX1A 4BVPA 1YHQN 3CHWA 4H5WA 2W40A 4JEPA 3A5OC 4OPAA 3EE9A 2A5XA 4YOTA 5LJVA 4MLHA 5AQJA 4DCHA 3CD6N 4IDHA 4BQZA 1K9MO 3U9DA 3M1FA 3O80A 2P9NB 4K41A 5KPTA 2HBLA 1KAZA 1DT9A 1ZXOA 3I8BA 4NB4A 3K9KA 5M1QA 3LDLA 2A42A 2PAVA 4FWLA 3ZYYX 1Q86O 4DHYA 3R8EA 2NNWA 5M1FA 3I55N 1BWFO 1YF5L 1BA0A 3AARA 3FR0A 3VEYA 2GUPA 3MN7A 1LCUA 1VQ5N 4G9ZA 4Z94A 2JWLA 4I6MA 2QWNA 2WFBA 1NBWA 1NWKA 4FPAA 3W0LA 3O4WA 1QHAA 4IFEA 4ISEA 4FOEA 4BQLA 4BY9C 4M7XA 3M6GA 4BRGA 1NMDA 2WUSA 1JCFA 4IEIA 2ZF5O 2E1YA 2NZTA 1NGFA 2H3GX 4FL9A 4XH5A 1HPMA 2FSJA 2F9WA 4JKHA 1TUUA 1OKJA 2P9SA 1S22A 1HKCA 1NGAA 4JHDB 1RFQA 3CCUN 4BR0A 3U9ZA 4BRCA 1X3MA 2GWJA 3ZX2A 3HOTA 4BG9A 5EXWA 3N4QA 5FPEA 4IOAL 3L4IA 4H5VA 3TSPA 4FSVA 3VTHA 4BC2A 4WYBA 3SLCA 2FF6A 4FWKA 3KK7A 2ASOA 2WBNA 3O9QA 5EOYA 3ENOA 3P38A 5AQUA 2QWRA 1X3NA 5JLFA 3P39A 4B1ZA 2RHKA 2P9UB 1BO5O 3BEXA 3MN5A 4IJAA 4LC9B 3VEOA 3WXJA 2ASMA 3C7NB 3CJ7A 4O5FA 2A6AA 5CHIA 5GINA 3CCRN 3VF6A 4BC3A 5BPLA 3G71N 4BRLA 4OPHA 4IXCA 1VQNN 3ZX3A 5EVZA 2FXUA 4WF9L 2CGKA 2QXLA 5AFUH 4YORA 4RWTA 1J6ZA 3CC7N 2E8AA 2Q2RA 3QFUA 5E84A 3EN9A 1GLLO 3ENHA 3VEWA 4GV9A 1ATSA 3F5TA 2CH6A 1V4TA 3VF2A 4B1XB 4DB3A 5ADXH 2D0OA 5BRFA 2IVPA 3ZEUB 1Q7YO 2P9KB 4HWIA 3DXMA 3KZBA 2YI1A 3O5BA 4WCEL 4JKFA 1KC8O 2E88A 2KKZA 1NGGA 5AQOA 3ZETB 4WQ5C 1MA9B 5AQPA 5JICA 3B8AX 3QICA 4YDUC 1P8ZA 3SK3A 1EQYA 5AZJB 3CQYA 5BREA 3HOSA 1VQ4N 1T6DA 1BU6O 3AAPA 4BC4A 3MX2A 4JK9A 3CJBA 5MLCQ 2YX6A 3TPQA 3LDPA 1X9JA 3IUCA 3K9JA 3WXMB 4ILGB 3QFPA 5BRDA 3E9PA 4H5RA 3O6WA 3D6RA 5KQDA 1YJ9N 3H6EA 1T6CA 1YUWA 3CMAN 3FLCO 3UE5A 1JJ2M 2GELA 4ILHA 2OTJN 1EO1A 2P9PA 3LM2A 1GLBG 3KHYA 4K42A 3EE8A 2VGMA 3PLAA 4DKWA 1HJOA 4CZMA 4FWNA 2GEMA 2HF3A 4CJ7A 3C6HA 5BPNA 3MWPA 3MCAB 3MK6A 3QDKA 3HBTA 3O1BA 3VEVA 1YJNN 3TU5A 3TSUA 4WFBL 2DPNA 3R3LA 1BDGA 4QS9A 4I6MB 3UKRA 3BUZB 4BRHA 1KXPA 2FSKA 3FZLA 2ZGZA 1KD1O 4IWVA 1SZ2A 2P9LA 3DXKB 1NGCA 3HZ6A 2V7YA 4BGBA 3OBYA 4BG8A 3ID8A 3VTIA 1VQ7N 5TKWA 4MDBA 1LOTB 2E2PA 4IZ9A 3FZHA 4O8UA 3SBTA 3G4SN 3VF4A 4CZEA 3MWTA 5BR9A 1GLDG 4BROA 5M1NA 2OANA 4EAHD 5GADP 4OO1J 4XH4A 3H3NO 1GLAG 3AY9A 3CPEA 5H1SQ 3EL2A 4WQ5A 5I9EB 5AQNA 4CZLA 5AQSA 4A61A 3MX5A 4A5BA 1MDUB 1MWKA 4PKHA 1WOQA 3MN9A 4CZIA 4M7YA 4HTLA 1DGKN 1YXQA 1U2VA 2J4RA 1NGIA 1TUYA 5AQXA 4FWRA 4JKDA 3DWLA 5LY3A 3EKUA 4JN4A 4BREA 5AR0A 2V7ZA 3UKUA 4BRDA 3CC4N 5M1OA 1W97L 4YOWA 2IVOA 1GLFO 2D4WA 2OTLN 2ZWHA 4XH1A 1Q18A 3QB0A 5AQGA 3GOIA 4JKEA 4BRFA 1QZ6A 1S3XA 1CZAN 3E9OA 2PFUA 4WQ4C 3CCVN 5GAGP 4IOXA 2JWKA 1YJWN 1NGHA 1VQLN 4H0PA 3WXLA 4MO5A 5EY4A 1GLJO 3ATVA 4YOXA 5GIOA 4A62A 4BR7A 3CETA 5CE3A 3DXMB 3J8AA 1R59O 3SJHA 3M3ZA 2QM1A 3VEZA 2QWPA 4KH4A 5C2DA 3NMUA 3WQUA 5C0YA 3D2EA 1QZ5A 2VWBA 3TTDA 4FWOA 4O8KA 3CC2N 1IJJA 2CGJA 4YOUA 1GLCG 4MLEA 1G99A 2VYPA 4K25A 3RSEA 1H1VA 3O9TA 3HRGA 4JKAA 4BRQA 1KAXA 2GWKA 3ATUA 2I7NA 4CZFA 1SS6A 5GAHP 5BPMA 5M1KA 3A5MC 1QQNA 4CZGA 5B8HA 1YVNA 3FFKB 4JK8A 4C23A 4CD3A 5JVGL 3E9LA 5ELZA 2A40A 3O1WA 2KLAA 4IOCL 4JKGB 3FZKA 4IO8A 1QVGM 2NLXA 1NLVA 2IIRA 4J8FA 3A5LC 1Z05A 3H1VX 3LDNA 4B1UB 3CCQN 5JVHL 5HOOA 1K8AO 3CMEN 3C0BA 2QWLA 3MMVA 1M1KO 3UKRB 1K8KA 1IG8A 3R9PA 3ULEA 4IO9L 3H45C 3D2FA 4JNEA 2HBKA 4Y0WA 3VGLA 4KH5A 4A5AA 1JCGA 2P9LB 2NRWA 1T44A 5C12A 3FGUA 1VQ8N 4WQ4A 2FSNA 3Q7BA 2NRRA 4FWSA 4PKGA 4BRKA 1XQSC 3QBXA 3G25A 3HTVA 3GBTA 3O9SA 4JKCA 2IVNA 4U7BA 4BR2A 3TTCA 4BR4A 3TSQA 3DLLL 2P9IA 5DM6L 2NRHA 2W41A 1ATRA 3OBWA 3VERA 4FPBA 2Q31A 2YCHA 5EX5A 4NO7A 3SAFA 3OHRA 4A2BA 3GDQA 5F0XA 4B9QA 3CJ1A 3EZWA 3HSCA 3WEEA 4BRIA 2ZJQL 2ITMA 1MWMA 2I7PA 3BF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWM A;  4BVO A;  4EFH A;  5AQM A;  3CQX A;  4H5N A;  1U2V B;  4PL8 A;  4BRA A;  5KQ8 A;  4BC5 A;  2V52 B;  4CZH A;  1BG3 A;  3FZM A;  4BR5 A;  3UKU B;  3VET A;  4PL7 A;  1KAY A;  4M63 C;  2E2N A;  1Z6R A;  3QML A;  3D7E O;  4H0Y B;  1NGB A;  4QS8 A;  4QS7 A;  2QWQ A;  2E20 A;  2CH5 A;  5AQK A;  2AP1 A;  3H1Q A;  2AA4 A;  2YHX A;  3SMS A;  1BOT O;  5AQY A;  3CJ9 A;  2P9S B;  3A0I X;  5F2R A;  2E1Z A;  5E26 A;  4L3Q A;  4FO0 A;  1DKG D;  1V4S A;  3D2E B;  3LDO A;  1RDW X;  1HKB A;  4YDU A;  1HUX A;  4B1V A;  5AZI A;  3EKS A;  1E4F T;  3VEN A;  3HM8 A;  3RSE B;  3GL1 A;  4CBU A;  3WUH A;  1SQK A;  3SMP A;  3JXU A;  3DAW A;  2D0P A;  4CZJ A;  3VEX A;  3ZET A;  3BP8 A;  4PKI A;  4CBX A;  1D4X A;  4EHU A;  3CER A;  5AZJ A;  4EHT A;  1NGD A;  1TYQ A;  5LJW A;  4JD2 A;  4BRM A;  3W3D A;  3O08 A;  1WUA A;  2E2O A;  3O8M A;  3L0Q A;  1YAG A;  4AM7 A;  4H03 B;  4H0T B;  1K8K B;  1ZBS A;  3ULE B;  4BR9 A;  2HF4 A;  3D2F B;  4H0O A;  1U6Z A;  1QQM A;  1BUP A;  4CI6 A;  3LDQ A;  2BUP A;  4RTF D;  5FPD A;  3CIP A;  5FPN A;  2P9I B;  3I33 A;  5FPM A;  4F9O A;  3VPZ A;  5JMV A;  3WXI A;  3A8Y A;  4FWQ A;  3DXK A;  1JCE A;  3WEE B;  3CJC A;  3MCP A;  3P4I A;  2Q97 A;  4ISF A;  4GY2 B;  5KPZ A;  2P9P B;  5BN9 A;  5KPR A;  3IDH A;  4ISG A;  3WQT A;  1SAZ A;  3LL3 A;  1HKG A;  3VGM A;  4H5T A;  4MO4 A;  4KBO A;  1C0F A;  3KVG A;  3FE1 A;  1E4G T;  4BGA A;  3ZX0 A;  2P9N A;  1ATN A;  3F9M A;  3WXK A;  3DJC A;  2Q0R A;  2YJE A;  4IJN A;  4E1J A;  2Q1N A;  2Q36 A;  4FWP A;  3U4L A;  5AQH A;  4A2A A;  1BA1 A;  2QW9 A;  2EWS A;  2YHY A;  2BTF A;  5AQQ A;  2HMP A;  5TKY A;  3HI0 A;  3S41 A;  4B1Y B;  3VOV A;  1Y64 A;  1DEJ A;  2F9T A;  4EIA A;  5AQT A;  5AZI B;  2QWO A;  5AQI A;  5BRH A;  2VCP A;  3CI5 A;  4H0V B;  3UB5 A;  4JHD A;  3BF3 A;  2E2Q A;  1ZC6 A;  1C0G A;  2Q0U A;  3LM9 A;  1NGE A;  4GNI A;  4B1W B;  3MN6 A;  5AQL A;  2UYT A;  3JS6 A;  5AQF A;  3U8X A;  4CZK A;  4FOI A;  1GLE G;  1TYQ B;  3H46 O;  3QBW A;  2FLO A;  4JD2 B;  1ESV A;  3IMX A;  3L6Q A;  3R6M A;  2FF3 B;  2PBD A;  2P9U A;  1NGJ A;  2V51 B;  2D1K A;  2HOE A;  4JAX A;  3WT0 A;  2GTD A;  2YHW A;  5BN8 A;  3C7N A;  2ASP A;  5JLH A;  5AFU A;  3H3O B;  4BRN A;  4CBW A;  5F1X A;  1NM1 A;  4H0X B;  2A3Z A;  4CD1 A;  1QQO A;  5ADX A;  3VES A;  4DQ8 A;  3GE1 A;  2CGL A;  2ZGY A;  3CJA A;  4AM6 A;  4BRP A;  4K43 A;  3FZF A;  4RCH A;  5AQR A;  1XC3 A;  1XUP O;  3GG4 A;  3IFR A;  5AQZ A;  5AQW A;  5AQV A;  3VGK A;  2YJF A;  3ZEU A;  2P9K A;  2QWM A;  2KHO A;  3AAQ A;  1RGI A;  4XEI A;  3EO3 A;  3MDQ A;  2A41 A;  3A5N C;  1HLU A;  1HX1 A;  4BVP A;  3CHW A;  4H5W A;  2W40 A;  3A5O C;  2A5X A;  5LJV A;  4MLH A;  5AQJ A;  4DCH A;  4BQZ A;  3U9D A;  3M1F A;  3O80 A;  2P9N B;  4K41 A;  5KPT A;  1KAZ A;  1ZXO A;  3I8B A;  4NB4 A;  3LDL A;  2A42 A;  2PAV A;  4FWL A;  4DHY A;  3R8E A;  1BWF O;  3FR0 A;  1BA0 A;  3AAR A;  3VEY A;  2GUP A;  3MN7 A;  1LCU A;  4Z94 A;  4I6M A;  2QWN A;  4FPA A;  1NBW A;  1NWK A;  3W0L A;  3O4W A;  1QHA A;  4ISE A;  4FOE A;  4BQL A;  4M7X A;  3M6G A;  4BRG A;  1NMD A;  2WUS A;  1JCF A;  2ZF5 O;  2E1Y A;  2NZT A;  1NGF A;  2H3G X;  4FL9 A;  4XH5 A;  1HPM A;  2FSJ A;  2F9W A;  1TUU A;  1OKJ A;  2P9S A;  1S22 A;  1HKC A;  1NGA A;  4JHD B;  1RFQ A;  4BR0 A;  3U9Z A;  4BRC A;  1X3M A;  2GWJ A;  3ZX2 A;  4BG9 A;  5EXW A;  5FPE A;  3L4I A;  4H5V A;  4FSV A;  4BC2 A;  4WYB A;  3SLC A;  2FF6 A;  4FWK A;  2ASO A;  5EOY A;  3ENO A;  5AQU A;  2QWR A;  1X3N A;  5JLF A;  4B1Z A;  2P9U B;  1BO5 O;  3BEX A;  3MN5 A;  4IJA A;  4LC9 B;  3VEO A;  3WXJ A;  2ASM A;  3C7N B;  3CJ7 A;  4O5F A;  2A6A A;  3VF6 A;  4BC3 A;  5BPL A;  4BRL A;  4IXC A;  3ZX3 A;  5EVZ A;  2FXU A;  2CGK A;  2QXL A;  5AFU H;  4RWT A;  1J6Z A;  2E8A A;  2Q2R A;  3QFU A;  5E84 A;  3EN9 A;  1GLL O;  3ENH A;  3VEW A;  1ATS A;  2CH6 A;  1V4T A;  3VF2 A;  4B1X B;  4DB3 A;  5ADX H;  2D0O A;  5BRF A;  2IVP A;  3ZEU B;  2P9K B;  4HWI A;  3DXM A;  3KZB A;  2YI1 A;  3O5B A;  2E88 A;  1NGG A;  5AQO A;  3ZET B;  4WQ5 C;  1MA9 B;  5AQP A;  5JIC A;  3B8A X;  3QIC A;  4YDU C;  1P8Z A;  3SK3 A;  1EQY A;  5AZJ B;  3CQY A;  5BRE A;  1T6D A;  1BU6 O;  3AAP A;  4BC4 A;  3CJB A;  3TPQ A;  3LDP A;  1X9J A;  3IUC A;  3QFP A;  5BRD A;  5KQD A;  4H5R A;  3O6W A;  3H6E A;  1T6C A;  1YUW A;  3FLC O;  3UE5 A;  2GEL A;  2P9P A;  3LM2 A;  1GLB G;  3KHY A;  4K42 A;  1HJO A;  4CZM A;  4FWN A;  2GEM A;  2HF3 A;  4CJ7 A;  5BPN A;  3MK6 A;  3QDK A;  3HBT A;  3O1B A;  3VEV A;  3TU5 A;  2DPN A;  4QS9 A;  1BDG A;  4I6M B;  3UKR A;  3BUZ B;  4BRH A;  1KXP A;  2FSK A;  3FZL A;  2ZGZ A;  4IWV A;  1SZ2 A;  2P9L A;  3DXK B;  1NGC A;  3HZ6 A;  2V7Y A;  4BGB A;  4BG8 A;  3ID8 A;  1LOT B;  2E2P A;  4IZ9 A;  3FZH A;  3VF4 A;  4CZE A;  5BR9 A;  1GLD G;  4BRO A;  2OAN A;  4EAH D;  4XH4 A;  3H3N O;  1GLA G;  3AY9 A;  3EL2 A;  4WQ5 A;  5I9E B;  5AQN A;  4CZL A;  5AQS A;  4A61 A;  1MDU B;  1MWK A;  4PKH A;  1WOQ A;  3MN9 A;  4CZI A;  4M7Y A;  4HTL A;  1DGK N;  1YXQ A;  1U2V A;  2J4R A;  1NGI A;  1TUY A;  5AQX A;  4FWR A;  3DWL A;  5LY3 A;  3EKU A;  4JN4 A;  4BRE A;  5AR0 A;  2V7Z A;  3UKU A;  4BRD A;  2IVO A;  1GLF O;  2D4W A;  2ZWH A;  4XH1 A;  1Q18 A;  3QB0 A;  5AQG A;  3GOI A;  4BRF A;  1QZ6 A;  1S3X A;  1CZA N;  4WQ4 C;  1NGH A;  4H0P A;  3WXL A;  4MO5 A;  5EY4 A;  1GLJ O;  3ATV A;  4A62 A;  4BR7 A;  3CET A;  5CE3 A;  3DXM B;  3J8A A;  1R59 O;  3SJH A;  3M3Z A;  2QM1 A;  3VEZ A;  2QWP A;  3WQU A;  3D2E A;  1QZ5 A;  2VWB A;  4FWO A;  4O8K A;  1IJJ A;  2CGJ A;  1GLC G;  4MLE A;  1G99 A;  2VYP A;  4K25 A;  3RSE A;  1H1V A;  4BRQ A;  1KAX A;  2GWK A;  3ATU A;  2I7N A;  4CZF A;  5BPM A;  3A5M C;  1QQN A;  4CZG A;  5B8H A;  1YVN A;  3FFK B;  4C23 A;  4CD3 A;  5ELZ A;  2A40 A;  3O1W A;  3FZK A;  4IO8 A;  2NLX A;  1NLV A;  2IIR A;  4J8F A;  3A5L C;  1Z05 A;  3H1V X;  3LDN A;  4B1U B;  3C0B A;  2QWL A;  3MMV A;  3UKR B;  1K8K A;  1IG8 A;  3R9P A;  3ULE A;  3H45 C;  3D2F A;  4JNE A;  4Y0W A;  3VGL A;  1JCG A;  2P9L B;  1T44 A;  3FGU A;  4WQ4 A;  2FSN A;  4FWS A;  4PKG A;  4BRK A;  1XQS C;  3QBX A;  3G25 A;  3HTV A;  3GBT A;  2IVN A;  4BR2 A;  4BR4 A;  2P9I A;  2NRH A;  2W41 A;  1ATR A;  3VER A;  4FPB A;  2Q31 A;  2YCH A;  5EX5 A;  4NO7 A;  3OHR A;  4A2B A;  3GDQ A;  5F0X A;  4B9Q A;  3CJ1 A;  3EZW A;  3HSC A;  3WEE A;  4BRI A;  2ITM A;  1MWM A;  2I7P A;  3BF1 A; 
#chains in the Genus database with same CATH topology
 1WSI A;  3NE6 A;  1C1C A;  4H5N A;  3ZSO A;  4FZZ A;  1HMV A;  1LV5 A;  1RT7 A;  4CZH A;  3FZM A;  4B9M A;  4BR5 A;  4JKB A;  4M63 C;  2E2N A;  1Z6R A;  4E7H A;  1KCF A;  2ZD1 A;  4QS7 A;  2QWQ A;  2CH5 A;  1JLA A;  1U45 A;  3SMS A;  5C25 A;  5LMU K;  2P9S B;  4WFA L;  4JI3 K;  3J7Y P;  3TAF A;  1VSF A;  1L3S A;  3NHG A;  3I56 N;  1X9S A;  1TKD A;  3LDO A;  3PIP L;  1RDW X;  4YDU A;  4B1V A;  1HUX A;  4CGI A;  5KRS A;  5FRM A;  3TI0 A;  1ASU A;  3HM8 A;  2RE2 A;  3RSE B;  4JK7 A;  1TKZ A;  3VQ5 A;  4CZJ A;  4F2R A;  4F4K A;  4Z4G A;  5AZJ A;  3CPW M;  4JLH A;  1NGD A;  3VQ8 A;  1TYQ A;  2F7T A;  2LSN A;  3W3D A;  1RTH A;  4CGJ A;  4AM7 A;  4DTR A;  3AVJ A;  3ZSQ A;  4DFP A;  2BDP A;  4HUF A;  4FJ5 A;  1T05 A;  4DR5 K;  4ILJ A;  1VQP N;  4DQI A;  4X66 K;  3WNH A;  2F4V K;  3A8Y A;  5SWM A;  4CK1 A;  4X64 K;  1UAX A;  3M8Q A;  2NUB A;  5FRN A;  3DM2 A;  5CR4 A;  4GVE A;  4J2B A;  4NCB A;  1VAZ A;  3LZI A;  3S9H A;  3CFP A;  3LL3 A;  1HKG A;  3VGM A;  1KVB A;  4E7K A;  3K5M A;  3KVG A;  1S1V A;  5AJ3 K;  3FE1 A;  3C6T A;  3OYI A;  3VQ6 A;  2Q1N A;  2ZJP L;  2Q36 A;  2UXC K;  1SUQ A;  4AF1 A;  3IRX A;  4CJQ A;  3D45 A;  1C0M A;  4ZHR A;  3THX A;  4A2A A;  1BA1 A;  3LPT A;  1KTQ A;  3CF5 L;  4GV3 A;  2D5R A;  5GAE P;  3DRS A;  5AQQ A;  4B9T A;  2FBT A;  4EIA A;  1JXE A;  1S6Q A;  3AVB A;  3G6E N;  1RDU A;  2NRZ A;  3HVR A;  2Q0U A;  2O4I A;  4NLB A;  4C1N I;  4B1W B;  4GNI A;  1RNH A;  4IG0 A;  3KK2 A;  4FYD A;  3CCM N;  3V4I A;  1GLE G;  3QBW A;  3TTF A;  4JD2 B;  1ESV A;  3L6Q A;  3TAQ A;  2FF3 B;  3BZC A;  3JYT A;  3C65 A;  1NK7 A;  2HOE A;  4KHQ A;  1QVF M;  3WT0 A;  2GTD A;  2YHW A;  3AVM A;  2ASP A;  3L3U A;  4B3R K;  4DU1 A;  4JKG A;  5JS1 A;  3VA3 A;  1RT3 A;  1QQO A;  2HBJ A;  3F73 A;  4HHT A;  3SYZ A;  3GE1 A;  2ZGY A;  4AM6 A;  4BRP A;  3BY5 A;  1XUP O;  1IO2 A;  4ZTF A;  3IFR A;  5AQW A;  3VGK A;  5AQV A;  3ZT2 A;  3PX0 A;  3ZEU A;  3AAQ A;  1RGI A;  1CXQ A;  4LFC K;  3EO3 A;  3A5N C;  4BVP A;  4FZY A;  2W40 A;  3BDP A;  3A5O C;  4OPA A;  5LJV A;  3CD6 N;  1K9M O;  2O8E B;  3NF6 A;  2P9N B;  3ZSZ A;  1XI1 A;  4OGE A;  2HBL A;  2KZM A;  1DT9 A;  4NB4 A;  1C6V A;  2KZZ A;  4FLX A;  3SNN A;  3LDL A;  2PAV A;  1FXX A;  3OJS A;  2AJQ A;  4E1N A;  2ATQ A;  4C8K A;  1JLC A;  3FR0 A;  1BA0 A;  4O0J A;  3VEY A;  3PV8 A;  2OYQ A;  1UA0 A;  4JI0 K;  1LCU A;  1VSD A;  4Z94 A;  4I6M A;  1NWK A;  1N34 K;  3O4W A;  1QHA A;  2IGI A;  4DTJ A;  4ISE A;  3M6G A;  4CEF A;  2E1Y A;  2O8F B;  3P83 D;  1BGX T;  3THW A;  1EKE A;  1QTM A;  4E7J A;  1HKC A;  4JHD B;  1X3M A;  3HOT A;  1TK5 A;  1JLF A;  2O4G A;  3AVF A;  3TAB A;  3L4I A;  4J2A A;  4FSV A;  3VTH A;  3K0S A;  1NK9 A;  5HLF A;  3KK7 A;  3ENO A;  4GMJ B;  5AQU A;  2O8C B;  5JLF A;  1S1T A;  4CJS A;  4KRF A;  1S1U A;  4LC9 B;  5IWA K;  2ASM A;  4RW7 A;  1TKX A;  3MAQ A;  1BI4 B;  2A6A A;  1C0T A;  2KFZ A;  2DTU A;  2R7Y A;  1S1X A;  3VF6 A;  4BC3 A;  4KHP K;  2B6A A;  3OYF A;  4BRL A;  3C94 A;  5EVZ A;  4E1M A;  3S3M A;  1NNE A;  3C6U A;  3RMC A;  4RWT A;  1XMO K;  4ICL A;  3EN9 A;  1ZYQ A;  1RIL A;  1ATS A;  4RW8 A;  3HPO A;  2I5J A;  1L3V A;  1QHT A;  4B1X B;  1WBB A;  4JI1 K;  2Y1J A;  5BRF A;  2OZS A;  1WSJ A;  4HWI A;  4DUZ K;  2E88 A;  1OH8 A;  1EXQ A;  3LP2 A;  5AQO A;  3ZET B;  1CZ9 A;  2F96 A;  5BRE A;  1EQY A;  3AAP A;  4JK9 A;  4DSE A;  5KQD A;  5BRD A;  3E9P A;  3D6R A;  1T6C A;  3CMA N;  3UE5 A;  3MXM A;  1GLB G;  5LMN K;  2VGM A;  4KI6 A;  2GEM A;  3DMJ A;  2HF3 A;  4CJ7 A;  2HHS A;  2E5L K;  1WB9 A;  1WSG A;  3MCA B;  3QNN A;  4DF8 A;  5HP1 A;  4CJ4 A;  3MXJ A;  3UKR A;  1RT4 A;  1I39 A;  1OH5 A;  3RR8 A;  1HYV A;  4CJ3 A;  1KD1 O;  4IWV A;  1SZ2 A;  1NGC A;  2BAN A;  2F8T A;  4F2S A;  3OBY A;  1VQ7 N;  4PA1 A;  1K6Y A;  4O8U A;  4IZ9 A;  3SBT A;  3FZH A;  4CZE A;  4OO1 J;  4XH4 A;  2HVH A;  1GLA G;  3AY9 A;  5H1S Q;  4CJR A;  5I9E B;  1RTD A;  3MEC A;  5AQN A;  4BAC A;  4A5B A;  1MDU B;  4DR3 K;  3AVI A;  4OLA A;  1U4B A;  3QEV A;  1YXQ A;  1RBV A;  3MEG A;  1XNQ K;  5LY3 A;  3HP9 A;  1RDA A;  3EKU A;  1W97 L;  2IVO A;  1VSH A;  2OPR A;  2E6L A;  2OTL N;  1IV0 A;  1Q18 A;  3QB0 A;  4CJV A;  4LF5 K;  4CIE A;  4CJ5 A;  3SUN A;  4CED A;  3HVT A;  3QEX A;  4YOX A;  4MO5 A;  1GLJ O;  2FBV A;  5CE3 A;  3DXM B;  4B9L A;  1R59 O;  3VQ7 A;  3LZJ A;  1TK0 A;  3MED A;  1BQM A;  3NMU A;  4FWO A;  5D3G A;  1IJJ A;  2CGJ A;  1GLC G;  2VYP A;  4FK0 A;  3U3Y A;  4CW7 B;  3ATU A;  1TVR A;  2I7N A;  4CZF A;  4AIL C;  5GAH P;  3A5M C;  4CZG A;  4C8O A;  1YVN A;  1DTQ A;  4W5O A;  4IOC L;  3DI6 A;  4RG8 A;  3FZK A;  4IO8 A;  4H4M A;  3PX4 A;  3H1V X;  1Z05 A;  3CCQ N;  5JVH L;  4C8N A;  2IC3 A;  3IS9 A;  5HOO A;  3C0B A;  1M1K O;  2HVI A;  3QEI A;  3ULE A;  2HBK A;  2YV0 X;  4N5S A;  1JCG A;  1D8Y A;  2DFF A;  2NRR A;  1XQS C;  2IS3 A;  3G25 A;  1J9A A;  4U7B A;  4BR2 A;  3TTC A;  4BR4 A;  4LFA K;  3DLL L;  3SCX A;  1ATR A;  4FPB A;  2YCH A;  1NK6 A;  4BRI A;  3EZW A;  3HSC A;  3WEE A;  5HRS A;  2HHQ A;  2ITM A;  4OLB A;  2I7P A;  3K5L A;  3V9U A;  1WAJ A;  4FWM A;  3ITH A;  4BVO A;  4EFH A;  3CQX A;  1IKV A;  1U2V B;  5KQ8 A;  4W5R A;  3QIO A;  1BG3 A;  3VET A;  4IFV A;  4CHO A;  4H0Y B;  3OS2 A;  4DLG A;  3KLE A;  1NJI O;  3RMA A;  3AVC A;  3THY B;  3DLG A;  3L3V A;  2DFE A;  4LF8 K;  3DLR A;  1IKW A;  3A2F A;  4CK3 A;  2UU9 K;  4E19 A;  2XRI A;  4OPJ A;  1BOT O;  3KIO A;  4KHN A;  3HXM A;  3A0I X;  1LAV A;  3KK3 A;  2E1Z A;  5C24 A;  4KB0 A;  3KJV A;  2NRV A;  5E26 A;  4FO0 A;  1T3V A;  1DKG D;  1RBR A;  5LL6 Z;  1V4S A;  1SV5 A;  3D2E B;  4EZ9 A;  4OKJ A;  2HNZ A;  3OYM A;  1T8E A;  5AZI A;  1JLE A;  4CBU A;  3BZK A;  3KWI A;  3WUH A;  4CEE A;  4M42 A;  4N41 A;  3JXU A;  3DAW A;  4CHY A;  3RVC A;  1D4X A;  2GUI A;  4DFM A;  1FJG K;  1YT3 A;  4Z4C A;  1FW6 A;  2YKM A;  4BRM A;  3O08 A;  1IKX A;  1WUA A;  1Q9Y A;  2P1J A;  4H03 B;  4H0T B;  2QA4 N;  1EX4 A;  3T1Y K;  2HB5 A;  2HF4 A;  3M5R A;  1BUP A;  3QLH A;  1X9W A;  3J7A P;  3LDQ A;  2BUP A;  3OY9 A;  4NYN A;  4MQ3 A;  5K14 A;  4PWD A;  3CIP A;  1LW0 A;  5FPN A;  2P9I B;  3I33 A;  1W2B M;  1WSE A;  4F9O A;  5JMV A;  3WXI A;  1ZBH A;  1N36 K;  4M3R A;  5C10 A;  3B6P A;  4LY7 A;  4CHN A;  1JCE A;  3LP1 A;  1RT6 A;  4QAG A;  3CXC M;  5KPR A;  2P9P B;  3IDH A;  4ISG A;  3S3N A;  3AA5 X;  4MO4 A;  4KBO A;  4FVU A;  2O8B A;  4DQQ A;  1HQU A;  3OYG A;  3VMF B;  3SAH A;  4PY5 A;  3AVH A;  1ATN A;  3J7Z O;  4CJP A;  2Q0R A;  4IEE A;  4IJN A;  4C1N K;  3VQD A;  1VQO N;  2KQ2 A;  3TAM A;  5AQH A;  1VQ9 N;  4KH6 A;  5CYM A;  3V9W A;  2QW9 A;  1FKP A;  2YHY A;  3ID6 A;  4DQP A;  2BTF A;  1HNV A;  4M45 A;  3T1H K;  3VOV A;  1DEJ A;  2X6S A;  3KKR A;  4MDA A;  4R79 A;  3JSM A;  1E3M A;  4CJK A;  3OYE A;  2QWO A;  5AQI A;  3O3G A;  4CFB A;  1QS4 A;  3CI5 A;  3VQE A;  5CZ2 A;  3RMD A;  4QCL A;  1ZC6 A;  3ZT3 A;  5AQF A;  3JS6 A;  3U8X A;  1TYQ B;  3H46 O;  3NCI A;  3R6M A;  1ZBU A;  2P9U A;  1NGJ A;  2V51 B;  5C2F A;  2OA8 A;  5DMR A;  4BDP A;  3C7N A;  1BIZ A;  5AFU A;  4DFK A;  1NM1 A;  4CJW A;  4H0X B;  4ELU A;  4YHH K;  4DWI A;  5ADX A;  3E01 A;  1OVY A;  4RCH A;  2W6K A;  4DV6 K;  1RDD A;  3QIP A;  3SBG A;  2ZM6 K;  3EYZ A;  4DTN A;  5C15 A;  2XY7 A;  5AQZ A;  2G8H A;  3QEP A;  2P9K A;  2QWM A;  2ITG A;  4A57 A;  2KHO A;  3CCE N;  4W5N A;  3T19 A;  5KI6 A;  4FW1 A;  4B3S K;  4X62 K;  4FJM A;  2WON A;  2Q3S A;  5KGX A;  3ULD A;  4IDH A;  4BQZ A;  1HNW K;  1RT2 A;  3V9S A;  3CG7 A;  3RRG A;  1ZXO A;  3I8B A;  1NJZ A;  3ZYY X;  1Q86 O;  3HP6 A;  4FJJ A;  4JV5 K;  3I55 N;  4KAZ A;  2YKN A;  4FJ9 A;  3THX B;  4G9Z A;  4BWJ A;  4FPA A;  3W0L A;  4DV7 K;  3OVN A;  2P51 A;  4BQL A;  3G0Z A;  4M7X A;  1HR0 K;  4BRG A;  1NMD A;  1JL1 A;  1NK5 A;  5HBM A;  3EY1 A;  2FSJ A;  1FK9 A;  1TUU A;  2P9S A;  3OYD A;  3IG1 A;  1NGA A;  2O8D A;  4BR0 A;  1OH6 A;  3U9Z A;  4BG9 A;  5FPE A;  4TSX A;  3LDS A;  2XY6 A;  4IOA L;  4JRQ A;  4H5V A;  3TSP A;  1SL1 A;  3SLC A;  1WNS A;  2FF6 A;  4FWK A;  3AO5 A;  2WBN A;  1RCH A;  1VRT A;  4HUG A;  4CJE A;  1TKT A;  1BO5 O;  3WXJ A;  3CJ7 A;  5CHI A;  2BE2 A;  4AHC A;  2QXL A;  1VK0 A;  1WSF A;  3SPY A;  1J6Z A;  3CC7 N;  2Q2R A;  1S6P A;  5E84 A;  2YHA A;  1GLL O;  3VEW A;  4LFB K;  3V1O A;  3U6F A;  4GV9 A;  3F5T A;  2CH6 A;  1V4T A;  1T03 A;  3K5O A;  3ZEU B;  3KZB A;  4GW6 A;  3O5B A;  3NGY A;  4PQU A;  1L3T A;  1NGG A;  4WQ5 C;  1MA9 B;  3K5N A;  3B8A X;  3M8P A;  4NCA A;  4N56 A;  1X1P A;  1VQ4 N;  1EWR A;  4BC4 A;  3CJB A;  5MLC Q;  2YX6 A;  4KFB A;  3LDP A;  1X9J A;  3WXM B;  3PY8 A;  3D0P A;  1JL2 A;  4H5R A;  2OTJ N;  4ILH A;  1EO1 A;  2JGU A;  1TAU A;  3EE8 A;  1HJO A;  4CZM A;  2W42 A;  2XHB A;  5HRN A;  1TV6 A;  3MWP A;  3MK6 A;  2VWJ A;  5HRR A;  1QSL A;  2Z1G A;  3O1B A;  3VEV A;  4JYA K;  3CM5 A;  3TU5 A;  4WFB L;  2DPN A;  1YVU A;  4I6M B;  5IT9 O;  1DTT A;  3OYB A;  3BUZ B;  4DV4 K;  2FSK A;  1TGO A;  1TL1 A;  2D0C A;  2GV9 A;  2P9L A;  3DXK B;  2V7Y A;  3V9X A;  1CZB A;  4BG8 A;  3VTI A;  3THW B;  5TKW A;  3I8D A;  1LOT B;  3G4S N;  3K57 A;  3MWT A;  5GAD P;  2OAN A;  1Y97 A;  4EAH D;  4DSK A;  3H3N O;  4Z4E A;  2FBX A;  4DLE A;  3CPE A;  4KHW A;  4WQ5 A;  2OZM A;  1QSS A;  4KKO A;  5DK5 A;  4FXD A;  1T7P A;  3OYN A;  2VG7 A;  1MWK A;  1WOQ A;  4CZI A;  1I3A A;  3ZSX A;  1DGK N;  2DY4 A;  3NBP A;  4FM2 A;  3V81 A;  5AQX A;  3THV A;  4FWR A;  3PSF A;  4BDZ A;  1SKW A;  3UKU A;  4BRD A;  4CE9 A;  3KTQ A;  2VG6 A;  4OKK A;  1ASV A;  3ALY A;  1IBM K;  3LP3 A;  4BRF A;  1CZA N;  3CCV N;  5GAG P;  3CFO A;  1VQL N;  4H0P A;  4M3Y A;  4Q0B A;  3VQ4 A;  5GIO A;  2A1S A;  1KSP A;  2VG5 A;  5SZT A;  3PSI A;  3L8B A;  1N5Y A;  1QZ5 A;  2VWB A;  4DSF A;  4MFB A;  4O8K A;  4DR1 K;  4YOU A;  1OVQ A;  2E6M A;  5C42 A;  4K25 A;  4DSL A;  4CF8 A;  1H1V A;  3O9T A;  5J2M A;  1KAX A;  2GWK A;  4DR2 K;  4EP5 A;  3MXI A;  3FFK B;  4CD3 A;  2RF2 A;  4HVJ A;  3NFA A;  5ELZ A;  3O1W A;  4XIU A;  3M8R A;  3VQB A;  1XMQ K;  1JLG A;  3LDN A;  3ZSV A;  3CME N;  1VSL A;  2QWL A;  1YTA A;  3UKR B;  1K8K A;  2UUB K;  3R9P A;  1QE1 A;  4YNQ A;  3DLB A;  3H45 C;  3D2F A;  3F9K A;  3VGL A;  2NRW A;  4OGC A;  4KRE A;  3FGU A;  2FSN A;  4L8R B;  3LAM A;  3OHR A;  3DYA A;  3GDQ A;  4B9Q A;  3CJ1 A;  4H4O A;  4CEA A;  3ZX2 A;  1NOZ A;  5KRT A;  1SKS A;  1G15 A;  5AQM A;  4YOY A;  2KFN A;  4JRP A;  3O9U A;  4PL8 A;  4BRA A;  3VQC A;  2V52 B;  3HT3 A;  4GVM A;  1KVC A;  1KAY A;  2G8U A;  2UXD K;  1HPZ A;  2A1R A;  3QML A;  3D7E O;  3CCJ N;  1NGB A;  4DU4 A;  1IBL K;  3NVK A;  2E20 A;  1DLO A;  1A5W A;  3OYK A;  3H1Q A;  5CZ1 A;  3AA3 A;  5BR8 K;  1W0H A;  1Q8I A;  3CJ9 A;  3OYC A;  2VQF K;  5F2R A;  3CCS N;  4KHS A;  3E1Y A;  1A5X A;  4YFU A;  3NVM A;  5HL7 L;  1HKB A;  1IKY A;  1O1W A;  3P5J A;  3NGI A;  2HNY A;  3VEN A;  3LWL A;  1SQK A;  4K8Z A;  2OPS A;  1Z26 A;  2HW3 A;  2D0P A;  4UY8 O;  3ZET A;  2QKK A;  4CBX A;  4DV1 K;  4G1Q A;  4KO0 A;  1ZBL A;  1XWL A;  2PZS A;  3PX6 A;  3CYM A;  5LJW A;  3O8M A;  4FW2 A;  1YAG A;  4PHT X;  4LH4 A;  3ULE B;  4WE1 A;  4WFN L;  4BR9 A;  4H0O A;  4I2Q A;  4OJR A;  4FJ8 A;  1U6Z A;  4CI6 A;  1UA1 A;  4FK2 A;  4GKK K;  1NK4 A;  3HK2 A;  3SUP A;  1HYZ A;  1KFD A;  5FPM A;  4IDK A;  3B6O A;  2G8I A;  1F21 A;  2Z1H A;  3SAG A;  4YOV A;  3TAN A;  3WEE B;  3CJC A;  3MCP A;  1O13 A;  2HBM A;  2YNH A;  2E4L A;  3KWG A;  4BWM A;  1NMN A;  2Q97 A;  4GY2 B;  5KPZ A;  5T7B A;  3QES A;  3V1R A;  3NF9 A;  3WQT A;  1SAZ A;  5HRO A;  3M8S A;  4H5T A;  1LWC A;  4BDY A;  1N8R O;  4X65 K;  1C0F A;  4F8R A;  2HHU A;  4FLW A;  1E4G T;  4BGA A;  3F9M A;  3WXK A;  4K0K K;  3AO1 A;  2YJE A;  4E1J A;  4CEZ A;  1RT1 A;  4JI5 K;  3AGK A;  5CY4 A;  2QTD A;  3S3O A;  5TKY A;  1VQK N;  3HI0 A;  4HCC A;  2F9T A;  1EET A;  5AZI B;  3L2U A;  4KTQ A;  2UUC K;  4B3O A;  1NKE A;  2VCP A;  3UB5 A;  1BCM A;  3BF3 A;  4CFD A;  2XY8 A;  1C0G A;  5DM7 L;  1M90 O;  1NGE A;  4CF0 A;  3MN6 A;  2ZJR L;  4FM1 A;  5AQL A;  2G8F A;  5J2Q A;  2UYT A;  4AHS A;  5E41 A;  4I9Q A;  4GV6 A;  4CER A;  3LP0 A;  3P31 A;  2FLO A;  3AO3 A;  2PBD A;  4M3X A;  4JAX A;  4NLC A;  3L2W A;  2VQE K;  2EHG A;  4CBW A;  5F1X A;  3K58 A;  3NH1 A;  2A3Z A;  4C8M A;  4AHV A;  2GX9 A;  3NAE A;  2CGL A;  3CJA A;  3O9R A;  4K43 A;  3KLI A;  3G10 A;  5M1P A;  5AQR A;  2GBZ A;  4CEQ A;  2VWK A;  5FLX O;  3HST B;  1NK8 A;  4IFY A;  1VHX A;  5J2N A;  3MDQ A;  3F2K A;  2X78 A;  1HLU A;  1HX1 A;  1YHQ N;  4C8L A;  4JEP A;  1B92 A;  4DTX A;  1WLJ A;  3TAE A;  2O8B B;  2A5X A;  4YOT A;  3KD1 E;  4DCH A;  1WSH A;  3U9D A;  3O80 A;  4O55 A;  3RR7 A;  4K41 A;  5KPT A;  3K9K A;  2HHV A;  4FWL A;  2A42 A;  4DHY A;  2NNW A;  4B08 A;  1BWF O;  1YF5 L;  3AAR A;  2GUP A;  3MN7 A;  2JWL A;  3DRP A;  2QWN A;  2WFB A;  1NBW A;  3ZSW A;  4CCH A;  4NYF A;  4IFE A;  4FOE A;  4RW6 A;  4BY9 C;  4B8A B;  1JCF A;  4IEI A;  2NZT A;  4I7F A;  2H3G X;  1BHL A;  4FL9 A;  4XH5 A;  3TWH A;  2F9W A;  1OKJ A;  2Y1I A;  1S22 A;  3CCU N;  1WBD A;  4BRC A;  1NJW A;  1IG9 A;  4CGG A;  3DOL A;  4BC2 A;  4OVL A;  1C1B A;  1J54 A;  1RDC A;  4CJU A;  4DTU A;  3P38 A;  2QWR A;  1X3N A;  3AO4 A;  2RHK A;  2G8V A;  2P9U B;  4M3W A;  4IJA A;  3O3F A;  1BCO A;  3PO5 A;  1D5A A;  3VEO A;  4HCB A;  3WNE A;  3C7N B;  2RN2 A;  4O5F A;  5BPL A;  4FJG A;  3G71 N;  4IXC A;  1VQN N;  3ZX3 A;  4WF9 L;  5AFU H;  2PYJ A;  3QFU A;  1BL3 A;  3OYH A;  4W5T A;  1NOY A;  3VF2 A;  4DB3 A;  5ADX H;  2IOC A;  4DQR A;  2D0O A;  2HHW A;  2P9K B;  4E7I A;  3WNF A;  2YI1 A;  1KC8 O;  2KKZ A;  4DV2 K;  4DFJ A;  5AQP A;  2B5J A;  4YDU C;  5AZJ B;  3CQY A;  1T6D A;  4LF6 K;  2X6N A;  1NKB A;  3VQQ A;  4CVN E;  3TPQ A;  1D9F A;  3K9J A;  4O0I A;  3QFP A;  1YJ9 N;  3O6W A;  3H6E A;  1YUW A;  1ZBF A;  2UUA K;  4BE2 A;  2P9P A;  4K42 A;  3KHY A;  4B9N A;  1U47 A;  2KTQ A;  1RBT A;  4E89 A;  3C6H A;  4JS5 A;  2FBY A;  1I94 K;  3QDK A;  1B9F A;  3VQA A;  1YJN N;  3TSU A;  2YNF A;  1BDG A;  5KTQ A;  1KLM A;  4JS4 A;  3SUQ A;  3SPZ A;  4BRH A;  3FZL A;  4KPY A;  1NK0 A;  3HZ6 A;  4LSN A;  4BGB A;  4AHR A;  4ID1 A;  3ID8 A;  1TAQ A;  4BE0 A;  4MDB A;  4OPK A;  3RTV A;  2O8D B;  5BR9 A;  5M1N A;  2PY5 A;  3P1G A;  1BQN A;  3IAY A;  1SL2 A;  5AQS A;  4A61 A;  4OX9 K;  4DR7 K;  3MX5 A;  4PKH A;  1GOB A;  3MN9 A;  1NGI A;  3SJJ A;  4M3Z A;  1LAW A;  3KD5 E;  2ZWH A;  4XH1 A;  3SQ1 A;  5AQG A;  4FK4 A;  2XO7 A;  4JKE A;  1S3X A;  3KLG A;  3E9O A;  3NF8 A;  3AVG A;  4FLZ A;  2YHB A;  1NGH A;  4DQS A;  3WXL A;  3ATV A;  3WNG A;  4A62 A;  3NDK A;  1U49 A;  3J8A A;  3M3Z A;  2QM1 A;  3QER A;  2QWP A;  4KH4 A;  3UIQ A;  5C2D A;  4NXM K;  3WQU A;  3TTD A;  2DFH A;  2IAJ A;  3RSE A;  4JKA A;  3PUF A;  2QXF A;  3HRG A;  4BRQ A;  4DV0 K;  4DTS A;  2HHH K;  4KHY A;  1SS6 A;  5BPM A;  1RBS A;  1RDB A;  1QQN A;  1NJX A;  3NH0 A;  4JK8 A;  5JVG L;  1TL3 A;  1HNZ K;  2A40 A;  3L2V A;  4JKG B;  3ZT0 A;  3AV9 A;  1VSI A;  3OJU A;  1QVG M;  4DV5 K;  1NLV A;  4J8F A;  3A5L C;  4B1U B;  4GKJ K;  5FDL A;  1K8A O;  3MMV A;  1SKR A;  4JI8 K;  2HHT A;  1IG8 A;  4IO9 L;  4FJK A;  1NU0 A;  4JNE A;  2UXB K;  4Y0W A;  4KH5 A;  1B9D A;  2HHX A;  2P9L B;  5C12 A;  1VQ8 N;  3Q7B A;  4FWS A;  3SZ2 A;  4PKG A;  4BRK A;  1SL0 A;  3HTV A;  2IVN A;  1Q9X A;  4E0D A;  3HL8 A;  3QET A;  3TSQ A;  2W41 A;  3OBW A;  3LPU A;  4DMN A;  4NO7 A;  1BIS A;  3SAF A;  3TAG A;  1JLQ A;  4DV3 K;  5F0X A;  1LWF A;  4V19 S;  1YIT N;  4N47 A;  1KRP A;  1S9G A;  1RTI A;  2XY5 A;  4BC5 A;  4E3S A;  2HST A;  4DUY K;  3UKU B;  4PL7 A;  3CCL N;  4CHQ A;  3C6A A;  3ENB A;  4LD0 A;  2RKI A;  2P5G A;  4NCG A;  1N32 K;  5I42 A;  5CYQ A;  1LW2 A;  3ZSR A;  4QS8 A;  1ASW A;  3AVL A;  2NRT A;  5AQK A;  4DG1 A;  4RW4 A;  2AP1 A;  3LAN A;  2AA4 A;  2YHX A;  1Q81 O;  5AQY A;  2G8K A;  1S72 N;  5I3U A;  4DF4 A;  1LWE A;  3O4N A;  5KGW A;  3K59 A;  4FJI A;  4L3Q A;  3OYL A;  4CK2 A;  3H08 A;  2QI2 A;  4IBN A;  4FZX C;  3R1X A;  3EKS A;  4CEB A;  1E4F T;  3IKM A;  3OS1 A;  3GL1 A;  3DLK A;  3SMP A;  1EWQ A;  3T69 A;  1K73 O;  2YNG A;  3BP8 A;  4PKI A;  4B9V A;  1JXB A;  4EHU A;  3CER A;  3FFI A;  4CF2 A;  4EHT A;  3N4P A;  4FJN A;  4HUE A;  4JD2 A;  4A59 A;  2E2O A;  4Z0U A;  3L0Q A;  4Z4F A;  1K8K B;  2BH1 A;  4RW9 A;  4LF4 K;  1ZBS A;  3SQ0 A;  3AGR A;  3AA2 A;  3D2F B;  1QQM A;  4Y1D A;  3I0R A;  4CF9 A;  1YI2 N;  4RTF D;  5FPD A;  3QO9 A;  3V9Z A;  1VSE A;  3O4Q A;  3T7Z A;  3VPZ A;  2WC9 A;  4FWQ A;  3DXK A;  3VQP A;  3P4I A;  4ISF A;  2NRX A;  5BN9 A;  3KLH A;  3HM9 A;  2P5O A;  3QIN A;  3TAP A;  3OS0 A;  5J2P A;  1C1A A;  1W9H A;  1RTJ A;  4U67 L;  2FC0 A;  3Q7C A;  4R5P A;  1VQM N;  2O8E A;  4UQG A;  3ZX0 A;  1VQ6 N;  2P9N A;  3SV4 A;  3DJC A;  3ISN C;  3LWM A;  1YIJ N;  4K8X A;  4FWP A;  3U4L A;  3V6D A;  1VRU A;  2EWS A;  2HMP A;  3S41 A;  4B1Y B;  1KQS M;  1Y64 A;  4CFC A;  3L4Q A;  2G8W A;  4M3T A;  4JI2 K;  4F3T A;  5AQT A;  4Z4I A;  1S9E A;  2O8F A;  2D0A A;  2B4J A;  4FLT A;  5BRH A;  1P90 A;  1HYS A;  4H0V B;  4JI6 K;  1NKC A;  1L5U A;  2OPP A;  4JHD A;  2E2Q A;  3K2P A;  3E66 A;  3LM9 A;  5GIP A;  2QEX N;  4M41 A;  1S5J A;  3JAM O;  4DTM A;  4CZK A;  1Z25 A;  4FOI A;  4PUO A;  2O8C A;  3IMX A;  5A2Q O;  4E7L A;  4CJF A;  3SQ2 A;  4ID5 A;  4DS4 A;  3CQ8 A;  1ILY A;  2D1K A;  3OW2 M;  3DLH A;  1JKH A;  2BGG A;  5BN8 A;  4FJX A;  1BI4 A;  3PIO L;  5JLH A;  3H3O B;  4BRN A;  4H8K A;  4CD1 A;  1HRH A;  3VES A;  4KHU A;  2VGN A;  4DQ8 A;  3ZSY A;  4J2E A;  3AO2 A;  4QOZ B;  2W6L A;  3FZF A;  1D9D A;  1XC3 A;  3TR8 A;  1UWB A;  3GG4 A;  2ETJ A;  2YJF A;  4Z4H A;  3OA9 A;  3BGR A;  4XEI A;  1Q82 O;  2A41 A;  2X74 A;  1KVA A;  1J5O A;  4KV8 A;  4ELV A;  3CHW A;  4H5W A;  3HO1 A;  3EE9 A;  4FJL A;  4MLH A;  5AQJ A;  4AH9 A;  1XNR K;  4CIG A;  3RRH A;  3NH2 A;  3M1F A;  4B9U A;  3J80 O;  4CGH A;  1KAZ A;  1KLN A;  1X9M A;  5M1Q A;  2JLE A;  2WTU A;  3R8E A;  5M1F A;  4YY3 K;  3EZ5 A;  4B3M K;  3DOK A;  1VQ5 N;  4CFA A;  2HND A;  4LF9 K;  3OYA A;  2QK9 A;  3ASM A;  4DTP A;  4B9S A;  1JLB A;  3HYF A;  2WUS A;  1EP4 A;  2ZF5 O;  3L2Q A;  1NGF A;  1HPM A;  4JKH A;  3ZCM A;  4DS5 A;  3AVK A;  1RFQ A;  4M3U A;  2GWJ A;  5EXW A;  3N4Q A;  4I2P A;  4O44 A;  3ZT1 A;  1HQE A;  4WYB A;  3AA4 A;  3VN5 A;  2ASO A;  3O9Q A;  1XHX A;  5EOY A;  4CIF A;  4DSJ A;  1J5E K;  3P39 A;  4B1Z A;  3BEX A;  4FVM A;  4LSL A;  3MN5 A;  4B3T K;  4J2D A;  1MU2 A;  3MEE A;  4DU3 A;  4FLV A;  3SI6 A;  1R0A A;  4FM0 A;  1ITG A;  4CES A;  5GIN A;  3CCR N;  2KW4 A;  1GOC A;  1N33 K;  4OPH A;  2FXU A;  2CGK A;  1W7A A;  1VSK A;  4YOR A;  5J1E A;  4ZTJ A;  4AHU A;  2E8A A;  3DRR A;  3ENH A;  4KTZ A;  4KB1 A;  4CHP A;  1C0U A;  3HPG A;  2WOM A;  3QEW A;  4FJ7 A;  4EP4 A;  2IVP A;  1Q7Y O;  3DXM A;  4WCE L;  1HNI A;  4JKF A;  4CHZ A;  4AQY K;  3T3F A;  3C95 A;  5JIC A;  3QIC A;  3SK3 A;  1P8Z A;  5FRO A;  3HOS A;  3VQ9 A;  1BU6 O;  3MX2 A;  3LAK A;  4NXN K;  3OTO K;  4ELT A;  3IUC A;  3HPH A;  5JS2 A;  1XHZ A;  4ILG B;  2Z1I A;  4FLU A;  1JJ2 M;  3FLC O;  3U3G A;  2GEL A;  3LM2 A;  3PLA A;  4DKW A;  4FWN A;  4Q5V A;  5BPN A;  4O5B A;  1NJY A;  3HBT A;  3LAL A;  2Z1J A;  4CF1 A;  3R3L A;  1VSM A;  4QS9 A;  1KXP A;  3DLE A;  3KK1 A;  1TK8 A;  2ZGZ A;  4DR4 K;  1QSY A;  3PO4 A;  1S1W A;  4O4G A;  4W5Q A;  4JI4 K;  2E2P A;  3VF4 A;  3NF7 A;  1GLD G;  3AVA A;  4BRO A;  4FLY A;  4LH5 A;  1IBK K;  3KKS A;  3EL2 A;  4DTO A;  1NG9 A;  4CGD A;  2ZQB A;  4CZL A;  1HNX K;  4M7Y A;  4HTL A;  1KFS A;  1U04 A;  1U2V A;  3J81 O;  2IDO A;  2J4R A;  1TUY A;  4JKD A;  3DWL A;  3OYJ A;  3SV3 A;  4DR6 K;  5HRP A;  4JN4 A;  4BRE A;  5AR0 A;  1J53 A;  2V7Z A;  3CC4 N;  5M1O A;  1RT5 A;  1QQC A;  4YOW A;  1GLF O;  1VSJ A;  2OPQ A;  3EEQ A;  2D4W A;  4HTU A;  4IKF A;  2PYL A;  3ZLJ A;  1WAF A;  1XC9 A;  4N76 A;  4CGF A;  2F8S A;  3ZT4 A;  3GOI A;  3THY A;  1QZ6 A;  1OH7 A;  3TAR A;  4B8C A;  2PFU A;  4KTW A;  4WQ4 C;  4IOX A;  2JWK A;  1YJW N;  3L2R A;  3T1A A;  1U48 A;  5EY4 A;  1A5V A;  2HMI A;  4BR7 A;  3CET A;  3SJH A;  3VEZ A;  1GOA A;  3V1Q A;  5C0Y A;  3D2E A;  1ZBI A;  3CC2 N;  2EX3 A;  2D0B A;  1WN7 A;  1YTU A;  4MLE A;  1G99 A;  3CFR A;  2QKB A;  3CM6 A;  4CJT A;  1IH7 A;  1L3U A;  4F3O A;  5M1K A;  3RMB A;  1CLQ A;  4DSI A;  3O3H A;  4JI7 K;  5B8H A;  4CEC A;  4KI4 A;  3QNO A;  4C23 A;  3NGZ A;  3E9L A;  3RWU A;  3SUO A;  2KLA A;  2NLX A;  2IIR A;  1RBU A;  4I9L A;  4EZ6 A;  5EU7 A;  3HJF A;  4Y1C A;  2YNI A;  4FJH A;  4A5A A;  4CEO A;  1T44 A;  2OCE A;  3AVN A;  3KLF A;  4WQ4 A;  1REV A;  2RPI A;  3QBX A;  3O9S A;  4JKC A;  3GBT A;  4IG3 A;  1UOC A;  4OKE A;  4LF7 K;  1HJR A;  3I0S A;  4BE1 A;  3SQ4 A;  2P9I A;  3VA0 A;  5DM6 L;  2NRH A;  3VER A;  4FCY A;  2Q31 A;  5EX5 A;  1BIU A;  1N6Q A;  4A2B A;  4AHT A;  2ZE2 A;  2ZJQ L;  1CXU A;  1FKO A;  1MWM A;  4CJL A;  3VEX A;  3BF1 A; 
#chains in the Genus database with same CATH homology
 1YIT N;  4FWM A;  4BVO A;  4EFH A;  5AQM A;  4YOY A;  3CQX A;  4H5N A;  1U2V B;  3O9U A;  4PL8 A;  4BRA A;  5KQ8 A;  4BC5 A;  2V52 B;  4CZH A;  1BG3 A;  3FZM A;  2HST A;  4BR5 A;  3UKU B;  3VET A;  4PL7 A;  3CCL N;  1KAY A;  3C6A A;  3ENB A;  4JKB A;  4M63 C;  2E2N A;  1Z6R A;  3QML A;  3D7E O;  3CCJ N;  4H0Y B;  1NGB A;  1NJI O;  4QS8 A;  3NVK A;  4QS7 A;  2NRT A;  2QWQ A;  2E20 A;  2CH5 A;  5AQK A;  2AP1 A;  3H1Q A;  2AA4 A;  2YHX A;  1Q81 O;  3SMS A;  1BOT O;  5AQY A;  1S72 N;  3CJ9 A;  2P9S B;  3A0I X;  4WFA L;  5F2R A;  3CCS N;  2E1Z A;  3E1Y A;  2NRV A;  5E26 A;  4L3Q A;  4FO0 A;  1T3V A;  1DKG D;  1V4S A;  3D2E B;  2QI2 A;  3I56 N;  3NVM A;  3LDO A;  3PIP L;  1RDW X;  5HL7 L;  1HKB A;  4YDU A;  1HUX A;  3R1X A;  5AZI A;  4B1V A;  3EKS A;  1E4F T;  3VEN A;  3HM8 A;  2RE2 A;  3IKM A;  3RSE B;  4JK7 A;  3GL1 A;  4CBU A;  3KWI A;  3WUH A;  1SQK A;  3SMP A;  3JXU A;  3DAW A;  3T69 A;  2D0P A;  3RVC A;  4CZJ A;  1K73 O;  3VEX A;  4UY8 O;  3ZET A;  3BP8 A;  4PKI A;  4CBX A;  1D4X A;  4EHU A;  3CER A;  5AZJ A;  4EHT A;  3N4P A;  3CPW M;  1NGD A;  1TYQ A;  5LJW A;  2F7T A;  4JD2 A;  4BRM A;  3W3D A;  4A59 A;  3O08 A;  1WUA A;  2E2O A;  3O8M A;  3L0Q A;  1YAG A;  4AM7 A;  4H03 B;  4H0T B;  4PHT X;  2QA4 N;  1K8K B;  2BH1 A;  1ZBS A;  3ULE B;  4WFN L;  4BR9 A;  3AGR A;  2HF4 A;  3D2F B;  4H0O A;  1U6Z A;  3M5R A;  1QQM A;  1BUP A;  4CI6 A;  1YI2 N;  3LDQ A;  2BUP A;  4RTF D;  4ILJ A;  1VQP N;  5FPD A;  3CIP A;  5FPN A;  2P9I B;  3I33 A;  5FPM A;  3T7Z A;  1W2B M;  4F9O A;  3VPZ A;  5JMV A;  3WXI A;  3A8Y A;  2WC9 A;  4FWQ A;  3SAG A;  5C10 A;  4YOV A;  3DXK A;  1JCE A;  3WEE B;  3CJC A;  3MCP A;  1O13 A;  2HBM A;  3P4I A;  4GVE A;  5CR4 A;  3CXC M;  3KWG A;  2Q97 A;  4ISF A;  4GY2 B;  2NRX A;  2P9P B;  5BN9 A;  5KPZ A;  5KPR A;  3IDH A;  1VAZ A;  4ISG A;  3WQT A;  1SAZ A;  3LL3 A;  1HKG A;  3VGM A;  4H5T A;  4U67 L;  4MO4 A;  4KBO A;  4FVU A;  1N8R O;  3Q7C A;  1VQM N;  1C0F A;  3KVG A;  3VMF B;  3FE1 A;  1E4G T;  4BGA A;  3SAH A;  3ZX0 A;  1VQ6 N;  2P9N A;  1ATN A;  3F9M A;  3J7Z O;  3WXK A;  3DJC A;  2Q0R A;  4IEE A;  2YJE A;  4IJN A;  4E1J A;  4C1N K;  1VQO N;  2Q1N A;  2ZJP L;  2Q36 A;  1YIJ N;  4AF1 A;  4FWP A;  3AGK A;  3U4L A;  5AQH A;  1VQ9 N;  2QTD A;  4A2A A;  4KH6 A;  1BA1 A;  3CF5 L;  2QW9 A;  4GV3 A;  2EWS A;  2YHY A;  3ID6 A;  5GAE P;  2BTF A;  5AQQ A;  2HMP A;  5TKY A;  1VQK N;  3HI0 A;  3S41 A;  4B1Y B;  1KQS M;  3VOV A;  1Y64 A;  1DEJ A;  3L4Q A;  2F9T A;  4MDA A;  4EIA A;  4R79 A;  5AQT A;  5AZI B;  2QWO A;  5AQI A;  5BRH A;  1P90 A;  2VCP A;  3CI5 A;  3G6E N;  4H0V B;  3UB5 A;  4JHD A;  3BF3 A;  1RDU A;  2E2Q A;  1ZC6 A;  2NRZ A;  1C0G A;  2Q0U A;  5DM7 L;  3E66 A;  1M90 O;  4NLB A;  3LM9 A;  1NGE A;  4GNI A;  4B1W B;  4C1N I;  3MN6 A;  5GIP A;  2ZJR L;  5AQL A;  2UYT A;  3JS6 A;  5AQF A;  3U8X A;  2QEX N;  4GV6 A;  3CCM N;  4CZK A;  4FOI A;  1GLE G;  1TYQ B;  3H46 O;  3P31 A;  3QBW A;  2FLO A;  4JD2 B;  1ESV A;  3IMX A;  3TTF A;  3L6Q A;  3R6M A;  2FF3 B;  2PBD A;  2P9U A;  1NGJ A;  2V51 B;  1ILY A;  3C65 A;  5C2F A;  2D1K A;  2HOE A;  4JAX A;  4NLC A;  3OW2 M;  1QVF M;  3WT0 A;  2GTD A;  2YHW A;  5BN8 A;  3C7N A;  2ASP A;  3PIO L;  5JLH A;  5AFU A;  3H3O B;  4BRN A;  4CBW A;  5F1X A;  1NM1 A;  4JKG A;  4H0X B;  2A3Z A;  4CD1 A;  1QQO A;  2HBJ A;  5ADX A;  2GX9 A;  3VES A;  2VGN A;  4DQ8 A;  3GE1 A;  2CGL A;  2ZGY A;  3CJA A;  4AM6 A;  4BRP A;  3O9R A;  4K43 A;  5M1P A;  1OVY A;  3FZF A;  4RCH A;  5AQR A;  3SBG A;  1XC3 A;  1XUP O;  3GG4 A;  5C15 A;  3IFR A;  5AQZ A;  5AQW A;  5AQV A;  3VGK A;  2YJF A;  3ZEU A;  2P9K A;  2QWM A;  3OA9 A;  4A57 A;  2KHO A;  3AAQ A;  1RGI A;  4XEI A;  3CCE N;  1Q82 O;  3EO3 A;  3MDQ A;  2A41 A;  3F2K A;  3A5N C;  1HLU A;  1HX1 A;  4BVP A;  1YHQ N;  3CHW A;  4H5W A;  2W40 A;  4JEP A;  3A5O C;  4OPA A;  3EE9 A;  2A5X A;  4YOT A;  5LJV A;  4MLH A;  5AQJ A;  4DCH A;  3CD6 N;  4IDH A;  4BQZ A;  1K9M O;  3U9D A;  3M1F A;  3O80 A;  2P9N B;  4K41 A;  5KPT A;  2HBL A;  1KAZ A;  1DT9 A;  1ZXO A;  3I8B A;  4NB4 A;  3K9K A;  5M1Q A;  3LDL A;  2A42 A;  2PAV A;  4FWL A;  3ZYY X;  1Q86 O;  4DHY A;  3R8E A;  2NNW A;  5M1F A;  3I55 N;  1BWF O;  1YF5 L;  1BA0 A;  3AAR A;  3FR0 A;  3VEY A;  2GUP A;  3MN7 A;  1LCU A;  1VQ5 N;  4G9Z A;  4Z94 A;  2JWL A;  4I6M A;  2QWN A;  2WFB A;  1NBW A;  1NWK A;  4FPA A;  3W0L A;  3O4W A;  1QHA A;  4IFE A;  4ISE A;  4FOE A;  4BQL A;  4BY9 C;  4M7X A;  3M6G A;  4BRG A;  1NMD A;  2WUS A;  1JCF A;  4IEI A;  2ZF5 O;  2E1Y A;  2NZT A;  1NGF A;  2H3G X;  4FL9 A;  4XH5 A;  1HPM A;  2FSJ A;  2F9W A;  4JKH A;  1TUU A;  1OKJ A;  2P9S A;  1S22 A;  1HKC A;  1NGA A;  4JHD B;  1RFQ A;  3CCU N;  4BR0 A;  3U9Z A;  4BRC A;  1X3M A;  2GWJ A;  3ZX2 A;  3HOT A;  4BG9 A;  5EXW A;  3N4Q A;  5FPE A;  4IOA L;  3L4I A;  4H5V A;  3TSP A;  4FSV A;  3VTH A;  4BC2 A;  4WYB A;  3SLC A;  2FF6 A;  4FWK A;  3KK7 A;  2ASO A;  2WBN A;  3O9Q A;  5EOY A;  3ENO A;  3P38 A;  5AQU A;  2QWR A;  1X3N A;  5JLF A;  3P39 A;  4B1Z A;  2RHK A;  2P9U B;  1BO5 O;  3BEX A;  3MN5 A;  4IJA A;  4LC9 B;  3VEO A;  3WXJ A;  2ASM A;  3C7N B;  3CJ7 A;  4O5F A;  2A6A A;  5CHI A;  5GIN A;  3CCR N;  3VF6 A;  4BC3 A;  5BPL A;  3G71 N;  4BRL A;  4OPH A;  4IXC A;  1VQN N;  3ZX3 A;  5EVZ A;  2FXU A;  4WF9 L;  2CGK A;  2QXL A;  5AFU H;  4YOR A;  4RWT A;  1J6Z A;  3CC7 N;  2E8A A;  2Q2R A;  3QFU A;  5E84 A;  3EN9 A;  1GLL O;  3ENH A;  3VEW A;  4GV9 A;  1ATS A;  3F5T A;  2CH6 A;  1V4T A;  3VF2 A;  4B1X B;  4DB3 A;  5ADX H;  2D0O A;  5BRF A;  2IVP A;  3ZEU B;  1Q7Y O;  2P9K B;  4HWI A;  3DXM A;  3KZB A;  2YI1 A;  3O5B A;  4WCE L;  4JKF A;  1KC8 O;  2E88 A;  2KKZ A;  1NGG A;  5AQO A;  3ZET B;  4WQ5 C;  1MA9 B;  5AQP A;  5JIC A;  3B8A X;  3QIC A;  4YDU C;  1P8Z A;  3SK3 A;  1EQY A;  5AZJ B;  3CQY A;  5BRE A;  3HOS A;  1VQ4 N;  1T6D A;  1BU6 O;  3AAP A;  4BC4 A;  3MX2 A;  4JK9 A;  3CJB A;  5MLC Q;  2YX6 A;  3TPQ A;  3LDP A;  1X9J A;  3IUC A;  3K9J A;  3WXM B;  4ILG B;  3QFP A;  5BRD A;  3E9P A;  4H5R A;  3O6W A;  3D6R A;  5KQD A;  1YJ9 N;  3H6E A;  1T6C A;  1YUW A;  3CMA N;  3FLC O;  3UE5 A;  1JJ2 M;  2GEL A;  4ILH A;  2OTJ N;  1EO1 A;  2P9P A;  3LM2 A;  1GLB G;  3KHY A;  4K42 A;  3EE8 A;  2VGM A;  3PLA A;  4DKW A;  1HJO A;  4CZM A;  4FWN A;  2GEM A;  2HF3 A;  4CJ7 A;  3C6H A;  5BPN A;  3MWP A;  3MCA B;  3MK6 A;  3QDK A;  3HBT A;  3O1B A;  3VEV A;  1YJN N;  3TU5 A;  3TSU A;  4WFB L;  2DPN A;  3R3L A;  1BDG A;  4QS9 A;  4I6M B;  3UKR A;  3BUZ B;  4BRH A;  1KXP A;  2FSK A;  3FZL A;  2ZGZ A;  1KD1 O;  4IWV A;  1SZ2 A;  2P9L A;  3DXK B;  1NGC A;  3HZ6 A;  2V7Y A;  4BGB A;  3OBY A;  4BG8 A;  3ID8 A;  3VTI A;  1VQ7 N;  5TKW A;  4MDB A;  1LOT B;  2E2P A;  4IZ9 A;  3FZH A;  4O8U A;  3SBT A;  3G4S N;  3VF4 A;  4CZE A;  3MWT A;  5BR9 A;  1GLD G;  4BRO A;  5M1N A;  2OAN A;  4EAH D;  5GAD P;  4OO1 J;  4XH4 A;  3H3N O;  1GLA G;  3AY9 A;  3CPE A;  5H1S Q;  3EL2 A;  4WQ5 A;  5I9E B;  5AQN A;  4CZL A;  5AQS A;  4A61 A;  3MX5 A;  4A5B A;  1MDU B;  1MWK A;  4PKH A;  1WOQ A;  3MN9 A;  4CZI A;  4M7Y A;  4HTL A;  1DGK N;  1YXQ A;  1U2V A;  2J4R A;  1NGI A;  1TUY A;  5AQX A;  4FWR A;  4JKD A;  3DWL A;  5LY3 A;  3EKU A;  4JN4 A;  4BRE A;  5AR0 A;  2V7Z A;  3UKU A;  4BRD A;  3CC4 N;  5M1O A;  1W97 L;  4YOW A;  2IVO A;  1GLF O;  2D4W A;  2OTL N;  2ZWH A;  4XH1 A;  1Q18 A;  3QB0 A;  5AQG A;  3GOI A;  4JKE A;  4BRF A;  1QZ6 A;  1S3X A;  1CZA N;  3E9O A;  2PFU A;  4WQ4 C;  3CCV N;  5GAG P;  4IOX A;  2JWK A;  1YJW N;  1NGH A;  1VQL N;  4H0P A;  3WXL A;  4MO5 A;  5EY4 A;  1GLJ O;  3ATV A;  4YOX A;  5GIO A;  4A62 A;  4BR7 A;  3CET A;  5CE3 A;  3DXM B;  3J8A A;  1R59 O;  3SJH A;  3M3Z A;  2QM1 A;  3VEZ A;  2QWP A;  4KH4 A;  5C2D A;  3NMU A;  3WQU A;  5C0Y A;  3D2E A;  1QZ5 A;  2VWB A;  3TTD A;  4FWO A;  4O8K A;  3CC2 N;  1IJJ A;  2CGJ A;  4YOU A;  1GLC G;  4MLE A;  1G99 A;  2VYP A;  4K25 A;  3RSE A;  1H1V A;  3O9T A;  3HRG A;  4JKA A;  4BRQ A;  1KAX A;  2GWK A;  3ATU A;  2I7N A;  4CZF A;  1SS6 A;  5GAH P;  5BPM A;  5M1K A;  3A5M C;  1QQN A;  4CZG A;  5B8H A;  1YVN A;  3FFK B;  4JK8 A;  4C23 A;  4CD3 A;  5JVG L;  3E9L A;  5ELZ A;  2A40 A;  3O1W A;  2KLA A;  4IOC L;  4JKG B;  3FZK A;  4IO8 A;  1QVG M;  2NLX A;  1NLV A;  2IIR A;  4J8F A;  3A5L C;  1Z05 A;  3H1V X;  3LDN A;  4B1U B;  3CCQ N;  5JVH L;  5HOO A;  1K8A O;  3CME N;  3C0B A;  2QWL A;  3MMV A;  1M1K O;  3UKR B;  1K8K A;  1IG8 A;  3R9P A;  3ULE A;  4IO9 L;  3H45 C;  3D2F A;  4JNE A;  2HBK A;  4Y0W A;  3VGL A;  4KH5 A;  4A5A A;  1JCG A;  2P9L B;  2NRW A;  1T44 A;  5C12 A;  3FGU A;  1VQ8 N;  4WQ4 A;  2FSN A;  3Q7B A;  2NRR A;  4FWS A;  4PKG A;  4BRK A;  1XQS C;  3QBX A;  3G25 A;  3HTV A;  3GBT A;  3O9S A;  4JKC A;  2IVN A;  4U7B A;  4BR2 A;  3TTC A;  4BR4 A;  3TSQ A;  3DLL L;  2P9I A;  5DM6 L;  2NRH A;  2W41 A;  1ATR A;  3OBW A;  3VER A;  4FPB A;  2Q31 A;  2YCH A;  5EX5 A;  4NO7 A;  3SAF A;  3OHR A;  4A2B A;  3GDQ A;  5F0X A;  4B9Q A;  3CJ1 A;  3EZW A;  3HSC A;  3WEE A;  4BRI A;  2ZJQ L;  2ITM A;  1MWM A;  2I7P A;  3BF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...