2Q2RA

Trypanosoma cruzi glucokinase in complex with beta-d-glucose and adp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
373
structure length
370
Chain Sequence
APAGSHMNIKELSLHELCEELKTPAWNAPLTFVGDVGGTSARMGFVREGKNDSVHACVTRYSMKRKDITEIIEFFNEIIELMPASVMKRVKAGVINVPGPVTGGAVGGPFNNLKGIARLSDYPKALFPPGHSAILNDLEAGGFGVLAVSDAHVFSEYFGVMWEGTQWRTCEQEPAGSVIGRGRCLVLAPGTGLGSSLIYYNPQHIVVPLELGSQTLPMRKDIDYIQTLHAELKLFPNYENMVSGAGLEFHYRQVVRGSRPPCSAGEIAKLASEGDANACKAMKKYHEYLMRVGSEASMALLPLTIVLVGDNIVNNAFFYRNPQNLKEMHHEALNHEMERFGFQSRVSYLRQKKLLNLNLMGCYRCGLDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Trypanosoma cruzi Glucokinase Reveals Features Determining Oligomerization and Anomer Specificity of Hexose-phosphorylating Enzymes.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
molecule keywords Glucokinase 1, putative
total genus 124
structure length 370
sequence length 373
chains with identical sequence B
ec nomenclature ec 2.7.1.2: Glucokinase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02685 Glucokinase Glucokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2q2rA01
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 2q2rA02
3FZMA 3DXMA 5EOYA 5BR9A 4NB4A 4DQ8A 3MN5A 1CZAN 3ID8A 4FOEA 4H5TA 1HUXA 2E20A 4MLHA 3ENHA 3DWLA 3VF6A 4GY2B 4CBXA 2ASOA 1HKCA 1QHAA 2CGLA 2QWMA 3UKRB 5BPNA 3D2FA 4M63C 3WT0A 5ADXH 3ZETA 2YI1A 3JXUA 5AQHA 5AQZA 3CJ9A 3U9DA 4BRAA 4DCHA 2Q1NA 2AA4A 3HZ6A 1ZBSA 1DEJA 1NWKA 3C0BA 2FSJA 3WXLA 3O4WA 3O1BA 4BGAA 1U6ZA 1GLEG 3FZLA 2Q36A 4FWMA 4IXCA 2P9SA 3C7NA 4BR4A 3BF3A 1Z6RA 4CBWA 3FZKA 4BQLA 3TPQA 2P9KB 4ISFA 4DHYA 3H1VX 2I7PA 3H3OB 4WQ5C 1U2VB 2P9KA 3QMLA 5JLFA 4JHDB 3P4IA 2QWPA 3I8BA 3LL3A 4B9QA 5EY4A 3M6GA 1NM1A 4AM7A 1NGAA 4BRPA 4BC3A 3A5MC 2V7YA 1XQSC 2P9LA 2ZGZA 4B1XB 1YVNA 2E88A 3ULEB 1K8KA 2V52B 3O08A 4JAXA 2P9LB 3MMVA 3LDOA 3IMXA 2ASPA 4BG8A 2Q0UA 2BUPA 1KXPA 4BR7A 3CJBA 3DAWA 2ZGYA 3GE1A 3R9PA 3VOVA 1BU6O 4BRMA 2D4WA 4L3QA 1X3MA 1G99A 1TYQA 1TUYA 4CZFA 4CBUA 1QQNA 2P9UB 5AQNA 2ZWHA 1H1VA 5AFUH 5BRFA 4YDUC 2FF3B 3KVGA 3HI0A 1ATSA 1NMDA 3R6MA 4GNIA 5AQJA 4BR5A 2P9NA 5JLHA 5EX5A 4FWSA 4M7YA 5FPNA 1DKGD 3VESA 3VPZA 2P9NB 2GTDA 4B1VA 5AQQA 4BRQA 2GEMA 4BRDA 1HPMA 3WXJA 2P9IA 3CQXA 1BDGA 5AQTA 4A62A 3J8AA 2P9PB 5AQSA 1QQMA 1SAZA 1Z05A 2IIRA 1BWFO 5BRHA 1MA9B 4XH1A 3CJ7A 3W3DA 2FLOA 4B1WB 5ADXA 3U4LA 5BPMA 3MCPA 3AY9A 4FSVA 3VEYA 1YXQA 1BG3A 1KAZA 1S3XA 5AQLA 4CZJA 3O5BA 4FWKA 4C23A 5AQIA 4QS8A 4J8FA 4BC2A 3H3NO 3ATVA 4H0PA 5BN9A 3VEOA 1HKBA 1T44A 5AFUA 2YJFA 3ZEUB 5BPLA 3WQTA 4RWTA 3H46O 1GLLO 4XEIA 3UKUB 2E8AA 3VEZA 5FPEA 4WQ4A 4I6MA 1S22A 3DXKA 4H0YB 2HMPA 3GOIA 5AQKA 3QBWA 4H0TB 5AZJB 3ZX2A 1XUPO 5TKYA 1ZXOA 1XC3A 4CZKA 1WUAA 3EKSA 3ZX0A 2CGKA 2E1ZA 5F2RA 4H0VB 3I33A 1BO5O 3FZFA 3QDKA 3VEWA 4B1YB 1BUPA 3CERA 2ITMA 4CZEA 3FZHA 4BRLA 1D4XA 1BA1A 1LOTB 2QWRA 1KAXA 2J4RA 3WEEB 5KPTA 1NGFA 4BR0A 2HOEA 2Q31A 3HTVA 4YDUA 1MWKA 4K25A 3A5NC 3MN9A 5AQVA 4BG9A 5FPDA 3FLCO 3BP8A 3SLCA 4BRIA 5AQOA 2FF6A 1GLCG 1NBWA 2ASMA 3CHWA 2GWJA 3QFUA 3GG4A 4PKIA 3AARA 2EWSA 1HKGA 3D2EA 4RCHA 2QWNA 4FWLA 1ZC6A 4FPAA 4K42A 1JCFA 2NRHA 1OKJA 2YHYA 2WUSA 3D2EB 2IVOA 5BN8A 1C0GA 3QFPA 1JCGA 3EL2A 5EXWA 1EQYA 4WQ4C 4FWPA 4B1UB 5BREA 1RDWX 3LDPA 4BR9A 1ESVA 5AQGA 3EKUA 5E84A 4BGBA 2YHWA 3CJAA 3JS6A 3VEVA 2H3GX 4HTLA 3RSEB 3U9ZA 1IJJA 1V4TA 4BC4A 4CI6A 5KPZA 2HF3A 2IVNA 2QW9A 3WUHA 2A40A 3FE1A 2F9WA 2P9IB 1GLJO 3QICA 4FWQA 2P9PA 5B8HA 2E2NA 3GBTA 3G25A 4H5RA 4IJAA 3VENA 1NGDA 4H5VA 1C0FA 5I9EB 3DXMB 3QB0A 5LY3A 1X3NA 2D1KA 2QWLA 4CZHA 2V7ZA 3AAPA 2ZF5O 3MN7A 3MN6A 3L6QA 4WYBA 3H1QA 5AQYA 4QS9A 1GLFO 4Z94A 2A41A 3AAQA 4FL9A 4PKGA 4BROA 1QZ5A 3ATUA 2FSNA 4JN4A 4CZGA 3MK6A 3L4IA 3UB5A 2VYPA 1NGBA 3CQYA 4BRGA 3L0QA 3FFKB 3SMSA 1IG8A 4EFHA 5F0XA 1QQOA 1QZ6A 3KZBA 3DXKB 2P9SB 3C7NB 3LM9A 5AQPA 4BR2A 5AR0A 4K41A 3BF1A 1SQKA 2QWOA 2YHXA 2F9TA 1U2VA 4B1ZA 4H03B 1RGIA 4CZLA 2QXLA 4JNEA 3WQUA 3VF2A 2UYTA 4BRHA 3O1WA 4PL7A 4PL8A 2I7NA 4IO8A 5KPRA 3FGUA 4PKHA 4DB3A 3WXKA 2DPNA 3WXIA 4XH4A 1TUUA 1X9JA 5AZIA 2PBDA 2W41A 3CETA 3O80A 4CD3A 3CJCA 4EAHD 3A5LC 3R8EA 5AZIB 3TU5A 2HF4A 1HJOA 4EIAA 4A2BA 3ULEA 3D7EO 1JCEA 2QWQA 3FR0A 4IWVA 4FOIA 1TYQB 1V4SA 4BRNA 2CH5A 5LJVA 2D0OA 5LJWA 4Y0WA 2NZTA 4H0OA 4A61A 3LDNA 1KAYA 3EZWA 3EO3A 1ATNA 3BUZB 4FWNA 4EHUA 5BRDA 3VGKA 3SK3A 1NLVA 5AQMA 4A2AA 3H6EA 1BA0A 2Q0RA 5ELZA 4FPBA 3QBXA 3VF4A 2E1YA 3IFRA 4JD2A 2E2PA 4M7XA 4WQ5A 3S41A 1MWMA 3M3ZA 4JD2B 5E26A 3ENOA 1ATRA 1GLBG 4HWIA 3RSEA 1NGHA 3F9MA 5AQUA 2YCHA 4H5NA 3SMPA 5JICA 2A3ZA 2PAVA 3UE5A 2GUPA 2GELA 3B8AX 3IDHA 4NO7A 4QS7A 3LDLA 2E2QA 3ZEUA 2NLXA 3UKRA 4E1JA 3HSCA 3D2FB 5KQDA 1SZ2A 3ZETB 1LCUA 5EVZA 2Q97A 1WOQA 1GLDG 3A8YA 2YJEA 4O8KA 3KHYA 2FXUA 2QM1A 3CJ1A 2D0PA 3EN9A 4BC5A 3UKUA 1YAGA 3A5OC 4H0XB 4BQZA 4MO4A 3OHRA 3A0IX 3GL1A 2VCPA 4I6MB 4CZIA 3GDQA 4BVPA 2E2OA 5AZJA 4K43A 4BRKA 3O6WA 4ISGA 1T6CA 2IVPA 3H45C 3LM2A 1NGCA 3VEXA 4BRCA 3CIPA 1DGKN 4MO5A 3WEEA 5AQRA 1GLAG 2A6AA 5KQ8A 4IZ9A 4F9OA 4LC9B 3HBTA 1Y64A 3VGMA 4BVOA 2W40A 3CI5A 3HM8A 1NGGA 2BTFA 4JHDA 1J6ZA 1BOTO 2OANA 5AQWA 1HX1A 5AQFA 3IUCA 1K8KB 3SJHA 1NGIA 2FSKA 3VETA 2VWBA 3M1FA 2GWKA 4CJ7A 1YUWA 1P8ZA 4BRFA 3VGLA 4MLEA 2CH6A 1NGEA 4AM6A 3U8XA 2CGJA 5F1XA 1E4GT 5FPMA 5CE3A 1NGJA 4FWRA 2P9UA 2Q2RA 1HLUA 2A5XA 3ZX3A 4EHTA 1MDUB 4KBOA 4ISEA 2A42A 4H5WA 1RFQA 2AP1A 4FO0A 4BREA 3MDQA 2V51B 1E4FT 3O8MA 1R59O 4O5FA 3VERA 4CD1A 5AQXA 4CZMA 1Q18A 4IJNA 4FWOA 3LDQA 3W0LA 5JMVA 4RTFD 4XH5A 2KHOA 1T6DA 3DJCA 3BEXA
chains in the Genus database with same CATH superfamily
3FZMA 5BR9A 4NB4A 3UIQA 4DQ8A 4ZTFA 1OH6A 4WFNL 3IS9A 3NGZA 1J5OA 4GV3A 4KV8A 1CZBA 3AVAA 3MX5A 1QSSA 4JKGA 3H08A 2CGLA 3TAMA 3DLGA 4M63C 3WT0A 3ZETA 3SV3A 2YNIA 3VA0A 2G8WA 3CC7N 2Q1NA 1ZBSA 2DFFA 4CJFA 4DQRA 1W7AA 2RPIA 3OYMA 1NWKA 4Y1DA 3O1BA 1GLEG 3ZT0A 2ETJA 4J2AA 4U7BA 1S1VA 5GAEP 3OYLA 1Z6RA 3HYFA 4BE0A 2I7PA 3DOKA 4WQ5C 1U2VB 2XHBA 3KIOA 2EHGA 5JLFA 4JHDB 3P4IA 5CHIA 4M41A 1S9GA 5EY4A 4HUEA 1EP4A 3M6GA 4AHVA 1NKCA 1NGAA 4PHTX 3NF6A 3ZSYA 3L2RA 1W0HA 2NNWA 3AA3A 2ZGZA 3OYCA 4RW7A 5KRTA 3O3GA 3ID6A 4OVLA 3CCLN 4KB1A 3NMUA 1K8KA 1REVA 3O08A 2P9LB 3LDOA 3ZSXA 2Q0UA 2BUPA 3TABA 1KXPA 4F3TA 4BR7A 4X65K 4DTPA 4DV2K 4BRMA 4LFCK 3KD1E 1TYQA 3EY1A 1NJIO 1QQNA 2P9UB 4OJRA 5AFUH 5BRFA 4YDUC 3KVGA 3OBWA 3KK2A 1YTAA 1G15A 4BR5A 4X64K 4FJIA 1WAFA 4FJLA 1XMOK 1DKGD 3NDKA 1TK8A 3PUFA 4M45A 4J2DA 1CLQA 4BRDA 4DTUA 1VQ7N 3SQ0A 4ZTJA 4A62A 1RBSA 2P9PB 1QQMA 3TAFA 1SAZA 2IIRA 1BWFO 4KHPK 4FJGA 3CJ7A 2GX9A 2FLOA 5ADXA 3U4LA 5BPMA 3T1HK 1YTUA 1BHLA 5AQLA 4CHZA 4CZJA 1C0TA 1TL3A 3O5BA 4DQIA 4CGHA 3PX6A 4DR6K 3DRPA 4BC2A 4OPJA 2QI2A 2OYQA 4RWTA 3H46O 1XMQK 2E8AA 3LZJA 3G10A 3LANA 3K5MA 4JRPA 3DXKA 4N41A 3RTVA 4JK9A 1O1WA 1SL2A 4YOYA 4E7JA 1ZXOA 4FZZA 4WE1A 3ZX0A 3SV4A 4IO9L 3THYB 4W5NA 1B9FA 5F2RA 3SUNA 4Z4CA 4B1YB 1RTJA 2ITMA 4CZEA 3FZHA 4H8KA 4BRLA 3G4SN 1LOTB 1RDDA 2ZD1A 3DLKA 3SI6A 5J2QA 1S6QA 3SLCA 4JI2K 3R1XA 5KTQA 3G6EN 4L8RB 3KK3A 2ASMA 3OYAA 3OYGA 4DTNA 3VN5A 5J1EA 3TAPA 4K0KK 2EWSA 1OH5A 3LWMA 4LY7A 4FWLA 4FPAA 2NRHA 1OKJA 5HBMA 5CR4A 3LPUA 3QFPA 4F8RA 1JCGA 4JI3K 4FZXC 1EQYA 1VSHA 4WQ4C 3LDPA 4DV6K 5E84A 4OKKA 3BZKA 1IJJA 3K58A 4JKFA 5I42A 3TR8A 3FE1A 3MCAB 3V1RA 1GLJO 2UXCK 3CCSN 1T3VA 3G25A 5LMUK 4IJAA 3SYZA 1S1XA 5LY3A 3QB0A 1VAZA 5GADP 4O0JA 2QWLA 3TSPA 4CZHA 3KWGA 2ZF5O 3OS2A 4JRQA 5HRNA 5CY4A 3RMCA 1HQEA 3H1QA 1K73O 3HT3A 4Z94A 3TSQA 1L5UA 3AAQA 4PKGA 1TL1A 3DLRA 3TAGA 3AO2A 4JN4A 3MK6A 1KVCA 3L4IA 4KHWA 1NGBA 1IBMK 1VK0A 3QO9A 2HMIA 3LP2A 4DLEA 3NVKA 4EFHA 5TKWA 3KZBA 3DXKB 4JKDA 3B6OA 3LM9A 4JI5K 4C8LA 2HHTA 4C1NI 4K41A 2O8CB 3BF1A 2E6MA 3PO5A 2F9TA 1U2VA 3CCQN 4B1ZA 4BY9C 2HVHA 4DV1K 4F2RA 3DM2A 3T3FA 4BWJA 3RR7A 2FC0A 3CM6A 3M5RA 4BRHA 4UY8O 4CJVA 1I94K 1BCOA 2DTUA 2XY5A 1QTMA 2I7NA 4IO8A 4OPHA 4FJ7A 4DV7K 1C1CA 4RW6A 5M1FA 3E66A 3WXIA 5AZIA 2W41A 4KO0A 4FJXA 4EAHD 2F8SA 3R8EA 5AZIB 4KREA 4EIAA 1D5AA 2FBTA 4LH4A 4IFEA 5KGXA 1RBRA 1R0AA 4C8MA 5LJWA 2NZTA 4JI1K 3EO3A 2GUIA 3NGYA 3VGKA 3K5LA 4A2AA 2PYLA 4B9MA 3VQEA 4IOCL 3D0PA 4CEOA 1HYZA 3QINA 4M7XA 3O9QA 4B9UA 4MDBA 3QEPA 3ENOA 4HWIA 1NGHA 3K59A 2ITGA 3AA4A 4KH4A 1C1AA 5JICA 1L3VA 3ASMA 2GELA 4KH6A 3OBYA 4NO7A 5D3GA 4B8CA 2ZQBA 1A5XA 3UKRA 3AVLA 4WFBL 1VQON 3HSCA 4CJUA 2DFEA 1LCUA 2VG6A 3PLAA 1WOQA 2Q3SA 3CF5L 3KHYA 2FXUA 1WN7A 2QM1A 3ALYA 3K9KA 2D0PA 1VSFA 4BC5A 4KHNA 4YORA 4YFUA 3O9SA 1WBDA 4CEAA 4FVMA 3L2UA 4G1QA 4JS4A 3E01A 2IAJA 1TK5A 3SBGA 1VQLN 1Q81O 4ISGA 1NGCA 3VEXA 3C6TA 4JEPA 4BRCA 3CIPA 3V1QA 4B3RK 4MO5A 4NYNA 5A2QO 1NK7A 2A6AA 4IZ9A 3P39A 3HBTA 4C1NK 1Y64A 3ZSQA 4EP5A 3SUQA 1IBKK 3VGMA 3ZSOA 1GOAA 1O13A 1RDUA 2IGIA 2O4GA 3DLBA 2NRXA 2BTFA 4QAGA 1Q7YO 2VWBA 4KKOA 3NBPA 1YUWA 4CGGA 4BRFA 3VGLA 4MLEA 2WC9A 3E1YA 1NGEA 4AM6A 2CGJA 1ZBLA 4PA1A 4FLWA 4TSXA 1E4GT 3LAMA 1NGJA 2A5XA 4FK0A 4KRFA 3P1GA 4HHTA 1MDUB 2A42A 1HNVA 3C6HA 4E1MA 2AP1A 4BREA 5BR8K 3O3FA 3E9LA 4KPYA 1JLAA 2NRRA 3AO5A 1C0MA 1VQNN 3DLLL 1RTDA 4JI0K 2HHVA 1EX4A 1Z25A 3DMJA 3CCRN 2UUBK 1M90O 2OTJN 1T6DA 3OYEA 4KB0A 1XNQK 5EOYA 1S1WA 2OPPA 4KHUA 4BWMA 2YNGA 3MN5A 3L4QA 4FOEA 3OJSA 3NVMA 4B9SA 3DWLA 4BE1A 3FFIA 1W9HA 2B5JA 3JSMA 2ASOA 1QHAA 1Q86O 3HPHA 2QWMA 3UKRB 3D2FA 5ADXH 3JXUA 5AQZA 4PQUA 4AHCA 4JKEA 3SZ2A 4N56A 1OH8A 3V9UA 5KI6A 3WXLA 3PV8A 3O4WA 4DR4K 2DY4A 3OYKA 4IXCA 2Q36A 3CFPA 2B4JA 1KLNA 1RDAA 1HJRA 4XIUA 1KQSM 4EZ9A 2BDPA 3FZKA 3O3HA 2HW3A 4BQLA 1RT1A 2P9KB 4ISFA 3SNNA 3IG1A 2O8EB 1JKHA 2P9KA 4JI8K 4CJPA 2QWPA 1K9MO 2GV9A 4QOZB 4B9QA 3AO1A 3OY9A 3OVNA 2V7YA 4W5OA 4JKBA 1WSEA 3AVJA 4DSJA 1YVNA 2FBYA 2XRIA 5F0XA 1YVUA 2HHSA 3IMXA 3O4NA 5J2PA 1L3UA 1WSHA 3DAWA 4IOAL 3R9PA 4DSKA 2D4WA 4DR3K 1XC9A 1X3MA 3V81A 4CZFA 4LSLA 4O44A 2ZWHA 1H1VA 4CGIA 4CHNA 3CC2N 1JL1A 4B08A 5IWAK 1YF5L 5C10A 5FRNA 4CJ4A 3VESA 3ZT1A 3AO3A 4FLTA 5AQQA 1UAXA 2GEMA 3SUPA 1HPMA 2O8DB 1D8YA 3C65A 3OYNA 5AJ3K 3T7ZA 5BRHA 1MA9B 4XH1A 3LPTA 3W3DA 4B1WB 3U3GA 3HVRA 4FSVA 1KAZA 1CXUA 4E7HA 4GVEA 3NH0A 4QS8A 1YJ9N 4AHRA 2HNDA 4Q5VA 3RR8A 1J9AA 1FKPA 3ATVA 3H3NO 5C2FA 1HKBA 1KC8O 2OCEA 5BPLA 3N4QA 3K5NA 3VQCA 3DLHA 1VSEA 4M3TA 4FJ9A 4I6MA 1T03A 4DV0K 2X6NA 4DU3A 4K8XA 2KFNA 1ASUA 3WXMB 1RCHA 4Z0UA 3ZX2A 4H0TB 5AZJB 4AHTA 1XUPO 1IO2A 4DLGA 4GV9A 1WUAA 1JLQA 4IKFA 4N76A 1B92A 2RKIA 3I33A 1BO5O 3FZFA 1VSLA 3VEWA 1BUPA 3CERA 4G9ZA 4GMJB 1QE1A 4DG1A 4E89A 1SUQA 2A1SA 2J4RA 3WEEB 3CFOA 4FW1A 1FKOA 2HOEA 5DK5A 1MWKA 4K25A 4YOTA 4CJ5A 1NOZA 3V6DA 4OPKA 3OYJA 4CFDA 1T05A 2YX6A 4E7LA 3AVIA 3E9PA 4CF8A 1EWRA 4CW7B 5HLFA 2OTLN 1RTIA 4IDHA 3D2EA 1XWLA 3L2VA 1YT3A 4K42A 4DFJA 2OZMA 1XNRK 2IVOA 3ENBA 1C0GA 1VHXA 3PSIA 3ZSRA 3KJVA 1Q9XA 4FW2A 3AVFA 3RWUA 4CE9A 3EEQA 4FWPA 5BREA 2QK9A 4KAZA 3AV9A 1ESVA 3S3OA 1L3TA 2VWJA 3PIOL 1FK9A 3CJAA 3VEVA 4JK8A 4DR2K 4M3RA 4BC4A 2HF3A 3HP9A 4FM1A 2HVIA 3WUHA 1FW6A 2HHUA 1HYSA 5SWMA 4FWQA 3B6PA 5CZ1A 4FJ8A 3CCMN 2QKBA 4MDAA 1NKEA 1TKXA 3CYMA 4H5VA 1C0FA 2VWKA 3DXMB 3AVMA 4R79A 3OS1A 2D1KA 3M8RA 2UUAK 5JS1A 2HNZA 4HCBA 1U49A 3L6QA 1BI4B 4CEBA 2A41A 4FL9A 3ATUA 3KWIA 1NK0A 3KK7A 2F7TA 1HPZA 3UB5A 2VYPA 2X78A 4DUYK 4BRGA 4E7KA 3L0QA 4CIGA 1IG8A 3TTDA 4DV3K 4HVJA 3F9KA 1RT4A 5E41A 3ZT3A 5AQPA 3QEWA 4B3MK 4MFBA 1TVRA 2QWOA 2YHXA 4ILGB 3L2WA 1SKSA 4JI6K 4CJLA 4H03B 1RGIA 4CESA 4CZLA 4JNEA 1JJ2M 1JXBA 1WSGA 4CEDA 5GIOA 4M3ZA 4M3XA 3DYAA 1WSJA 4V19S 3VQDA 5KPRA 5IT9O 2KZMA 1VSIA 4PKHA 1ASVA 2W42A 3KD5E 1BQNA 4DQQA 1TUUA 3HL8A 1RT2A 4JYAK 3CJCA 1RBTA 4K8ZA 3SUOA 4A2BA 3ULEA 3ZSZA 3PX4A 2W6LA 4DUZK 1XHZA 3FR0A 4IWVA 1TYQB 1V4SA 1YI2N 2CH5A 2D0OA 4DWIA 2WBNA 4A61A 4H0OA 3LDNA 1ITGA 1KAYA 4BDZA 4EHUA 5AQMA 1A5WA 3H6EA 2Q0RA 3CPWM 4YOXA 3HRGA 4FPBA 3QBXA 3TANA 3V9ZA 4JD2A 4I2PA 4DTXA 5GIPA 3S41A 3M3ZA 3IKMA 3VMFB 4WCEL 4HUGA 4B9LA 2O8DA 1IBLK 3RSEA 2YCHA 3LP1A 4AH9A 4H5NA 1SKRA 4I9QA 4Y1CA 2A3ZA 2ZJRL 3VQ9A 3K5OA 2HHHK 2UU9K 3TWHA 2NLXA 4FJKA 5KGWA 4E1JA 3D2FB 5EVZA 1UA0A 3TSUA 1BI4A 1GLDG 4CHOA 4O8UA 2YJEA 4CGJA 3Q7CA 3S3NA 3NH2A 1BQMA 3UKUA 1YAGA 1UOCA 1ZBHA 3AVGA 3OHRA 4MO4A 1VQMN 2Z1IA 3ZYYX 2E2OA 1CXQA 1Z26A 1HYVA 2VGNA 2IVPA 3QIOA 3LM2A 2NRVA 4DS4A 3RRGA 1DGKN 3WEEA 5KQ8A 3D6RA 3K2PA 1NU0A 2XO7A 3ITHA 5C42A 2W40A 3CI5A 5CYMA 3HM8A 5M1OA 1NGGA 2OPRA 4JHDA 3NE6A 2QEXN 1VQ9N 4FXDA 5AQWA 1BOTO 1QHTA 4F3OA 3MEDA 4JV5K 4M42A 1RBUA 3M1FA 1J53A 4UQGA 2GWKA 4DF4A 3SBTA 3AA5X 2G8KA 4A59A 4RW8A 1BIUA 3NCIA 4DTJA 3ZCMA 5F1XA 1X9MA 1W97L 4DU1A 4YOVA 2Q2RA 1HLUA 4YNQA 4KTQA 4EHTA 4E0DA 3T19A 2VQEK 1RFQA 4FO0A 3J7AP 2G8IA 2Y1IA 2DFHA 2V51B 2VGMA 1E4FT 3OTOK 1TKDA 1R59O 3VERA 5AQXA 4DFPA 1C0UA 1EKEA 5JMVA 4O4GA 3PSFA 1NJYA 4FLZA 2XY6A 2UXBK 4LF9K 3NF8A 4CJWA 4XH5A 5I3UA 3MECA 2O4IA 3DXMA 3VQBA 2YKMA 2X74A 3J7YP 2W6KA 1CZAN 3ID8A 1FXXA 4H5TA 4A5AA 3ENHA 2QKKA 4DTSA 4IDKA 3G0ZA 3F73A 1B9DA 2YNFA 3JYTA 3VF6A 4GY2B 4ELTA 1NJZA 1HKCA 4KFBA 5GAHP 4CIEA 2YV0X 3WNFA 2KFZA 3U9DA 1OVYA 4DCHA 2AA4A 3HZ6A 2YKNA 3VTIA 1JLFA 5CZ2A 5K14A 2E4LA 1QQCA 3C0BA 4BDPA 2HBMA 4IFVA 3OYBA 4OPAA 4JI7K 2O8CA 4FWMA 4DV5K 3O4QA 4YHHK 4IOXA 2BANA 4CF1A 3THXB 3TPQA 3AVHA 1ZBUA 3H3OB 4I9LA 3M8QA 4ILHA 3VA3A 3QMLA 1NK4A 3C94A 3O9UA 4WF9L 4OKEA 4DSLA 3VQ7A 2PY5A 3HP6A 3SPYA 3QETA 3WNEA 4CF9A 2VG5A 5C25A 4BRPA 4BC3A 1JLCA 3A5MC 1XQSC 4NLBA 4HCCA 3ULEB 3EZ5A 2Z1HA 3QNOA 3MMVA 1HQUA 2BGGA 1EO1A 2NRWA 3VQ5A 1RNHA 3CJBA 2ZGYA 4B3OA 1BU6O 4LFBK 1TUYA 5AQNA 2IC3A 2RN2A 3OYFA 4DFMA 3O9TA 3HI0A 5GAGP 5HRSA 4GNIA 5JVHL 3CQ8A 5EX5A 4DR5K 1NNEA 4M7YA 3QERA 1KTQA 2GTDA 4B1VA 1J5EK 4NXMK 1N36K 3WXJA 1BDGA 5AQTA 3J8AA 1IKVA 5AQSA 2YHBA 3N4PA 3VQQA 3AVBA 1NKBA 1Z05A 1NK6A 3M8SA 4JI4K 1HNIA 4LF4K 1WLJA 1YXQA 1BG3A 1JLGA 4H4OA 4C23A 5AQIA 1TK0A 3BZCA 3KLIA 1RBVA 1NG9A 3LP0A 4FK2A 5HOOA 4OLBA 4H0PA 1S6PA 3VEOA 3KLGA 5AFUA 3ZEUB 4CF2A 1VSKA 3WQTA 2Z1JA 1HR0K 3UKUB 3VEZA 3P38A 2G8FA 1EXQA 1IH7A 4WQ4A 5FRMA 4FYDA 1S22A 1JLEA 4H0YB 2HMPA 4CIFA 3MXMA 5AQKA 1TAUA 5TKYA 1XC3A 3ZT2A 4FJJA 2O8BB 1X1PA 1YJWN 1KD1O 1U4BA 1L3SA 2E1ZA 4DV4K 4H0VB 1HRHA 3QDKA 3NGIA 1LWFA 1D4XA 2QWRA 1KAXA 2AJQA 5C12A 2BE2A 1DTTA 4BR0A 5EU7A 2Q31A 4YDUA 4B9VA 3A5NC 3MN9A 5AQVA 1RDCA 4BG9A 5FPDA 1D9DA 4Z4GA 3Q7BA 4E1NA 4DU4A 2FF6A 3C6AA 4FCYA 1YIJN 2ZM6K 3CHWA 3AGRA 3QFUA 3GG4A 4B3SK 4PKIA 3AARA 4DF8A 1HKGA 1EWQA 4RCHA 2QWNA 5JS2A 2UXDK 3U3YA 4CJRA 1ZC6A 4KHQA 3D2EB 5BN8A 2YHYA 2WUSA 4KI6A 3HO1A 4EZ6A 4F4KA 4M3WA 3EL2A 4HUFA 2BH1A 4CJ3A 3MXIA 4AHSA 4KHYA 4CFBA 1RDWX 4BR9A 3V9SA 1RDBA 4NXNK 3EKUA 4LF5K 1F21A 2YHWA 3K57A 5LMNK 3RSEB 4U67L 3U9ZA 1V4TA 3SPZA 3LDSA 1KCFA 4FJ5A 2IVNA 2WTUA 4M3YA 3VTHA 1IG9A 2F9WA 4E19A 4NCGA 5J2NA 3QICA 3AA2A 2E2NA 3GBTA 2IDOA 4NCAA 4H5RA 1NGDA 3OYIA 5FLXO 1X3NA 3HOTA 5DM7L 2V7ZA 5HL7L 3AAPA 3MN6A 3MN7A 3RMAA 1MU2A 4WYBA 5AQYA 1GOCA 4OGCA 1GLFO 2OZSA 1S1TA 4O55A 4RW9A 1SV5A 1QZ5A 2FSNA 4CEZA 4CZGA 3AVCA 3KLFA 2KW4A 3KK1A 3V9WA 3L8BA 4CK1A 3AVNA 3RMBA 3PIPL 1TGOA 2IS3A 4IEEA 1OVQA 3I0RA 1X9SA 5AR0A 4CVNE 1YITN 3R3LA 2O8BA 1VQKN 2QXLA 3RRHA 2VQFK 3AVKA 3VF2A 4CJTA 3BDPA 4JK7A 4E3SA 1VRUA 1IKXA 3NAEA 4PL8A 1K8AO 5FROA 3KKRA 3MAQA 5KRSA 3WXKA 2DPNA 3EE9A 4XH4A 3KTQA 2NRTA 4ELUA 1Q9YA 3TU5A 2HF4A 2XY8A 4FVUA 4FJMA 3HXMA 1FJGK 3CCVN 2QWQA 3K9JA 3ZLJA 2KQ2A 4X66K 4CJKA 3CC4N 3EZWA 5BRDA 3SK3A 1BA0A 4N47A 3DOLA 1VQPN 2WFBA 5ELZA 1KFDA 3MEEA 2QXFA 2A1RA 2JWKA 4WQ5A 4JD2B 3P83D 3KLEA 4C8KA 1SL1A 3F9MA 5AQUA 3CMAN 4AQYK 4GW6A 2YHAA 3SMPA 3QEXA 4LD0A 3CXCM 1N34K 2PAVA 2GUPA 4FLVA 5M1PA 1I39A 3B8AX 3I55N 3IDHA 4FLXA 3E9OA 1C6VA 4W5RA 3VQ4A 3LDLA 1SKWA 2JLEA 3M8PA 5KQDA 3OYHA 1SZ2A 4CK3A 1Q82O 4M3UA 1N8RO 3BGRA 3A8YA 4W5TA 4OX9K 3CG7A 1IV0A 4JKGB 4JKAA 4O8KA 3P31A 1KRPA 2P5OA 5C24A 4I7FA 3EN9A 4DKWA 3THVA 3A5OC 4BDYA 2OPQA 5H1SQ 3A0IX 3GL1A 1HNZK 4CZIA 1WSFA 2ZJPL 1KSPA 1ILYA 1LW0A 4BVPA 1VRTA 4K43A 4FJHA 1WNSA 4BRKA 3O6WA 3SJJA 1T6CA 1DT9A 3HSTB 5JVGL 3I8DA 1RTHA 1GLAG 5AQRA 2O8FA 4F9OA 4FM0A 4LC9B 3F2KA 5SZTA 1M1KO 2O8EA 4AF1A 4BVOA 2O8FB 2HB5A 1WAJA 3OW2M 1UA1A 3SJHA 1J6ZA 3VETA 2OANA 1HX1A 5AQFA 5HP1A 2P5GA 1TAQA 1LAWA 1YJNN 3AGKA 1VQ4N 1P8ZA 3WNGA 5M1NA 3EYZA 3RVCA 1ZYQA 1QS4A 3ZSWA 2CH6A 2F4VK 5CE3A 2KTQA 4HTUA 3TI0A 3ZX3A 2UUCK 4ISEA 4H5WA 4ZHRA 3CPEA 4CCHA 4O5FA 4CD1A 4CGFA 1N33K 4C8OA 3NH1A 1N6QA 1HNXK 2RE2A 5T7BA 3TTFA 3T1YK 3A2FA 1D9FA 1U04A 1HUXA 2E20A 4MLHA 4OO1J 1KVAA 3MX2A 4CBXA 1QSYA 2NRZA 5BPNA 2YI1A 3F5TA 5AQHA 4KTZA 3CJ9A 4BRAA 3V1OA 3HM9A 1GOBA 3KKSA 1DEJA 2FSJA 4W5QA 4BGAA 1U6ZA 3T69A 3FZLA 1NJXA 2P9SA 3C7NA 1LV5A 4BR4A 3BF3A 2IOCA 4CBWA 4CJSA 4DHYA 3SQ2A 3H1VX 3THXA 3WNHA 3QEIA 1LAVA 2HNYA 2JWLA 1K6YA 4ILJA 3D45A 3I8BA 4IFYA 3LL3A 1NM1A 3ZT4A 4AM7A 4CHYA 1QVGM 4CEEA 3OJUA 2PFUA 2P9LA 4B1XB 2D0CA 1CZ9A 4N5SA 2E88A 2V52B 2KLAA 4BG8A 4JAXA 1S72N 5C15A 4DR7K 2ASPA 2FBXA 5FDLA 1WB9A 3NF7A 3GE1A 4LF8K 3VOVA 3VQAA 2E5LK 1U45A 4L3QA 5GINA 1G99A 1I3AA 4DSIA 4DQPA 2F96A 4CBUA 4LSNA 2LSNA 2FF3B 4AILC 3VQPA 3PX0A 4DSFA 1ATSA 1NMDA 3R6MA 5AQJA 4GKJK 2P9NA 3U6FA 2HHWA 1IKWA 4FWSA 5FPNA 3IRXA 3VPZA 2P9NB 2ZE2A 4CK2A 4DFKA 4BRQA 3V4IA 2P9IA 3CQXA 3JAMO 4NCBA 3OS0A 3G71N 1T8EA 3KLHA 2HBJA 3TARA 1WSIA 3LALA 5J2MA 3MCPA 3AY9A 1NK9A 3VEYA 1NJWA 1S3XA 4FWKA 1A5VA 3L2QA 3BY5A 4DSEA 4J8FA 3TTCA 1X9WA 1U47A 1TV6A 4H4MA 5BN9A 1ZBFA 1T44A 2YJFA 4CFCA 1YHQN 3VQ6A 4XEIA 1GLLO 4FM2A 4IG3A 5FPEA 1S9EA 4I2QA 3GOIA 3QBWA 4CGDA 2WONA 4CZKA 1TKZA 1JXEA 3THYA 1S1UA 3EKSA 4C8NA 2CGKA 2I5JA 3DI6A 4KI4A 3CCEN 4IG0A 2HSTA 3ZSVA 4J2EA 1BA1A 1W2BM 2ATQA 1J54A 5KPTA 1NGFA 2Z1GA 5LL6Z 3HOSA 3HTVA 3IAYA 4A57A 3FLCO 3BP8A 4BRIA 5AQOA 1DLOA 5C2DA 5M1QA 5C0YA 1EETA 1BGXT 1GLCG 1NBWA 4O5BA 1NK5A 2XY7A 2FBVA 4EP4A 2GWJA 3QEVA 3NHGA 3CM5A 4DS5A 4CJEA 3THWB 3TAEA 1BISA 1JCFA 3LP3A 2NUBA 4B8AB 4A5BA 1NMNA 4CHPA 5EXWA 4PWDA 1KLMA 3HJFA 4B1UB 3C6UA 3CMEN 4RG8A 4CJQA 1VSMA 5AQGA 1ZBIA 1QSLA 4BGBA 3JS6A 2H3GX 3RMDA 4HTLA 4J2BA 3K0SA 4KH5A 4CI6A 5KPZA 1HMVA 2QW9A 2G8VA 2A40A 3MEGA 5HROA 2D0BA 2PYJA 1BIZA 3QIPA 2P9IB 3HK2A 3HPGA 2P9PA 1VSDA 5B8HA 3HPOA 1LWEA 3VENA 4OGEA 4QCLA 5I9EB 4E7IA 2D5RA 3ISNC 3CD6N 4QS9A 1BL3A 3PY8A 2HBLA 4BROA 4DR1K 4IBNA 2EX3A 3J80O 3LAKA 3SAGA 4YY3K 1NOYA 3J7ZO 4DQSA 3CQYA 4RW4A 5HRPA 2P51A 1RILA 3FFKB 2QTDA 3SMSA 1XI1A 3VQ8A 3LWLA 1WBBA 3CCUN 1QQOA 1QZ6A 5DMRA 1OH7A 2P9SB 4OLAA 3C7NB 4OKJA 4ICLA 4BR2A 3S3MA 4FK4A 1SL0A 1SQKA 4JKHA 1ASWA 4NLCA 3WQUA 4DTMA 1P90A 1QVFM 1N32K 2UYTA 3O1WA 4B9TA 3HVTA 4Q0BA 2ZJQL 1RT5A 3NFAA 4PL7A 4Z4IA 3QESA 1E3MA 1KVBA 3FGUA 4MQ3A 4DB3A 5MLCQ 2JGUA 1VQ5N 3CCJN 4DMNA 1X9JA 2PBDA 2R7YA 2RHKA 3MXJA 3CETA 3O80A 4CD3A 4Z4FA 4R5PA 3A5LC 1HJOA 4CHQA 1VQ8N 3D7EO 4X62K 3I0SA 1JCEA 4FJNA 4FOIA 1VQ6N 4BRNA 1T7PA 5LJVA 3LZIA 4Y0WA 1ATNA 3BUZB 4FWNA 1JL2A 5DM6L 1NLVA 4IEIA 3L3VA 2OA8A 1SS6A 1UWBA 2D0AA 3VF4A 1XHXA 3L3UA 2E1YA 3IFRA 2B6AA 3AO4A 2E2PA 1MWMA 2VG7A 5E26A 3SAFA 1U48A 1ATRA 3PO4A 1GLBG 4KTWA 4ELVA 4LFAK 5M1KA 1DTQA 4FLUA 4JLHA 4O0IA 4ID5A 4CFAA 3UE5A 4Z4EA 2X6SA 3DRRA 1LWCA 3EE8A 1VSJA 4YOWA 1KFSA 1IKYA 4KHSA 4AHUA 1JLBA 4QS7A 1N5YA 4ID1A 4F2SA 2E2QA 4BACA 3ZEUA 4CEQA 2YNHA 4LF7K 4GVMA 4PUOA 3ZETB 1C1BA 2Q97A 1S5JA 1HNWK 4FZYA 3P5JA 2OPSA 2P1JA 3CJ1A 4LF6K 2KZZA 1NK8A 1RT3A 3QLHA 4H0XB 4BQZA 2QA4N 4I6MB 2VCPA 2GBZA 1BCMA 2G8HA 3GDQA 4CERA 4CECA 4YOUA 2RF2A 1RT7A 5AZJA 3O9RA 3DRSA 3TAQA 3H45C 3DLEA 1Q8IA 2F8TA 3ULDA 4CEFA 2HBKA 4B9NA 3QNNA 3MWPA 3SAHA 4JKCA 3J81O 3SCXA 1TKTA 4DTRA 5JLHA 2KKZA 2HHXA 1K8KB 3IUCA 1NGIA 2FSKA 3MWTA 4WFAL 2Y1JA 4CJ7A 4Z4HA 5HRRA 3THWA 3NF9A 1RT6A 3OYDA 4LH5A 4JS5A 4FLYA 1LW2A 3I56N 3CFRA 3C95A 3U8XA 4DTOA 2WOMA 4NYFA 3V9XA 5FPMA 4FWRA 2P9UA 2HHQA 3SQ4A 4KBOA 2E6LA 4GKKK 4PY5A 3MDQA 3S9HA 2G8UA 4GV6A 2PZSA 3O8MA 4CZMA 1Q18A 4IJNA 3T1AA 4FWOA 3LDQA 3W0LA 3OA9A 3SQ1A 1Y97A 4RTFD 2KHOA 4B3TK 3DJCA 4CF0A 3BEXA 5CYQA 4BE2A
chains in the Genus database with same CATH topology
3FZMA 3DXMA 5EOYA 5BR9A 4NB4A 4DQ8A 3MN5A 1CZAN 3ID8A 3L4QA 4FOEA 4H5TA 4WFNL 1HUXA 2E20A 3NVMA 3ENHA 4MLHA 4A5AA 4GV3A 4OO1J 3DWLA 3MX2A 3VF6A 4GY2B 4CBXA 2ASOA 3MX5A 1HKCA 1QHAA 1Q86O 4JKGA 2NRZA 2CGLA 2QWMA 3UKRB 5BPNA 5GAHP 3D2FA 4M63C 3WT0A 5ADXH 3ZETA 2YI1A 3F5TA 3JXUA 5AQHA 5AQZA 3CJ9A 4JKEA 3SJHA 3U9DA 4BRAA 3CC7N 1OVYA 4DCHA 2Q1NA 2AA4A 3HZ6A 1ZBSA 3VTIA 1DEJA 1NWKA 3C0BA 2FSJA 3WXLA 2HBMA 3O4WA 4OPAA 3O1BA 4BGAA 1U6ZA 3T69A 1GLEG 3FZLA 2Q36A 4FWMA 4IXCA 2P9SA 4U7BA 4IOXA 3C7NA 5GAEP 1KQSM 4BR4A 3BF3A 1Z6RA 4CBWA 3FZKA 4BQLA 3TPQA 2P9KB 4ISFA 4DHYA 3H1VX 2I7PA 3H3OB 4WQ5C 1U2VB 2P9KA 4ILHA 3QMLA 2JWLA 5JLFA 3O9UA 4JHDB 3P4IA 5CHIA 4WF9L 4ILJA 2QWPA 1K9MO 3I8BA 3LL3A 4B9QA 5EY4A 3M6GA 1NM1A 4AM7A 1QVGM 1NGAA 4BRPA 4BC3A 4PHTX 3A5MC 2NNWA 2V7YA 2PFUA 1S72N 1XQSC 4JKBA 2P9LA 2ZGZA 4B1XB 4NLBA 3CCLN 3ID6A 1YVNA 2E88A 3ULEB 3NMUA 1K8KA 2KLAA 2V52B 3O08A 2P9LB 3MMVA 3LDOA 3IMXA 2ASPA 4JAXA 4BG8A 2Q0UA 2BUPA 5C15A 1EO1A 2NRWA 1KXPA 4BR7A 3CJBA 3DAWA 4IOAL 2ZGYA 3GE1A 3R9PA 3VOVA 1BU6O 4BRMA 2D4WA 4L3QA 5GINA 1X3MA 1G99A 1TYQA 1TUYA 4CZFA 1NJIO 4CBUA 1QQNA 2P9UB 5AQNA 2ZWHA 1H1VA 5AFUH 5BRFA 4YDUC 2FF3B 3CC2N 3KVGA 3OBWA 3O9TA 3HI0A 5GAGP 1ATSA 1NMDA 1YF5L 3R6MA 4GNIA 5AQJA 2P9NA 4BR5A 5C10A 5JLHA 5JVHL 5EX5A 4FWSA 4M7YA 5FPNA 1DKGD 3VESA 3VPZA 2P9NB 2GTDA 4B1VA 5AQQA 4BRQA 2GEMA 4BRDA 1HPMA 1VQ7N 3WXJA 2P9IA 3CQXA 1BDGA 5AQTA 4A62A 3J8AA 2P9PB 5AQSA 3N4PA 1QQMA 3C65A 1SAZA 1Z05A 2IIRA 1BWFO 3G71N 3T7ZA 5BRHA 1MA9B 2HBJA 4XH1A 3CJ7A 2GX9A 2FLOA 3W3DA 4B1WB 5ADXA 3U4LA 5BPMA 3MCPA 3AY9A 4FSVA 3VEYA 1YXQA 1BG3A 1KAZA 1S3XA 5AQLA 4CZJA 3O5BA 4FWKA 4C23A 5AQIA 4GVEA 4QS8A 1YJ9N 4J8FA 3TTCA 5HOOA 4BC2A 3H3NO 3ATVA 4H0PA 5BN9A 3VEOA 1HKBA 5C2FA 2QI2A 1KC8O 1T44A 5AFUA 2YJFA 3ZEUB 5BPLA 3N4QA 3WQTA 4RWTA 1YHQN 3H46O 1GLLO 4XEIA 3UKUB 2E8AA 3VEZA 5FPEA 3P38A 4WQ4A 4I6MA 1S22A 3DXKA 4H0YB 2HMPA 3GOIA 4JK9A 3WXMB 4YOYA 5AQKA 3QBWA 4H0TB 5AZJB 3ZX2A 1XUPO 5TKYA 1ZXOA 1XC3A 4CZKA 4GV9A 1WUAA 1YJWN 3EKSA 3ZX0A 1KD1O 2CGKA 4IO9L 2E1ZA 5F2RA 4H0VB 3I33A 1BO5O 3FZFA 3QDKA 3VEWA 4B1YB 1BUPA 3CERA 2HSTA 2ITMA 3FZHA 4CZEA 3CCEN 4BRLA 1D4XA 4G9ZA 3G4SN 1BA1A 1LOTB 1W2BM 2QWRA 1KAXA 5C12A 2J4RA 3WEEB 5KPTA 1NGFA 3HOSA 4BR0A 2HOEA 2Q31A 3HTVA 4YDUA 1MWKA 4K25A 4YOTA 4A57A 3A5NC 3MN9A 5AQVA 4BG9A 5FPDA 3FLCO 3BP8A 2YX6A 3Q7BA 3SLCA 5AQOA 3R1XA 4BRIA 5M1QA 5C2DA 5C0YA 3G6EN 2FF6A 1GLCG 1NBWA 2ASMA 3C6AA 3E9PA 1YIJN 3CHWA 3AGRA 2GWJA 3QFUA 2OTLN 3GG4A 4PKIA 3AARA 2EWSA 1HKGA 3D2EA 4IDHA 4RCHA 2QWNA 4FWLA 1ZC6A 4FPAA 4K42A 1JCFA 2NRHA 1OKJA 2YHYA 2WUSA 3D2EB 2IVOA 3ENBA 1C0GA 5CR4A 5BN8A 3QFPA 1JCGA 3EL2A 4A5BA 2BH1A 5EXWA 1EQYA 4WQ4C 4FWPA 4B1UB 5BREA 1RDWX 3LDPA 4BR9A 3CMEN 1ESVA 5AQGA 3EKUA 5E84A 4BGBA 3PIOL 2YHWA 3CJAA 3JS6A 3VEVA 4JK8A 2H3GX 4HTLA 3RSEB 4U67L 3U9ZA 1IJJA 1V4TA 4KH5A 4BC4A 4CI6A 5KPZA 2HF3A 4JKFA 2IVNA 2QW9A 3WUHA 2A40A 3FE1A 3VTHA 2F9WA 3MCAB 2P9IB 1GLJO 3QICA 4FWQA 2P9PA 5B8HA 2E2NA 3GBTA 3CCMN 3CCSN 1T3VA 3G25A 4H5RA 4MDAA 4IJAA 3VENA 1NGDA 4H5VA 1C0FA 5I9EB 3DXMB 3QB0A 1VAZA 4R79A 5LY3A 1X3NA 2D1KA 5GADP 3TSPA 2QWLA 3HOTA 4CZHA 3CD6N 5DM7L 2V7ZA 5HL7L 3AAPA 2ZF5O 3KWGA 3MN7A 3MN6A 3L6QA 4WYBA 3H1QA 5AQYA 1K73O 4QS9A 1GLFO 4Z94A 3TSQA 2HBLA 2A41A 3AAQA 4FL9A 4PKGA 4BROA 1QZ5A 3ATUA 2FSNA 3KWIA 4JN4A 3KK7A 3MK6A 3L4IA 2F7TA 4CZGA 3UB5A 3SAGA 3J7ZO 2VYPA 1NGBA 3CQYA 4BRGA 3L0QA 3FFKB 2QTDA 3SMSA 1IG8A 3NVKA 3PIPL 4EFHA 3TTDA 4IEEA 5F0XA 5TKWA 1QQOA 1QZ6A 3KZBA 3CCUN 3DXKB 2P9SB 4JKDA 3C7NB 3LM9A 5AQPA 4BR2A 5AR0A 4C1NI 4K41A 1YITN 3BF1A 1SQKA 4JKHA 2QWOA 2YHXA 2F9TA 3R3LA 4ILGB 1U2VA 3CCQN 4B1ZA 4H03B 1RGIA 4CZLA 1VQKN 2QXLA 4BY9C 4JNEA 1JJ2M 4NLCA 3WQUA 5GIOA 1P90A 1QVFM 3M5RA 3VF2A 2UYTA 4BRHA 3O1WA 4UY8O 4JK7A 2ZJQL 4PL7A 4PL8A 2I7NA 4IO8A 4OPHA 5KPRA 3FGUA 4PKHA 4DB3A 5MLCQ 1K8AO 3WXKA 2DPNA 5M1FA 3E66A 3CCJN 3EE9A 4XH4A 3WXIA 1VQ5N 1TUUA 1X9JA 5AZIA 2PBDA 2W41A 2NRTA 2RHKA 3CETA 3O80A 4CD3A 3CJCA 4EAHD 3A5LC 3R8EA 5AZIB 3TU5A 2HF4A 1HJOA 1VQ8N 4EIAA 4A2BA 3ULEA 4FVUA 3D7EO 1JCEA 3CCVN 4IFEA 2QWQA 3K9JA 3FR0A 4IWVA 4FOIA 1TYQB 1V4SA 4BRNA 1VQ6N 1YI2N 2CH5A 5LJVA 2D0OA 5LJWA 2WBNA 4Y0WA 2NZTA 4H0OA 4A61A 3CC4N 3LDNA 1KAYA 3EZWA 3EO3A 1ATNA 3BUZB 4FWNA 4EHUA 5BRDA 3VGKA 5DM6L 3SK3A 1NLVA 4IEIA 5AQMA 4A2AA 3H6EA 1BA0A 2Q0RA 3CPWM 1VQPN 1SS6A 2WFBA 4YOXA 5ELZA 3HRGA 4FPBA 3QBXA 4IOCL 3VF4A 2E1YA 3IFRA 4JD2A 2JWKA 2E2PA 5GIPA 4M7XA 4WQ5A 3S41A 3O9QA 1MWMA 3M3ZA 3IKMA 4MDBA 4JD2B 3VMFB 4WCEL 5E26A 3SAFA 3ENOA 1ATRA 1GLBG 4HWIA 3RSEA 1NGHA 3F9MA 5AQUA 3CMAN 4KH4A 5M1KA 2YCHA 4H5NA 3SMPA 5JICA 2A3ZA 3CXCM 2PAVA 3UE5A 2GUPA 2ZJRL 2GELA 3EE8A 4YOWA 5M1PA 4KH6A 3B8AX 3I55N 3IDHA 3OBYA 4NO7A 3E9OA 4QS7A 3LDLA 2E2QA 3ZEUA 2NLXA 3UKRA 4WFBL 4E1JA 1VQON 3HSCA 3D2FB 5KQDA 1SZ2A 3ZETB 1LCUA 5EVZA 2Q97A 1Q82O 3PLAA 3TSUA 1WOQA 1GLDG 1N8RO 3A8YA 4O8UA 2YJEA 3CF5L 3Q7CA 4JKGB 4JKAA 3KHYA 4O8KA 3P31A 2FXUA 2QM1A 3CJ1A 3K9KA 2D0PA 3EN9A 4BC5A 3UKUA 4DKWA 1YAGA 4YORA 3A5OC 3O9SA 4H0XB 4BQZA 4MO4A 3OHRA 5H1SQ 2QA4N 1VQMN 3A0IX 3GL1A 2VCPA 4I6MB 4CZIA 3GDQA 2ZJPL 3ZYYX 1ILYA 4BVPA 2E2OA 4YOUA 3SBGA 4K43A 5AZJA 4BRKA 3O6WA 1Q81O 1VQLN 3O9RA 4ISGA 1T6CA 2VGNA 2IVPA 3H45C 1DT9A 3LM2A 1NGCA 2NRVA 4JEPA 2HBKA 3VEXA 4BRCA 5JVGL 3CIPA 1DGKN 3MWPA 4MO5A 3WEEA 3SAHA 5AQRA 1GLAG 2A6AA 5KQ8A 4IZ9A 3D6RA 4LC9B 3P39A 3F2KA 3HBTA 4C1NK 1Y64A 4F9OA 3VGMA 1M1KO 4JKCA 4AF1A 4BVOA 1O13A 2W40A 3CI5A 1RDUA 3HM8A 5M1OA 1NGGA 2NRXA 2BTFA 4JHDA 2QEXN 1VQ9N 1Q7YO 3OW2M 1J6ZA 1BOTO 2KKZA 2OANA 1HX1A 5AQFA 1K8KB 3IUCA 5AQWA 1NGIA 2FSKA 3VETA 3MWTA 4WFAL 2VWBA 3M1FA 2GWKA 4CJ7A 3SBTA 1YJNN 3AGKA 1VQ4N 1YUWA 1P8ZA 4BRFA 5M1NA 3VGLA 4A59A 4MLEA 3RVCA 2WC9A 3E1YA 2CH6A 1NGEA 3I56N 4AM6A 3U8XA 2CGJA 5F1XA 1E4GT 5FPMA 5CE3A 1W97L 1NGJA 4FWRA 2P9UA 4YOVA 2Q2RA 1HLUA 2A5XA 3ZX3A 4EHTA 1MDUB 4KBOA 4ISEA 2A42A 4H5WA 3C6HA 1RFQA 2AP1A 4FO0A 4BREA 3CPEA 3MDQA 2V51B 2VGMA 1E4FT 3E9LA 4GV6A 3O8MA 1R59O 4O5FA 3VERA 4CD1A 2NRRA 5AQXA 4CZMA 1VQNN 1Q18A 4IJNA 3DLLL 4FWOA 3LDQA 3W0LA 5JMVA 3OA9A 3CCRN 4RTFD 1M90O 2RE2A 2OTJN 4XH5A 3TTFA 2KHOA 1T6DA 3DJCA 3BEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZM A;  3DXM A;  5EOY A;  5BR9 A;  4NB4 A;  4DQ8 A;  3MN5 A;  1CZA N;  3ID8 A;  4FOE A;  4H5T A;  1HUX A;  2E20 A;  4MLH A;  3ENH A;  3DWL A;  3VF6 A;  4GY2 B;  4CBX A;  2ASO A;  1HKC A;  1QHA A;  2CGL A;  2QWM A;  3UKR B;  5BPN A;  3D2F A;  4M63 C;  3WT0 A;  5ADX H;  3ZET A;  2YI1 A;  3JXU A;  5AQH A;  5AQZ A;  3CJ9 A;  3U9D A;  4BRA A;  4DCH A;  2Q1N A;  2AA4 A;  3HZ6 A;  1ZBS A;  1DEJ A;  1NWK A;  3C0B A;  2FSJ A;  3WXL A;  3O4W A;  3O1B A;  4BGA A;  1U6Z A;  1GLE G;  3FZL A;  2Q36 A;  4FWM A;  4IXC A;  2P9S A;  3C7N A;  4BR4 A;  3BF3 A;  1Z6R A;  4CBW A;  3FZK A;  4BQL A;  3TPQ A;  2P9K B;  4ISF A;  4DHY A;  3H1V X;  2I7P A;  3H3O B;  4WQ5 C;  1U2V B;  2P9K A;  3QML A;  5JLF A;  4JHD B;  3P4I A;  2QWP A;  3I8B A;  3LL3 A;  4B9Q A;  5EY4 A;  3M6G A;  1NM1 A;  4AM7 A;  1NGA A;  4BRP A;  4BC3 A;  3A5M C;  2V7Y A;  1XQS C;  2P9L A;  2ZGZ A;  4B1X B;  1YVN A;  2E88 A;  3ULE B;  1K8K A;  2V52 B;  3O08 A;  4JAX A;  2P9L B;  3MMV A;  3LDO A;  3IMX A;  2ASP A;  4BG8 A;  2Q0U A;  2BUP A;  1KXP A;  4BR7 A;  3CJB A;  3DAW A;  2ZGY A;  3GE1 A;  3R9P A;  3VOV A;  1BU6 O;  4BRM A;  2D4W A;  4L3Q A;  1X3M A;  1G99 A;  1TYQ A;  1TUY A;  4CZF A;  4CBU A;  1QQN A;  2P9U B;  5AQN A;  2ZWH A;  1H1V A;  5AFU H;  5BRF A;  4YDU C;  2FF3 B;  3KVG A;  3HI0 A;  1ATS A;  1NMD A;  3R6M A;  4GNI A;  5AQJ A;  4BR5 A;  2P9N A;  5JLH A;  5EX5 A;  4FWS A;  4M7Y A;  5FPN A;  1DKG D;  3VES A;  3VPZ A;  2P9N B;  2GTD A;  4B1V A;  5AQQ A;  4BRQ A;  2GEM A;  4BRD A;  1HPM A;  3WXJ A;  2P9I A;  3CQX A;  1BDG A;  5AQT A;  4A62 A;  3J8A A;  2P9P B;  5AQS A;  1QQM A;  1SAZ A;  1Z05 A;  2IIR A;  1BWF O;  5BRH A;  1MA9 B;  4XH1 A;  3CJ7 A;  3W3D A;  2FLO A;  4B1W B;  5ADX A;  3U4L A;  5BPM A;  3MCP A;  3AY9 A;  4FSV A;  3VEY A;  1YXQ A;  1BG3 A;  1KAZ A;  1S3X A;  5AQL A;  4CZJ A;  3O5B A;  4FWK A;  4C23 A;  5AQI A;  4QS8 A;  4J8F A;  4BC2 A;  3H3N O;  3ATV A;  4H0P A;  5BN9 A;  3VEO A;  1HKB A;  1T44 A;  5AFU A;  2YJF A;  3ZEU B;  5BPL A;  3WQT A;  4RWT A;  3H46 O;  1GLL O;  4XEI A;  3UKU B;  2E8A A;  3VEZ A;  5FPE A;  4WQ4 A;  4I6M A;  1S22 A;  3DXK A;  4H0Y B;  2HMP A;  3GOI A;  5AQK A;  3QBW A;  4H0T B;  5AZJ B;  3ZX2 A;  1XUP O;  5TKY A;  1ZXO A;  1XC3 A;  4CZK A;  1WUA A;  3EKS A;  3ZX0 A;  2CGK A;  2E1Z A;  5F2R A;  4H0V B;  3I33 A;  1BO5 O;  3FZF A;  3QDK A;  3VEW A;  4B1Y B;  1BUP A;  3CER A;  2ITM A;  4CZE A;  3FZH A;  4BRL A;  1D4X A;  1BA1 A;  1LOT B;  2QWR A;  1KAX A;  2J4R A;  3WEE B;  5KPT A;  1NGF A;  4BR0 A;  2HOE A;  2Q31 A;  3HTV A;  4YDU A;  1MWK A;  4K25 A;  3A5N C;  3MN9 A;  5AQV A;  4BG9 A;  5FPD A;  3FLC O;  3BP8 A;  3SLC A;  4BRI A;  5AQO A;  2FF6 A;  1GLC G;  1NBW A;  2ASM A;  3CHW A;  2GWJ A;  3QFU A;  3GG4 A;  4PKI A;  3AAR A;  2EWS A;  1HKG A;  3D2E A;  4RCH A;  2QWN A;  4FWL A;  1ZC6 A;  4FPA A;  4K42 A;  1JCF A;  2NRH A;  1OKJ A;  2YHY A;  2WUS A;  3D2E B;  2IVO A;  5BN8 A;  1C0G A;  3QFP A;  1JCG A;  3EL2 A;  5EXW A;  1EQY A;  4WQ4 C;  4FWP A;  4B1U B;  5BRE A;  1RDW X;  3LDP A;  4BR9 A;  1ESV A;  5AQG A;  3EKU A;  5E84 A;  4BGB A;  2YHW A;  3CJA A;  3JS6 A;  3VEV A;  2H3G X;  4HTL A;  3RSE B;  3U9Z A;  1IJJ A;  1V4T A;  4BC4 A;  4CI6 A;  5KPZ A;  2HF3 A;  2IVN A;  2QW9 A;  3WUH A;  2A40 A;  3FE1 A;  2F9W A;  2P9I B;  1GLJ O;  3QIC A;  4FWQ A;  2P9P A;  5B8H A;  2E2N A;  3GBT A;  3G25 A;  4H5R A;  4IJA A;  3VEN A;  1NGD A;  4H5V A;  1C0F A;  5I9E B;  3DXM B;  3QB0 A;  5LY3 A;  1X3N A;  2D1K A;  2QWL A;  4CZH A;  2V7Z A;  3AAP A;  2ZF5 O;  3MN7 A;  3MN6 A;  3L6Q A;  4WYB A;  3H1Q A;  5AQY A;  4QS9 A;  1GLF O;  4Z94 A;  2A41 A;  3AAQ A;  4FL9 A;  4PKG A;  4BRO A;  1QZ5 A;  3ATU A;  2FSN A;  4JN4 A;  4CZG A;  3MK6 A;  3L4I A;  3UB5 A;  2VYP A;  1NGB A;  3CQY A;  4BRG A;  3L0Q A;  3FFK B;  3SMS A;  1IG8 A;  4EFH A;  5F0X A;  1QQO A;  1QZ6 A;  3KZB A;  3DXK B;  2P9S B;  3C7N B;  3LM9 A;  5AQP A;  4BR2 A;  5AR0 A;  4K41 A;  3BF1 A;  1SQK A;  2QWO A;  2YHX A;  2F9T A;  1U2V A;  4B1Z A;  4H03 B;  1RGI A;  4CZL A;  2QXL A;  4JNE A;  3WQU A;  3VF2 A;  2UYT A;  4BRH A;  3O1W A;  4PL7 A;  4PL8 A;  2I7N A;  4IO8 A;  5KPR A;  3FGU A;  4PKH A;  4DB3 A;  3WXK A;  2DPN A;  3WXI A;  4XH4 A;  1TUU A;  1X9J A;  5AZI A;  2PBD A;  2W41 A;  3CET A;  3O80 A;  4CD3 A;  3CJC A;  4EAH D;  3A5L C;  3R8E A;  5AZI B;  3TU5 A;  2HF4 A;  1HJO A;  4EIA A;  4A2B A;  3ULE A;  3D7E O;  1JCE A;  2QWQ A;  3FR0 A;  4IWV A;  4FOI A;  1TYQ B;  1V4S A;  4BRN A;  2CH5 A;  5LJV A;  2D0O A;  5LJW A;  4Y0W A;  2NZT A;  4H0O A;  4A61 A;  3LDN A;  1KAY A;  3EZW A;  3EO3 A;  1ATN A;  3BUZ B;  4FWN A;  4EHU A;  5BRD A;  3VGK A;  3SK3 A;  1NLV A;  5AQM A;  4A2A A;  3H6E A;  1BA0 A;  2Q0R A;  5ELZ A;  4FPB A;  3QBX A;  3VF4 A;  2E1Y A;  3IFR A;  4JD2 A;  2E2P A;  4M7X A;  4WQ5 A;  3S41 A;  1MWM A;  3M3Z A;  4JD2 B;  5E26 A;  3ENO A;  1ATR A;  1GLB G;  4HWI A;  3RSE A;  1NGH A;  3F9M A;  5AQU A;  2YCH A;  4H5N A;  3SMP A;  5JIC A;  2A3Z A;  2PAV A;  3UE5 A;  2GUP A;  2GEL A;  3B8A X;  3IDH A;  4NO7 A;  4QS7 A;  3LDL A;  2E2Q A;  3ZEU A;  2NLX A;  3UKR A;  4E1J A;  3HSC A;  3D2F B;  5KQD A;  1SZ2 A;  3ZET B;  1LCU A;  5EVZ A;  2Q97 A;  1WOQ A;  1GLD G;  3A8Y A;  2YJE A;  4O8K A;  3KHY A;  2FXU A;  2QM1 A;  3CJ1 A;  2D0P A;  3EN9 A;  4BC5 A;  3UKU A;  1YAG A;  3A5O C;  4H0X B;  4BQZ A;  4MO4 A;  3OHR A;  3A0I X;  3GL1 A;  2VCP A;  4I6M B;  4CZI A;  3GDQ A;  4BVP A;  2E2O A;  5AZJ A;  4K43 A;  4BRK A;  3O6W A;  4ISG A;  1T6C A;  2IVP A;  3H45 C;  3LM2 A;  1NGC A;  3VEX A;  4BRC A;  3CIP A;  1DGK N;  4MO5 A;  3WEE A;  5AQR A;  1GLA G;  2A6A A;  5KQ8 A;  4IZ9 A;  4F9O A;  4LC9 B;  3HBT A;  1Y64 A;  3VGM A;  4BVO A;  2W40 A;  3CI5 A;  3HM8 A;  1NGG A;  2BTF A;  4JHD A;  1J6Z A;  1BOT O;  2OAN A;  5AQW A;  1HX1 A;  5AQF A;  3IUC A;  1K8K B;  3SJH A;  1NGI A;  2FSK A;  3VET A;  2VWB A;  3M1F A;  2GWK A;  4CJ7 A;  1YUW A;  1P8Z A;  4BRF A;  3VGL A;  4MLE A;  2CH6 A;  1NGE A;  4AM6 A;  3U8X A;  2CGJ A;  5F1X A;  1E4G T;  5FPM A;  5CE3 A;  1NGJ A;  4FWR A;  2P9U A;  2Q2R A;  1HLU A;  2A5X A;  3ZX3 A;  4EHT A;  1MDU B;  4KBO A;  4ISE A;  2A42 A;  4H5W A;  1RFQ A;  2AP1 A;  4FO0 A;  4BRE A;  3MDQ A;  2V51 B;  1E4F T;  3O8M A;  1R59 O;  4O5F A;  3VER A;  4CD1 A;  5AQX A;  4CZM A;  1Q18 A;  4IJN A;  4FWO A;  3LDQ A;  3W0L A;  5JMV A;  4RTF D;  4XH5 A;  2KHO A;  1T6D A;  3DJC A;  3BEX A; 
#chains in the Genus database with same CATH topology
 3FZM A;  5BR9 A;  4NB4 A;  3UIQ A;  4DQ8 A;  4ZTF A;  1OH6 A;  4WFN L;  3IS9 A;  3NGZ A;  1J5O A;  4GV3 A;  4KV8 A;  1CZB A;  3AVA A;  3MX5 A;  1QSS A;  4JKG A;  3H08 A;  2CGL A;  3TAM A;  3DLG A;  4M63 C;  3WT0 A;  3ZET A;  3SV3 A;  2YNI A;  3VA0 A;  2G8W A;  3CC7 N;  2Q1N A;  1ZBS A;  2DFF A;  4CJF A;  4DQR A;  1W7A A;  2RPI A;  3OYM A;  1NWK A;  4Y1D A;  3O1B A;  1GLE G;  3ZT0 A;  2ETJ A;  4J2A A;  4U7B A;  1S1V A;  5GAE P;  3OYL A;  1Z6R A;  3HYF A;  4BE0 A;  2I7P A;  3DOK A;  4WQ5 C;  1U2V B;  2XHB A;  3KIO A;  2EHG A;  5JLF A;  4JHD B;  3P4I A;  5CHI A;  4M41 A;  1S9G A;  5EY4 A;  4HUE A;  1EP4 A;  3M6G A;  4AHV A;  1NKC A;  1NGA A;  4PHT X;  3NF6 A;  3ZSY A;  3L2R A;  1W0H A;  2NNW A;  3AA3 A;  2ZGZ A;  3OYC A;  4RW7 A;  5KRT A;  3O3G A;  3ID6 A;  4OVL A;  3CCL N;  4KB1 A;  3NMU A;  1K8K A;  1REV A;  3O08 A;  2P9L B;  3LDO A;  3ZSX A;  2Q0U A;  2BUP A;  3TAB A;  1KXP A;  4F3T A;  4BR7 A;  4X65 K;  4DTP A;  4DV2 K;  4BRM A;  4LFC K;  3KD1 E;  1TYQ A;  3EY1 A;  1NJI O;  1QQN A;  2P9U B;  4OJR A;  5AFU H;  5BRF A;  4YDU C;  3KVG A;  3OBW A;  3KK2 A;  1YTA A;  1G15 A;  4BR5 A;  4X64 K;  4FJI A;  1WAF A;  4FJL A;  1XMO K;  1DKG D;  3NDK A;  1TK8 A;  3PUF A;  4M45 A;  4J2D A;  1CLQ A;  4BRD A;  4DTU A;  1VQ7 N;  3SQ0 A;  4ZTJ A;  4A62 A;  1RBS A;  2P9P B;  1QQM A;  3TAF A;  1SAZ A;  2IIR A;  1BWF O;  4KHP K;  4FJG A;  3CJ7 A;  2GX9 A;  2FLO A;  5ADX A;  3U4L A;  5BPM A;  3T1H K;  1YTU A;  1BHL A;  5AQL A;  4CHZ A;  4CZJ A;  1C0T A;  1TL3 A;  3O5B A;  4DQI A;  4CGH A;  3PX6 A;  4DR6 K;  3DRP A;  4BC2 A;  4OPJ A;  2QI2 A;  2OYQ A;  4RWT A;  3H46 O;  1XMQ K;  2E8A A;  3LZJ A;  3G10 A;  3LAN A;  3K5M A;  4JRP A;  3DXK A;  4N41 A;  3RTV A;  4JK9 A;  1O1W A;  1SL2 A;  4YOY A;  4E7J A;  1ZXO A;  4FZZ A;  4WE1 A;  3ZX0 A;  3SV4 A;  4IO9 L;  3THY B;  4W5N A;  1B9F A;  5F2R A;  3SUN A;  4Z4C A;  4B1Y B;  1RTJ A;  2ITM A;  4CZE A;  3FZH A;  4H8K A;  4BRL A;  3G4S N;  1LOT B;  1RDD A;  2ZD1 A;  3DLK A;  3SI6 A;  5J2Q A;  1S6Q A;  3SLC A;  4JI2 K;  3R1X A;  5KTQ A;  3G6E N;  4L8R B;  3KK3 A;  2ASM A;  3OYA A;  3OYG A;  4DTN A;  3VN5 A;  5J1E A;  3TAP A;  4K0K K;  2EWS A;  1OH5 A;  3LWM A;  4LY7 A;  4FWL A;  4FPA A;  2NRH A;  1OKJ A;  5HBM A;  5CR4 A;  3LPU A;  3QFP A;  4F8R A;  1JCG A;  4JI3 K;  4FZX C;  1EQY A;  1VSH A;  4WQ4 C;  3LDP A;  4DV6 K;  5E84 A;  4OKK A;  3BZK A;  1IJJ A;  3K58 A;  4JKF A;  5I42 A;  3TR8 A;  3FE1 A;  3MCA B;  3V1R A;  1GLJ O;  2UXC K;  3CCS N;  1T3V A;  3G25 A;  5LMU K;  4IJA A;  3SYZ A;  1S1X A;  5LY3 A;  3QB0 A;  1VAZ A;  5GAD P;  4O0J A;  2QWL A;  3TSP A;  4CZH A;  3KWG A;  2ZF5 O;  3OS2 A;  4JRQ A;  5HRN A;  5CY4 A;  3RMC A;  1HQE A;  3H1Q A;  1K73 O;  3HT3 A;  4Z94 A;  3TSQ A;  1L5U A;  3AAQ A;  4PKG A;  1TL1 A;  3DLR A;  3TAG A;  3AO2 A;  4JN4 A;  3MK6 A;  1KVC A;  3L4I A;  4KHW A;  1NGB A;  1IBM K;  1VK0 A;  3QO9 A;  2HMI A;  3LP2 A;  4DLE A;  3NVK A;  4EFH A;  5TKW A;  3KZB A;  3DXK B;  4JKD A;  3B6O A;  3LM9 A;  4JI5 K;  4C8L A;  2HHT A;  4C1N I;  4K41 A;  2O8C B;  3BF1 A;  2E6M A;  3PO5 A;  2F9T A;  1U2V A;  3CCQ N;  4B1Z A;  4BY9 C;  2HVH A;  4DV1 K;  4F2R A;  3DM2 A;  3T3F A;  4BWJ A;  3RR7 A;  2FC0 A;  3CM6 A;  3M5R A;  4BRH A;  4UY8 O;  4CJV A;  1I94 K;  1BCO A;  2DTU A;  2XY5 A;  1QTM A;  2I7N A;  4IO8 A;  4OPH A;  4FJ7 A;  4DV7 K;  1C1C A;  4RW6 A;  5M1F A;  3E66 A;  3WXI A;  5AZI A;  2W41 A;  4KO0 A;  4FJX A;  4EAH D;  2F8S A;  3R8E A;  5AZI B;  4KRE A;  4EIA A;  1D5A A;  2FBT A;  4LH4 A;  4IFE A;  5KGX A;  1RBR A;  1R0A A;  4C8M A;  5LJW A;  2NZT A;  4JI1 K;  3EO3 A;  2GUI A;  3NGY A;  3VGK A;  3K5L A;  4A2A A;  2PYL A;  4B9M A;  3VQE A;  4IOC L;  3D0P A;  4CEO A;  1HYZ A;  3QIN A;  4M7X A;  3O9Q A;  4B9U A;  4MDB A;  3QEP A;  3ENO A;  4HWI A;  1NGH A;  3K59 A;  2ITG A;  3AA4 A;  4KH4 A;  1C1A A;  5JIC A;  1L3V A;  3ASM A;  2GEL A;  4KH6 A;  3OBY A;  4NO7 A;  5D3G A;  4B8C A;  2ZQB A;  1A5X A;  3UKR A;  3AVL A;  4WFB L;  1VQO N;  3HSC A;  4CJU A;  2DFE A;  1LCU A;  2VG6 A;  3PLA A;  1WOQ A;  2Q3S A;  3CF5 L;  3KHY A;  2FXU A;  1WN7 A;  2QM1 A;  3ALY A;  3K9K A;  2D0P A;  1VSF A;  4BC5 A;  4KHN A;  4YOR A;  4YFU A;  3O9S A;  1WBD A;  4CEA A;  4FVM A;  3L2U A;  4G1Q A;  4JS4 A;  3E01 A;  2IAJ A;  1TK5 A;  3SBG A;  1VQL N;  1Q81 O;  4ISG A;  1NGC A;  3VEX A;  3C6T A;  4JEP A;  4BRC A;  3CIP A;  3V1Q A;  4B3R K;  4MO5 A;  4NYN A;  5A2Q O;  1NK7 A;  2A6A A;  4IZ9 A;  3P39 A;  3HBT A;  4C1N K;  1Y64 A;  3ZSQ A;  4EP5 A;  3SUQ A;  1IBK K;  3VGM A;  3ZSO A;  1GOA A;  1O13 A;  1RDU A;  2IGI A;  2O4G A;  3DLB A;  2NRX A;  2BTF A;  4QAG A;  1Q7Y O;  2VWB A;  4KKO A;  3NBP A;  1YUW A;  4CGG A;  4BRF A;  3VGL A;  4MLE A;  2WC9 A;  3E1Y A;  1NGE A;  4AM6 A;  2CGJ A;  1ZBL A;  4PA1 A;  4FLW A;  4TSX A;  1E4G T;  3LAM A;  1NGJ A;  2A5X A;  4FK0 A;  4KRF A;  3P1G A;  4HHT A;  1MDU B;  2A42 A;  1HNV A;  3C6H A;  4E1M A;  2AP1 A;  4BRE A;  5BR8 K;  3O3F A;  3E9L A;  4KPY A;  1JLA A;  2NRR A;  3AO5 A;  1C0M A;  1VQN N;  3DLL L;  1RTD A;  4JI0 K;  2HHV A;  1EX4 A;  1Z25 A;  3DMJ A;  3CCR N;  2UUB K;  1M90 O;  2OTJ N;  1T6D A;  3OYE A;  4KB0 A;  1XNQ K;  5EOY A;  1S1W A;  2OPP A;  4KHU A;  4BWM A;  2YNG A;  3MN5 A;  3L4Q A;  4FOE A;  3OJS A;  3NVM A;  4B9S A;  3DWL A;  4BE1 A;  3FFI A;  1W9H A;  2B5J A;  3JSM A;  2ASO A;  1QHA A;  1Q86 O;  3HPH A;  2QWM A;  3UKR B;  3D2F A;  5ADX H;  3JXU A;  5AQZ A;  4PQU A;  4AHC A;  4JKE A;  3SZ2 A;  4N56 A;  1OH8 A;  3V9U A;  5KI6 A;  3WXL A;  3PV8 A;  3O4W A;  4DR4 K;  2DY4 A;  3OYK A;  4IXC A;  2Q36 A;  3CFP A;  2B4J A;  1KLN A;  1RDA A;  1HJR A;  4XIU A;  1KQS M;  4EZ9 A;  2BDP A;  3FZK A;  3O3H A;  2HW3 A;  4BQL A;  1RT1 A;  2P9K B;  4ISF A;  3SNN A;  3IG1 A;  2O8E B;  1JKH A;  2P9K A;  4JI8 K;  4CJP A;  2QWP A;  1K9M O;  2GV9 A;  4QOZ B;  4B9Q A;  3AO1 A;  3OY9 A;  3OVN A;  2V7Y A;  4W5O A;  4JKB A;  1WSE A;  3AVJ A;  4DSJ A;  1YVN A;  2FBY A;  2XRI A;  5F0X A;  1YVU A;  2HHS A;  3IMX A;  3O4N A;  5J2P A;  1L3U A;  1WSH A;  3DAW A;  4IOA L;  3R9P A;  4DSK A;  2D4W A;  4DR3 K;  1XC9 A;  1X3M A;  3V81 A;  4CZF A;  4LSL A;  4O44 A;  2ZWH A;  1H1V A;  4CGI A;  4CHN A;  3CC2 N;  1JL1 A;  4B08 A;  5IWA K;  1YF5 L;  5C10 A;  5FRN A;  4CJ4 A;  3VES A;  3ZT1 A;  3AO3 A;  4FLT A;  5AQQ A;  1UAX A;  2GEM A;  3SUP A;  1HPM A;  2O8D B;  1D8Y A;  3C65 A;  3OYN A;  5AJ3 K;  3T7Z A;  5BRH A;  1MA9 B;  4XH1 A;  3LPT A;  3W3D A;  4B1W B;  3U3G A;  3HVR A;  4FSV A;  1KAZ A;  1CXU A;  4E7H A;  4GVE A;  3NH0 A;  4QS8 A;  1YJ9 N;  4AHR A;  2HND A;  4Q5V A;  3RR8 A;  1J9A A;  1FKP A;  3ATV A;  3H3N O;  5C2F A;  1HKB A;  1KC8 O;  2OCE A;  5BPL A;  3N4Q A;  3K5N A;  3VQC A;  3DLH A;  1VSE A;  4M3T A;  4FJ9 A;  4I6M A;  1T03 A;  4DV0 K;  2X6N A;  4DU3 A;  4K8X A;  2KFN A;  1ASU A;  3WXM B;  1RCH A;  4Z0U A;  3ZX2 A;  4H0T B;  5AZJ B;  4AHT A;  1XUP O;  1IO2 A;  4DLG A;  4GV9 A;  1WUA A;  1JLQ A;  4IKF A;  4N76 A;  1B92 A;  2RKI A;  3I33 A;  1BO5 O;  3FZF A;  1VSL A;  3VEW A;  1BUP A;  3CER A;  4G9Z A;  4GMJ B;  1QE1 A;  4DG1 A;  4E89 A;  1SUQ A;  2A1S A;  2J4R A;  3WEE B;  3CFO A;  4FW1 A;  1FKO A;  2HOE A;  5DK5 A;  1MWK A;  4K25 A;  4YOT A;  4CJ5 A;  1NOZ A;  3V6D A;  4OPK A;  3OYJ A;  4CFD A;  1T05 A;  2YX6 A;  4E7L A;  3AVI A;  3E9P A;  4CF8 A;  1EWR A;  4CW7 B;  5HLF A;  2OTL N;  1RTI A;  4IDH A;  3D2E A;  1XWL A;  3L2V A;  1YT3 A;  4K42 A;  4DFJ A;  2OZM A;  1XNR K;  2IVO A;  3ENB A;  1C0G A;  1VHX A;  3PSI A;  3ZSR A;  3KJV A;  1Q9X A;  4FW2 A;  3AVF A;  3RWU A;  4CE9 A;  3EEQ A;  4FWP A;  5BRE A;  2QK9 A;  4KAZ A;  3AV9 A;  1ESV A;  3S3O A;  1L3T A;  2VWJ A;  3PIO L;  1FK9 A;  3CJA A;  3VEV A;  4JK8 A;  4DR2 K;  4M3R A;  4BC4 A;  2HF3 A;  3HP9 A;  4FM1 A;  2HVI A;  3WUH A;  1FW6 A;  2HHU A;  1HYS A;  5SWM A;  4FWQ A;  3B6P A;  5CZ1 A;  4FJ8 A;  3CCM N;  2QKB A;  4MDA A;  1NKE A;  1TKX A;  3CYM A;  4H5V A;  1C0F A;  2VWK A;  3DXM B;  3AVM A;  4R79 A;  3OS1 A;  2D1K A;  3M8R A;  2UUA K;  5JS1 A;  2HNZ A;  4HCB A;  1U49 A;  3L6Q A;  1BI4 B;  4CEB A;  2A41 A;  4FL9 A;  3ATU A;  3KWI A;  1NK0 A;  3KK7 A;  2F7T A;  1HPZ A;  3UB5 A;  2VYP A;  2X78 A;  4DUY K;  4BRG A;  4E7K A;  3L0Q A;  4CIG A;  1IG8 A;  3TTD A;  4DV3 K;  4HVJ A;  3F9K A;  1RT4 A;  5E41 A;  3ZT3 A;  5AQP A;  3QEW A;  4B3M K;  4MFB A;  1TVR A;  2QWO A;  2YHX A;  4ILG B;  3L2W A;  1SKS A;  4JI6 K;  4CJL A;  4H03 B;  1RGI A;  4CES A;  4CZL A;  4JNE A;  1JJ2 M;  1JXB A;  1WSG A;  4CED A;  5GIO A;  4M3Z A;  4M3X A;  3DYA A;  1WSJ A;  4V19 S;  3VQD A;  5KPR A;  5IT9 O;  2KZM A;  1VSI A;  4PKH A;  1ASV A;  2W42 A;  3KD5 E;  1BQN A;  4DQQ A;  1TUU A;  3HL8 A;  1RT2 A;  4JYA K;  3CJC A;  1RBT A;  4K8Z A;  3SUO A;  4A2B A;  3ULE A;  3ZSZ A;  3PX4 A;  2W6L A;  4DUZ K;  1XHZ A;  3FR0 A;  4IWV A;  1TYQ B;  1V4S A;  1YI2 N;  2CH5 A;  2D0O A;  4DWI A;  2WBN A;  4A61 A;  4H0O A;  3LDN A;  1ITG A;  1KAY A;  4BDZ A;  4EHU A;  5AQM A;  1A5W A;  3H6E A;  2Q0R A;  3CPW M;  4YOX A;  3HRG A;  4FPB A;  3QBX A;  3TAN A;  3V9Z A;  4JD2 A;  4I2P A;  4DTX A;  5GIP A;  3S41 A;  3M3Z A;  3IKM A;  3VMF B;  4WCE L;  4HUG A;  4B9L A;  2O8D A;  1IBL K;  3RSE A;  2YCH A;  3LP1 A;  4AH9 A;  4H5N A;  1SKR A;  4I9Q A;  4Y1C A;  2A3Z A;  2ZJR L;  3VQ9 A;  3K5O A;  2HHH K;  2UU9 K;  3TWH A;  2NLX A;  4FJK A;  5KGW A;  4E1J A;  3D2F B;  5EVZ A;  1UA0 A;  3TSU A;  1BI4 A;  1GLD G;  4CHO A;  4O8U A;  2YJE A;  4CGJ A;  3Q7C A;  3S3N A;  3NH2 A;  1BQM A;  3UKU A;  1YAG A;  1UOC A;  1ZBH A;  3AVG A;  3OHR A;  4MO4 A;  1VQM N;  2Z1I A;  3ZYY X;  2E2O A;  1CXQ A;  1Z26 A;  1HYV A;  2VGN A;  2IVP A;  3QIO A;  3LM2 A;  2NRV A;  4DS4 A;  3RRG A;  1DGK N;  3WEE A;  5KQ8 A;  3D6R A;  3K2P A;  1NU0 A;  2XO7 A;  3ITH A;  5C42 A;  2W40 A;  3CI5 A;  5CYM A;  3HM8 A;  5M1O A;  1NGG A;  2OPR A;  4JHD A;  3NE6 A;  2QEX N;  1VQ9 N;  4FXD A;  5AQW A;  1BOT O;  1QHT A;  4F3O A;  3MED A;  4JV5 K;  4M42 A;  1RBU A;  3M1F A;  1J53 A;  4UQG A;  2GWK A;  4DF4 A;  3SBT A;  3AA5 X;  2G8K A;  4A59 A;  4RW8 A;  1BIU A;  3NCI A;  4DTJ A;  3ZCM A;  5F1X A;  1X9M A;  1W97 L;  4DU1 A;  4YOV A;  2Q2R A;  1HLU A;  4YNQ A;  4KTQ A;  4EHT A;  4E0D A;  3T19 A;  2VQE K;  1RFQ A;  4FO0 A;  3J7A P;  2G8I A;  2Y1I A;  2DFH A;  2V51 B;  2VGM A;  1E4F T;  3OTO K;  1TKD A;  1R59 O;  3VER A;  5AQX A;  4DFP A;  1C0U A;  1EKE A;  5JMV A;  4O4G A;  3PSF A;  1NJY A;  4FLZ A;  2XY6 A;  2UXB K;  4LF9 K;  3NF8 A;  4CJW A;  4XH5 A;  5I3U A;  3MEC A;  2O4I A;  3DXM A;  3VQB A;  2YKM A;  2X74 A;  3J7Y P;  2W6K A;  1CZA N;  3ID8 A;  1FXX A;  4H5T A;  4A5A A;  3ENH A;  2QKK A;  4DTS A;  4IDK A;  3G0Z A;  3F73 A;  1B9D A;  2YNF A;  3JYT A;  3VF6 A;  4GY2 B;  4ELT A;  1NJZ A;  1HKC A;  4KFB A;  5GAH P;  4CIE A;  2YV0 X;  3WNF A;  2KFZ A;  3U9D A;  1OVY A;  4DCH A;  2AA4 A;  3HZ6 A;  2YKN A;  3VTI A;  1JLF A;  5CZ2 A;  5K14 A;  2E4L A;  1QQC A;  3C0B A;  4BDP A;  2HBM A;  4IFV A;  3OYB A;  4OPA A;  4JI7 K;  2O8C A;  4FWM A;  4DV5 K;  3O4Q A;  4YHH K;  4IOX A;  2BAN A;  4CF1 A;  3THX B;  3TPQ A;  3AVH A;  1ZBU A;  3H3O B;  4I9L A;  3M8Q A;  4ILH A;  3VA3 A;  3QML A;  1NK4 A;  3C94 A;  3O9U A;  4WF9 L;  4OKE A;  4DSL A;  3VQ7 A;  2PY5 A;  3HP6 A;  3SPY A;  3QET A;  3WNE A;  4CF9 A;  2VG5 A;  5C25 A;  4BRP A;  4BC3 A;  1JLC A;  3A5M C;  1XQS C;  4NLB A;  4HCC A;  3ULE B;  3EZ5 A;  2Z1H A;  3QNO A;  3MMV A;  1HQU A;  2BGG A;  1EO1 A;  2NRW A;  3VQ5 A;  1RNH A;  3CJB A;  2ZGY A;  4B3O A;  1BU6 O;  4LFB K;  1TUY A;  5AQN A;  2IC3 A;  2RN2 A;  3OYF A;  4DFM A;  3O9T A;  3HI0 A;  5GAG P;  5HRS A;  4GNI A;  5JVH L;  3CQ8 A;  5EX5 A;  4DR5 K;  1NNE A;  4M7Y A;  3QER A;  1KTQ A;  2GTD A;  4B1V A;  1J5E K;  4NXM K;  1N36 K;  3WXJ A;  1BDG A;  5AQT A;  3J8A A;  1IKV A;  5AQS A;  2YHB A;  3N4P A;  3VQQ A;  3AVB A;  1NKB A;  1Z05 A;  1NK6 A;  3M8S A;  4JI4 K;  1HNI A;  4LF4 K;  1WLJ A;  1YXQ A;  1BG3 A;  1JLG A;  4H4O A;  4C23 A;  5AQI A;  1TK0 A;  3BZC A;  3KLI A;  1RBV A;  1NG9 A;  3LP0 A;  4FK2 A;  5HOO A;  4OLB A;  4H0P A;  1S6P A;  3VEO A;  3KLG A;  5AFU A;  3ZEU B;  4CF2 A;  1VSK A;  3WQT A;  2Z1J A;  1HR0 K;  3UKU B;  3VEZ A;  3P38 A;  2G8F A;  1EXQ A;  1IH7 A;  4WQ4 A;  5FRM A;  4FYD A;  1S22 A;  1JLE A;  4H0Y B;  2HMP A;  4CIF A;  3MXM A;  5AQK A;  1TAU A;  5TKY A;  1XC3 A;  3ZT2 A;  4FJJ A;  2O8B B;  1X1P A;  1YJW N;  1KD1 O;  1U4B A;  1L3S A;  2E1Z A;  4DV4 K;  4H0V B;  1HRH A;  3QDK A;  3NGI A;  1LWF A;  1D4X A;  2QWR A;  1KAX A;  2AJQ A;  5C12 A;  2BE2 A;  1DTT A;  4BR0 A;  5EU7 A;  2Q31 A;  4YDU A;  4B9V A;  3A5N C;  3MN9 A;  5AQV A;  1RDC A;  4BG9 A;  5FPD A;  1D9D A;  4Z4G A;  3Q7B A;  4E1N A;  4DU4 A;  2FF6 A;  3C6A A;  4FCY A;  1YIJ N;  2ZM6 K;  3CHW A;  3AGR A;  3QFU A;  3GG4 A;  4B3S K;  4PKI A;  3AAR A;  4DF8 A;  1HKG A;  1EWQ A;  4RCH A;  2QWN A;  5JS2 A;  2UXD K;  3U3Y A;  4CJR A;  1ZC6 A;  4KHQ A;  3D2E B;  5BN8 A;  2YHY A;  2WUS A;  4KI6 A;  3HO1 A;  4EZ6 A;  4F4K A;  4M3W A;  3EL2 A;  4HUF A;  2BH1 A;  4CJ3 A;  3MXI A;  4AHS A;  4KHY A;  4CFB A;  1RDW X;  4BR9 A;  3V9S A;  1RDB A;  4NXN K;  3EKU A;  4LF5 K;  1F21 A;  2YHW A;  3K57 A;  5LMN K;  3RSE B;  4U67 L;  3U9Z A;  1V4T A;  3SPZ A;  3LDS A;  1KCF A;  4FJ5 A;  2IVN A;  2WTU A;  4M3Y A;  3VTH A;  1IG9 A;  2F9W A;  4E19 A;  4NCG A;  5J2N A;  3QIC A;  3AA2 A;  2E2N A;  3GBT A;  2IDO A;  4NCA A;  4H5R A;  1NGD A;  3OYI A;  5FLX O;  1X3N A;  3HOT A;  5DM7 L;  2V7Z A;  5HL7 L;  3AAP A;  3MN6 A;  3MN7 A;  3RMA A;  1MU2 A;  4WYB A;  5AQY A;  1GOC A;  4OGC A;  1GLF O;  2OZS A;  1S1T A;  4O55 A;  4RW9 A;  1SV5 A;  1QZ5 A;  2FSN A;  4CEZ A;  4CZG A;  3AVC A;  3KLF A;  2KW4 A;  3KK1 A;  3V9W A;  3L8B A;  4CK1 A;  3AVN A;  3RMB A;  3PIP L;  1TGO A;  2IS3 A;  4IEE A;  1OVQ A;  3I0R A;  1X9S A;  5AR0 A;  4CVN E;  1YIT N;  3R3L A;  2O8B A;  1VQK N;  2QXL A;  3RRH A;  2VQF K;  3AVK A;  3VF2 A;  4CJT A;  3BDP A;  4JK7 A;  4E3S A;  1VRU A;  1IKX A;  3NAE A;  4PL8 A;  1K8A O;  5FRO A;  3KKR A;  3MAQ A;  5KRS A;  3WXK A;  2DPN A;  3EE9 A;  4XH4 A;  3KTQ A;  2NRT A;  4ELU A;  1Q9Y A;  3TU5 A;  2HF4 A;  2XY8 A;  4FVU A;  4FJM A;  3HXM A;  1FJG K;  3CCV N;  2QWQ A;  3K9J A;  3ZLJ A;  2KQ2 A;  4X66 K;  4CJK A;  3CC4 N;  3EZW A;  5BRD A;  3SK3 A;  1BA0 A;  4N47 A;  3DOL A;  1VQP N;  2WFB A;  5ELZ A;  1KFD A;  3MEE A;  2QXF A;  2A1R A;  2JWK A;  4WQ5 A;  4JD2 B;  3P83 D;  3KLE A;  4C8K A;  1SL1 A;  3F9M A;  5AQU A;  3CMA N;  4AQY K;  4GW6 A;  2YHA A;  3SMP A;  3QEX A;  4LD0 A;  3CXC M;  1N34 K;  2PAV A;  2GUP A;  4FLV A;  5M1P A;  1I39 A;  3B8A X;  3I55 N;  3IDH A;  4FLX A;  3E9O A;  1C6V A;  4W5R A;  3VQ4 A;  3LDL A;  1SKW A;  2JLE A;  3M8P A;  5KQD A;  3OYH A;  1SZ2 A;  4CK3 A;  1Q82 O;  4M3U A;  1N8R O;  3BGR A;  3A8Y A;  4W5T A;  4OX9 K;  3CG7 A;  1IV0 A;  4JKG B;  4JKA A;  4O8K A;  3P31 A;  1KRP A;  2P5O A;  5C24 A;  4I7F A;  3EN9 A;  4DKW A;  3THV A;  3A5O C;  4BDY A;  2OPQ A;  5H1S Q;  3A0I X;  3GL1 A;  1HNZ K;  4CZI A;  1WSF A;  2ZJP L;  1KSP A;  1ILY A;  1LW0 A;  4BVP A;  1VRT A;  4K43 A;  4FJH A;  1WNS A;  4BRK A;  3O6W A;  3SJJ A;  1T6C A;  1DT9 A;  3HST B;  5JVG L;  3I8D A;  1RTH A;  1GLA G;  5AQR A;  2O8F A;  4F9O A;  4FM0 A;  4LC9 B;  3F2K A;  5SZT A;  1M1K O;  2O8E A;  4AF1 A;  4BVO A;  2O8F B;  2HB5 A;  1WAJ A;  3OW2 M;  1UA1 A;  3SJH A;  1J6Z A;  3VET A;  2OAN A;  1HX1 A;  5AQF A;  5HP1 A;  2P5G A;  1TAQ A;  1LAW A;  1YJN N;  3AGK A;  1VQ4 N;  1P8Z A;  3WNG A;  5M1N A;  3EYZ A;  3RVC A;  1ZYQ A;  1QS4 A;  3ZSW A;  2CH6 A;  2F4V K;  5CE3 A;  2KTQ A;  4HTU A;  3TI0 A;  3ZX3 A;  2UUC K;  4ISE A;  4H5W A;  4ZHR A;  3CPE A;  4CCH A;  4O5F A;  4CD1 A;  4CGF A;  1N33 K;  4C8O A;  3NH1 A;  1N6Q A;  1HNX K;  2RE2 A;  5T7B A;  3TTF A;  3T1Y K;  3A2F A;  1D9F A;  1U04 A;  1HUX A;  2E20 A;  4MLH A;  4OO1 J;  1KVA A;  3MX2 A;  4CBX A;  1QSY A;  2NRZ A;  5BPN A;  2YI1 A;  3F5T A;  5AQH A;  4KTZ A;  3CJ9 A;  4BRA A;  3V1O A;  3HM9 A;  1GOB A;  3KKS A;  1DEJ A;  2FSJ A;  4W5Q A;  4BGA A;  1U6Z A;  3T69 A;  3FZL A;  1NJX A;  2P9S A;  3C7N A;  1LV5 A;  4BR4 A;  3BF3 A;  2IOC A;  4CBW A;  4CJS A;  4DHY A;  3SQ2 A;  3H1V X;  3THX A;  3WNH A;  3QEI A;  1LAV A;  2HNY A;  2JWL A;  1K6Y A;  4ILJ A;  3D45 A;  3I8B A;  4IFY A;  3LL3 A;  1NM1 A;  3ZT4 A;  4AM7 A;  4CHY A;  1QVG M;  4CEE A;  3OJU A;  2PFU A;  2P9L A;  4B1X B;  2D0C A;  1CZ9 A;  4N5S A;  2E88 A;  2V52 B;  2KLA A;  4BG8 A;  4JAX A;  1S72 N;  5C15 A;  4DR7 K;  2ASP A;  2FBX A;  5FDL A;  1WB9 A;  3NF7 A;  3GE1 A;  4LF8 K;  3VOV A;  3VQA A;  2E5L K;  1U45 A;  4L3Q A;  5GIN A;  1G99 A;  1I3A A;  4DSI A;  4DQP A;  2F96 A;  4CBU A;  4LSN A;  2LSN A;  2FF3 B;  4AIL C;  3VQP A;  3PX0 A;  4DSF A;  1ATS A;  1NMD A;  3R6M A;  5AQJ A;  4GKJ K;  2P9N A;  3U6F A;  2HHW A;  1IKW A;  4FWS A;  5FPN A;  3IRX A;  3VPZ A;  2P9N B;  2ZE2 A;  4CK2 A;  4DFK A;  4BRQ A;  3V4I A;  2P9I A;  3CQX A;  3JAM O;  4NCB A;  3OS0 A;  3G71 N;  1T8E A;  3KLH A;  2HBJ A;  3TAR A;  1WSI A;  3LAL A;  5J2M A;  3MCP A;  3AY9 A;  1NK9 A;  3VEY A;  1NJW A;  1S3X A;  4FWK A;  1A5V A;  3L2Q A;  3BY5 A;  4DSE A;  4J8F A;  3TTC A;  1X9W A;  1U47 A;  1TV6 A;  4H4M A;  5BN9 A;  1ZBF A;  1T44 A;  2YJF A;  4CFC A;  1YHQ N;  3VQ6 A;  4XEI A;  1GLL O;  4FM2 A;  4IG3 A;  5FPE A;  1S9E A;  4I2Q A;  3GOI A;  3QBW A;  4CGD A;  2WON A;  4CZK A;  1TKZ A;  1JXE A;  3THY A;  1S1U A;  3EKS A;  4C8N A;  2CGK A;  2I5J A;  3DI6 A;  4KI4 A;  3CCE N;  4IG0 A;  2HST A;  3ZSV A;  4J2E A;  1BA1 A;  1W2B M;  2ATQ A;  1J54 A;  5KPT A;  1NGF A;  2Z1G A;  5LL6 Z;  3HOS A;  3HTV A;  3IAY A;  4A57 A;  3FLC O;  3BP8 A;  4BRI A;  5AQO A;  1DLO A;  5C2D A;  5M1Q A;  5C0Y A;  1EET A;  1BGX T;  1GLC G;  1NBW A;  4O5B A;  1NK5 A;  2XY7 A;  2FBV A;  4EP4 A;  2GWJ A;  3QEV A;  3NHG A;  3CM5 A;  4DS5 A;  4CJE A;  3THW B;  3TAE A;  1BIS A;  1JCF A;  3LP3 A;  2NUB A;  4B8A B;  4A5B A;  1NMN A;  4CHP A;  5EXW A;  4PWD A;  1KLM A;  3HJF A;  4B1U B;  3C6U A;  3CME N;  4RG8 A;  4CJQ A;  1VSM A;  5AQG A;  1ZBI A;  1QSL A;  4BGB A;  3JS6 A;  2H3G X;  3RMD A;  4HTL A;  4J2B A;  3K0S A;  4KH5 A;  4CI6 A;  5KPZ A;  1HMV A;  2QW9 A;  2G8V A;  2A40 A;  3MEG A;  5HRO A;  2D0B A;  2PYJ A;  1BIZ A;  3QIP A;  2P9I B;  3HK2 A;  3HPG A;  2P9P A;  1VSD A;  5B8H A;  3HPO A;  1LWE A;  3VEN A;  4OGE A;  4QCL A;  5I9E B;  4E7I A;  2D5R A;  3ISN C;  3CD6 N;  4QS9 A;  1BL3 A;  3PY8 A;  2HBL A;  4BRO A;  4DR1 K;  4IBN A;  2EX3 A;  3J80 O;  3LAK A;  3SAG A;  4YY3 K;  1NOY A;  3J7Z O;  4DQS A;  3CQY A;  4RW4 A;  5HRP A;  2P51 A;  1RIL A;  3FFK B;  2QTD A;  3SMS A;  1XI1 A;  3VQ8 A;  3LWL A;  1WBB A;  3CCU N;  1QQO A;  1QZ6 A;  5DMR A;  1OH7 A;  2P9S B;  4OLA A;  3C7N B;  4OKJ A;  4ICL A;  4BR2 A;  3S3M A;  4FK4 A;  1SL0 A;  1SQK A;  4JKH A;  1ASW A;  4NLC A;  3WQU A;  4DTM A;  1P90 A;  1QVF M;  1N32 K;  2UYT A;  3O1W A;  4B9T A;  3HVT A;  4Q0B A;  2ZJQ L;  1RT5 A;  3NFA A;  4PL7 A;  4Z4I A;  3QES A;  1E3M A;  1KVB A;  3FGU A;  4MQ3 A;  4DB3 A;  5MLC Q;  2JGU A;  1VQ5 N;  3CCJ N;  4DMN A;  1X9J A;  2PBD A;  2R7Y A;  2RHK A;  3MXJ A;  3CET A;  3O80 A;  4CD3 A;  4Z4F A;  4R5P A;  3A5L C;  1HJO A;  4CHQ A;  1VQ8 N;  3D7E O;  4X62 K;  3I0S A;  1JCE A;  4FJN A;  4FOI A;  1VQ6 N;  4BRN A;  1T7P A;  5LJV A;  3LZI A;  4Y0W A;  1ATN A;  3BUZ B;  4FWN A;  1JL2 A;  5DM6 L;  1NLV A;  4IEI A;  3L3V A;  2OA8 A;  1SS6 A;  1UWB A;  2D0A A;  3VF4 A;  1XHX A;  3L3U A;  2E1Y A;  3IFR A;  2B6A A;  3AO4 A;  2E2P A;  1MWM A;  2VG7 A;  5E26 A;  3SAF A;  1U48 A;  1ATR A;  3PO4 A;  1GLB G;  4KTW A;  4ELV A;  4LFA K;  5M1K A;  1DTQ A;  4FLU A;  4JLH A;  4O0I A;  4ID5 A;  4CFA A;  3UE5 A;  4Z4E A;  2X6S A;  3DRR A;  1LWC A;  3EE8 A;  1VSJ A;  4YOW A;  1KFS A;  1IKY A;  4KHS A;  4AHU A;  1JLB A;  4QS7 A;  1N5Y A;  4ID1 A;  4F2S A;  2E2Q A;  4BAC A;  3ZEU A;  4CEQ A;  2YNH A;  4LF7 K;  4GVM A;  4PUO A;  3ZET B;  1C1B A;  2Q97 A;  1S5J A;  1HNW K;  4FZY A;  3P5J A;  2OPS A;  2P1J A;  3CJ1 A;  4LF6 K;  2KZZ A;  1NK8 A;  1RT3 A;  3QLH A;  4H0X B;  4BQZ A;  2QA4 N;  4I6M B;  2VCP A;  2GBZ A;  1BCM A;  2G8H A;  3GDQ A;  4CER A;  4CEC A;  4YOU A;  2RF2 A;  1RT7 A;  5AZJ A;  3O9R A;  3DRS A;  3TAQ A;  3H45 C;  3DLE A;  1Q8I A;  2F8T A;  3ULD A;  4CEF A;  2HBK A;  4B9N A;  3QNN A;  3MWP A;  3SAH A;  4JKC A;  3J81 O;  3SCX A;  1TKT A;  4DTR A;  5JLH A;  2KKZ A;  2HHX A;  1K8K B;  3IUC A;  1NGI A;  2FSK A;  3MWT A;  4WFA L;  2Y1J A;  4CJ7 A;  4Z4H A;  5HRR A;  3THW A;  3NF9 A;  1RT6 A;  3OYD A;  4LH5 A;  4JS5 A;  4FLY A;  1LW2 A;  3I56 N;  3CFR A;  3C95 A;  3U8X A;  4DTO A;  2WOM A;  4NYF A;  3V9X A;  5FPM A;  4FWR A;  2P9U A;  2HHQ A;  3SQ4 A;  4KBO A;  2E6L A;  4GKK K;  4PY5 A;  3MDQ A;  3S9H A;  2G8U A;  4GV6 A;  2PZS A;  3O8M A;  4CZM A;  1Q18 A;  4IJN A;  3T1A A;  4FWO A;  3LDQ A;  3W0L A;  3OA9 A;  3SQ1 A;  1Y97 A;  4RTF D;  2KHO A;  4B3T K;  3DJC A;  4CF0 A;  3BEX A;  5CYQ A;  4BE2 A; 
#chains in the Genus database with same CATH homology
 3FZM A;  3DXM A;  5EOY A;  5BR9 A;  4NB4 A;  4DQ8 A;  3MN5 A;  1CZA N;  3ID8 A;  3L4Q A;  4FOE A;  4H5T A;  4WFN L;  1HUX A;  2E20 A;  3NVM A;  3ENH A;  4MLH A;  4A5A A;  4GV3 A;  4OO1 J;  3DWL A;  3MX2 A;  3VF6 A;  4GY2 B;  4CBX A;  2ASO A;  3MX5 A;  1HKC A;  1QHA A;  1Q86 O;  4JKG A;  2NRZ A;  2CGL A;  2QWM A;  3UKR B;  5BPN A;  5GAH P;  3D2F A;  4M63 C;  3WT0 A;  5ADX H;  3ZET A;  2YI1 A;  3F5T A;  3JXU A;  5AQH A;  5AQZ A;  3CJ9 A;  4JKE A;  3SJH A;  3U9D A;  4BRA A;  3CC7 N;  1OVY A;  4DCH A;  2Q1N A;  2AA4 A;  3HZ6 A;  1ZBS A;  3VTI A;  1DEJ A;  1NWK A;  3C0B A;  2FSJ A;  3WXL A;  2HBM A;  3O4W A;  4OPA A;  3O1B A;  4BGA A;  1U6Z A;  3T69 A;  1GLE G;  3FZL A;  2Q36 A;  4FWM A;  4IXC A;  2P9S A;  4U7B A;  4IOX A;  3C7N A;  5GAE P;  1KQS M;  4BR4 A;  3BF3 A;  1Z6R A;  4CBW A;  3FZK A;  4BQL A;  3TPQ A;  2P9K B;  4ISF A;  4DHY A;  3H1V X;  2I7P A;  3H3O B;  4WQ5 C;  1U2V B;  2P9K A;  4ILH A;  3QML A;  2JWL A;  5JLF A;  3O9U A;  4JHD B;  3P4I A;  5CHI A;  4WF9 L;  4ILJ A;  2QWP A;  1K9M O;  3I8B A;  3LL3 A;  4B9Q A;  5EY4 A;  3M6G A;  1NM1 A;  4AM7 A;  1QVG M;  1NGA A;  4BRP A;  4BC3 A;  4PHT X;  3A5M C;  2NNW A;  2V7Y A;  2PFU A;  1S72 N;  1XQS C;  4JKB A;  2P9L A;  2ZGZ A;  4B1X B;  4NLB A;  3CCL N;  3ID6 A;  1YVN A;  2E88 A;  3ULE B;  3NMU A;  1K8K A;  2KLA A;  2V52 B;  3O08 A;  2P9L B;  3MMV A;  3LDO A;  3IMX A;  2ASP A;  4JAX A;  4BG8 A;  2Q0U A;  2BUP A;  5C15 A;  1EO1 A;  2NRW A;  1KXP A;  4BR7 A;  3CJB A;  3DAW A;  4IOA L;  2ZGY A;  3GE1 A;  3R9P A;  3VOV A;  1BU6 O;  4BRM A;  2D4W A;  4L3Q A;  5GIN A;  1X3M A;  1G99 A;  1TYQ A;  1TUY A;  4CZF A;  1NJI O;  4CBU A;  1QQN A;  2P9U B;  5AQN A;  2ZWH A;  1H1V A;  5AFU H;  5BRF A;  4YDU C;  2FF3 B;  3CC2 N;  3KVG A;  3OBW A;  3O9T A;  3HI0 A;  5GAG P;  1ATS A;  1NMD A;  1YF5 L;  3R6M A;  4GNI A;  5AQJ A;  2P9N A;  4BR5 A;  5C10 A;  5JLH A;  5JVH L;  5EX5 A;  4FWS A;  4M7Y A;  5FPN A;  1DKG D;  3VES A;  3VPZ A;  2P9N B;  2GTD A;  4B1V A;  5AQQ A;  4BRQ A;  2GEM A;  4BRD A;  1HPM A;  1VQ7 N;  3WXJ A;  2P9I A;  3CQX A;  1BDG A;  5AQT A;  4A62 A;  3J8A A;  2P9P B;  5AQS A;  3N4P A;  1QQM A;  3C65 A;  1SAZ A;  1Z05 A;  2IIR A;  1BWF O;  3G71 N;  3T7Z A;  5BRH A;  1MA9 B;  2HBJ A;  4XH1 A;  3CJ7 A;  2GX9 A;  2FLO A;  3W3D A;  4B1W B;  5ADX A;  3U4L A;  5BPM A;  3MCP A;  3AY9 A;  4FSV A;  3VEY A;  1YXQ A;  1BG3 A;  1KAZ A;  1S3X A;  5AQL A;  4CZJ A;  3O5B A;  4FWK A;  4C23 A;  5AQI A;  4GVE A;  4QS8 A;  1YJ9 N;  4J8F A;  3TTC A;  5HOO A;  4BC2 A;  3H3N O;  3ATV A;  4H0P A;  5BN9 A;  3VEO A;  1HKB A;  5C2F A;  2QI2 A;  1KC8 O;  1T44 A;  5AFU A;  2YJF A;  3ZEU B;  5BPL A;  3N4Q A;  3WQT A;  4RWT A;  1YHQ N;  3H46 O;  1GLL O;  4XEI A;  3UKU B;  2E8A A;  3VEZ A;  5FPE A;  3P38 A;  4WQ4 A;  4I6M A;  1S22 A;  3DXK A;  4H0Y B;  2HMP A;  3GOI A;  4JK9 A;  3WXM B;  4YOY A;  5AQK A;  3QBW A;  4H0T B;  5AZJ B;  3ZX2 A;  1XUP O;  5TKY A;  1ZXO A;  1XC3 A;  4CZK A;  4GV9 A;  1WUA A;  1YJW N;  3EKS A;  3ZX0 A;  1KD1 O;  2CGK A;  4IO9 L;  2E1Z A;  5F2R A;  4H0V B;  3I33 A;  1BO5 O;  3FZF A;  3QDK A;  3VEW A;  4B1Y B;  1BUP A;  3CER A;  2HST A;  2ITM A;  3FZH A;  4CZE A;  3CCE N;  4BRL A;  1D4X A;  4G9Z A;  3G4S N;  1BA1 A;  1LOT B;  1W2B M;  2QWR A;  1KAX A;  5C12 A;  2J4R A;  3WEE B;  5KPT A;  1NGF A;  3HOS A;  4BR0 A;  2HOE A;  2Q31 A;  3HTV A;  4YDU A;  1MWK A;  4K25 A;  4YOT A;  4A57 A;  3A5N C;  3MN9 A;  5AQV A;  4BG9 A;  5FPD A;  3FLC O;  3BP8 A;  2YX6 A;  3Q7B A;  3SLC A;  5AQO A;  3R1X A;  4BRI A;  5M1Q A;  5C2D A;  5C0Y A;  3G6E N;  2FF6 A;  1GLC G;  1NBW A;  2ASM A;  3C6A A;  3E9P A;  1YIJ N;  3CHW A;  3AGR A;  2GWJ A;  3QFU A;  2OTL N;  3GG4 A;  4PKI A;  3AAR A;  2EWS A;  1HKG A;  3D2E A;  4IDH A;  4RCH A;  2QWN A;  4FWL A;  1ZC6 A;  4FPA A;  4K42 A;  1JCF A;  2NRH A;  1OKJ A;  2YHY A;  2WUS A;  3D2E B;  2IVO A;  3ENB A;  1C0G A;  5CR4 A;  5BN8 A;  3QFP A;  1JCG A;  3EL2 A;  4A5B A;  2BH1 A;  5EXW A;  1EQY A;  4WQ4 C;  4FWP A;  4B1U B;  5BRE A;  1RDW X;  3LDP A;  4BR9 A;  3CME N;  1ESV A;  5AQG A;  3EKU A;  5E84 A;  4BGB A;  3PIO L;  2YHW A;  3CJA A;  3JS6 A;  3VEV A;  4JK8 A;  2H3G X;  4HTL A;  3RSE B;  4U67 L;  3U9Z A;  1IJJ A;  1V4T A;  4KH5 A;  4BC4 A;  4CI6 A;  5KPZ A;  2HF3 A;  4JKF A;  2IVN A;  2QW9 A;  3WUH A;  2A40 A;  3FE1 A;  3VTH A;  2F9W A;  3MCA B;  2P9I B;  1GLJ O;  3QIC A;  4FWQ A;  2P9P A;  5B8H A;  2E2N A;  3GBT A;  3CCM N;  3CCS N;  1T3V A;  3G25 A;  4H5R A;  4MDA A;  4IJA A;  3VEN A;  1NGD A;  4H5V A;  1C0F A;  5I9E B;  3DXM B;  3QB0 A;  1VAZ A;  4R79 A;  5LY3 A;  1X3N A;  2D1K A;  5GAD P;  3TSP A;  2QWL A;  3HOT A;  4CZH A;  3CD6 N;  5DM7 L;  2V7Z A;  5HL7 L;  3AAP A;  2ZF5 O;  3KWG A;  3MN7 A;  3MN6 A;  3L6Q A;  4WYB A;  3H1Q A;  5AQY A;  1K73 O;  4QS9 A;  1GLF O;  4Z94 A;  3TSQ A;  2HBL A;  2A41 A;  3AAQ A;  4FL9 A;  4PKG A;  4BRO A;  1QZ5 A;  3ATU A;  2FSN A;  3KWI A;  4JN4 A;  3KK7 A;  3MK6 A;  3L4I A;  2F7T A;  4CZG A;  3UB5 A;  3SAG A;  3J7Z O;  2VYP A;  1NGB A;  3CQY A;  4BRG A;  3L0Q A;  3FFK B;  2QTD A;  3SMS A;  1IG8 A;  3NVK A;  3PIP L;  4EFH A;  3TTD A;  4IEE A;  5F0X A;  5TKW A;  1QQO A;  1QZ6 A;  3KZB A;  3CCU N;  3DXK B;  2P9S B;  4JKD A;  3C7N B;  3LM9 A;  5AQP A;  4BR2 A;  5AR0 A;  4C1N I;  4K41 A;  1YIT N;  3BF1 A;  1SQK A;  4JKH A;  2QWO A;  2YHX A;  2F9T A;  3R3L A;  4ILG B;  1U2V A;  3CCQ N;  4B1Z A;  4H03 B;  1RGI A;  4CZL A;  1VQK N;  2QXL A;  4BY9 C;  4JNE A;  1JJ2 M;  4NLC A;  3WQU A;  5GIO A;  1P90 A;  1QVF M;  3M5R A;  3VF2 A;  2UYT A;  4BRH A;  3O1W A;  4UY8 O;  4JK7 A;  2ZJQ L;  4PL7 A;  4PL8 A;  2I7N A;  4IO8 A;  4OPH A;  5KPR A;  3FGU A;  4PKH A;  4DB3 A;  5MLC Q;  1K8A O;  3WXK A;  2DPN A;  5M1F A;  3E66 A;  3CCJ N;  3EE9 A;  4XH4 A;  3WXI A;  1VQ5 N;  1TUU A;  1X9J A;  5AZI A;  2PBD A;  2W41 A;  2NRT A;  2RHK A;  3CET A;  3O80 A;  4CD3 A;  3CJC A;  4EAH D;  3A5L C;  3R8E A;  5AZI B;  3TU5 A;  2HF4 A;  1HJO A;  1VQ8 N;  4EIA A;  4A2B A;  3ULE A;  4FVU A;  3D7E O;  1JCE A;  3CCV N;  4IFE A;  2QWQ A;  3K9J A;  3FR0 A;  4IWV A;  4FOI A;  1TYQ B;  1V4S A;  4BRN A;  1VQ6 N;  1YI2 N;  2CH5 A;  5LJV A;  2D0O A;  5LJW A;  2WBN A;  4Y0W A;  2NZT A;  4H0O A;  4A61 A;  3CC4 N;  3LDN A;  1KAY A;  3EZW A;  3EO3 A;  1ATN A;  3BUZ B;  4FWN A;  4EHU A;  5BRD A;  3VGK A;  5DM6 L;  3SK3 A;  1NLV A;  4IEI A;  5AQM A;  4A2A A;  3H6E A;  1BA0 A;  2Q0R A;  3CPW M;  1VQP N;  1SS6 A;  2WFB A;  4YOX A;  5ELZ A;  3HRG A;  4FPB A;  3QBX A;  4IOC L;  3VF4 A;  2E1Y A;  3IFR A;  4JD2 A;  2JWK A;  2E2P A;  5GIP A;  4M7X A;  4WQ5 A;  3S41 A;  3O9Q A;  1MWM A;  3M3Z A;  3IKM A;  4MDB A;  4JD2 B;  3VMF B;  4WCE L;  5E26 A;  3SAF A;  3ENO A;  1ATR A;  1GLB G;  4HWI A;  3RSE A;  1NGH A;  3F9M A;  5AQU A;  3CMA N;  4KH4 A;  5M1K A;  2YCH A;  4H5N A;  3SMP A;  5JIC A;  2A3Z A;  3CXC M;  2PAV A;  3UE5 A;  2GUP A;  2ZJR L;  2GEL A;  3EE8 A;  4YOW A;  5M1P A;  4KH6 A;  3B8A X;  3I55 N;  3IDH A;  3OBY A;  4NO7 A;  3E9O A;  4QS7 A;  3LDL A;  2E2Q A;  3ZEU A;  2NLX A;  3UKR A;  4WFB L;  4E1J A;  1VQO N;  3HSC A;  3D2F B;  5KQD A;  1SZ2 A;  3ZET B;  1LCU A;  5EVZ A;  2Q97 A;  1Q82 O;  3PLA A;  3TSU A;  1WOQ A;  1GLD G;  1N8R O;  3A8Y A;  4O8U A;  2YJE A;  3CF5 L;  3Q7C A;  4JKG B;  4JKA A;  3KHY A;  4O8K A;  3P31 A;  2FXU A;  2QM1 A;  3CJ1 A;  3K9K A;  2D0P A;  3EN9 A;  4BC5 A;  3UKU A;  4DKW A;  1YAG A;  4YOR A;  3A5O C;  3O9S A;  4H0X B;  4BQZ A;  4MO4 A;  3OHR A;  5H1S Q;  2QA4 N;  1VQM N;  3A0I X;  3GL1 A;  2VCP A;  4I6M B;  4CZI A;  3GDQ A;  2ZJP L;  3ZYY X;  1ILY A;  4BVP A;  2E2O A;  4YOU A;  3SBG A;  4K43 A;  5AZJ A;  4BRK A;  3O6W A;  1Q81 O;  1VQL N;  3O9R A;  4ISG A;  1T6C A;  2VGN A;  2IVP A;  3H45 C;  1DT9 A;  3LM2 A;  1NGC A;  2NRV A;  4JEP A;  2HBK A;  3VEX A;  4BRC A;  5JVG L;  3CIP A;  1DGK N;  3MWP A;  4MO5 A;  3WEE A;  3SAH A;  5AQR A;  1GLA G;  2A6A A;  5KQ8 A;  4IZ9 A;  3D6R A;  4LC9 B;  3P39 A;  3F2K A;  3HBT A;  4C1N K;  1Y64 A;  4F9O A;  3VGM A;  1M1K O;  4JKC A;  4AF1 A;  4BVO A;  1O13 A;  2W40 A;  3CI5 A;  1RDU A;  3HM8 A;  5M1O A;  1NGG A;  2NRX A;  2BTF A;  4JHD A;  2QEX N;  1VQ9 N;  1Q7Y O;  3OW2 M;  1J6Z A;  1BOT O;  2KKZ A;  2OAN A;  1HX1 A;  5AQF A;  1K8K B;  3IUC A;  5AQW A;  1NGI A;  2FSK A;  3VET A;  3MWT A;  4WFA L;  2VWB A;  3M1F A;  2GWK A;  4CJ7 A;  3SBT A;  1YJN N;  3AGK A;  1VQ4 N;  1YUW A;  1P8Z A;  4BRF A;  5M1N A;  3VGL A;  4A59 A;  4MLE A;  3RVC A;  2WC9 A;  3E1Y A;  2CH6 A;  1NGE A;  3I56 N;  4AM6 A;  3U8X A;  2CGJ A;  5F1X A;  1E4G T;  5FPM A;  5CE3 A;  1W97 L;  1NGJ A;  4FWR A;  2P9U A;  4YOV A;  2Q2R A;  1HLU A;  2A5X A;  3ZX3 A;  4EHT A;  1MDU B;  4KBO A;  4ISE A;  2A42 A;  4H5W A;  3C6H A;  1RFQ A;  2AP1 A;  4FO0 A;  4BRE A;  3CPE A;  3MDQ A;  2V51 B;  2VGM A;  1E4F T;  3E9L A;  4GV6 A;  3O8M A;  1R59 O;  4O5F A;  3VER A;  4CD1 A;  2NRR A;  5AQX A;  4CZM A;  1VQN N;  1Q18 A;  4IJN A;  3DLL L;  4FWO A;  3LDQ A;  3W0L A;  5JMV A;  3OA9 A;  3CCR N;  4RTF D;  1M90 O;  2RE2 A;  2OTJ N;  4XH5 A;  3TTF A;  2KHO A;  1T6D A;  3DJC A;  3BEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...