2Q2UA

Structure of chlorella virus dna ligase-product dna complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
293
Chain Sequence
b'MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
molecule tags Ligase/dna
source organism Paramecium bursaria chlorella virus 1
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
total genus 78
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2uA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2uA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2uA01
3CMEA 3PO2G 4DR1L 4GLVB 2CKZB 1R9TH 3NENA 3B6YA 2MO0A 1PH6A 3S2HH 1J6QA 2EQSA 3HOXG 4OO1I 1XMOQ 2Z6KA 3D31A 4P75A 1UWVA 3UDXA 1N36Q 3TY5A 1RIPA 1N34Q 4JBKA 2DGYA 3HOXH 1VQOA 3T1HQ 3PSIA 1V1QA 4A3IG 1QVFA 1X56A 2Q2HA 4DKAC 1KD1C 1QVCA 4B3RQ 2UXBL 1TAEA 4LF9Q 4LF4L 2NVXH 1CKNA 2I5LX 2IHFA 1XTDA 3I4OA 1OXXK 2KENA 3FP9A 2NVQH 2F3IA 1YIJA 4DR5Q 1A8VA 4GLXA 4B3TL 4OO1G 1G291 1E22A 1LUZA 4LNQA 2K50A 4DV3Q 4LWCA 3T1YQ 2E5LQ 2VL6A 4A76A 4OWXB 3F1ZA 4PZ8A 4UP9A 1H95A 1PH1A 4JI7L 1VQ7A 1XPOA 3L2PA 2UXDQ 4YCVA 1UE7A 4JI8Q 4P74A 3HOUG 3U4VA 2IX1A 1Q86C 3GTPH 3PUYA 2LXJA 3BA8A 3HOVG 4X65Q 1E3PA 1HNXL 4LFCL 3A74A 1X65A 4NXML 2JA8H 3IRBA 4DUZQ 2LSSA 3L7ZC 4GKKL 5FPOA 2JA7H 4L5SA 2HVRA 2NVYH 3TY8A 1XMQQ 2ALYB 3L0OA 3STBD 1ASZA 4LF8Q 3ICEA 1IYJB 2B63G 4A3FH 1P8LA 1WOCA 3CC7A 1PYBA 4LF7Q 2B63H 3S24A 1YHAA 5C4JH 1VQIA 5LMNW 1M1KC 1X3FA 3CPFA 3A5UA 2K4KA 3KJOA 1L1OB 2WB1E 1NY4A 1C7YA 4AQYL 3AFPA 2E2IH 4B3MQ 2B3GA 1K83H 3UE1A 3GD7A 4C3HH 3I56A 5J3BA 1XNRQ 3D0FA 3PO3G 3AQQA 5IYDG 4JI4L 1X3EA 3MEFA 2RHQB 4JI6L 1NMFA 2GVBA 4JI5Q 1AH9A 2DUDA 2PQAA 2WP8J 3M9BA 1IBML 4BY7H 4A4IA 4B3ML 3BJUA 4PG3A 2UUBQ 4UCOA 4NB3A 1IBKQ 1HR0Q 4RG1A 3GB8B 1SR3A 3PUZA 1I3QH 1PH8A 3JC66 5M5YH 4IPGA 1YI2A 3BA9A 1BVSA 1MKHA 2QA4A 3BU2A 4GOPA 4K0KQ 1E7ZA 1W3SA 4EX5A 4BBRH 2R93G 4YWMA 1YEZA 5C0XG 2E2HH 1VCIA 1WCMG 2K5NA 2R93H 3CCUA 1S3OA 1N33L 3G6EA 4A3BG 1DGSA 4WJ4A 2WAQG 2EXDA 2RCNA 4MNOA 4X64L 4A3BH 1K9MC 1HR0W 2UUCL 1A63A 2QEXA 2JA9A 1CKNB 1VQKA 3F2DA 4LUOA 1PH3A 1OXVA 4DAYB 4YHHL 3VDYA 2YYZA 4JI2Q 1YITA 2ASBA 4WJ3M 3KLWA 4DR2L 2AKWB 2Q2IA 1E1OA 3PV0A 4R4QA 4DV0L 3S14H 1TA8A 1WFQA 4UCUA 1W2BA 4LFAQ 4X66Q 5AJ3Q 4DUYQ 1XJVA 2AHOB 1QVGA 1I50H 4LFBQ 3PUWA 5IY0A 4IFDJ 2BA1A 2JK8A 4X62L 4DR7Q 4JOIA 3NEMA 4JI3L 2PNHA 2V1CC 1FGUA 1MIUA 5LMNQ 2JA5G 2UU9L 4NXNQ 4UCSA 4JI1L 2HHHQ 3F2BA 1N32L 2XGTA 4GOPB 3PIPA 4DV7L 3K80C 4DV1L 2E2JH 4OWTB 2UXCL 3TRZA 1VQMA 2Y0SE 2R7FA 4IOCA 3E9IA 4OONA 3J80i 3J81j 2ZM6Q 4JYAL 2GVAA 2FXQA 1Z9FA 1MJCA 2NZHA 4J15A 5C0XJ 1UE6A 2K14A 4ME3A 5FLXc 4A3EH 4E6NA 5HY6A 4HIOA 4A93G 3CCLA 3AEVA 1XDNA 1Z47A 4PMWA 3TQYA 1Q1EA 3RR5A 4DR4L 3U58A 3PF5A 4BXXG 3BABA 1IXRA 3Q8DA 4BY7G 1PH7A 3ZJYC 1HZ9A 2MQHA 5C44H 5EAYA 5GAEC 2UXBQ 5JJIA 1Y1WG 4R4IA 4YCWA 1QUQA 1IBLL 3HOZH 1FL0A 1VQBA 3KF6B 4KHPL 3ER0A 1EQRA 2RF4A 1HNWL 1CSQA 3GTKH 4DR6L 2YTXA 5IP7H 4DV4L 2PI2E 1HZBA 1AE3A 1VQDA 3A0JA 2Y0SG 3I55A 2IY5B 3HKZE 4GN4B 1FJGQ 5JJKA 2HIXA 1NTGA 3HOZG 4JV5L 4R1JA 4AYBG 2UUAL 3H0GG 1QZGA 2YU9H 4JI7Q 4YY3L 2I5HA 5D1OA 3S1NH 4JC0A 3TS2A 5C4XG 2N8NA 4P71A 1P16A 2OTLA 2WFWA 2KCMA 5FLMG 4GNXA 4B3SQ 3KDFB 1K73C 1GVPA 3S1RH 4MTNA 5IWAQ 3UDFA 3W5OA 1HNXQ 1OTCA 3PO2H 4YWKA 3CMAA 4DV6L 3KOJA 3CCJA 1S68A 3GTJH 1I94L 1SRUA 1QZHA 3J80c 3FHWA 2JA6H 4UPAA 5M3FH 2AWOA 3OTOQ 2VNUD 2D0OA 1N34L 5FJ8G 1PFSA 1O7IA 4YWLA 2VQEL 4LF6Q 2ZJQA 1HJPA 1TXYA 2YTVA 3GTLH 1M90C 1HZAA 4H02A 5IT9c 2WAQE 4A3LG 1IZ6A 1U5KA 2JA5H 5DLQE 3M85A 2KHIA 2XTIA 3W1GA 2VW9A 4A3LH 4QL5A 4EFEA 1UEBA 4DR5L 3UDIA 2Z6KC 4CC6A 4AIMA 2A19A 4GN3B 3RTXA 3CCSA 1OXUA 1JJ2A 4JI5L 1Q7YC 3FKIH 4Y52H 1PH5A 4HJ8A 4DR3Q 1VQAA 3CCVA 3OW2A 2ZJRA 4A3EG 3FKIG 1MJEA 2HVSA 2BH8A 3K7UC 3G4SA 3HOVH 1YZ6A 5E7NA 1HR0L 3CC4A 2PQAB 2JE6I 5BR8Q 4OXPA 1BBUA 3E0EA 5JEAJ 4DK3C 1HNZL 1LM0A 4BXXH 4DUZL 3PCOB 4JCVE 4K0KL 4JBMA 1PH9A 1VQEA 1VS0A 1Y1WH 2R7ZG 4DV2Q 1VQFA 1VQ6A 4MZ9A 4JI0Q 2K52A 3I7FA 3K81C 4FDBA 4A3FG 4HIMA 1SN8A 2CQOA 2OQ0A 4KI0A 4R4CA 1GKHA 3UDGA 4OX9Q 4EQ5A 3RN5A 1Y1VG 3A5ZB 3I4NG 3HKZG 3CCMA 4A3MH 3KYHC 5JEAG 1IL2A 3JSNA 5D1OB 2KCTA 1TWHH 2R7DA 4NPSA 4LF5L 4LF7L 4X64Q 4GKJQ 5IP9G 1EQQA 4QY7A 2CCZA 4BBSH 1Q46A 2N49A 3BZCA 3H0GH 4PZ6A 4IJHA 3PUVA 1CKOA 4AQYQ 3GTOH 5H1SE 3GTQH 2AWNA 2CWPA 5M5XH 1VQLA 1VQ5A 3HOUH 4QJFA 3NBYB 3KF6A 3K7AH 1L0WA 4JI4Q 3AFQA 1K3RA 1L1OC 5GADC 4GLAC 3PGZA 1EFWA 1SE8A 2Z0SA 5ELOA 2K5HA 4A75A 1YHBA 2VQFL 3HOYH 4UP7A 3LGJA 3S16H 2PI2A 4XIGS 2PMZE 1A62A 1Q1BA 5LMNL 4HJAA 2UU9Q 4DRFA 3S1QH 2D0PA 4TVAB 1AE2A 5M3FG 5HGQA 1S72A 4UCVA 3CAMA 3DLLA 1KIXA 1B04A 2ZTDA 4POGA 3VNNA 3M3YH 4JG2A 2ZTCA 3STBC 4BY1G 3DM3A 4HJ7A 1J5EL 1PA6A 1RL2A 4JYAQ 4BY1H 2VUMH 2F4VL 5K36G 3J7ZC 4LUVA 2VUMG 4IOAA 4UCTA 3NBZB 1XK5A 2N78A 4JBWA 1TWCH 1WYDA 1V43A 5GAGC 4DR1Q 3PO3H 2K5VA 4GOPC 1X9NA 5JJLA 3F2CA 1LYLA 2KHJA 2OQKA 4YHHQ 3U50C 3RZOH 4AH6A 2NN6G 5ELNA 5GAHC 4DR2Q 1NBWA 5IYCH 2R7ZH 4DV0Q 1SFOH 4X6AH 3QWUA 1CKMA 3T1HL 2BA0A 5LMUQ 2JA7G 1PVOA 1BKBA 4DV5L 1IBLQ 4RMFA 5M3MG 4LF9L 4LF4Q 1VQ9A 3S2DH 3GJXB 4KHPQ 4IPCA 3NELA 1HNWQ 1KL9A 4IPHA 1HZCA 5M3MH 1V9PA 4BA2I 4DR7L 5FPRA 2LXKA 4BBRG 1XNQL 1G6PA 2NN6I 3T1YL 2E5LL 3NBHB 1N32Q 4LH6A 4DV7Q 1E24A 4BA1I 5IYBH 4OWWB 3KJPA 2QGQA 4UFZA 1B7YB 4YCUA 4DV1Q 1YBYA 2NZOA 3F8TA 2OTJA 1N9WA 4JOIC 4B3SL 4TQUS 4A3GG 1X54A 5IWAL 3GTMH 2IT1A 3M7NA 3K8AA 4LFCQ 4L5TA 4NXMQ 1VQNA 4A93H 1YVCA 3G48A 4UY8C 3PF4A 4GKKQ 1T9HA 1TWGH 2JA8G 4LUZA 1U0LA 1X3GA 3NC0B 1CSPA 3OTOL 1VQHA 1JJCB 1XMQL 2A8VA 3M4OH 3ERSX 1XMOL 1N36L 2VQEQ 3J81c 2HT1A 4P73A 4DR4Q 4A3DG 1VQPA 3M4PA 4DPGA 2L15A 4B3RL 2WB1G 1K8GA 1FJGL 4A3DH 1B8AA 5GROA 3RLFA 2I0QA 4KLKA 3CCQA 1I5FA 2JEBI 3U4ZA 3AYHB 3GTGH 1WCMH 2HVQA 4DV4Q 1C9OA 3ULPA 4UCRA 4ALPA 3H3VI 1LTLA 2EIFA 1L1OA 3CF5A 1QUQB 2A1AA 2MFIA 1G51A 4HIDA 2OWOA 2R6GA 1KC8C 4B3TQ 4IFDI 4DV3L 4JV5Q 4CC5A 3ULJA 4QIWE 3UQ8A 3CP0A 3BZKA 3TS0A 1YJ9A 3CC2A 2AMCB 2HQLA 2JQOA 4YY3Q 1C0AA 1IBMQ 3ULLA 2GN5A 4DK6C 1PH2A 2UXDL 1EIFA 4JI8L 2KBNA 1Q82C 1GD7A 5GQOA 1HNZQ 3M4QA 2IHEA 2CFMA 1S40A 4X65L 1EOVA 4LW1A 2MO1A 4DV6Q 5IYCG 2JA6G 1I6HH 2K75A 3J7A5 2R92G 1KRTA 3E9HA 1I94Q 4JI0L 3S15H 4HJ9A 2F52A 2R92H 3I4MH 1D8LA 2N3SA 3I2ZA 4OX9L 1UE1A 1KXLA 1GM5A 1ASYA 4LF8L 4L5QA 1JMCA 4LF6L 1UE5A 1YJNA 5DISC 2D62A 4Y7NH 4GKJL 5M5WH 3RLOA 5C3EG 4PZ7A 3CW2C 3GDEA 4GS3A 1XPUA 4LH7A 1JJGA 1K0RA 1N8RC 3RLNA 5C3EH 4A3KG 4IJLA 1PYSB 1E1TA 3KF8B 3RZDH 3CCEA 5IYBG 2ES2A 1OXSC 2HIVA 2ATWA 4HIKA 4A3KH 1YNXA 3JAMi 4UP8A 1OXTA 5FLMH 1CUKA 4A3JH 1XNRL 1EIYB 4A3GH 3CQZH 2E8GA 1B70B 1TWAH 4X66L 5AJ3L 3JAMc 3W1BA 3G71A 4DUYL 4DR3L 4JI6Q 1SMXA 4A3JG 4LFBL 3PN1A 1VQCA 2NVTH 4X62Q 4A3IH 1Q12A 3EN2A 4KHZA 3TEHB 1X55A 2I5MX 5C44G 4O0AA 1SROA 1EYGA 1KHIA 5BR8L 2UUBL 2VZAA 3KDFA 4JI3Q 2YTYA 2VY3A 3UE0A 4JI1Q 4POFA 5FJ8H 1IBKL 2HHHL 1KRSA 2ID0A 3MXNB 3PUXA 4A3CG 4QQBX 1VQJA 2CWAA 4R4TA 1VQ8A 1Q81C 4A3CH 5D1PA 3CCRA 3K0XA 1K8AC 2UXCQ 4JBJA 4DV2L 4APVA 1HH2P 2BH2A 2JEAI 3RNUA 5IP9H 4LFAL 4P72A 1N33Q 3JSLA 4LF5Q 4IO9A 1A0IA 2YV5A 1KQSA 4BBSG 1VQGA 4C3IH 1NE3A 2UUCQ 1D7QA 1SLJA 1Y14B 1PHJA 2Q2TA 3HKSA 3S17H 1YJWA 2OCEA 1EWIA 1PV4A 4JI2L 1FVIA 4GN5A 4HJ5A 3SGIA 5LMUL 4DAMA 4C3JH 1PH4A 4DV5Q 2RHSB 3PIOA 3EIVA 3TREA 3CXCA 3H15A 1EUJA 3RN2A 1BBWA 3HOYG 1X6OA 3KFUA 3H3VH 4IPDA 4EFBA 4XTCS 4GNXB 4DR6Q 2IX0A 2VQFQ 1JB7A 4QGUA 3HOWH 1WI5A 4EEQA 2ZJPA 4AYBE 2VS1A 4GNXC 1KAWA 1Q8KA 1YHQA 4L5RC 4DNIA 5C0XI 1XNQQ 1L2FA 4C2MH 4O2DA 2H5XA 5IP7G 2MNAA 3HOWG 3BAAA 3HFZB 1NMGA 4NXNL 2JJQA 1XPRA 1TWFH 2UUAQ 3I4MG 3I4NH 1Y1VH 5IE8A 2Q2UA 3CD6A 4A3MG 3S1MH 3TY9A 3OYYA 4R4OA 3CPWA 3J81i 1JT8A 3GO5A 1J5EQ 2C35B 1JE5A 1GO3E 4IFDG 2F4VQ 2B29A 5IYDH 1NJIC 2ZM6L 3EBEA 5C4XH 2ZTEA 1VQ4A 2VUGA 1WJJA 3WWVA
chains in the Genus database with same CATH superfamily
4DR1L 4HTHA 1R9TH 3B6YA 2RDIA 2MO0A 5KG7A 1SFOA 4O7LA 1XMOQ 2Z6KA 1UWVA 1RIPA 2E74C 1K0SA 3GIDA 2L12A 1KD1C 3GTKB 1TAEA 3M4OB 4XXEA 2NVYB 2AGQA 2NVXH 5C0XH 1CKNA 2I5LX 2IHFA 2R87A 3CEBA 4M9UA 5BWUA 3H91A 2JA5A 1QNUA 3FP9A 1I4PA 2F3IA 2W9CA 3BYYB 1BCPB 4GLXA 4B3TL 3KF8A 4OO1G 2W6MA 4A3BB 3T1YQ 4A76A 3T16A 2EJFC 4AQYH 4OWXB 4UP9A 1PH1A 1FR3A 1VQ7A 1XPOA 4P74A 5A35A 3U4VA 4DR1H 1H9RA 3VYTA 5KGUA 5DLFA 2R85A 5DGIA 4C3IB 3GTPH 5L1LA 2LXJA 4HMJA 5K5PA 4X65Q 1HNXL 1GUWA 3A74A 2WTFA 4O4IF 3IRBA 3LWUA 3DM1A 2HCIA 5DMXA 1B6RA 4DQNA 4DA2A 4O3QA 1SEIA 3ITPA 3TY8A 4HNUA 3GV8B 2ZDQA 1KT8A 1U4PA 4A3FH 3ND9A 2J6TA 1P8LA 5C8YF 3PW5A 1PYBA 3S24A 3H6MA 2R8HA 4EQNA 1YHAA 4EG0A 4FFPA 3GTGA 5JEAH 4I55F 3LX0A 3A5UA 2WV6D 3KJOA 5M5WB 3JAMW 2C5CA 4AQYL 3FKIB 1K83H 2I46A 3PO3G 1S5DD 1TVXA 1GGOA 1AH9A 2GVBA 4A3KB 1BNCA 4XZ3B 2PQAA 4ED2A 2WP8J 3OMGA 3CKIB 4BY7H 2F0OA 4ZUIA 4O3OA 4YP3A 2YZLA 4MTDA 5KFXA 5J39A 3HZXA 3HOZB 4O7TA 2K6AA 4JW0A 2XSCA 4HEDA 3SNOA 4QCLA 4IPGA 3BZDB 4GOPA 3BU2A 4RH6A 4BBRH 4MV1A 3I4NB 5K3WA 2R93G 1RHPA 1RD9D 1N56A 3J80L 4U7CA 4Q45A 3CCUA 1S3OA 1N33L 1XX8A 3EJIA 3NTIA 4DV1H 1ESRA 2EYLA 1EY9A 4MNOA 3MFGA 1WH2A 1I4HA 2UUCL 1IKMA 4ME5A 4JV5H 4QIWA 3GQCA 5BYBA 4QB4A 4OHJA 1YITA 3GTKA 3WOFA 4WJ3M 1Z2OX 5FNVF 4A2BA 1TA8A 2AKWB 2Q2IA 3X3NA 2EYFA 2F0NA 2J4XA 4LFAQ 5AJ3Q 2BQ3A 2FK2A 2B2UA 4LFBQ 1GSHA 1EKFA 4JV1A 3PUWA 5M5YB 2E2IA 4RB2C 1BGWA 1EZ8A 5D14A 4FE2A 1PTOC 3NEMA 2MP1A 3M3YB 5LMNQ 2UU9L 2Y4RA 2PNRC 4R8NA 2XGTA 2B8FA 3HO8A 4DV7L 3K80C 3L4KA 4L63B 4DV1L 2E2JH 1AN8A 2F0HA 1VQMA 4I7AA 1SYFA 2MPMA 4IOCA 5DQIA 1XXGA 1HQRD 4JYAL 2EY6A 2GVAA 1BJTA 2NZHA 1MJCA 5IIFA 4FBUA 2EY2A 4A3EH 3KREA 3H0GB 5KT3A 5HY6A 1HNXH 1FD7D 1IW7D 2RCFA 1VF7A 4IAJA 1UNNC 5IT9L 1A48A 3GIIA 1U9RA 5HBRB 1FYCA 1Q1EA 2QILA 2WACA 3P1HA 4H0LC 4Q5VA 3U58A 3PF5A 1I7NA 1PMRA 2PO4A 3Q8DA 4H44C 3T13A 3ZJYC 4BY7G 2W57A 3OHBA 2R8IA 3H0GA 5GAEC 3OTOH 2K5QA 4R4IA 2YZMA 3KF6B 4CDDC 1SNDA 1II3A 3FMCA 5JVDF 2RF4A 1HNWL 1CSQA 4QW9A 3H40A 2YTXA 3MTSA 3T51B 5IP7H 1AE3A 4WRDA 3I55A 2IY5B 3HKZE 5BN4A 5G3LD 5E25A 2HIXA 4FGRA 1KC7A 2O2LD 4AYBG 2UUAL 2ASJA 3WWHA 2I5HA 2KEEA 1JICA 2N8NA 1VMCA 4P71A 2OTLA 2WFWA 1LT4D 5FLMG 3L9AX 2ZGIA 4WD3A 1BCPC 1HNXQ 5EKLA 3PO2H 3UDFA 3W5OA 3J81W 4JI6H 3MA2B 2CZGA 4YWKA 5I6YA 2W9AA 1I6UA 4K5XA 4DV6L 3VR4A 2AQ4A 2MGSA 5BR8H 1S03G 1S68A 3RZOB 1B6SA 1DXMA 5DG8A 3S1QB 1GXDC 3I70A 4JI1H 5M3FH 3OTOQ 2VNUD 3RUZA 2D0OA 1N34L 5FJ8G 2SCUB 1O7IA 5BWWA 4I50F 3V6HA 1HJPA 3GTOA 2UXCH 4KN4C 3J80E 3N6RA 4IRKA 2WAQE 3OHAA 5DLQE 3H4BA 1Q3LA 4OEMB 4FU0A 3GIPA 3RB6A 4QL5A 1UEBA 4DR5L 4RZQA 2YZNA 2W71A 1ONLA 5FO7B 3PVXA 4AIMA 3E6ZX 5I6WA 3IAYA 3RTXA 3V6JA 3CCSA 1EY6A 2JEGA 4CJ1B 2WKCA 2MCTA 2E2IB 1XTCD 4FNFA 1VQAA 2O03A 1JE4A 2EXZA 4A3EG 2Z02A 1MJEA 1SJHD 1SBBB 4QF4A 4IUUA 4R7RA 2PQAB 2A5HA 3D8GA 4OXPA 2J6SA 1HPCA 3A7AB 5JEAJ 4DK3C 2B2VA 2Q8IB 4O7SA 4DUZL 3Q8PB 4DAYA 1S0NA 1M7JA 4O7WA 3L4JA 1V1PA 3R5XA 1Y1WH 4MZ9A 4JI0Q 1KJ9A 2CQOA 4KI0A 1XYIA 1GKHA 2ZXOA 2PPBC 4EQ5A 3I4NG 1Y1VG 4BBSG 4Q0YA 3JSNA 4JYAH 1CHQD 1Q8IA 2KCTA 2HCCA 3Q24A 2JA6A 4X64Q 2YRXA 5IP9G 2F4VH 3SVMA 3MFYA 4QY7A 1NSNS 3BZCA 4A3EB 4F87A 5KEEA 3PUVA 5L9XA 5EWGA 5H1SE 3GTQH 2AWNA 1VQLA 3HOUH 4QJFA 2R7KA 5KG3A 3UI2A 4MN3A 3K7AH 4JI4Q 1ILQA 3HXLA 3MAQA 3DMUA 3UFXB 1N36H 2F0LA 1KAAA 1SYCA 2Z0SA 5KFPA 4A75A 2W9BB 1D1KA 4DUZH 2W7OA 2PI2A 1S4ZA 4ECQA 2PMZE 5LMNL 2UU9Q 2YW2A 4O7RA 2JA6B 4TVAB 3MJFA 4FFRA 2KOLA 3M3YH 1D5XC 3STBC 3DAAA 2W9CB 1PRTF 4HJ7A 2YU9B 3TIGA 1PA6A 4EGJA 1TWHA 2BDNA 4BY1H 2F4VL 3MWMA 3J7ZC 2R93A 1PFBA 4DL5A 4DL3A 4XQJA 4IALA 4YAKB 1I3QA 2VA3A 1I4QA 3A8KE 5CORA 2VUMG 1J9OA 1RYSA 1SYBA 2I87A 5J2UF 4DR1Q 1V43A 5LL6b 5C6AA 1Y69U 1GLVA 5H80A 3WWIA 3U50C 1RK5A 4WJWA 5IYCH 3QWUA 4K2KA 4IIJF 2BA0A 5LMUQ 2JA7G 4U6PA 1I6VC 4LF9L 4LF4Q 4RUCA 2HUGA 4IPCA 1HNWQ 3H94A 5C44B 5M3MH 3GV7B 1TY0A 1E2ZA 5LL6X 4DR7L 5I60A 3U55A 2A6ED 4ZOLF 4KY5A 2RGRA 3K3VA 5FOBB 3OUZA 3G7LA 5ELBA 4O84A 4YAJB 1N32Q 1T5EA 4RNMA 5I5VA 5JVH3 4OWWB 3H20A 1YBYA 1HA6A 4XT3B 2Z8LA 5EPLA 5FLXL 1IYDA 2YWVA 1N9WA 4JOIC 4A3GG 3GTMH 3GV3A 4L5TA 3TSSA 1YVCA 3G48A 1ESFA 5KFFA 3PF4A 1SFOB 5BWVA 4GKKQ 3PW2A 4YHHH 4CKBA 1E2VA 1U0LA 3K0YA 3NC0B 1CSPA 1K1QA 2FPPB 5LMUH 4PMBA 3T56B 2WYOA 4DR4Q 4NDXA 5KFCA 2HT1A 1JDEA 3J81c 5KFJA 2ATLA 1K1SA 3TP6A 3BVZA 3M4PA 4O42A 1JWSD 2AQ3B 5KKNB 2L1BA 1MHWC 4O86A 2W8KA 4A3DH 1B8AA 1S10A 4NXNH 5C3XA 1F9QA 2JEBI 3GTGH 4DU9A 1A2TA 1C9OA 3LULA 2PN1A 1Z2NX 3N41B 1LTLA 2EIFA 1NNXA 3CF5A 1G51A 3C2PA 3UQ8A 2DNCA 3CC2A 2DPIA 1SAPA 2JN4A 4ME6A 3A55A 3K7AB 1BF4A 1ILPA 3SE7A 1EIFA 2KBNA 4RNNA 1D5MC 3RF2A 1GD7A 1V51A 1TWAB 3M4QA 3D6CA 4HCEA 3URYA 4LFBH 4LW1A 4QW8A 5I5XA 5IYCG 2GQSA 2K75A 3MVVA 4A3IB 3J7A5 4DR4H 4CMDA 2UXBH 3E9HA 4JI0L 1IKLA 3S15H 4IRCA 4HJ9A 2LFNA 3I4MH 3I2ZA 1F9PA 2N3SA 1UE1A 1GM5A 1ASYA 2LS01 4L5QA 5DISC 1YJNA 5KFMA 2GQRA 4IUPA 3BQ1A 3IG0A 3QZ8A 3CW2C 4KD3A 4LH7A 1JJGA 1K0RA 1CA5A 1N8RC 5C3EH 3CCEA 4KY6A 1OXSC 4J6HA 4K8IA 1B9NA 4A3KH 3K5HA 1KABA 3V4SA 2C9OA 5AFWA 2FLPA 1AUVA 2KECA 2JXMB 1XNRL 3CQZH 2E8GA 1TWAH 5AJ3L 3G71A 4X3UA 4DR3L 3W1BA 4LFAL 2R82A 4LFBL 3TW6A 5IWAH 4O2BF 1GSOA 4ZK9B 2HDKA 4ZLTF 3H09A 4XT1B 1LT6D 3PIO3 1MI2A 3EN2A 1ICFB 1X55A 2I5MX 4HNVA 4O0AA 1SROA 1KHIA 3KDFA 2YTYA 1KRSA 2ID0A 4MV4A 2CWAA 3CCRA 4YJ2F 3DEPA 4IUNA 1A3GA 1TWFB 3LNNA 4UDUC 4HAEA 1LACA 2X6GA 2KEDA 4P72A 5KFKA 2J7ZA 1F9RA 2XGQA 3PW7A 2FFKB 2LY7A 4IO9A 4JV0A 2I07B 4DAAA 1D7QA 4A3GB 3NQIA 4E6IA 2Q2TA 3HKSA 3S17H 3PW0A 1FVIA 4EGVA 1C8CA 4KJOA 3SGIA 5LMUL 4CBVA 3RN2A 1A3UA 3E5SA 4N9PA 3T1HH 2MJ8A 4XTCS 4IUQA 3E3XA 2AGOA 2B63B 2VS1A 4GNXC 4CC6A 3GTGB 3QFFA 3X3MA 4DNIA 5IP7G 2H5XA 1NMGA 4CDFC 2JJQA 4FXDA 5BWTA 4A3MG 1A2UA 3OYYA 5I2XA 4HR7B 3GO5A 2F0PA 3U0GA 3E0JA 2Z1CA 2CHBD 4BS9A 5C4XH 1NJIC 4I4TF 3RZDB 2EE1A 3H4DA 1VQ4A 4IFDH 4BY7B 2J6UA 3T5JA 2E75C 1H9MA 4P2CB 5IGGA 3KALA 5CAEB 4G3IA 3PO2G 1VMPA 4RAYA 4RGTA 2KCCA 3NENA 1L0XB 1SYDA 3WO0A 1GUSA 4I7HA 2PZTA 3R8BA 3UDXA 1STBA 5ELCA 3NQTA 4JBKA 2DGYA 1VQOA 3KHRA 2NVTB 3K5IA 3T1HQ 3PSIA 3FRPB 2R92B 2JYOA 4DKAC 1QVCA 5EDWA 4G7OC 2FLNA 3HP3A 2NU9B 1TS5A 3PZPA 3K3PA 2DZDA 2PW5A 3PIP3 3N40P 4J9MA 2OH2A 4LNQA 1O75A 4LWCA 5TSSA 2FMCA 3MC0B 3RMHA 1H95A 3PR5B 1XNRH 3L2PA 1NR4A 3HOUG 3KHLA 3UZOA 3PUYA 5CR5A 4LFCL 4BWGB 1WTHA 1UEAB 1X65A 4NXML 1B50A 4DUZQ 4TV8F 2EY5A 4J9LA 2UU9H 1EUDB 1N34H 4H7BA 2O5IC 4ECTA 3SE0A 2DNEA 4JK1C 5KFQA 5DQGA 5L1KA 3STBD 3FPUB 1ASZA 3AX6A 1WOCA 1DV2A 5GONF 5C4JH 4KKUA 4WORA 2HHFA 1M1KC 1X3FA 4FBTA 5KNCA 3HRZC 1L1OB 2WB1E 2W6NA 4YJ3F 4LMYA 4PBCA 1EWCA 1CHPD 3K5OA 1XNRQ 3D0FA 3AQQA 2RHQB 5BN3A 4PDBA 1EEFD 4C3HG 5KG4A 2H4OA 4DR2H 3MR2A 5CBAE 3RB4A 1QCBD 3RV4A 3Q6SA 4A4IA 3P7JA 3T7AA 4J9PA 2OT2A 4I7ZC 3LWEA 4UCOA 2FMAA 4LF4H 3MEHA 3RJ0A 3PUZA 2A1HA 3HT5A 2NTTA 2OXPA 3JC66 5KFBA 4L8JA 4YR2A 2FLLA 3D4RA 5LL6S 2EJ2A 3TINA 5JQGF 4K0KQ 1SNPA 1W3SA 2A73B 1VDZA 5C4HA 4RCNA 5I9OA 1GYFA 3MR3A 4HMIA 2R93H 4DL2A 3G6EA 1CQVA 1DGSA 4Q43A 3WWJA 3BACA 3MR5A 2EXDA 3IFTA 4FS2A 1EQTA 1ET6A 4YBZB 3NBIA 5J1ZA 3F2DA 1OXVA 1IHZA 3R2IA 4JI2Q 4ZAIA 4U673 4DR2L 4R4QA 3T54A 2KHSA 1EYAA 2K33A 3CRKC 4GKKH 4LSAA 4EVOA 5CYUA 5KT7A 4UCUA 4MTKA 3R5FA 4DUYQ 4X66Q 1TS2A 3BVMA 1XJVA 1HNZH 3QO2A 2R7MA 5C5LA 5IY0A 2B2TA 1HR0H 2L5TA 4DIMA 1JR0D 1B3QA 1PTOH 1TY2A 4JOIA 1TQOA 4PV1C 1SNQA 4FF4A 4DR7Q 1TS4A 3J81L 5FKAC 2V1CC 1MIUA 2R86A 4JI1L 2QEJC 3CHBD 3F2BA 2HHHQ 2E2HB 1N32L 5BWXA 3PIPA 5IGBA 1I2LA 1BOSA 1EZ6A 4ECYA 1WTRA 4HR7A 4IZOA 2UXCL 2R7FA 3E9IA 3J81j 3J80i 2ZM6Q 4MV9A 3GILA 3MZ5A 2PW7A 5L1IA 5C0XJ 2R61A 5FLXc 4N8FA 2XD4A 4E6NA 4B3SH 2JA8B 3CCLA 3MXPA 3CU7A 3AEVA 1Z47A 3TQYA 5IGDA 3MXUA 1STNA 3S1RB 1SCUB 2FKLA 3RR5A 4C1NI 4ECZA 3K57A 4DUYH 5KG1A 3OPOA 4IWYA 5JJIA 1JOOA 1DIKA 3JZ6A 1WTOA 1JOKA 1FL0A 5IT9W 4UHVA 1CQJB 4KHPL 4EBEA 5C1PA 3NGDA 2PI2E 3IL8A 5C4JB 3C1FA 4H13C 5JJKA 4GN4B 1WCMA 2NVQB 3KLSX 1TWFA 3CSWA 4R1JA 5EBCA 1NUCA 5C5MA 2IBKA 4JI7Q 1B44D 3S1NH 3AU7A 4J9QA 5HGTA 1P16A 2KCMA 3KUPA 3KDFB 4FO2A 1GVPA 3S1RH 4MTNA 5IWAQ 4B3SQ 1OTCA 3C1EA 2CNVA 3G6XA 3CMAA 1QWYA 2A74C 1S0OA 2F0VA 4KN7C 4K5WA 3CCJA 1R9TA 3A8JE 4RAZA 5T1GA 3M9NB 1SRUA 1QZHA 3J80c 1SEBD 1FGBD 2AWOA 5CV7A 4G4KA 1G8ZD 2VQEL 5KNBA 4LF6Q 1RCVD 2ZJQA 1TXYA 2YTVA 5CMDA 1M90C 1HZAA 3FEWX 3DF7A 2JA5H 3M85A 4DAVA 2XTIA 3W1GA 1F2YA 2PZWA 4LJZC 3UDIA 1JORA 1EUCB 1PXUA 3GV5B 4GN3B 4JI7H 2HDLA 3T9CA 3TQTA 2WE6A 1BCPD 1EYCA 1Q7YC 2NZ1D 5FO9B 2ASDA 1PH5A 4HJ8A 4DR3Q 2Z6BA 1EU4A 3OW2A 2VA2A 3FPPA 1IYUA 4K6NA 3K7UC 2HVSA 1W6JA 3I4LA 3F2UA 2A6EC 5E7NA 1HR0L 3CC4A 1T94A 2JE6I 5E1FA 1OBGA 1KDBA 2CW0C 4CMFA 1BBUA 3E0EA 5HURA 1LM0A 1B53A 2SOBA 1MSGA 4BXXH 4DR6H 1O7LA 2JP1A 4JBMA 1ZEQX 1VS0A 2F0JA 4DK0A 1VQ6A 4BBSH 3K81C 3I7FA 4LF9H 2KSWA 4HIMA 1SN8A 4R4CA 2E2JB 3T5HA 3A5ZB 2WB1B 5NUCA 3CCMA 3KYHC 5JEAG 5D1OB 1X3QA 3TP5A 2QB5A 1STYA 4LAAA 4B9WA 1EQQA 2F0KA 2VXWA 5BN5A 2N49A 1TKWB 4PZ6A 3GTOH 3J7AK 3CQZB 2CWPA 4DR3H 3KF6A 1G6ZA 4EQOA 5EPKA 4C3JG 2K04A 4Z9CB 1MGSA 1EFWA 2K5HA 1YHBA 5KYIA 3LGJA 5KFGA 1AFPA 1K8OA 5F2DA 2D0PA 4GLWA 3CAMA 4KHVA 3TEKA 1B04A 2ZTDA 2EYJA 3FDTA 1JXLA 1CK1A 4JG2A 3KHGA 2ZTCA 4BY1G 3QR8A 4OGQC 2V4RA 2K5DA 3DWQA 2VUMH 2C28A 5DG7A 3Q23A 2DAAA 1KJQA 4UCTA 5M5XB 3J80W 4JBWA 1WYDA 4QWBA 2KCNA 3OMCA 4ED0A 5KYLA 3NE5B 2L11A 5DM73 2OQKA 1ENFA 3DWAA 2IP4A 2W6PA 1ICWA 5KFNA 5ELNA 1JOQA 1W6KA 1NBWA 4X6AH 1B2TA 4DV0Q 3RIZA 3T1HL 2QF7A 4JV2A 5E4WC 1E0BA 2VQEH 4YB8B 4RMFA 2EZVA 4IN3A 4KHPQ 1PX2A 3NELA 1B3AA 1QE6A 2FE3A 3C0FB 1HZCA 4ZKBB 1V9PA 3G8CA 3PR4A 1AZQA 5FPRA 1E4FT 4BBRG 1LT3D 2JSOA 1G6PA 1VBGA 3PQIA 2NN6I 3BG5A 5C3EB 2R8JA 5ISRA 1E24A 4BA1I 5IYBH 1V4YA 4J9SA 3K58A 2B2UC 4DV1Q 5CE8A 5KFEA 4L1KA 2A68D 4R8UB 2OTJA 2XC9A 3GP7A 1KDCA 3GLKA 4TQUS 1OBDA 5EWFA 5IWAL 1TWCA 4J9KA 4JI5H 2IT1A 1R9TB 4CKEA 1M6VA 4LFCQ 4NXMQ 2R3ZA 4M7EA 1XWEA 4QWDA 2KUMA 1T9HA 3BG3A 4LUZA 2Z4IA 5G3LF 5IYZF 1TS3A 3M4OH 1F2LA 2TSSA 1GHJA 4HSVA 3TN2A 1XMOL 1WD0A 1ZXTA 1BNZA 2A8VA 5KFWA 4RNOA 1IBLH 4A3DG 1VQPA 4KY7A 4DPGA 5DG9A 5GROA 1PZID 3I4MB 2HVQA 4ED3A 4IRDA 1QG7A 4NZNA 3H3VI 4ILWA 3QIAA 5KNDA 5KT5A 2YU9A 4HIDA 2MFIA 4B3TQ 3Q8QB 5KT2A 2R6GA 4O4HF 2QW7A 4DV3L 1Z6HA 1IYEA 3CP0A 3TS0A 2AMCB 3R93A 1IBMQ 3EFXD 2GN5A 5JVG3 5C4XB 4F4ZA 4DK6C 2UXDL 1HCZA 4HNTA 4JVZA 5GQOA 1HNZQ 1UNSA 2RGVA 1EOVA 1RJPA 3BDOA 2MO1A 4HQ6A 5HV6A 2G9DA 1D1IA 2F4IA 1KRTA 1I94Q 4IR1A 2H1EA 2OF1A 3I3CA 3I73A 5IODA 3RAXA 1D8LA 4OELB 3JRXA 4V0BA 5DNFA 3JAML 3TQ1A 2CW0D 4Y7NH 3T9AA 5EWEA 4ED8A 4J9OA 5M5WH 1LV9A 4YQWA 1K28A 1XPUA 1JWMD 1HXYD 1I50A 4IJLA 4O3PA 1E1TA 1SMYC 2YL2A 5IYBG 2M2LA 2QKIC 4S3SA 2ATWA 2QK4A 4UP8A 4RAUC 2NBFA 1CUKA 1DM0B 4A3JH 3DTFA 1AEXA 4JI6Q 3PN1A 3WOEA 4TVIA 1CTMA 3W3AA 4A3IH 3K5MA 3TEHB 1FNVA 4RGNA 5C44G 4B3MQ 4CHIA 4JI3Q 5BR8L 2VZAA 2VY3A 2A6HC 3ERQA 3K6OA 4A3CG 3T9BA 5FLXW 1PK8A 4Y7NB 1Q81C 3WDNA 3LP8A 4OO1H 1LO5D 4C5CA 3JAME 2WAQB 2RSOA 1F2ZA 1GUGA 2VPQA 3ORRA 3EROA 5IP9H 1Z7TA 3NP8A 5I2YA 5D8DA 2DY7A 4LF5Q 1JLLB 4Q8FA 1X32A 2X69A 4F4XA 4L6TB 3HS0C 1A0IA 2YV5A 1KQSA 3J7AF 2RKSA 1Z2PX 4A3JB 4C3IH 3GTPB 2V4QA 3KTMA 4IR9A 2OCEA 1EWIA 1PV4A 3CQZA 4HJ5A 1I1LA 2RDJA 2EYHA 3CXCA 2D5DA 3TREA 3H15A 1GUOA 2CW7A 5LYJF 3HOYG 5KFRA 4IPDA 3G6VA 4B3MH 1SXTA 1DYQA 2G9HD 4LF6H 2K03A 2VQFQ 1JB7A 4A3DB 5COYA 4IWXA 2ZJPA 4AYBE 1EL0A 2HHFB 1YHQA 4L5RC 4DNTB 1XNQQ 3BAAA 1PZJD 1L2FA 3ZYYX 3GTPA 1SNCA 3JZIA 1TWFH 3D3RA 4AYBB 3I4NH 1Y1VH 3K59A 3S1MH 4DV3H 5KFOA 2XNAC 3CPWA 3ETHA 4EYHB 3T1YH 3J81i 1JT8A 2NU8B 3T9FA 1JE5A 3VA5A 4GKJH 3ONAB 5C1OA 4IFDG 2F4VQ 2X5RA 1S0MA 4J9NA 3EBEA 5EKIA 3NHHA 2UXDH 2ZTEA 2YZGA 4RKLA 2VUGA 2KJXA 3SDZA 2N88A 3WWVA 1IYVA 2B2WC 5EGTA 4GLVB 4WFN3 1IOWA 2UVUA 1NR2A 5JQWA 1J6QA 3HOXG 4ID6A 4OO1I 1N36Q 4P75A 2ABJA 2F0EA 3TY5A 1QILA 2Z4HA 3JRWA 1PFNA 5C5JA 3K5NA 2NYZD 1V1QA 4A3IG 1K83A 1QJOA 2B39A 2CNUA 4LF9Q 4LF4L 2XCPA 4QIWB 1XTDA 3I4OA 2R93B 1OXXK 2O5JC 1XNQH 2ICEC 1JC7A 1A8VA 4B9XA 1JB3A 1G291 1LUZA 2L4NA 2K50A 4DV3Q 2CH4W 1RYRA 3D6WA 2DY8A 4PZ8A 2KQ3A 4O7VA 3RGZA 4O1NA 2GPWA 2ODTX 2IJ0A 2RVLA 1UE7A 4YCVA 4JI8Q 4DF7A 2UXDQ 2IX1A 2M05A 1SYXB 3BA8A 3HOVG 1E3PA 4ECVA 3OWFA 3VMMA 3L7ZC 2HGWA 4GKKL 2B2YC 2FJ2A 2JA7H 4L5SA 3V6KA 5DLGA 2XIGA 1S5CD 1I6HB 2ALYB 3L0OA 1EHIA 5A2QW 3GTQA 5K2MA 1EIHA 1HNWH 1IYJB 1F9SA 4ETSA 1RKNA 1WR2A 2B63H 4LF7Q 4QUFA 4FP5D 2Q8RE 2PMZB 1KTAA 1NY4A 3QZ7A 1ET9A 3AFPA 2E2IH 2XWJB 1V1PB 2B3GA 4ED7A 2LKVA 1HRJA 3UE1A 3GD7A 4C3HH 5J3BA 3DUZA 4Y8VB 5IYDG 4O7ZA 1X3EA 3NWSA 3MEFA 2V58A 4JI6L 1NMFA 1FNWA 3KXYT 5KG6A 3EPGA 4JI8H 3M9BA 3TBIB 2R7ZA 3QB3A 1B1ZA 3KAKA 4V190 4X65H 4B3ML 3RGXA 4PG3A 4RG1A 4KHPH 1SR3A 1I3QH 4F50A 5KS8A 1R4PB 1SDFA 1PH8A 2R7ZB 3RD4A 3BA9A 1MKHA 5KIXA 3HB9A 2FHTA 1CQFA 4EX5A 3TP7A 3JZFA 1HTLD 4LSXA 3CRLC 5C0XG 3RBDA 1WCMG 2B2WA 3I8ZA 3GIQA 5DEHA 1BBXC 1AN7A 4A3BG 4ECRA 2K7VA 1BUVT 4X64L 1S5BD 1HR0W 4K5VA 2BOSA 3U9SA 1CKNB 4LUOA 1PH3A 4DAYB 5I9PA 2QDBA 2YYZA 3VDYA 3KLWA 5ELDA 3IKJA 3KK7A 3PV0A 4DV0L 3S14H 5EKKA 2I80A 1WFQA 3VR2A 2NN6H 3W2DA 3RB3A 1W2BA 3HOXB 1KEEA 5M3FB 5KFVA 1QVGA 1I50H 3T4AC 3BYTB 4IFDJ 4EEYA 2BA1A 2JK8A 1V1OA 3DHQA 3GTMA 3UZBA 3KBGA 4UCSA 1UAPA 3FDSA 4RCOA 2IX3A 3N44B 4Q0FA 1WTXA 3OW7A 5C3WA 1GUTA 3A7LA 4AYBA 4OONA 4QUCA 4CJ0B 2FXQA 2B2YA 1CT1D 1A6XA 5JH7F 1UE6A 1IBMH 4O3SA 1LABA 2CNQA 2EVBA 2EIYA 4HIOA 1WSCA 1SNMA 4IUVA 4A93G 2F3WA 4HCSA 1EEID 1XDNA 4MHEA 4RKBA 4PMWA 1CS0A 3PO2B 2ENBA 4RU9A 3RBEA 3BABA 2ZDHA 4LFAH 4PNYA 1HZ9A 5EAYA 1Y1WG 3LMLA 4YCWA 1QUQA 1SJED 4GZYC 2V5AA 5FLXE 5KFSA 3ER0A 3PMFA 3GTKH 4DR6L 4DV4L 4EGQA 1HZBA 1VQDA 3MWYW 2NVXB 5DGAA 3MHBA 4CE5A 1FJGQ 1L2ZA 2BDOA 5CGKA 3NK9A 2F03A 5IGEA 4K6DA 1QZGA 2YU9H 4GC6A 4MV6A 2X0SA 5D1OA 5C4XG 1STHA 2EJ3A 3QQMA 3BJYA 4NP5A 4GNXA 4PQXA 1UC8A 2I8CA 2CQYA 1HQMC 1I7LA 1ZYRC 5EOYA 3V96A 2A6HD 3GTJH 1I94L 4JI3H 2VB3X 4DN4M 3FHWA 2F0GA 3BVGA 1WD1A 2ALZA 5CC4A 2RBMA 3GIJA 1PFSA 4YWLA 2A69D 4XX0B 4H02A 3TP8A 1ULZA 5IT9c 3M7GA 4A3LG 2NU6B 1U5KA 2D9UA 2KHIA 1ENCA 3SEBA 4DXFA 2WAQA 2QDLA 4O82A 1DZ1A 1N33H 4LF5H 3H3VC 2WINB 4IHJF 2A19A 4FYDA 1OXUA 3DWPA 2CQAA 1JJ2A 1ZETA 4F88A 3FKIH 4A2AA 3PFFA 3QOLA 3CCVA 4ZRZA 4JI4H 3KLSA 2C2EA 5DGBA 1U4RA 2BH8A 2AQ1B 1YZ6A 4GC7A 4EQPA 4HYKA 5BR8Q 3S2DB 1IL8A 1K8MA 2XCAA 5D3DA 5KG2A 4IQZA 3PCOB 4JCVE 4Q4CA 2UVRA 5KT4A 2F0TA 2RA4A 1PH9A 1I2KA 3NTKA 2K52A 2OQ0A 2XCLA 2Y0SB 1PYWD 3RN5A 4K14A 1QNKA 5CA1F 2R7DA 4LF5L 4NPSA 2HD3A 2PVPA 4GKJQ 4R8IA 4NYEA 2JEFA 2EOTA 1Q46A 4IZ8A 4MIUA 2RDGA 3HEJA 1HUNA 5KX5F 5CV5A 4RUAA 5M5XH 4FS1A 3NBYB 3N52A 5KFHA 1OO9B 3AFQA 1WTPA 1K3RA 1Y8PB 1XMOH 1L1OC 2YS7A 1SE8A 2VQFL 3HOYH 1H9SB 4XIGS 5I5TA 3TW7A 5BYAA 2DIKA 1A62A 5KFDA 2EJ0A 5EQ0A 2Q8TA 1AE2A 2DN8A 5M3FG 5HGQA 4UCVA 3FKIA 1SYGA 1KIXA 3DTGA 1L0YB 3GV6A 2DWCA 5J2TF 4JYAQ 5CV9A 5LHY1 2JA5B 4ZCKA 2VR1A 1LTAD 5LXTF 4F4YA 3GTQB 2RQXA 1HUMA 3NBZB 2N78A 1TWCH 1Y1WA 1KTKA 3V05A 5GAGC 2K5VA 1YNNC 1X9NA 2W70A 3GTLA 5IOCA 2FP4B 4YHHQ 3MR6A 1DCZA 5DM63 2F3VA 1PDQA 1V8QA 4DR2Q 3CVZA 1SFOH 2R8KA 1CKMA 2FINB 2B8GA 1AZPA 3S15B 3SK8A 2PCFB 1VQ9A 3GQBA 3VPBA 5LA6F 3DXJC 4IPHA 4RZRA 3C46A 4LK1C 4K0KH 3NWTA 4DL6A 2NUAB 1SE2A 3T1YL 2OEOA 1DJRD 3NBHB 5CA0F 5BPHA 4J9RA 3PW4A 2F0IA 5FO8B 4UFZA 1B7YB 2NZOA 2CVRA 2NVYA 4YY3H 3R3OA 5KRUA 1X54A 4YIJA 3K8AA 1GOZA 2ZT9C 2FB9A 2PYKA 1TWGH 1BO0A 2VUMA 2NWGA 1X3GA 4O4JF 3OTOL 4CDCC 1VQHA 4ZUJA 4P73A 1A9XA 1ZHSA 1CZWA 1T36A 2F0SA 4B3RL 2WB1G 1K8GA 2UVWA 1I4GA 4KLKA 3CCQA 2XGPA 1NCVA 3OUUA 3U4ZA 3AYHB 1JX4A 1WCMH 3AMUA 4EBCA 4UCRA 3T9DA 4ULLA 4ALPA 4EYIB 2A68C 3OSPA 1N32H 1L1OA 2V9WA 1QUQB 1YNJC 3VA7A 4IFDI 3K5LA 4CC5A 4JV5Q 1WTWA 2L55A 2VUMB 3BZKA 1YJ9A 1D5ZC 2HQLA 2JQOA 4YY3Q 2DPJA 4QMGA 2HQEA 1MBYA 1CFMA 4DLKA 4X3KA 1Q82C 3ETJA 1CQIB 1I1KA 2CFMA 2D2CC 1RJQA 3RUPA 3WNZA 1HFGA 2JA6G 4XQNA 4XDXA 1U4LA 5LMNH 1RTOA 1J8IA 2R92H 4MV8A 4TM5A 1OWTA 1SNOA 1DOMA 2XN9C 3VYUA 4LF8L 1WTQA 4LF6L 5I47A 1UE5A 5DAUA 2SNSA 2D62A 4GKJL 2F0WA 5JJZA 4PZ7A 1H9JA 4ZHQF 4QWEA 2SNMA 1PTOD 2BE5C 3RZDH 2ES2A 4ECUA 2F1MA 2ZXRA 4DFAA 1UUPA 3ND8A 3VYRA 4HIKA 5CBEE 1A0GA 1A15A 4ZQIA 3R23A 2FJZA 1OXTA 4A3GH 1EIYB 1M0TA 4O83A 4QWCA 1B70B 3HOUB 3JAMc 4O4LF 1SMXA 4A3JG 1C3OA 2V59A 5DGHA 1VQCA 2NVTH 1I3QB 4CDEC 1DOLA 2C22A 2UUBL 3J7AV 1IBKL 2PMZA 4ED1A 3MXNB 1STGA 3V4ZA 5F9LA 1C30A 4R4TA 4A3CH 2QYZA 2O4XA 3K0XA 1FJGH 4F7XA 1K8AC 4DV2L 5LOVF 4XYQA 3R2TA 4O3NA 1HH2P 4MTEA 1UC9A 4K8JA 1SMYD 5JPMC 2R7NA 1J5EH 3S1MB 1WCMB 4NZMA 3U54A 3JSLA 1EKPA 4ECSA 1VQGA 3MXGA 5JUMA 1SLJA 1Y14B 4G7HC 1PHJA 4Q4DA 1MZBA 1S9FA 3D4WA 1STEA 3J81E 2B63A 4JI2L 4GN5A 2F0DA 2QCPX 4QWAA 4DAMA 2R8GA 4N9TA 4C3JH 1PH4A 3KHHA 2RHSB 4CHTB 1EY4A 1BBWA 2COGA 3TIIA 1X6OA 3KFUA 3H3VH 1JDBB 4EFBA 3NTHA 3Q0AA 4DL4A 4RGMA 4DR6Q 3N8DA 4HSPA 4QGUA 3HOWH 2P0AA 4EEQA 2Y0SA 4RB3C 2XVSA 2R7ZH 1KAWA 2RSNA 5C0XI 5KFZA 4O2DA 2MNAA 4DV2H 2IMWP 3HFZB 1HA5A 4NXNL 1O80A 3I4MG 2UUAQ 1E4EB 5IE8A 3CD6A 4ED6A 2E5LH 1EIGA 1LLRD 5K36H 1K83B 1E4GT 1J5EQ 2C35B 2IW3A 1RF2D 1WVLA 4FFMA 1GO3E 1O78A 2ZM6L 3QG1A 4C56C 1VAJA 3VR3A 2GPSA 3MWDA 1ML0D 4NMZA 2VPSA 3CMEA 1RTNA 3MXNA 4DNRB 2CKZB 1EKVA 2ASLA 4A93B 1PH6A 3S2HH 2FMMA 2EQSA 3QJYA 4G57A 4APMA 4QSHA 3G8DA 3D31A 1PRTB 2JA7A 2HDMA 3GTJA 3M9MB 1N34Q 1EY0A 4NZOA 3HOXH 2F0MA 2J0TD 4M8AA 1QVFA 1XMQH 1X56A 2Q2HA 4B3RQ 2UXBL 1KBLA 4JI0H 1BQQT 2BCOA 2KENA 3HG9A 2NVQH 2SEBD 1C4QA 1YIJA 4DR5Q 5JVLA 2AUKA 3OOCA 1Y1VA 4EBDA 2R6FA 4X64H 1E22A 3VR6A 4ZKCB 4DAPA 2E5LQ 1CA6A 2VL6A 2HJWA 3T5LA 5I4DA 4C5BA 3F1ZA 1NAPA 4JI7L 5CM0A 2FPIB 2YCHA 3EPIA 2R7LA 1Q86C 1ENAA 5A2QL 2JA8H 4NKLA 2BE5D 1KJJA 2LSSA 4FF1A 2W6QA 4MAMA 5FPOA 4DV0H 4LMQD 2HVRA 2K05A 2NVYH 2K5WA 2V4DA 1XMQQ 4ODGA 3A8IE 2NVXA 4LF8Q 3ICEA 1JWUD 2B63G 1KUTA 4R9WA 5FR9A 3CC7A 3HOWB 2VQDA 4TSSA 1VQIA 5LMNW 3CPFA 2K4KA 1HTPA 1C7YA 3N43B 3Q8SB 5J22A 1HHVA 4J8QA 3U9OA 5IGFA 2PBZA 1STAA 4JI2H 3I56A 4RHRA 1G2TA 3GIMA 4JI4L 4HN7A 1GSAA 4JI5Q 2DUDA 1IBML 3BQ0A 4U68A 3TZUA 2GA4B 4KKSA 2W6ZA 4X66H 1DD2A 4X3TA 3OSOA 3BJUA 2UUBQ 2XRSD 1KLGD 5I5UA 4NB3A 1IBKQ 1HR0Q 3GB8B 5DAAA 2VB2X 4DR7H 1TT2A 1EYZA 1I50B 2DJGC 4KJNA 5M5YH 1GHKA 1YI2A 1BVSA 4NW2A 2SDFA 2QA4A 3N6XA 4TKOB 2XWBB 1E7ZA 4A3MB 4YWMA 1YEZA 3OWEB 2E2HH 1VCIA 2M00A 5FK9C 2K5NA 4WHXA 3RV3A 1B4OA 4N8X1 4ZI7F 1A3TA 4WJ4A 3R9RA 2ZM6H 2WAQG 2RCNA 2HG8A 4CKCA 4RA8A 2F0QA 1ZYRD 2K32A 1A63A 4A3BH 1K9MC 4B3TH 1QOHA 2QEXA 2JA9A 2TMPA 1VQKA 2L0CA 2COJA 3G6YA 4YHHL 5EBDA 5I5YA 1EU3A 2ASBA 2IPKD 1SYEA 2HGXA 1E1OA 4OL7A 2YS6A 2A69C 3LQSA 4MA0A 3GTJB 4MA5A 3O13A 2AQ2B 4CGYB 1M4VA 4JPBW 1BDOA 2XRQD 1I4RA 3KAJA 2AHOB 3RAQA 4F4WA 1FKAH 1R4QB 2NTSA 4X62L 3SK5A 4BBRB 4JI3L 2PNHA 1I94H 1FGUA 2XIWA 2JA5G 4NXNQ 4ZQ3A 1Y1WB 4KK7A 4GOPB 3IFDA 3I90A 5D3IB 1YNJD 3EYYA 4C2MB 3EVQA 4OWTB 2R84A 4G7ZC 3TRZA 2Y0SE 5I5WA 1Y1VB 4J0MA 1E4EA 4TQRA 1TWHB 4J15A 1Z9FA 3M4YA 4X3SA 4FFLA 5FD6A 3NPPA 2ZDGA 1KNEA 2K14A 4ME3A 1M8AA 1AUXA 1DV1A 1WRVA 2OLSA 3S1NB 5BMVF 2Z9HA 2WKDA 1TWGA 3NXWA 1MSHA 2W6OA 5KG0A 2AUJD 2JA7B 4KMUC 4DR4L 4BXXG 1H9SA 4YR0A 1O7YA 1IXRA 4DK1A 2AU0A 1PH7A 1VBHA 2W9BA 4R8UA 2MQHA 3R5HA 5C44H 2UXBQ 3T99A 5KFYA 1IBLL 3HOZH 1CE8A 2DABA 1VQBA 1JCKB 1EQRA 2EPBA 1ZQ7A 4KD4A 4YR3A 3U9TA 3N42B 4RWSC 3A0JA 3SR1A 2Y0SG 4C2MA 2K1BA 4KV6A 1N48A 1T3NA 4FFOA 1NTGA 1EQVA 4JV5L 2PQEA 5KT6A 4B08A 3H0GG 3D4DA 2C2DA 5JAVA 3FVQA 4FVMA 1SE3A 1EWHA 4WBNF 4YY3L 3G6JB 1K3BC 4PWQA 5D65A 4JC0A 3TS2A 1LTSD 2UUCH 1K73C 2JEJA 2YYAA 3BDCA 3T53B 3OIPA 3KOJA 5CR3A 4M0JA 1CZGA 3S16B 3HOVB 2AGPA 4FF3A 4O7YA 3HGBA 1E2WA 2JA6H 1PLFA 4UPAA 4ZYSA 4RFBA 1BCPF 3GTLH 1I1MA 3HBLA 2VQFH 1PTOB 3QWNA 1C48A 4TRDA 2FK1A 1U4MA 2P5ZX 1IZ6A 4K6LA 4BY1B 3OIQA 2C00A 2Z04A 1PFMA 1YNND 2IL8A 1RK6A 2VW9A 4A3LH 4EFEA 5KFTA 2Z6KC 4O7NA 3E5NA 2G5DA 3SK6A 2B2TC 4JI5L 2X6LA 4Y52H 2BR0A 3S9WA 3GTOB 4IUTA 3VPCA 2ZJRA 3FKIG 3EQLC 4DGZA 4XYLB 3G4SA 2DLNA 3HOVH 1SE4A 4HN2A 3NUAA 4FXKC 1RJTA 1H9KA 1AW7A 2K01A 1HNZL 3BDLA 4K0KL 1DOKA 4Q44A 1LTID 1VQEA 1EOTA 4ECWA 2R7ZG 1EY8A 1VQFA 5JPNC 4DV2Q 4MV7A 4A3FG 4FDBA 1ZKOA 2UUAH 1EZ1A 3UDGA 4OX9Q 1EYDA 2CH4A 3J7YW 3FMAA 1KDAA 3Q8RB 3HKZG 4A3MH 5DQHA 1IL2A 1TWHH 2KVMA 4DXGA 4LF7L 4DL7A 2EJMA 1ZHQA 2VOBA 3SK4A 2CCZA 1DONA 3H0GH 3L3OC 4IJHA 1CKOA 4AQYQ 5E3FA 3Q2OA 1VQ5A 3GIKA 2EY1A 5T14A 1PTOF 1L0WA 1VF5C 4O2AF 3LWBA 5M9OA 5GADC 4GLAC 3S14B 3PGZA 5ELOA 1RJRA 1M0WA 4UP7A 3S16H 3F8NA 4B3RH 1RDPD 2K28A 1FNUA 1Q1BA 1X3PA 4HJAA 4DRFA 1D2BA 3S1QH 3HKZB 3AW8A 4PMCA 1BXRA 1DAAA 1S72A 1EY7A 3DLLA 2WB1A 4POGA 4DR5H 3VNNA 4Q8EA 2MUYA 2Q7DA 2ZJTA 5CV8A 5LP6F 2BQUA 1JIHA 4TQSA 4OX9H 3DM3A 1J5EL 2EYMA 3Q22A 1RL2A 4DV7H 4LF7H 1BXTA 2WDTA 5K36G 4LUVA 1LTRD 3BS1A 4O81A 4IOAA 3BQ2A 1ET0A 1XK5A 2R92A 3EA6A 1PRTD 2ZXPA 3PO3H 4GOPC 4LFCH 4NXMH 3GTMB 5JJLA 3F2CA 2M9VA 1LYLA 2KHJA 4CJ2C 3RZOH 3VPDA 1BR9A 2NN6G 4AH6A 5GAHC 4UUGA 3IN5A 2EYPA 2MHVA 1PVOA 2LMCB 1BKBA 4DV5L 1IBLQ 5M3MG 4C1NK 3KLRA 3S2DH 3GJXB 3GTLB 4LF8H 4OIJA 2W7PA 1KL9A 2FPGB 4BA2I 3P20A 2LXKA 4K2LA 4MV3A 3A54A 1XNQL 4BBSB 1SSOA 3TZDA 2E5LL 1CI3M 3M9OB 4E4TA 4FM9A 4LH6A 3UYYA 4DV7Q 3NBHA 3KJPA 2QGQA 1ZAUA 5I5SA 4YCUA 1VKZA 3F8TA 3MWEA 1F77A 1IW7C 4XYOA 1S5FD 4M1UB 4B3SL 4F8MA 3M7NA 1VQNA 4A93H 2E76C 1G91A 4UY8C 1S5ED 2NB0A 3I91A 2N55A 4KKTA 2JA8G 2UUBH 1CM9A 1KJ8A 1EY5A 1IBKH 4DV6H 1A3VA 1TR5A 1JJCB 1XMQL 4NLGA 3ERSX 1N36L 4TUYF 2VQEQ 3NUCA 5C4ZA 3HOYB 1S97A 1LTTD 2L15A 1W93A 3RLFA 3ORQA 4FFNA 1I5FA 4DV4Q 3V2TA 4FXGC 3ULPA 2IA6A 2OWOA 1FJGL 2A1AA 1O7ZA 1KC8C 4JUZA 2EDGA 4C3IG 3ULJA 4QIWE 3S17B 1C0AA 5KFAA 1Y8OB 1B33N 3ULLA 4C3JB 4RB0A 1PH2A 1TWGB 3WO1A 1TWCB 3P75A 4JI8L 2GLTA 2EYOA 2ICIA 1LTGD 1QB5D 2IHEA 1S40A 3RB0A 4X65L 1AP0A 2BQRA 3SI8A 5IT9E 4DV6Q 1I6HH 2R92G 3MFHA 4A3FB 4RGOS 5ELFA 2HHHH 1D6EC 2F52A 4RHSA 5JOBA 3M4IA 4TV9F 5KFLA 4OX9L 5EJWA 3TDQA 3VR5A 1KXLA 1KLUD 1JMCA 2NU7B 3OHXC 2E2HA 4J1MA 3RLOA 5C3EG 4DV4H 5EPJA 2IWHA 2CW8A 3GDEA 4GS3A 1IOVA 1TU2B 3RFCA 3T5KA 3RLNA 4IURA 4A3KG 1PYSB 1JQYD 1LTBD 3KF8B 3PO3B 2HIVA 2COIA 1W96A 2F0FA 4KTAA 2KA7A 1YNXA 4ABNA 3JAMi 1JKJB 5BWRA 2L9HA 2W8LA 5FLMH 1LT5D 5KFUA 4BWSC 4DUYL 4X66L 1KNAA 4DV5H 5KFIA 4O3RA 1G2SA 5FD5A 3I12A 4X62Q 1Q12A 5L37A 3C3LA 1MD2D 4KHZA 1EYGA 5E4XA 1PRTC 5M3MB 3A56A 5ELEA 4POFA 2I0QA 3UE0A 4JI1Q 2HHHL 5FJ8H 3HOZG 4QQBX 3PUXA 2UVVA 1PZKD 1VQJA 5D1PA 3AB9A 4UAIA 1VQ8A 5EZYF 2UXCQ 3MFIA 4JBJA 1TIID 3HKZA 4APVA 2YRWA 2PZUA 1B9MA 2BH2A 2JEAI 3VOTA 2RDFA 1GJXA 2J9GA 3RNUA 1HFNA 5KG5A 1N33Q 4XYMB 5T1IA 1Q90A 2B2VC 5HNEA 2WIIB 3NSWA 3OSNA 4XQQA 3Q1KA 4RB1A 4OIKA 1F2MA 2F0UA 1NE3A 2UUCQ 2EJGC 5A2QE 1T5XD 1EFID 4C3HB 1YJWA 5F9NA 4JXUA 1TWAA 5CV4A 4DV5Q 3PIOA 3EIVA 1EUJA 4FF2A 3S2HB 2FK3A 3I72A 4ECXA 4X62H 1GUNA 5IGCA 4GNXB 2IX0A 3KBXA 1Y8NB 1WI5A 5BPFA 1Q8KA 4C5AA 4I65A 4C2MH 3HOWG 5CB4F 5L1JA 2JEIA 3T9EA 1XPRA 3SHLA 3DEOA 2Q2UA 3SXHA 3TY9A 1WTVA 4R4OA 2RDHA 1G2WA 1RODA 1KJIA 2C2RA 2B29A 5IYDH 3VYSA 1I4XA 3TMEA 2NUCA 5CV6A 2HGSA 2E2DC 3QOJA 1WJJA 2DJFC
chains in the Genus database with same CATH topology
3CMEA 3PO2G 4DR1L 4RAYA 4GLVB 2CKZB 1R9TH 3NENA 3B6YA 2MO0A 1PH6A 3S2HH 4I7HA 1J6QA 2EQSA 3HOXG 4APMA 4OO1I 1XMOQ 2Z6KA 3D31A 4P75A 1UWVA 3UDXA 1N36Q 3TY5A 1RIPA 1N34Q 4JBKA 2DGYA 3HOXH 1VQOA 3T1HQ 3PSIA 1V1QA 4A3IG 1QVFA 1XMQH 1X56A 2Q2HA 4DKAC 1KD1C 1QVCA 4B3RQ 2UXBL 1TAEA 4JI0H 4LF9Q 4LF4L 2NVXH 1CKNA 2I5LX 2IHFA 1XTDA 3I4OA 1OXXK 2KENA 3FP9A 2NVQH 2F3IA 1XNQH 1YIJA 4DR5Q 1A8VA 4GLXA 4B3TL 3N40P 4OO1G 1G291 1E22A 1LUZA 4LNQA 2K50A 4DV3Q 1O75A 4LWCA 3T1YQ 2E5LQ 2VL6A 4A76A 4AQYH 4OWXB 3F1ZA 4PZ8A 4UP9A 1H95A 1PH1A 3RGZA 1XNRH 4JI7L 1VQ7A 1XPOA 3L2PA 2UXDQ 4YCVA 1UE7A 4JI8Q 4P74A 3HOUG 2YCHA 3U4VA 2IX1A 4DR1H 1Q86C 3GTPH 3PUYA 2LXJA 1SYXB 3BA8A 3HOVG 4X65Q 1E3PA 1HNXL 4LFCL 3A74A 1X65A 4NXML 2JA8H 3IRBA 4DUZQ 2LSSA 3L7ZC 4GKKL 5FPOA 2JA7H 4DV0H 4L5SA 1SEIA 2HVRA 2UU9H 1N34H 2NVYH 3TY8A 1XMQQ 2XIGA 2ALYB 3L0OA 3STBD 5A2QW 1ASZA 4LF8Q 3ICEA 1IYJB 2B63G 1HNWH 4A3FH 1P8LA 1WOCA 3CC7A 4ETSA 1PYBA 4LF7Q 2B63H 3S24A 1YHAA 5C4JH 1VQIA 5LMNW 1M1KC 1X3FA 3CPFA 3A5UA 2K4KA 3KJOA 1L1OB 2WB1E 1NY4A 1C7YA 4AQYL 3N43B 3AFPA 3JAMW 2E2IH 4B3MQ 2B3GA 4LMYA 1K83H 3UE1A 3GD7A 4C3HH 3I56A 5J3BA 1XNRQ 3D0FA 3PO3G 3AQQA 5IYDG 4JI4L 1X3EA 3MEFA 2RHQB 4JI6L 1NMFA 2GVBA 4JI5Q 1AH9A 2DUDA 2PQAA 2WP8J 3M9BA 1IBML 4PDBA 4DR2H 4BY7H 3KAKA 4X65H 4X66H 4A4IA 4B3ML 4MTDA 3RGXA 3BJUA 4Q0YA 4PG3A 2UUBQ 4UCOA 4DUZH 4LF4H 4NB3A 1IBKQ 1HR0Q 4RG1A 3GB8B 3RJ0A 1SR3A 3PUZA 1I3QH 4KHPH 4DR7H 1PH8A 3JC66 5M5YH 4IPGA 1YI2A 3BA9A 1BVSA 1MKHA 2QA4A 3BU2A 4GOPA 4K0KQ 3N6XA 1E7ZA 1W3SA 4EX5A 4BBRH 2R93G 4LSXA 4YWMA 1YEZA 5C0XG 2E2HH 1GYFA 1VCIA 1WCMG 2K5NA 2R93H 3CCUA 1S3OA 1N33L 3G6EA 1AN7A 4DV1H 4A3BG 1DGSA 4WJ4A 2ZM6H 2WAQG 2EXDA 2RCNA 4MNOA 1WH2A 4X64L 4A3BH 1K9MC 1HR0W 2UUCL 1A63A 4B3TH 2QEXA 2JA9A 1CKNB 1VQKA 3F2DA 4LUOA 4JV5H 1PH3A 1OXVA 4DAYB 4YHHL 3VDYA 2YYZA 4JI2Q 1YITA 2ASBA 4WJ3M 1Z2OX 4A2BA 3KLWA 4DR2L 2AKWB 2Q2IA 1E1OA 3PV0A 4R4QA 4DV0L 3S14H 1TA8A 4LSAA 1WFQA 4UCUA 1W2BA 4LFAQ 4X66Q 5AJ3Q 4DUYQ 1XJVA 3KAJA 1HNZH 2AHOB 1QVGA 1I50H 4LFBQ 1FKAH 3PUWA 5IY0A 1HR0H 4IFDJ 4RB2C 2BA1A 2JK8A 4X62L 4DR7Q 4JOIA 1BGWA 3NEMA 4JI3L 2PNHA 2V1CC 1FGUA 1I94H 1MIUA 5LMNQ 2JA5G 2UU9L 4NXNQ 4UCSA 4JI1L 2HHHQ 3F2BA 1N32L 2XGTA 4GOPB 3PIPA 4DV7L 3EYYA 3K80C 3L4KA 3N44B 4DV1L 2E2JH 4OWTB 2UXCL 3TRZA 1VQMA 2Y0SE 2R7FA 4IOCA 4J0MA 3E9IA 4OONA 3J80i 3J81j 2ZM6Q 4JYAL 4MV9A 2GVAA 2FXQA 1Z9FA 1MJCA 2NZHA 4J15A 5C0XJ 1BJTA 5FD6A 1UE6A 1IBMH 2K14A 4ME3A 5FLXc 2VPSA 4A3EH 4E6NA 5HY6A 4B3SH 3RIZA 4HIOA 1HNXH 4A93G 3CCLA 4IAJA 3AEVA 1XDNA 1Z47A 4PMWA 3TQYA 1Q1EA 3RR5A 4DR4L 3U58A 3PF5A 4BXXG 3BABA 1IXRA 3Q8DA 4BY7G 1PH7A 3ZJYC 4DUYH 4LFAH 2W57A 1HZ9A 2MQHA 2WYOA 5C44H 5EAYA 5GAEC 2UXBQ 5JJIA 4JI2H 1Y1WG 3OTOH 4R4IA 3LMLA 4YCWA 1QUQA 1IBLL 3HOZH 1FL0A 5IT9W 1VQBA 3KF6B 4X64H 4KHPL 3ER0A 1EQRA 2RF4A 1HNWL 1CSQA 3GTKH 4DR6L 2YTXA 5IP7H 4DV4L 2PI2E 3N42B 1HZBA 1AE3A 1VQDA 3A0JA 2Y0SG 3I55A 2IY5B 3HKZE 4GN4B 1FJGQ 5JJKA 2HIXA 1L2ZA 1NTGA 3HOZG 4JV5L 4R1JA 4AYBG 2UUAL 3H0GG 1QZGA 2YU9H 4JI7Q 4YY3L 2I5HA 5D1OA 3S1NH 4JC0A 3TS2A 5C4XG 2N8NA 4P71A 1P16A 2OTLA 2WFWA 2KCMA 5FLMG 4GNXA 4B3SQ 3KDFB 1K73C 1GVPA 3S1RH 4MTNA 5IWAQ 3UDFA 3W5OA 1HNXQ 1OTCA 3PO2H 3J81W 4JI6H 4YWKA 3CMAA 1S03G 4DV6L 3KOJA 1I6UA 5EOYA 3CCJA 5BR8H 1S68A 4RAZA 2UUCH 3GTJH 1I94L 4JI3H 1SRUA 1QZHA 3J80c 3FHWA 2JA6H 4UPAA 4JI1H 5M3FH 2AWOA 3OTOQ 2VNUD 2D0OA 1N34L 5FJ8G 1PFSA 1O7IA 4YWLA 2VQEL 4LF6Q 2ZJQA 1HJPA 1TXYA 2YTVA 3GTLH 2VQFH 1M90C 1HZAA 2UXCH 4H02A 3DF7A 5IT9c 2WAQE 4A3LG 1IZ6A 1U5KA 2JA5H 5DLQE 3M85A 2KHIA 2XTIA 3W1GA 2VW9A 4A3LH 4QL5A 4EFEA 1UEBA 4DR5L 3UDIA 4RZQA 1N33H 2Z6KC 4LF5H 4CC6A 4AIMA 2A19A 4GN3B 3RTXA 4JI7H 3CCSA 1OXUA 1JJ2A 2WE6A 4JI5L 1Q7YC 3FKIH 2MCTA 4Y52H 1PH5A 4HJ8A 4DR3Q 4A2AA 1VQAA 2O03A 3CCVA 3OW2A 2ZJRA 4A3EG 3FKIG 3CVZA 1MJEA 2HVSA 2BH8A 3K7UC 3G4SA 4JI4H 3HOVH 1YZ6A 4MV7A 5E7NA 1HR0L 4R7RA 3CC4A 2PQAB 2JE6I 5BR8Q 4OXPA 1BBUA 3E0EA 5JEAJ 4DK3C 1HNZL 1LM0A 4BXXH 4DUZL 4DR6H 3PCOB 4JCVE 4K0KL 4JBMA 1PH9A 3L4JA 1VQEA 1VS0A 1Y1WH 2R7ZG 4DV2Q 1VQFA 1VQ6A 4MZ9A 4JI0Q 2K52A 3I7FA 3K81C 4FDBA 4A3FG 2KSWA 4HIMA 1SN8A 2CQOA 2OQ0A 4KI0A 4R4CA 2UUAH 1GKHA 3UDGA 4OX9Q 4EQ5A 3RN5A 1Y1VG 3A5ZB 3I4NG 3HKZG 3CCMA 4A3MH 3KYHC 5JEAG 1IL2A 3JSNA 5D1OB 2KCTA 1TWHH 2R7DA 4NPSA 4LF5L 4LF7L 1ZHQA 4X64Q 4GKJQ 5IP9G 1EQQA 2F4VH 2VOBA 4QY7A 2CCZA 4BBSH 1Q46A 2N49A 3BZCA 3H0GH 4PZ6A 4IJHA 4DV2H 3PUVA 1CKOA 4AQYQ 3GTOH 5H1SE 3GTQH 2AWNA 3J7AK 2CWPA 5M5XH 1VQLA 1VQ5A 3HOUH 4QJFA 3NBYB 4DR3H 3KF6A 3K7AH 1L0WA 4JI4Q 3AFQA 3HXLA 1K3RA 1XMOH 1L1OC 1N36H 5GADC 4GLAC 3PGZA 1EFWA 1SE8A 2Z0SA 5ELOA 2K5HA 4A75A 1YHBA 2VQFL 3HOYH 4UP7A 1M0WA 3LGJA 3S16H 3F8NA 2PI2A 4XIGS 4B3RH 2PMZE 1A62A 1Q1BA 5LMNL 4HJAA 2UU9Q 4DRFA 3S1QH 2D0PA 4TVAB 1AE2A 5M3FG 5HGQA 1S72A 4UCVA 3CAMA 3DLLA 1KIXA 1B04A 2ZTDA 4POGA 4DR5H 3VNNA 3M3YH 4JG2A 2ZTCA 3STBC 2ZJTA 4BY1G 4OX9H 3DM3A 4HJ7A 1J5EL 1PA6A 1RL2A 4DV7H 4JYAQ 4LF7H 4BY1H 2VUMH 2F4VL 5K36G 3J7ZC 2WDTA 4LUVA 3MWMA 2VUMG 4IOAA 4UCTA 3NBZB 1XK5A 2N78A 3J80W 4JBWA 1TWCH 1WYDA 1V43A 5GAGC 4DR1Q 3PO3H 2K5VA 4GOPC 5LL6b 4LFCH 4NXMH 1X9NA 5JJLA 3F2CA 1LYLA 2KHJA 2OQKA 4YHHQ 3U50C 3RZOH 4AH6A 2NN6G 5ELNA 5GAHC 4DR2Q 1NBWA 5IYCH 2R7ZH 4DV0Q 1SFOH 4X6AH 3QWUA 1CKMA 3T1HL 2BA0A 5LMUQ 2JA7G 1PVOA 1BKBA 4DV5L 1IBLQ 2VQEH 4RMFA 5M3MG 4DV5H 4LF9L 4LF4Q 1VQ9A 3S2DH 3GJXB 4KHPQ 4IPCA 3NELA 1HNWQ 2FE3A 3C0FB 4LF8H 1KL9A 4IPHA 1HZCA 5M3MH 1V9PA 4BA2I 4DR7L 5FPRA 1E4FT 2LXKA 4BBRG 2RGRA 4K0KH 3K3VA 1XNQL 1G6PA 4LF9H 2NN6I 3T1YL 2E5LL 3NBHB 1N32Q 4FM9A 4LH6A 4DV7Q 1E24A 4BA1I 5IYBH 3FMAA 4OWWB 3KJPA 2QGQA 4UFZA 1B7YB 4YCUA 4DV1Q 1YBYA 2NZOA 3F8TA 3H20A 2OTJA 1N9WA 4YY3H 4JOIC 4B3SL 4TQUS 4A3GG 1X54A 5IWAL 3GTMH 4JI5H 2IT1A 3M7NA 3K8AA 4LFCQ 4L5TA 4NXMQ 1VQNA 4A93H 1YVCA 3G48A 4UY8C 3PF4A 4GKKQ 4M7EA 4YHHH 1T9HA 1TWGH 2JA8G 4LUZA 2UUBH 1IBKH 1U0LA 1X3GA 3NC0B 1CSPA 4DV6H 3OTOL 5LMUH 1VQHA 1JJCB 1XMQL 2A8VA 3M4OH 3ERSX 1XMOL 1N36L 2VQEQ 3J81c 2HT1A 4P73A 4DR4Q 1IBLH 1ZHSA 4A3DG 1VQPA 3M4PA 4DPGA 2L15A 4B3RL 2WB1G 1K8GA 1FJGL 4A3DH 1B8AA 5GROA 3RLFA 2I0QA 4KLKA 4NXNH 3CCQA 1I5FA 2JEBI 3U4ZA 3AYHB 3GTGH 1WCMH 2HVQA 4DV4Q 1C9OA 3ULPA 1Z2NX 3N41B 4UCRA 4ALPA 3H3VI 1N32H 1LTLA 2EIFA 1L1OA 3CF5A 1QUQB 2A1AA 2MFIA 1G51A 4HIDA 2OWOA 2R6GA 1KC8C 4B3TQ 4IFDI 4DV3L 4JV5Q 4CC5A 3ULJA 4QIWE 3UQ8A 3CP0A 3BZKA 3TS0A 1YJ9A 3CC2A 2AMCB 2HQLA 2JQOA 4YY3Q 1C0AA 1IBMQ 3ULLA 2GN5A 4DK6C 4RB0A 1PH2A 2UXDL 1EIFA 4JI8L 2KBNA 1Q82C 3RF2A 1GD7A 5GQOA 1HNZQ 3M4QA 4LFBH 2IHEA 2CFMA 1S40A 4X65L 1EOVA 4LW1A 2RGVA 2MO1A 4DV6Q 5IYCG 2JA6G 1I6HH 2K75A 3J7A5 2R92G 4DR4H 1KRTA 2UXBH 3E9HA 1I94Q 4JI0L 5LMNH 3S15H 4HJ9A 2HHHH 2F52A 2R92H 3I4MH 1D8LA 2N3SA 3I2ZA 3M4IA 4OX9L 1UE1A 1KXLA 1GM5A 1ASYA 4LF8L 4L5QA 1JMCA 4LF6L 1UE5A 1YJNA 5DISC 4JYAH 2D62A 4Y7NH 4GKJL 3IG0A 5M5WH 3RLOA 5C3EG 4DV4H 2CW8A 4PZ7A 4GKKH 3CW2C 3GDEA 4GS3A 1XPUA 4LH7A 1JJGA 1K0RA 1N8RC 3RLNA 5C3EH 4A3KG 4IJLA 1PYSB 1E1TA 3KF8B 3RZDH 3CCEA 5IYBG 2ES2A 1OXSC 2HIVA 2ATWA 4HIKA 4A3KH 4JI8H 1YNXA 3JAMi 4UP8A 1OXTA 5FLMH 1CUKA 4A3JH 1XNRL 1EIYB 4A3GH 1M0TA 3CQZH 2E8GA 1B70B 1TWAH 4X66L 5AJ3L 3JAMc 3W1BA 3G71A 4DUYL 4DR3L 4JI6Q 1SMXA 4A3JG 4LFBL 3PN1A 5IWAH 1VQCA 2NVTH 5FD5A 4X62Q 4A3IH 1Q12A 3EN2A 4KHZA 3TEHB 1X55A 2I5MX 5C44G 4O0AA 1SROA 1EYGA 1KHIA 5BR8L 2UUBL 2VZAA 3KDFA 4JI3Q 2YTYA 2VY3A 3UE0A 4JI1Q 4POFA 5FJ8H 1IBKL 2HHHL 1KRSA 2ID0A 3MXNB 3PUXA 4A3CG 4QQBX 5FLXW 1VQJA 2CWAA 4R4TA 1VQ8A 1Q81C 4A3CH 5D1PA 3CCRA 3K0XA 1FJGH 1K8AC 2UXCQ 4JBJA 4DV2L 4APVA 1HH2P 2BH2A 4MTEA 2JEAI 1J5EH 3RNUA 5IP9H 4LFAL 4P72A 1N33Q 3JSLA 4LF5Q 4IO9A 1A0IA 2YV5A 1KQSA 4BBSG 4RB1A 1Z2PX 1VQGA 4C3IH 1NE3A 2UUCQ 1D7QA 1SLJA 1Y14B 1PHJA 2Q2TA 3HKSA 3S17H 1MZBA 1YJWA 2OCEA 1EWIA 1PV4A 4JI2L 1FVIA 4GN5A 4HJ5A 3SGIA 5LMUL 4DAMA 4C3JH 1PH4A 4DV5Q 2RHSB 3PIOA 3EIVA 3TREA 3CXCA 3H15A 1EUJA 3RN2A 2CW7A 1BBWA 3HOYG 1X6OA 3KFUA 3H3VH 4IPDA 4X62H 3T1HH 4EFBA 4B3MH 4XTCS 4GNXB 4DR6Q 4LF6H 2IX0A 2VQFQ 1JB7A 4QGUA 3HOWH 1WI5A 4EEQA 2ZJPA 4AYBE 3KXYT 4RB3C 2VS1A 4GNXC 1KAWA 1Q8KA 1YHQA 4L5RC 4DNIA 5C0XI 1XNQQ 1L2FA 4C2MH 4O2DA 2H5XA 5IP7G 2MNAA 3HOWG 3BAAA 3HFZB 1NMGA 4NXNL 2JJQA 1XPRA 1TWFH 2UUAQ 3I4MG 3I4NH 1Y1VH 5IE8A 2Q2UA 3CD6A 4A3MG 3S1MH 3TY9A 4DV3H 3OYYA 4R4OA 3CPWA 3T1YH 2E5LH 3J81i 1JT8A 3GO5A 1E4GT 1J5EQ 2C35B 1JE5A 4GKJH 1GO3E 4IFDG 2F4VQ 2B29A 5IYDH 1NJIC 2ZM6L 3EBEA 5C4XH 2UXDH 2ZTEA 2HGSA 1VQ4A 4BWSC 2VUGA 1WJJA 3WWVA 3KALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME A;  3PO2 G;  4DR1 L;  4GLV B;  2CKZ B;  1R9T H;  3NEN A;  3B6Y A;  2MO0 A;  1PH6 A;  3S2H H;  1J6Q A;  2EQS A;  3HOX G;  4OO1 I;  1XMO Q;  2Z6K A;  3D31 A;  4P75 A;  1UWV A;  3UDX A;  1N36 Q;  3TY5 A;  1RIP A;  1N34 Q;  4JBK A;  2DGY A;  3HOX H;  1VQO A;  3T1H Q;  3PSI A;  1V1Q A;  4A3I G;  1QVF A;  1X56 A;  2Q2H A;  4DKA C;  1KD1 C;  1QVC A;  4B3R Q;  2UXB L;  1TAE A;  4LF9 Q;  4LF4 L;  2NVX H;  1CKN A;  2I5L X;  2IHF A;  1XTD A;  3I4O A;  1OXX K;  2KEN A;  3FP9 A;  2NVQ H;  2F3I A;  1YIJ A;  4DR5 Q;  1A8V A;  4GLX A;  4B3T L;  4OO1 G;  1G29 1;  1E22 A;  1LUZ A;  4LNQ A;  2K50 A;  4DV3 Q;  4LWC A;  3T1Y Q;  2E5L Q;  2VL6 A;  4A76 A;  4OWX B;  3F1Z A;  4PZ8 A;  4UP9 A;  1H95 A;  1PH1 A;  4JI7 L;  1VQ7 A;  1XPO A;  3L2P A;  2UXD Q;  4YCV A;  1UE7 A;  4JI8 Q;  4P74 A;  3HOU G;  3U4V A;  2IX1 A;  1Q86 C;  3GTP H;  3PUY A;  2LXJ A;  3BA8 A;  3HOV G;  4X65 Q;  1E3P A;  1HNX L;  4LFC L;  3A74 A;  1X65 A;  4NXM L;  2JA8 H;  3IRB A;  4DUZ Q;  2LSS A;  3L7Z C;  4GKK L;  5FPO A;  2JA7 H;  4L5S A;  2HVR A;  2NVY H;  3TY8 A;  1XMQ Q;  2ALY B;  3L0O A;  3STB D;  1ASZ A;  4LF8 Q;  3ICE A;  1IYJ B;  2B63 G;  4A3F H;  1P8L A;  1WOC A;  3CC7 A;  1PYB A;  4LF7 Q;  2B63 H;  3S24 A;  1YHA A;  5C4J H;  1VQI A;  5LMN W;  1M1K C;  1X3F A;  3CPF A;  3A5U A;  2K4K A;  3KJO A;  1L1O B;  2WB1 E;  1NY4 A;  1C7Y A;  4AQY L;  3AFP A;  2E2I H;  4B3M Q;  2B3G A;  1K83 H;  3UE1 A;  3GD7 A;  4C3H H;  3I56 A;  5J3B A;  1XNR Q;  3D0F A;  3PO3 G;  3AQQ A;  5IYD G;  4JI4 L;  1X3E A;  3MEF A;  2RHQ B;  4JI6 L;  1NMF A;  2GVB A;  4JI5 Q;  1AH9 A;  2DUD A;  2PQA A;  2WP8 J;  3M9B A;  1IBM L;  4BY7 H;  4A4I A;  4B3M L;  3BJU A;  4PG3 A;  2UUB Q;  4UCO A;  4NB3 A;  1IBK Q;  1HR0 Q;  4RG1 A;  3GB8 B;  1SR3 A;  3PUZ A;  1I3Q H;  1PH8 A;  3JC6 6;  5M5Y H;  4IPG A;  1YI2 A;  3BA9 A;  1BVS A;  1MKH A;  2QA4 A;  3BU2 A;  4GOP A;  4K0K Q;  1E7Z A;  1W3S A;  4EX5 A;  4BBR H;  2R93 G;  4YWM A;  1YEZ A;  5C0X G;  2E2H H;  1VCI A;  1WCM G;  2K5N A;  2R93 H;  3CCU A;  1S3O A;  1N33 L;  3G6E A;  4A3B G;  1DGS A;  4WJ4 A;  2WAQ G;  2EXD A;  2RCN A;  4MNO A;  4X64 L;  4A3B H;  1K9M C;  1HR0 W;  2UUC L;  1A63 A;  2QEX A;  2JA9 A;  1CKN B;  1VQK A;  3F2D A;  4LUO A;  1PH3 A;  1OXV A;  4DAY B;  4YHH L;  3VDY A;  2YYZ A;  4JI2 Q;  1YIT A;  2ASB A;  4WJ3 M;  3KLW A;  4DR2 L;  2AKW B;  2Q2I A;  1E1O A;  3PV0 A;  4R4Q A;  4DV0 L;  3S14 H;  1TA8 A;  1WFQ A;  4UCU A;  1W2B A;  4LFA Q;  4X66 Q;  5AJ3 Q;  4DUY Q;  1XJV A;  2AHO B;  1QVG A;  1I50 H;  4LFB Q;  3PUW A;  5IY0 A;  4IFD J;  2BA1 A;  2JK8 A;  4X62 L;  4DR7 Q;  4JOI A;  3NEM A;  4JI3 L;  2PNH A;  2V1C C;  1FGU A;  1MIU A;  5LMN Q;  2JA5 G;  2UU9 L;  4NXN Q;  4UCS A;  4JI1 L;  2HHH Q;  3F2B A;  1N32 L;  2XGT A;  4GOP B;  3PIP A;  4DV7 L;  3K80 C;  4DV1 L;  2E2J H;  4OWT B;  2UXC L;  3TRZ A;  1VQM A;  2Y0S E;  2R7F A;  4IOC A;  3E9I A;  4OON A;  3J80 i;  3J81 j;  2ZM6 Q;  4JYA L;  2GVA A;  2FXQ A;  1Z9F A;  1MJC A;  2NZH A;  4J15 A;  5C0X J;  1UE6 A;  2K14 A;  4ME3 A;  5FLX c;  4A3E H;  4E6N A;  5HY6 A;  4HIO A;  4A93 G;  3CCL A;  3AEV A;  1XDN A;  1Z47 A;  4PMW A;  3TQY A;  1Q1E A;  3RR5 A;  4DR4 L;  3U58 A;  3PF5 A;  4BXX G;  3BAB A;  1IXR A;  3Q8D A;  4BY7 G;  1PH7 A;  3ZJY C;  1HZ9 A;  2MQH A;  5C44 H;  5EAY A;  5GAE C;  2UXB Q;  5JJI A;  1Y1W G;  4R4I A;  4YCW A;  1QUQ A;  1IBL L;  3HOZ H;  1FL0 A;  1VQB A;  3KF6 B;  4KHP L;  3ER0 A;  1EQR A;  2RF4 A;  1HNW L;  1CSQ A;  3GTK H;  4DR6 L;  2YTX A;  5IP7 H;  4DV4 L;  2PI2 E;  1HZB A;  1AE3 A;  1VQD A;  3A0J A;  2Y0S G;  3I55 A;  2IY5 B;  3HKZ E;  4GN4 B;  1FJG Q;  5JJK A;  2HIX A;  1NTG A;  3HOZ G;  4JV5 L;  4R1J A;  4AYB G;  2UUA L;  3H0G G;  1QZG A;  2YU9 H;  4JI7 Q;  4YY3 L;  2I5H A;  5D1O A;  3S1N H;  4JC0 A;  3TS2 A;  5C4X G;  2N8N A;  4P71 A;  1P16 A;  2OTL A;  2WFW A;  2KCM A;  5FLM G;  4GNX A;  4B3S Q;  3KDF B;  1K73 C;  1GVP A;  3S1R H;  4MTN A;  5IWA Q;  3UDF A;  3W5O A;  1HNX Q;  1OTC A;  3PO2 H;  4YWK A;  3CMA A;  4DV6 L;  3KOJ A;  3CCJ A;  1S68 A;  3GTJ H;  1I94 L;  1SRU A;  1QZH A;  3J80 c;  3FHW A;  2JA6 H;  4UPA A;  5M3F H;  2AWO A;  3OTO Q;  2VNU D;  2D0O A;  1N34 L;  5FJ8 G;  1PFS A;  1O7I A;  4YWL A;  2VQE L;  4LF6 Q;  2ZJQ A;  1HJP A;  1TXY A;  2YTV A;  3GTL H;  1M90 C;  1HZA A;  4H02 A;  5IT9 c;  2WAQ E;  4A3L G;  1IZ6 A;  1U5K A;  2JA5 H;  5DLQ E;  3M85 A;  2KHI A;  2XTI A;  3W1G A;  2VW9 A;  4A3L H;  4QL5 A;  4EFE A;  1UEB A;  4DR5 L;  3UDI A;  2Z6K C;  4CC6 A;  4AIM A;  2A19 A;  4GN3 B;  3RTX A;  3CCS A;  1OXU A;  1JJ2 A;  4JI5 L;  1Q7Y C;  3FKI H;  4Y52 H;  1PH5 A;  4HJ8 A;  4DR3 Q;  1VQA A;  3CCV A;  3OW2 A;  2ZJR A;  4A3E G;  3FKI G;  1MJE A;  2HVS A;  2BH8 A;  3K7U C;  3G4S A;  3HOV H;  1YZ6 A;  5E7N A;  1HR0 L;  3CC4 A;  2PQA B;  2JE6 I;  5BR8 Q;  4OXP A;  1BBU A;  3E0E A;  5JEA J;  4DK3 C;  1HNZ L;  1LM0 A;  4BXX H;  4DUZ L;  3PCO B;  4JCV E;  4K0K L;  4JBM A;  1PH9 A;  1VQE A;  1VS0 A;  1Y1W H;  2R7Z G;  4DV2 Q;  1VQF A;  1VQ6 A;  4MZ9 A;  4JI0 Q;  2K52 A;  3I7F A;  3K81 C;  4FDB A;  4A3F G;  4HIM A;  1SN8 A;  2CQO A;  2OQ0 A;  4KI0 A;  4R4C A;  1GKH A;  3UDG A;  4OX9 Q;  4EQ5 A;  3RN5 A;  1Y1V G;  3A5Z B;  3I4N G;  3HKZ G;  3CCM A;  4A3M H;  3KYH C;  5JEA G;  1IL2 A;  3JSN A;  5D1O B;  2KCT A;  1TWH H;  2R7D A;  4NPS A;  4LF5 L;  4LF7 L;  4X64 Q;  4GKJ Q;  5IP9 G;  1EQQ A;  4QY7 A;  2CCZ A;  4BBS H;  1Q46 A;  2N49 A;  3BZC A;  3H0G H;  4PZ6 A;  4IJH A;  3PUV A;  1CKO A;  4AQY Q;  3GTO H;  5H1S E;  3GTQ H;  2AWN A;  2CWP A;  5M5X H;  1VQL A;  1VQ5 A;  3HOU H;  4QJF A;  3NBY B;  3KF6 A;  3K7A H;  1L0W A;  4JI4 Q;  3AFQ A;  1K3R A;  1L1O C;  5GAD C;  4GLA C;  3PGZ A;  1EFW A;  1SE8 A;  2Z0S A;  5ELO A;  2K5H A;  4A75 A;  1YHB A;  2VQF L;  3HOY H;  4UP7 A;  3LGJ A;  3S16 H;  2PI2 A;  4XIG S;  2PMZ E;  1A62 A;  1Q1B A;  5LMN L;  4HJA A;  2UU9 Q;  4DRF A;  3S1Q H;  2D0P A;  4TVA B;  1AE2 A;  5M3F G;  5HGQ A;  1S72 A;  4UCV A;  3CAM A;  3DLL A;  1KIX A;  1B04 A;  2ZTD A;  4POG A;  3VNN A;  3M3Y H;  4JG2 A;  2ZTC A;  3STB C;  4BY1 G;  3DM3 A;  4HJ7 A;  1J5E L;  1PA6 A;  1RL2 A;  4JYA Q;  4BY1 H;  2VUM H;  2F4V L;  5K36 G;  3J7Z C;  4LUV A;  2VUM G;  4IOA A;  4UCT A;  3NBZ B;  1XK5 A;  2N78 A;  4JBW A;  1TWC H;  1WYD A;  1V43 A;  5GAG C;  4DR1 Q;  3PO3 H;  2K5V A;  4GOP C;  1X9N A;  5JJL A;  3F2C A;  1LYL A;  2KHJ A;  2OQK A;  4YHH Q;  3U50 C;  3RZO H;  4AH6 A;  2NN6 G;  5ELN A;  5GAH C;  4DR2 Q;  1NBW A;  5IYC H;  2R7Z H;  4DV0 Q;  1SFO H;  4X6A H;  3QWU A;  1CKM A;  3T1H L;  2BA0 A;  5LMU Q;  2JA7 G;  1PVO A;  1BKB A;  4DV5 L;  1IBL Q;  4RMF A;  5M3M G;  4LF9 L;  4LF4 Q;  1VQ9 A;  3S2D H;  3GJX B;  4KHP Q;  4IPC A;  3NEL A;  1HNW Q;  1KL9 A;  4IPH A;  1HZC A;  5M3M H;  1V9P A;  4BA2 I;  4DR7 L;  5FPR A;  2LXK A;  4BBR G;  1XNQ L;  1G6P A;  2NN6 I;  3T1Y L;  2E5L L;  3NBH B;  1N32 Q;  4LH6 A;  4DV7 Q;  1E24 A;  4BA1 I;  5IYB H;  4OWW B;  3KJP A;  2QGQ A;  4UFZ A;  1B7Y B;  4YCU A;  4DV1 Q;  1YBY A;  2NZO A;  3F8T A;  2OTJ A;  1N9W A;  4JOI C;  4B3S L;  4TQU S;  4A3G G;  1X54 A;  5IWA L;  3GTM H;  2IT1 A;  3M7N A;  3K8A A;  4LFC Q;  4L5T A;  4NXM Q;  1VQN A;  4A93 H;  1YVC A;  3G48 A;  4UY8 C;  3PF4 A;  4GKK Q;  1T9H A;  1TWG H;  2JA8 G;  4LUZ A;  1U0L A;  1X3G A;  3NC0 B;  1CSP A;  3OTO L;  1VQH A;  1JJC B;  1XMQ L;  2A8V A;  3M4O H;  3ERS X;  1XMO L;  1N36 L;  2VQE Q;  3J81 c;  2HT1 A;  4P73 A;  4DR4 Q;  4A3D G;  1VQP A;  3M4P A;  4DPG A;  2L15 A;  4B3R L;  2WB1 G;  1K8G A;  1FJG L;  4A3D H;  1B8A A;  5GRO A;  3RLF A;  2I0Q A;  4KLK A;  3CCQ A;  1I5F A;  2JEB I;  3U4Z A;  3AYH B;  3GTG H;  1WCM H;  2HVQ A;  4DV4 Q;  1C9O A;  3ULP A;  4UCR A;  4ALP A;  3H3V I;  1LTL A;  2EIF A;  1L1O A;  3CF5 A;  1QUQ B;  2A1A A;  2MFI A;  1G51 A;  4HID A;  2OWO A;  2R6G A;  1KC8 C;  4B3T Q;  4IFD I;  4DV3 L;  4JV5 Q;  4CC5 A;  3ULJ A;  4QIW E;  3UQ8 A;  3CP0 A;  3BZK A;  3TS0 A;  1YJ9 A;  3CC2 A;  2AMC B;  2HQL A;  2JQO A;  4YY3 Q;  1C0A A;  1IBM Q;  3ULL A;  2GN5 A;  4DK6 C;  1PH2 A;  2UXD L;  1EIF A;  4JI8 L;  2KBN A;  1Q82 C;  1GD7 A;  5GQO A;  1HNZ Q;  3M4Q A;  2IHE A;  2CFM A;  1S40 A;  4X65 L;  1EOV A;  4LW1 A;  2MO1 A;  4DV6 Q;  5IYC G;  2JA6 G;  1I6H H;  2K75 A;  3J7A 5;  2R92 G;  1KRT A;  3E9H A;  1I94 Q;  4JI0 L;  3S15 H;  4HJ9 A;  2F52 A;  2R92 H;  3I4M H;  1D8L A;  2N3S A;  3I2Z A;  4OX9 L;  1UE1 A;  1KXL A;  1GM5 A;  1ASY A;  4LF8 L;  4L5Q A;  1JMC A;  4LF6 L;  1UE5 A;  1YJN A;  5DIS C;  2D62 A;  4Y7N H;  4GKJ L;  5M5W H;  3RLO A;  5C3E G;  4PZ7 A;  3CW2 C;  3GDE A;  4GS3 A;  1XPU A;  4LH7 A;  1JJG A;  1K0R A;  1N8R C;  3RLN A;  5C3E H;  4A3K G;  4IJL A;  1PYS B;  1E1T A;  3KF8 B;  3RZD H;  3CCE A;  5IYB G;  2ES2 A;  1OXS C;  2HIV A;  2ATW A;  4HIK A;  4A3K H;  1YNX A;  3JAM i;  4UP8 A;  1OXT A;  5FLM H;  1CUK A;  4A3J H;  1XNR L;  1EIY B;  4A3G H;  3CQZ H;  2E8G A;  1B70 B;  1TWA H;  4X66 L;  5AJ3 L;  3JAM c;  3W1B A;  3G71 A;  4DUY L;  4DR3 L;  4JI6 Q;  1SMX A;  4A3J G;  4LFB L;  3PN1 A;  1VQC A;  2NVT H;  4X62 Q;  4A3I H;  1Q12 A;  3EN2 A;  4KHZ A;  3TEH B;  1X55 A;  2I5M X;  5C44 G;  4O0A A;  1SRO A;  1EYG A;  1KHI A;  5BR8 L;  2UUB L;  2VZA A;  3KDF A;  4JI3 Q;  2YTY A;  2VY3 A;  3UE0 A;  4JI1 Q;  4POF A;  5FJ8 H;  1IBK L;  2HHH L;  1KRS A;  2ID0 A;  3MXN B;  3PUX A;  4A3C G;  4QQB X;  1VQJ A;  2CWA A;  4R4T A;  1VQ8 A;  1Q81 C;  4A3C H;  5D1P A;  3CCR A;  3K0X A;  1K8A C;  2UXC Q;  4JBJ A;  4DV2 L;  4APV A;  1HH2 P;  2BH2 A;  2JEA I;  3RNU A;  5IP9 H;  4LFA L;  4P72 A;  1N33 Q;  3JSL A;  4LF5 Q;  4IO9 A;  1A0I A;  2YV5 A;  1KQS A;  4BBS G;  1VQG A;  4C3I H;  1NE3 A;  2UUC Q;  1D7Q A;  1SLJ A;  1Y14 B;  1PHJ A;  2Q2T A;  3HKS A;  3S17 H;  1YJW A;  2OCE A;  1EWI A;  1PV4 A;  4JI2 L;  1FVI A;  4GN5 A;  4HJ5 A;  3SGI A;  5LMU L;  4DAM A;  4C3J H;  1PH4 A;  4DV5 Q;  2RHS B;  3PIO A;  3EIV A;  3TRE A;  3CXC A;  3H15 A;  1EUJ A;  3RN2 A;  1BBW A;  3HOY G;  1X6O A;  3KFU A;  3H3V H;  4IPD A;  4EFB A;  4XTC S;  4GNX B;  4DR6 Q;  2IX0 A;  2VQF Q;  1JB7 A;  4QGU A;  3HOW H;  1WI5 A;  4EEQ A;  2ZJP A;  4AYB E;  2VS1 A;  4GNX C;  1KAW A;  1Q8K A;  1YHQ A;  4L5R C;  4DNI A;  5C0X I;  1XNQ Q;  1L2F A;  4C2M H;  4O2D A;  2H5X A;  5IP7 G;  2MNA A;  3HOW G;  3BAA A;  3HFZ B;  1NMG A;  4NXN L;  2JJQ A;  1XPR A;  1TWF H;  2UUA Q;  3I4M G;  3I4N H;  1Y1V H;  5IE8 A;  2Q2U A;  3CD6 A;  4A3M G;  3S1M H;  3TY9 A;  3OYY A;  4R4O A;  3CPW A;  3J81 i;  1JT8 A;  3GO5 A;  1J5E Q;  2C35 B;  1JE5 A;  1GO3 E;  4IFD G;  2F4V Q;  2B29 A;  5IYD H;  1NJI C;  2ZM6 L;  3EBE A;  5C4X H;  2ZTE A;  1VQ4 A;  2VUG A;  1WJJ A;  3WWV A; 
#chains in the Genus database with same CATH topology
 4DR1 L;  4HTH A;  1R9T H;  3B6Y A;  2RDI A;  2MO0 A;  5KG7 A;  1SFO A;  4O7L A;  1XMO Q;  2Z6K A;  1UWV A;  1RIP A;  2E74 C;  1K0S A;  3GID A;  2L12 A;  1KD1 C;  3GTK B;  1TAE A;  3M4O B;  4XXE A;  2NVY B;  2AGQ A;  2NVX H;  5C0X H;  1CKN A;  2I5L X;  2IHF A;  2R87 A;  3CEB A;  4M9U A;  5BWU A;  3H91 A;  2JA5 A;  1QNU A;  3FP9 A;  1I4P A;  2F3I A;  2W9C A;  3BYY B;  1BCP B;  4GLX A;  4B3T L;  3KF8 A;  4OO1 G;  2W6M A;  4A3B B;  3T1Y Q;  4A76 A;  3T16 A;  2EJF C;  4AQY H;  4OWX B;  4UP9 A;  1PH1 A;  1FR3 A;  1VQ7 A;  1XPO A;  4P74 A;  5A35 A;  3U4V A;  4DR1 H;  1H9R A;  3VYT A;  5KGU A;  5DLF A;  2R85 A;  5DGI A;  4C3I B;  3GTP H;  5L1L A;  2LXJ A;  4HMJ A;  5K5P A;  4X65 Q;  1HNX L;  1GUW A;  3A74 A;  2WTF A;  4O4I F;  3IRB A;  3LWU A;  3DM1 A;  2HCI A;  5DMX A;  1B6R A;  4DQN A;  4DA2 A;  4O3Q A;  1SEI A;  3ITP A;  3TY8 A;  4HNU A;  3GV8 B;  2ZDQ A;  1KT8 A;  1U4P A;  4A3F H;  3ND9 A;  2J6T A;  1P8L A;  5C8Y F;  3PW5 A;  1PYB A;  3S24 A;  3H6M A;  2R8H A;  4EQN A;  1YHA A;  4EG0 A;  4FFP A;  3GTG A;  5JEA H;  4I55 F;  3LX0 A;  3A5U A;  2WV6 D;  3KJO A;  5M5W B;  3JAM W;  2C5C A;  4AQY L;  3FKI B;  1K83 H;  2I46 A;  3PO3 G;  1S5D D;  1TVX A;  1GGO A;  1AH9 A;  2GVB A;  4A3K B;  1BNC A;  4XZ3 B;  2PQA A;  4ED2 A;  2WP8 J;  3OMG A;  3CKI B;  4BY7 H;  2F0O A;  4ZUI A;  4O3O A;  4YP3 A;  2YZL A;  4MTD A;  5KFX A;  5J39 A;  3HZX A;  3HOZ B;  4O7T A;  2K6A A;  4JW0 A;  2XSC A;  4HED A;  3SNO A;  4QCL A;  4IPG A;  3BZD B;  4GOP A;  3BU2 A;  4RH6 A;  4BBR H;  4MV1 A;  3I4N B;  5K3W A;  2R93 G;  1RHP A;  1RD9 D;  1N56 A;  3J80 L;  4U7C A;  4Q45 A;  3CCU A;  1S3O A;  1N33 L;  1XX8 A;  3EJI A;  3NTI A;  4DV1 H;  1ESR A;  2EYL A;  1EY9 A;  4MNO A;  3MFG A;  1WH2 A;  1I4H A;  2UUC L;  1IKM A;  4ME5 A;  4JV5 H;  4QIW A;  3GQC A;  5BYB A;  4QB4 A;  4OHJ A;  1YIT A;  3GTK A;  3WOF A;  4WJ3 M;  1Z2O X;  5FNV F;  4A2B A;  1TA8 A;  2AKW B;  2Q2I A;  3X3N A;  2EYF A;  2F0N A;  2J4X A;  4LFA Q;  5AJ3 Q;  2BQ3 A;  2FK2 A;  2B2U A;  4LFB Q;  1GSH A;  1EKF A;  4JV1 A;  3PUW A;  5M5Y B;  2E2I A;  4RB2 C;  1BGW A;  1EZ8 A;  5D14 A;  4FE2 A;  1PTO C;  3NEM A;  2MP1 A;  3M3Y B;  5LMN Q;  2UU9 L;  2Y4R A;  2PNR C;  4R8N A;  2XGT A;  2B8F A;  3HO8 A;  4DV7 L;  3K80 C;  3L4K A;  4L63 B;  4DV1 L;  2E2J H;  1AN8 A;  2F0H A;  1VQM A;  4I7A A;  1SYF A;  2MPM A;  4IOC A;  5DQI A;  1XXG A;  1HQR D;  4JYA L;  2EY6 A;  2GVA A;  1BJT A;  2NZH A;  1MJC A;  5IIF A;  4FBU A;  2EY2 A;  4A3E H;  3KRE A;  3H0G B;  5KT3 A;  5HY6 A;  1HNX H;  1FD7 D;  1IW7 D;  2RCF A;  1VF7 A;  4IAJ A;  1UNN C;  5IT9 L;  1A48 A;  3GII A;  1U9R A;  5HBR B;  1FYC A;  1Q1E A;  2QIL A;  2WAC A;  3P1H A;  4H0L C;  4Q5V A;  3U58 A;  3PF5 A;  1I7N A;  1PMR A;  2PO4 A;  3Q8D A;  4H44 C;  3T13 A;  3ZJY C;  4BY7 G;  2W57 A;  3OHB A;  2R8I A;  3H0G A;  5GAE C;  3OTO H;  2K5Q A;  4R4I A;  2YZM A;  3KF6 B;  4CDD C;  1SND A;  1II3 A;  3FMC A;  5JVD F;  2RF4 A;  1HNW L;  1CSQ A;  4QW9 A;  3H40 A;  2YTX A;  3MTS A;  3T51 B;  5IP7 H;  1AE3 A;  4WRD A;  3I55 A;  2IY5 B;  3HKZ E;  5BN4 A;  5G3L D;  5E25 A;  2HIX A;  4FGR A;  1KC7 A;  2O2L D;  4AYB G;  2UUA L;  2ASJ A;  3WWH A;  2I5H A;  2KEE A;  1JIC A;  2N8N A;  1VMC A;  4P71 A;  2OTL A;  2WFW A;  1LT4 D;  5FLM G;  3L9A X;  2ZGI A;  4WD3 A;  1BCP C;  1HNX Q;  5EKL A;  3PO2 H;  3UDF A;  3W5O A;  3J81 W;  4JI6 H;  3MA2 B;  2CZG A;  4YWK A;  5I6Y A;  2W9A A;  1I6U A;  4K5X A;  4DV6 L;  3VR4 A;  2AQ4 A;  2MGS A;  5BR8 H;  1S03 G;  1S68 A;  3RZO B;  1B6S A;  1DXM A;  5DG8 A;  3S1Q B;  1GXD C;  3I70 A;  4JI1 H;  5M3F H;  3OTO Q;  2VNU D;  3RUZ A;  2D0O A;  1N34 L;  5FJ8 G;  2SCU B;  1O7I A;  5BWW A;  4I50 F;  3V6H A;  1HJP A;  3GTO A;  2UXC H;  4KN4 C;  3J80 E;  3N6R A;  4IRK A;  2WAQ E;  3OHA A;  5DLQ E;  3H4B A;  1Q3L A;  4OEM B;  4FU0 A;  3GIP A;  3RB6 A;  4QL5 A;  1UEB A;  4DR5 L;  4RZQ A;  2YZN A;  2W71 A;  1ONL A;  5FO7 B;  3PVX A;  4AIM A;  3E6Z X;  5I6W A;  3IAY A;  3RTX A;  3V6J A;  3CCS A;  1EY6 A;  2JEG A;  4CJ1 B;  2WKC A;  2MCT A;  2E2I B;  1XTC D;  4FNF A;  1VQA A;  2O03 A;  1JE4 A;  2EXZ A;  4A3E G;  2Z02 A;  1MJE A;  1SJH D;  1SBB B;  4QF4 A;  4IUU A;  4R7R A;  2PQA B;  2A5H A;  3D8G A;  4OXP A;  2J6S A;  1HPC A;  3A7A B;  5JEA J;  4DK3 C;  2B2V A;  2Q8I B;  4O7S A;  4DUZ L;  3Q8P B;  4DAY A;  1S0N A;  1M7J A;  4O7W A;  3L4J A;  1V1P A;  3R5X A;  1Y1W H;  4MZ9 A;  4JI0 Q;  1KJ9 A;  2CQO A;  4KI0 A;  1XYI A;  1GKH A;  2ZXO A;  2PPB C;  4EQ5 A;  3I4N G;  1Y1V G;  4BBS G;  4Q0Y A;  3JSN A;  4JYA H;  1CHQ D;  1Q8I A;  2KCT A;  2HCC A;  3Q24 A;  2JA6 A;  4X64 Q;  2YRX A;  5IP9 G;  2F4V H;  3SVM A;  3MFY A;  4QY7 A;  1NSN S;  3BZC A;  4A3E B;  4F87 A;  5KEE A;  3PUV A;  5L9X A;  5EWG A;  5H1S E;  3GTQ H;  2AWN A;  1VQL A;  3HOU H;  4QJF A;  2R7K A;  5KG3 A;  3UI2 A;  4MN3 A;  3K7A H;  4JI4 Q;  1ILQ A;  3HXL A;  3MAQ A;  3DMU A;  3UFX B;  1N36 H;  2F0L A;  1KAA A;  1SYC A;  2Z0S A;  5KFP A;  4A75 A;  2W9B B;  1D1K A;  4DUZ H;  2W7O A;  2PI2 A;  1S4Z A;  4ECQ A;  2PMZ E;  5LMN L;  2UU9 Q;  2YW2 A;  4O7R A;  2JA6 B;  4TVA B;  3MJF A;  4FFR A;  2KOL A;  3M3Y H;  1D5X C;  3STB C;  3DAA A;  2W9C B;  1PRT F;  4HJ7 A;  2YU9 B;  3TIG A;  1PA6 A;  4EGJ A;  1TWH A;  2BDN A;  4BY1 H;  2F4V L;  3MWM A;  3J7Z C;  2R93 A;  1PFB A;  4DL5 A;  4DL3 A;  4XQJ A;  4IAL A;  4YAK B;  1I3Q A;  2VA3 A;  1I4Q A;  3A8K E;  5COR A;  2VUM G;  1J9O A;  1RYS A;  1SYB A;  2I87 A;  5J2U F;  4DR1 Q;  1V43 A;  5LL6 b;  5C6A A;  1Y69 U;  1GLV A;  5H80 A;  3WWI A;  3U50 C;  1RK5 A;  4WJW A;  5IYC H;  3QWU A;  4K2K A;  4IIJ F;  2BA0 A;  5LMU Q;  2JA7 G;  4U6P A;  1I6V C;  4LF9 L;  4LF4 Q;  4RUC A;  2HUG A;  4IPC A;  1HNW Q;  3H94 A;  5C44 B;  5M3M H;  3GV7 B;  1TY0 A;  1E2Z A;  5LL6 X;  4DR7 L;  5I60 A;  3U55 A;  2A6E D;  4ZOL F;  4KY5 A;  2RGR A;  3K3V A;  5FOB B;  3OUZ A;  3G7L A;  5ELB A;  4O84 A;  4YAJ B;  1N32 Q;  1T5E A;  4RNM A;  5I5V A;  5JVH 3;  4OWW B;  3H20 A;  1YBY A;  1HA6 A;  4XT3 B;  2Z8L A;  5EPL A;  5FLX L;  1IYD A;  2YWV A;  1N9W A;  4JOI C;  4A3G G;  3GTM H;  3GV3 A;  4L5T A;  3TSS A;  1YVC A;  3G48 A;  1ESF A;  5KFF A;  3PF4 A;  1SFO B;  5BWV A;  4GKK Q;  3PW2 A;  4YHH H;  4CKB A;  1E2V A;  1U0L A;  3K0Y A;  3NC0 B;  1CSP A;  1K1Q A;  2FPP B;  5LMU H;  4PMB A;  3T56 B;  2WYO A;  4DR4 Q;  4NDX A;  5KFC A;  2HT1 A;  1JDE A;  3J81 c;  5KFJ A;  2ATL A;  1K1S A;  3TP6 A;  3BVZ A;  3M4P A;  4O42 A;  1JWS D;  2AQ3 B;  5KKN B;  2L1B A;  1MHW C;  4O86 A;  2W8K A;  4A3D H;  1B8A A;  1S10 A;  4NXN H;  5C3X A;  1F9Q A;  2JEB I;  3GTG H;  4DU9 A;  1A2T A;  1C9O A;  3LUL A;  2PN1 A;  1Z2N X;  3N41 B;  1LTL A;  2EIF A;  1NNX A;  3CF5 A;  1G51 A;  3C2P A;  3UQ8 A;  2DNC A;  3CC2 A;  2DPI A;  1SAP A;  2JN4 A;  4ME6 A;  3A55 A;  3K7A B;  1BF4 A;  1ILP A;  3SE7 A;  1EIF A;  2KBN A;  4RNN A;  1D5M C;  3RF2 A;  1GD7 A;  1V51 A;  1TWA B;  3M4Q A;  3D6C A;  4HCE A;  3URY A;  4LFB H;  4LW1 A;  4QW8 A;  5I5X A;  5IYC G;  2GQS A;  2K75 A;  3MVV A;  4A3I B;  3J7A 5;  4DR4 H;  4CMD A;  2UXB H;  3E9H A;  4JI0 L;  1IKL A;  3S15 H;  4IRC A;  4HJ9 A;  2LFN A;  3I4M H;  3I2Z A;  1F9P A;  2N3S A;  1UE1 A;  1GM5 A;  1ASY A;  2LS0 1;  4L5Q A;  5DIS C;  1YJN A;  5KFM A;  2GQR A;  4IUP A;  3BQ1 A;  3IG0 A;  3QZ8 A;  3CW2 C;  4KD3 A;  4LH7 A;  1JJG A;  1K0R A;  1CA5 A;  1N8R C;  5C3E H;  3CCE A;  4KY6 A;  1OXS C;  4J6H A;  4K8I A;  1B9N A;  4A3K H;  3K5H A;  1KAB A;  3V4S A;  2C9O A;  5AFW A;  2FLP A;  1AUV A;  2KEC A;  2JXM B;  1XNR L;  3CQZ H;  2E8G A;  1TWA H;  5AJ3 L;  3G71 A;  4X3U A;  4DR3 L;  3W1B A;  4LFA L;  2R82 A;  4LFB L;  3TW6 A;  5IWA H;  4O2B F;  1GSO A;  4ZK9 B;  2HDK A;  4ZLT F;  3H09 A;  4XT1 B;  1LT6 D;  3PIO 3;  1MI2 A;  3EN2 A;  1ICF B;  1X55 A;  2I5M X;  4HNV A;  4O0A A;  1SRO A;  1KHI A;  3KDF A;  2YTY A;  1KRS A;  2ID0 A;  4MV4 A;  2CWA A;  3CCR A;  4YJ2 F;  3DEP A;  4IUN A;  1A3G A;  1TWF B;  3LNN A;  4UDU C;  4HAE A;  1LAC A;  2X6G A;  2KED A;  4P72 A;  5KFK A;  2J7Z A;  1F9R A;  2XGQ A;  3PW7 A;  2FFK B;  2LY7 A;  4IO9 A;  4JV0 A;  2I07 B;  4DAA A;  1D7Q A;  4A3G B;  3NQI A;  4E6I A;  2Q2T A;  3HKS A;  3S17 H;  3PW0 A;  1FVI A;  4EGV A;  1C8C A;  4KJO A;  3SGI A;  5LMU L;  4CBV A;  3RN2 A;  1A3U A;  3E5S A;  4N9P A;  3T1H H;  2MJ8 A;  4XTC S;  4IUQ A;  3E3X A;  2AGO A;  2B63 B;  2VS1 A;  4GNX C;  4CC6 A;  3GTG B;  3QFF A;  3X3M A;  4DNI A;  5IP7 G;  2H5X A;  1NMG A;  4CDF C;  2JJQ A;  4FXD A;  5BWT A;  4A3M G;  1A2U A;  3OYY A;  5I2X A;  4HR7 B;  3GO5 A;  2F0P A;  3U0G A;  3E0J A;  2Z1C A;  2CHB D;  4BS9 A;  5C4X H;  1NJI C;  4I4T F;  3RZD B;  2EE1 A;  3H4D A;  1VQ4 A;  4IFD H;  4BY7 B;  2J6U A;  3T5J A;  2E75 C;  1H9M A;  4P2C B;  5IGG A;  3KAL A;  5CAE B;  4G3I A;  3PO2 G;  1VMP A;  4RAY A;  4RGT A;  2KCC A;  3NEN A;  1L0X B;  1SYD A;  3WO0 A;  1GUS A;  4I7H A;  2PZT A;  3R8B A;  3UDX A;  1STB A;  5ELC A;  3NQT A;  4JBK A;  2DGY A;  1VQO A;  3KHR A;  2NVT B;  3K5I A;  3T1H Q;  3PSI A;  3FRP B;  2R92 B;  2JYO A;  4DKA C;  1QVC A;  5EDW A;  4G7O C;  2FLN A;  3HP3 A;  2NU9 B;  1TS5 A;  3PZP A;  3K3P A;  2DZD A;  2PW5 A;  3PIP 3;  3N40 P;  4J9M A;  2OH2 A;  4LNQ A;  1O75 A;  4LWC A;  5TSS A;  2FMC A;  3MC0 B;  3RMH A;  1H95 A;  3PR5 B;  1XNR H;  3L2P A;  1NR4 A;  3HOU G;  3KHL A;  3UZO A;  3PUY A;  5CR5 A;  4LFC L;  4BWG B;  1WTH A;  1UEA B;  1X65 A;  4NXM L;  1B50 A;  4DUZ Q;  4TV8 F;  2EY5 A;  4J9L A;  2UU9 H;  1EUD B;  1N34 H;  4H7B A;  2O5I C;  4ECT A;  3SE0 A;  2DNE A;  4JK1 C;  5KFQ A;  5DQG A;  5L1K A;  3STB D;  3FPU B;  1ASZ A;  3AX6 A;  1WOC A;  1DV2 A;  5GON F;  5C4J H;  4KKU A;  4WOR A;  2HHF A;  1M1K C;  1X3F A;  4FBT A;  5KNC A;  3HRZ C;  1L1O B;  2WB1 E;  2W6N A;  4YJ3 F;  4LMY A;  4PBC A;  1EWC A;  1CHP D;  3K5O A;  1XNR Q;  3D0F A;  3AQQ A;  2RHQ B;  5BN3 A;  4PDB A;  1EEF D;  4C3H G;  5KG4 A;  2H4O A;  4DR2 H;  3MR2 A;  5CBA E;  3RB4 A;  1QCB D;  3RV4 A;  3Q6S A;  4A4I A;  3P7J A;  3T7A A;  4J9P A;  2OT2 A;  4I7Z C;  3LWE A;  4UCO A;  2FMA A;  4LF4 H;  3MEH A;  3RJ0 A;  3PUZ A;  2A1H A;  3HT5 A;  2NTT A;  2OXP A;  3JC6 6;  5KFB A;  4L8J A;  4YR2 A;  2FLL A;  3D4R A;  5LL6 S;  2EJ2 A;  3TIN A;  5JQG F;  4K0K Q;  1SNP A;  1W3S A;  2A73 B;  1VDZ A;  5C4H A;  4RCN A;  5I9O A;  1GYF A;  3MR3 A;  4HMI A;  2R93 H;  4DL2 A;  3G6E A;  1CQV A;  1DGS A;  4Q43 A;  3WWJ A;  3BAC A;  3MR5 A;  2EXD A;  3IFT A;  4FS2 A;  1EQT A;  1ET6 A;  4YBZ B;  3NBI A;  5J1Z A;  3F2D A;  1OXV A;  1IHZ A;  3R2I A;  4JI2 Q;  4ZAI A;  4U67 3;  4DR2 L;  4R4Q A;  3T54 A;  2KHS A;  1EYA A;  2K33 A;  3CRK C;  4GKK H;  4LSA A;  4EVO A;  5CYU A;  5KT7 A;  4UCU A;  4MTK A;  3R5F A;  4DUY Q;  4X66 Q;  1TS2 A;  3BVM A;  1XJV A;  1HNZ H;  3QO2 A;  2R7M A;  5C5L A;  5IY0 A;  2B2T A;  1HR0 H;  2L5T A;  4DIM A;  1JR0 D;  1B3Q A;  1PTO H;  1TY2 A;  4JOI A;  1TQO A;  4PV1 C;  1SNQ A;  4FF4 A;  4DR7 Q;  1TS4 A;  3J81 L;  5FKA C;  2V1C C;  1MIU A;  2R86 A;  4JI1 L;  2QEJ C;  3CHB D;  3F2B A;  2HHH Q;  2E2H B;  1N32 L;  5BWX A;  3PIP A;  5IGB A;  1I2L A;  1BOS A;  1EZ6 A;  4ECY A;  1WTR A;  4HR7 A;  4IZO A;  2UXC L;  2R7F A;  3E9I A;  3J81 j;  3J80 i;  2ZM6 Q;  4MV9 A;  3GIL A;  3MZ5 A;  2PW7 A;  5L1I A;  5C0X J;  2R61 A;  5FLX c;  4N8F A;  2XD4 A;  4E6N A;  4B3S H;  2JA8 B;  3CCL A;  3MXP A;  3CU7 A;  3AEV A;  1Z47 A;  3TQY A;  5IGD A;  3MXU A;  1STN A;  3S1R B;  1SCU B;  2FKL A;  3RR5 A;  4C1N I;  4ECZ A;  3K57 A;  4DUY H;  5KG1 A;  3OPO A;  4IWY A;  5JJI A;  1JOO A;  1DIK A;  3JZ6 A;  1WTO A;  1JOK A;  1FL0 A;  5IT9 W;  4UHV A;  1CQJ B;  4KHP L;  4EBE A;  5C1P A;  3NGD A;  2PI2 E;  3IL8 A;  5C4J B;  3C1F A;  4H13 C;  5JJK A;  4GN4 B;  1WCM A;  2NVQ B;  3KLS X;  1TWF A;  3CSW A;  4R1J A;  5EBC A;  1NUC A;  5C5M A;  2IBK A;  4JI7 Q;  1B44 D;  3S1N H;  3AU7 A;  4J9Q A;  5HGT A;  1P16 A;  2KCM A;  3KUP A;  3KDF B;  4FO2 A;  1GVP A;  3S1R H;  4MTN A;  5IWA Q;  4B3S Q;  1OTC A;  3C1E A;  2CNV A;  3G6X A;  3CMA A;  1QWY A;  2A74 C;  1S0O A;  2F0V A;  4KN7 C;  4K5W A;  3CCJ A;  1R9T A;  3A8J E;  4RAZ A;  5T1G A;  3M9N B;  1SRU A;  1QZH A;  3J80 c;  1SEB D;  1FGB D;  2AWO A;  5CV7 A;  4G4K A;  1G8Z D;  2VQE L;  5KNB A;  4LF6 Q;  1RCV D;  2ZJQ A;  1TXY A;  2YTV A;  5CMD A;  1M90 C;  1HZA A;  3FEW X;  3DF7 A;  2JA5 H;  3M85 A;  4DAV A;  2XTI A;  3W1G A;  1F2Y A;  2PZW A;  4LJZ C;  3UDI A;  1JOR A;  1EUC B;  1PXU A;  3GV5 B;  4GN3 B;  4JI7 H;  2HDL A;  3T9C A;  3TQT A;  2WE6 A;  1BCP D;  1EYC A;  1Q7Y C;  2NZ1 D;  5FO9 B;  2ASD A;  1PH5 A;  4HJ8 A;  4DR3 Q;  2Z6B A;  1EU4 A;  3OW2 A;  2VA2 A;  3FPP A;  1IYU A;  4K6N A;  3K7U C;  2HVS A;  1W6J A;  3I4L A;  3F2U A;  2A6E C;  5E7N A;  1HR0 L;  3CC4 A;  1T94 A;  2JE6 I;  5E1F A;  1OBG A;  1KDB A;  2CW0 C;  4CMF A;  1BBU A;  3E0E A;  5HUR A;  1LM0 A;  1B53 A;  2SOB A;  1MSG A;  4BXX H;  4DR6 H;  1O7L A;  2JP1 A;  4JBM A;  1ZEQ X;  1VS0 A;  2F0J A;  4DK0 A;  1VQ6 A;  4BBS H;  3K81 C;  3I7F A;  4LF9 H;  2KSW A;  4HIM A;  1SN8 A;  4R4C A;  2E2J B;  3T5H A;  3A5Z B;  2WB1 B;  5NUC A;  3CCM A;  3KYH C;  5JEA G;  5D1O B;  1X3Q A;  3TP5 A;  2QB5 A;  1STY A;  4LAA A;  4B9W A;  1EQQ A;  2F0K A;  2VXW A;  5BN5 A;  2N49 A;  1TKW B;  4PZ6 A;  3GTO H;  3J7A K;  3CQZ B;  2CWP A;  4DR3 H;  3KF6 A;  1G6Z A;  4EQO A;  5EPK A;  4C3J G;  2K04 A;  4Z9C B;  1MGS A;  1EFW A;  2K5H A;  1YHB A;  5KYI A;  3LGJ A;  5KFG A;  1AFP A;  1K8O A;  5F2D A;  2D0P A;  4GLW A;  3CAM A;  4KHV A;  3TEK A;  1B04 A;  2ZTD A;  2EYJ A;  3FDT A;  1JXL A;  1CK1 A;  4JG2 A;  3KHG A;  2ZTC A;  4BY1 G;  3QR8 A;  4OGQ C;  2V4R A;  2K5D A;  3DWQ A;  2VUM H;  2C28 A;  5DG7 A;  3Q23 A;  2DAA A;  1KJQ A;  4UCT A;  5M5X B;  3J80 W;  4JBW A;  1WYD A;  4QWB A;  2KCN A;  3OMC A;  4ED0 A;  5KYL A;  3NE5 B;  2L11 A;  5DM7 3;  2OQK A;  1ENF A;  3DWA A;  2IP4 A;  2W6P A;  1ICW A;  5KFN A;  5ELN A;  1JOQ A;  1W6K A;  1NBW A;  4X6A H;  1B2T A;  4DV0 Q;  3RIZ A;  3T1H L;  2QF7 A;  4JV2 A;  5E4W C;  1E0B A;  2VQE H;  4YB8 B;  4RMF A;  2EZV A;  4IN3 A;  4KHP Q;  1PX2 A;  3NEL A;  1B3A A;  1QE6 A;  2FE3 A;  3C0F B;  1HZC A;  4ZKB B;  1V9P A;  3G8C A;  3PR4 A;  1AZQ A;  5FPR A;  1E4F T;  4BBR G;  1LT3 D;  2JSO A;  1G6P A;  1VBG A;  3PQI A;  2NN6 I;  3BG5 A;  5C3E B;  2R8J A;  5ISR A;  1E24 A;  4BA1 I;  5IYB H;  1V4Y A;  4J9S A;  3K58 A;  2B2U C;  4DV1 Q;  5CE8 A;  5KFE A;  4L1K A;  2A68 D;  4R8U B;  2OTJ A;  2XC9 A;  3GP7 A;  1KDC A;  3GLK A;  4TQU S;  1OBD A;  5EWF A;  5IWA L;  1TWC A;  4J9K A;  4JI5 H;  2IT1 A;  1R9T B;  4CKE A;  1M6V A;  4LFC Q;  4NXM Q;  2R3Z A;  4M7E A;  1XWE A;  4QWD A;  2KUM A;  1T9H A;  3BG3 A;  4LUZ A;  2Z4I A;  5G3L F;  5IYZ F;  1TS3 A;  3M4O H;  1F2L A;  2TSS A;  1GHJ A;  4HSV A;  3TN2 A;  1XMO L;  1WD0 A;  1ZXT A;  1BNZ A;  2A8V A;  5KFW A;  4RNO A;  1IBL H;  4A3D G;  1VQP A;  4KY7 A;  4DPG A;  5DG9 A;  5GRO A;  1PZI D;  3I4M B;  2HVQ A;  4ED3 A;  4IRD A;  1QG7 A;  4NZN A;  3H3V I;  4ILW A;  3QIA A;  5KND A;  5KT5 A;  2YU9 A;  4HID A;  2MFI A;  4B3T Q;  3Q8Q B;  5KT2 A;  2R6G A;  4O4H F;  2QW7 A;  4DV3 L;  1Z6H A;  1IYE A;  3CP0 A;  3TS0 A;  2AMC B;  3R93 A;  1IBM Q;  3EFX D;  2GN5 A;  5JVG 3;  5C4X B;  4F4Z A;  4DK6 C;  2UXD L;  1HCZ A;  4HNT A;  4JVZ A;  5GQO A;  1HNZ Q;  1UNS A;  2RGV A;  1EOV A;  1RJP A;  3BDO A;  2MO1 A;  4HQ6 A;  5HV6 A;  2G9D A;  1D1I A;  2F4I A;  1KRT A;  1I94 Q;  4IR1 A;  2H1E A;  2OF1 A;  3I3C A;  3I73 A;  5IOD A;  3RAX A;  1D8L A;  4OEL B;  3JRX A;  4V0B A;  5DNF A;  3JAM L;  3TQ1 A;  2CW0 D;  4Y7N H;  3T9A A;  5EWE A;  4ED8 A;  4J9O A;  5M5W H;  1LV9 A;  4YQW A;  1K28 A;  1XPU A;  1JWM D;  1HXY D;  1I50 A;  4IJL A;  4O3P A;  1E1T A;  1SMY C;  2YL2 A;  5IYB G;  2M2L A;  2QKI C;  4S3S A;  2ATW A;  2QK4 A;  4UP8 A;  4RAU C;  2NBF A;  1CUK A;  1DM0 B;  4A3J H;  3DTF A;  1AEX A;  4JI6 Q;  3PN1 A;  3WOE A;  4TVI A;  1CTM A;  3W3A A;  4A3I H;  3K5M A;  3TEH B;  1FNV A;  4RGN A;  5C44 G;  4B3M Q;  4CHI A;  4JI3 Q;  5BR8 L;  2VZA A;  2VY3 A;  2A6H C;  3ERQ A;  3K6O A;  4A3C G;  3T9B A;  5FLX W;  1PK8 A;  4Y7N B;  1Q81 C;  3WDN A;  3LP8 A;  4OO1 H;  1LO5 D;  4C5C A;  3JAM E;  2WAQ B;  2RSO A;  1F2Z A;  1GUG A;  2VPQ A;  3ORR A;  3ERO A;  5IP9 H;  1Z7T A;  3NP8 A;  5I2Y A;  5D8D A;  2DY7 A;  4LF5 Q;  1JLL B;  4Q8F A;  1X32 A;  2X69 A;  4F4X A;  4L6T B;  3HS0 C;  1A0I A;  2YV5 A;  1KQS A;  3J7A F;  2RKS A;  1Z2P X;  4A3J B;  4C3I H;  3GTP B;  2V4Q A;  3KTM A;  4IR9 A;  2OCE A;  1EWI A;  1PV4 A;  3CQZ A;  4HJ5 A;  1I1L A;  2RDJ A;  2EYH A;  3CXC A;  2D5D A;  3TRE A;  3H15 A;  1GUO A;  2CW7 A;  5LYJ F;  3HOY G;  5KFR A;  4IPD A;  3G6V A;  4B3M H;  1SXT A;  1DYQ A;  2G9H D;  4LF6 H;  2K03 A;  2VQF Q;  1JB7 A;  4A3D B;  5COY A;  4IWX A;  2ZJP A;  4AYB E;  1EL0 A;  2HHF B;  1YHQ A;  4L5R C;  4DNT B;  1XNQ Q;  3BAA A;  1PZJ D;  1L2F A;  3ZYY X;  3GTP A;  1SNC A;  3JZI A;  1TWF H;  3D3R A;  4AYB B;  3I4N H;  1Y1V H;  3K59 A;  3S1M H;  4DV3 H;  5KFO A;  2XNA C;  3CPW A;  3ETH A;  4EYH B;  3T1Y H;  3J81 i;  1JT8 A;  2NU8 B;  3T9F A;  1JE5 A;  3VA5 A;  4GKJ H;  3ONA B;  5C1O A;  4IFD G;  2F4V Q;  2X5R A;  1S0M A;  4J9N A;  3EBE A;  5EKI A;  3NHH A;  2UXD H;  2ZTE A;  2YZG A;  4RKL A;  2VUG A;  2KJX A;  3SDZ A;  2N88 A;  3WWV A;  1IYV A;  2B2W C;  5EGT A;  4GLV B;  4WFN 3;  1IOW A;  2UVU A;  1NR2 A;  5JQW A;  1J6Q A;  3HOX G;  4ID6 A;  4OO1 I;  1N36 Q;  4P75 A;  2ABJ A;  2F0E A;  3TY5 A;  1QIL A;  2Z4H A;  3JRW A;  1PFN A;  5C5J A;  3K5N A;  2NYZ D;  1V1Q A;  4A3I G;  1K83 A;  1QJO A;  2B39 A;  2CNU A;  4LF9 Q;  4LF4 L;  2XCP A;  4QIW B;  1XTD A;  3I4O A;  2R93 B;  1OXX K;  2O5J C;  1XNQ H;  2ICE C;  1JC7 A;  1A8V A;  4B9X A;  1JB3 A;  1G29 1;  1LUZ A;  2L4N A;  2K50 A;  4DV3 Q;  2CH4 W;  1RYR A;  3D6W A;  2DY8 A;  4PZ8 A;  2KQ3 A;  4O7V A;  3RGZ A;  4O1N A;  2GPW A;  2ODT X;  2IJ0 A;  2RVL A;  1UE7 A;  4YCV A;  4JI8 Q;  4DF7 A;  2UXD Q;  2IX1 A;  2M05 A;  1SYX B;  3BA8 A;  3HOV G;  1E3P A;  4ECV A;  3OWF A;  3VMM A;  3L7Z C;  2HGW A;  4GKK L;  2B2Y C;  2FJ2 A;  2JA7 H;  4L5S A;  3V6K A;  5DLG A;  2XIG A;  1S5C D;  1I6H B;  2ALY B;  3L0O A;  1EHI A;  5A2Q W;  3GTQ A;  5K2M A;  1EIH A;  1HNW H;  1IYJ B;  1F9S A;  4ETS A;  1RKN A;  1WR2 A;  2B63 H;  4LF7 Q;  4QUF A;  4FP5 D;  2Q8R E;  2PMZ B;  1KTA A;  1NY4 A;  3QZ7 A;  1ET9 A;  3AFP A;  2E2I H;  2XWJ B;  1V1P B;  2B3G A;  4ED7 A;  2LKV A;  1HRJ A;  3UE1 A;  3GD7 A;  4C3H H;  5J3B A;  3DUZ A;  4Y8V B;  5IYD G;  4O7Z A;  1X3E A;  3NWS A;  3MEF A;  2V58 A;  4JI6 L;  1NMF A;  1FNW A;  3KXY T;  5KG6 A;  3EPG A;  4JI8 H;  3M9B A;  3TBI B;  2R7Z A;  3QB3 A;  1B1Z A;  3KAK A;  4V19 0;  4X65 H;  4B3M L;  3RGX A;  4PG3 A;  4RG1 A;  4KHP H;  1SR3 A;  1I3Q H;  4F50 A;  5KS8 A;  1R4P B;  1SDF A;  1PH8 A;  2R7Z B;  3RD4 A;  3BA9 A;  1MKH A;  5KIX A;  3HB9 A;  2FHT A;  1CQF A;  4EX5 A;  3TP7 A;  3JZF A;  1HTL D;  4LSX A;  3CRL C;  5C0X G;  3RBD A;  1WCM G;  2B2W A;  3I8Z A;  3GIQ A;  5DEH A;  1BBX C;  1AN7 A;  4A3B G;  4ECR A;  2K7V A;  1BUV T;  4X64 L;  1S5B D;  1HR0 W;  4K5V A;  2BOS A;  3U9S A;  1CKN B;  4LUO A;  1PH3 A;  4DAY B;  5I9P A;  2QDB A;  2YYZ A;  3VDY A;  3KLW A;  5ELD A;  3IKJ A;  3KK7 A;  3PV0 A;  4DV0 L;  3S14 H;  5EKK A;  2I80 A;  1WFQ A;  3VR2 A;  2NN6 H;  3W2D A;  3RB3 A;  1W2B A;  3HOX B;  1KEE A;  5M3F B;  5KFV A;  1QVG A;  1I50 H;  3T4A C;  3BYT B;  4IFD J;  4EEY A;  2BA1 A;  2JK8 A;  1V1O A;  3DHQ A;  3GTM A;  3UZB A;  3KBG A;  4UCS A;  1UAP A;  3FDS A;  4RCO A;  2IX3 A;  3N44 B;  4Q0F A;  1WTX A;  3OW7 A;  5C3W A;  1GUT A;  3A7L A;  4AYB A;  4OON A;  4QUC A;  4CJ0 B;  2FXQ A;  2B2Y A;  1CT1 D;  1A6X A;  5JH7 F;  1UE6 A;  1IBM H;  4O3S A;  1LAB A;  2CNQ A;  2EVB A;  2EIY A;  4HIO A;  1WSC A;  1SNM A;  4IUV A;  4A93 G;  2F3W A;  4HCS A;  1EEI D;  1XDN A;  4MHE A;  4RKB A;  4PMW A;  1CS0 A;  3PO2 B;  2ENB A;  4RU9 A;  3RBE A;  3BAB A;  2ZDH A;  4LFA H;  4PNY A;  1HZ9 A;  5EAY A;  1Y1W G;  3LML A;  4YCW A;  1QUQ A;  1SJE D;  4GZY C;  2V5A A;  5FLX E;  5KFS A;  3ER0 A;  3PMF A;  3GTK H;  4DR6 L;  4DV4 L;  4EGQ A;  1HZB A;  1VQD A;  3MWY W;  2NVX B;  5DGA A;  3MHB A;  4CE5 A;  1FJG Q;  1L2Z A;  2BDO A;  5CGK A;  3NK9 A;  2F03 A;  5IGE A;  4K6D A;  1QZG A;  2YU9 H;  4GC6 A;  4MV6 A;  2X0S A;  5D1O A;  5C4X G;  1STH A;  2EJ3 A;  3QQM A;  3BJY A;  4NP5 A;  4GNX A;  4PQX A;  1UC8 A;  2I8C A;  2CQY A;  1HQM C;  1I7L A;  1ZYR C;  5EOY A;  3V96 A;  2A6H D;  3GTJ H;  1I94 L;  4JI3 H;  2VB3 X;  4DN4 M;  3FHW A;  2F0G A;  3BVG A;  1WD1 A;  2ALZ A;  5CC4 A;  2RBM A;  3GIJ A;  1PFS A;  4YWL A;  2A69 D;  4XX0 B;  4H02 A;  3TP8 A;  1ULZ A;  5IT9 c;  3M7G A;  4A3L G;  2NU6 B;  1U5K A;  2D9U A;  2KHI A;  1ENC A;  3SEB A;  4DXF A;  2WAQ A;  2QDL A;  4O82 A;  1DZ1 A;  1N33 H;  4LF5 H;  3H3V C;  2WIN B;  4IHJ F;  2A19 A;  4FYD A;  1OXU A;  3DWP A;  2CQA A;  1JJ2 A;  1ZET A;  4F88 A;  3FKI H;  4A2A A;  3PFF A;  3QOL A;  3CCV A;  4ZRZ A;  4JI4 H;  3KLS A;  2C2E A;  5DGB A;  1U4R A;  2BH8 A;  2AQ1 B;  1YZ6 A;  4GC7 A;  4EQP A;  4HYK A;  5BR8 Q;  3S2D B;  1IL8 A;  1K8M A;  2XCA A;  5D3D A;  5KG2 A;  4IQZ A;  3PCO B;  4JCV E;  4Q4C A;  2UVR A;  5KT4 A;  2F0T A;  2RA4 A;  1PH9 A;  1I2K A;  3NTK A;  2K52 A;  2OQ0 A;  2XCL A;  2Y0S B;  1PYW D;  3RN5 A;  4K14 A;  1QNK A;  5CA1 F;  2R7D A;  4LF5 L;  4NPS A;  2HD3 A;  2PVP A;  4GKJ Q;  4R8I A;  4NYE A;  2JEF A;  2EOT A;  1Q46 A;  4IZ8 A;  4MIU A;  2RDG A;  3HEJ A;  1HUN A;  5KX5 F;  5CV5 A;  4RUA A;  5M5X H;  4FS1 A;  3NBY B;  3N52 A;  5KFH A;  1OO9 B;  3AFQ A;  1WTP A;  1K3R A;  1Y8P B;  1XMO H;  1L1O C;  2YS7 A;  1SE8 A;  2VQF L;  3HOY H;  1H9S B;  4XIG S;  5I5T A;  3TW7 A;  5BYA A;  2DIK A;  1A62 A;  5KFD A;  2EJ0 A;  5EQ0 A;  2Q8T A;  1AE2 A;  2DN8 A;  5M3F G;  5HGQ A;  4UCV A;  3FKI A;  1SYG A;  1KIX A;  3DTG A;  1L0Y B;  3GV6 A;  2DWC A;  5J2T F;  4JYA Q;  5CV9 A;  5LHY 1;  2JA5 B;  4ZCK A;  2VR1 A;  1LTA D;  5LXT F;  4F4Y A;  3GTQ B;  2RQX A;  1HUM A;  3NBZ B;  2N78 A;  1TWC H;  1Y1W A;  1KTK A;  3V05 A;  5GAG C;  2K5V A;  1YNN C;  1X9N A;  2W70 A;  3GTL A;  5IOC A;  2FP4 B;  4YHH Q;  3MR6 A;  1DCZ A;  5DM6 3;  2F3V A;  1PDQ A;  1V8Q A;  4DR2 Q;  3CVZ A;  1SFO H;  2R8K A;  1CKM A;  2FIN B;  2B8G A;  1AZP A;  3S15 B;  3SK8 A;  2PCF B;  1VQ9 A;  3GQB A;  3VPB A;  5LA6 F;  3DXJ C;  4IPH A;  4RZR A;  3C46 A;  4LK1 C;  4K0K H;  3NWT A;  4DL6 A;  2NUA B;  1SE2 A;  3T1Y L;  2OEO A;  1DJR D;  3NBH B;  5CA0 F;  5BPH A;  4J9R A;  3PW4 A;  2F0I A;  5FO8 B;  4UFZ A;  1B7Y B;  2NZO A;  2CVR A;  2NVY A;  4YY3 H;  3R3O A;  5KRU A;  1X54 A;  4YIJ A;  3K8A A;  1GOZ A;  2ZT9 C;  2FB9 A;  2PYK A;  1TWG H;  1BO0 A;  2VUM A;  2NWG A;  1X3G A;  4O4J F;  3OTO L;  4CDC C;  1VQH A;  4ZUJ A;  4P73 A;  1A9X A;  1ZHS A;  1CZW A;  1T36 A;  2F0S A;  4B3R L;  2WB1 G;  1K8G A;  2UVW A;  1I4G A;  4KLK A;  3CCQ A;  2XGP A;  1NCV A;  3OUU A;  3U4Z A;  3AYH B;  1JX4 A;  1WCM H;  3AMU A;  4EBC A;  4UCR A;  3T9D A;  4ULL A;  4ALP A;  4EYI B;  2A68 C;  3OSP A;  1N32 H;  1L1O A;  2V9W A;  1QUQ B;  1YNJ C;  3VA7 A;  4IFD I;  3K5L A;  4CC5 A;  4JV5 Q;  1WTW A;  2L55 A;  2VUM B;  3BZK A;  1YJ9 A;  1D5Z C;  2HQL A;  2JQO A;  4YY3 Q;  2DPJ A;  4QMG A;  2HQE A;  1MBY A;  1CFM A;  4DLK A;  4X3K A;  1Q82 C;  3ETJ A;  1CQI B;  1I1K A;  2CFM A;  2D2C C;  1RJQ A;  3RUP A;  3WNZ A;  1HFG A;  2JA6 G;  4XQN A;  4XDX A;  1U4L A;  5LMN H;  1RTO A;  1J8I A;  2R92 H;  4MV8 A;  4TM5 A;  1OWT A;  1SNO A;  1DOM A;  2XN9 C;  3VYU A;  4LF8 L;  1WTQ A;  4LF6 L;  5I47 A;  1UE5 A;  5DAU A;  2SNS A;  2D62 A;  4GKJ L;  2F0W A;  5JJZ A;  4PZ7 A;  1H9J A;  4ZHQ F;  4QWE A;  2SNM A;  1PTO D;  2BE5 C;  3RZD H;  2ES2 A;  4ECU A;  2F1M A;  2ZXR A;  4DFA A;  1UUP A;  3ND8 A;  3VYR A;  4HIK A;  5CBE E;  1A0G A;  1A15 A;  4ZQI A;  3R23 A;  2FJZ A;  1OXT A;  4A3G H;  1EIY B;  1M0T A;  4O83 A;  4QWC A;  1B70 B;  3HOU B;  3JAM c;  4O4L F;  1SMX A;  4A3J G;  1C3O A;  2V59 A;  5DGH A;  1VQC A;  2NVT H;  1I3Q B;  4CDE C;  1DOL A;  2C22 A;  2UUB L;  3J7A V;  1IBK L;  2PMZ A;  4ED1 A;  3MXN B;  1STG A;  3V4Z A;  5F9L A;  1C30 A;  4R4T A;  4A3C H;  2QYZ A;  2O4X A;  3K0X A;  1FJG H;  4F7X A;  1K8A C;  4DV2 L;  5LOV F;  4XYQ A;  3R2T A;  4O3N A;  1HH2 P;  4MTE A;  1UC9 A;  4K8J A;  1SMY D;  5JPM C;  2R7N A;  1J5E H;  3S1M B;  1WCM B;  4NZM A;  3U54 A;  3JSL A;  1EKP A;  4ECS A;  1VQG A;  3MXG A;  5JUM A;  1SLJ A;  1Y14 B;  4G7H C;  1PHJ A;  4Q4D A;  1MZB A;  1S9F A;  3D4W A;  1STE A;  3J81 E;  2B63 A;  4JI2 L;  4GN5 A;  2F0D A;  2QCP X;  4QWA A;  4DAM A;  2R8G A;  4N9T A;  4C3J H;  1PH4 A;  3KHH A;  2RHS B;  4CHT B;  1EY4 A;  1BBW A;  2COG A;  3TII A;  1X6O A;  3KFU A;  3H3V H;  1JDB B;  4EFB A;  3NTH A;  3Q0A A;  4DL4 A;  4RGM A;  4DR6 Q;  3N8D A;  4HSP A;  4QGU A;  3HOW H;  2P0A A;  4EEQ A;  2Y0S A;  4RB3 C;  2XVS A;  2R7Z H;  1KAW A;  2RSN A;  5C0X I;  5KFZ A;  4O2D A;  2MNA A;  4DV2 H;  2IMW P;  3HFZ B;  1HA5 A;  4NXN L;  1O80 A;  3I4M G;  2UUA Q;  1E4E B;  5IE8 A;  3CD6 A;  4ED6 A;  2E5L H;  1EIG A;  1LLR D;  5K36 H;  1K83 B;  1E4G T;  1J5E Q;  2C35 B;  2IW3 A;  1RF2 D;  1WVL A;  4FFM A;  1GO3 E;  1O78 A;  2ZM6 L;  3QG1 A;  4C56 C;  1VAJ A;  3VR3 A;  2GPS A;  3MWD A;  1ML0 D;  4NMZ A;  2VPS A;  3CME A;  1RTN A;  3MXN A;  4DNR B;  2CKZ B;  1EKV A;  2ASL A;  4A93 B;  1PH6 A;  3S2H H;  2FMM A;  2EQS A;  3QJY A;  4G57 A;  4APM A;  4QSH A;  3G8D A;  3D31 A;  1PRT B;  2JA7 A;  2HDM A;  3GTJ A;  3M9M B;  1N34 Q;  1EY0 A;  4NZO A;  3HOX H;  2F0M A;  2J0T D;  4M8A A;  1QVF A;  1XMQ H;  1X56 A;  2Q2H A;  4B3R Q;  2UXB L;  1KBL A;  4JI0 H;  1BQQ T;  2BCO A;  2KEN A;  3HG9 A;  2NVQ H;  2SEB D;  1C4Q A;  1YIJ A;  4DR5 Q;  5JVL A;  2AUK A;  3OOC A;  1Y1V A;  4EBD A;  2R6F A;  4X64 H;  1E22 A;  3VR6 A;  4ZKC B;  4DAP A;  2E5L Q;  1CA6 A;  2VL6 A;  2HJW A;  3T5L A;  5I4D A;  4C5B A;  3F1Z A;  1NAP A;  4JI7 L;  5CM0 A;  2FPI B;  2YCH A;  3EPI A;  2R7L A;  1Q86 C;  1ENA A;  5A2Q L;  2JA8 H;  4NKL A;  2BE5 D;  1KJJ A;  2LSS A;  4FF1 A;  2W6Q A;  4MAM A;  5FPO A;  4DV0 H;  4LMQ D;  2HVR A;  2K05 A;  2NVY H;  2K5W A;  2V4D A;  1XMQ Q;  4ODG A;  3A8I E;  2NVX A;  4LF8 Q;  3ICE A;  1JWU D;  2B63 G;  1KUT A;  4R9W A;  5FR9 A;  3CC7 A;  3HOW B;  2VQD A;  4TSS A;  1VQI A;  5LMN W;  3CPF A;  2K4K A;  1HTP A;  1C7Y A;  3N43 B;  3Q8S B;  5J22 A;  1HHV A;  4J8Q A;  3U9O A;  5IGF A;  2PBZ A;  1STA A;  4JI2 H;  3I56 A;  4RHR A;  1G2T A;  3GIM A;  4JI4 L;  4HN7 A;  1GSA A;  4JI5 Q;  2DUD A;  1IBM L;  3BQ0 A;  4U68 A;  3TZU A;  2GA4 B;  4KKS A;  2W6Z A;  4X66 H;  1DD2 A;  4X3T A;  3OSO A;  3BJU A;  2UUB Q;  2XRS D;  1KLG D;  5I5U A;  4NB3 A;  1IBK Q;  1HR0 Q;  3GB8 B;  5DAA A;  2VB2 X;  4DR7 H;  1TT2 A;  1EYZ A;  1I50 B;  2DJG C;  4KJN A;  5M5Y H;  1GHK A;  1YI2 A;  1BVS A;  4NW2 A;  2SDF A;  2QA4 A;  3N6X A;  4TKO B;  2XWB B;  1E7Z A;  4A3M B;  4YWM A;  1YEZ A;  3OWE B;  2E2H H;  1VCI A;  2M00 A;  5FK9 C;  2K5N A;  4WHX A;  3RV3 A;  1B4O A;  4N8X 1;  4ZI7 F;  1A3T A;  4WJ4 A;  3R9R A;  2ZM6 H;  2WAQ G;  2RCN A;  2HG8 A;  4CKC A;  4RA8 A;  2F0Q A;  1ZYR D;  2K32 A;  1A63 A;  4A3B H;  1K9M C;  4B3T H;  1QOH A;  2QEX A;  2JA9 A;  2TMP A;  1VQK A;  2L0C A;  2COJ A;  3G6Y A;  4YHH L;  5EBD A;  5I5Y A;  1EU3 A;  2ASB A;  2IPK D;  1SYE A;  2HGX A;  1E1O A;  4OL7 A;  2YS6 A;  2A69 C;  3LQS A;  4MA0 A;  3GTJ B;  4MA5 A;  3O13 A;  2AQ2 B;  4CGY B;  1M4V A;  4JPB W;  1BDO A;  2XRQ D;  1I4R A;  3KAJ A;  2AHO B;  3RAQ A;  4F4W A;  1FKA H;  1R4Q B;  2NTS A;  4X62 L;  3SK5 A;  4BBR B;  4JI3 L;  2PNH A;  1I94 H;  1FGU A;  2XIW A;  2JA5 G;  4NXN Q;  4ZQ3 A;  1Y1W B;  4KK7 A;  4GOP B;  3IFD A;  3I90 A;  5D3I B;  1YNJ D;  3EYY A;  4C2M B;  3EVQ A;  4OWT B;  2R84 A;  4G7Z C;  3TRZ A;  2Y0S E;  5I5W A;  1Y1V B;  4J0M A;  1E4E A;  4TQR A;  1TWH B;  4J15 A;  1Z9F A;  3M4Y A;  4X3S A;  4FFL A;  5FD6 A;  3NPP A;  2ZDG A;  1KNE A;  2K14 A;  4ME3 A;  1M8A A;  1AUX A;  1DV1 A;  1WRV A;  2OLS A;  3S1N B;  5BMV F;  2Z9H A;  2WKD A;  1TWG A;  3NXW A;  1MSH A;  2W6O A;  5KG0 A;  2AUJ D;  2JA7 B;  4KMU C;  4DR4 L;  4BXX G;  1H9S A;  4YR0 A;  1O7Y A;  1IXR A;  4DK1 A;  2AU0 A;  1PH7 A;  1VBH A;  2W9B A;  4R8U A;  2MQH A;  3R5H A;  5C44 H;  2UXB Q;  3T99 A;  5KFY A;  1IBL L;  3HOZ H;  1CE8 A;  2DAB A;  1VQB A;  1JCK B;  1EQR A;  2EPB A;  1ZQ7 A;  4KD4 A;  4YR3 A;  3U9T A;  3N42 B;  4RWS C;  3A0J A;  3SR1 A;  2Y0S G;  4C2M A;  2K1B A;  4KV6 A;  1N48 A;  1T3N A;  4FFO A;  1NTG A;  1EQV A;  4JV5 L;  2PQE A;  5KT6 A;  4B08 A;  3H0G G;  3D4D A;  2C2D A;  5JAV A;  3FVQ A;  4FVM A;  1SE3 A;  1EWH A;  4WBN F;  4YY3 L;  3G6J B;  1K3B C;  4PWQ A;  5D65 A;  4JC0 A;  3TS2 A;  1LTS D;  2UUC H;  1K73 C;  2JEJ A;  2YYA A;  3BDC A;  3T53 B;  3OIP A;  3KOJ A;  5CR3 A;  4M0J A;  1CZG A;  3S16 B;  3HOV B;  2AGP A;  4FF3 A;  4O7Y A;  3HGB A;  1E2W A;  2JA6 H;  1PLF A;  4UPA A;  4ZYS A;  4RFB A;  1BCP F;  3GTL H;  1I1M A;  3HBL A;  2VQF H;  1PTO B;  3QWN A;  1C48 A;  4TRD A;  2FK1 A;  1U4M A;  2P5Z X;  1IZ6 A;  4K6L A;  4BY1 B;  3OIQ A;  2C00 A;  2Z04 A;  1PFM A;  1YNN D;  2IL8 A;  1RK6 A;  2VW9 A;  4A3L H;  4EFE A;  5KFT A;  2Z6K C;  4O7N A;  3E5N A;  2G5D A;  3SK6 A;  2B2T C;  4JI5 L;  2X6L A;  4Y52 H;  2BR0 A;  3S9W A;  3GTO B;  4IUT A;  3VPC A;  2ZJR A;  3FKI G;  3EQL C;  4DGZ A;  4XYL B;  3G4S A;  2DLN A;  3HOV H;  1SE4 A;  4HN2 A;  3NUA A;  4FXK C;  1RJT A;  1H9K A;  1AW7 A;  2K01 A;  1HNZ L;  3BDL A;  4K0K L;  1DOK A;  4Q44 A;  1LTI D;  1VQE A;  1EOT A;  4ECW A;  2R7Z G;  1EY8 A;  1VQF A;  5JPN C;  4DV2 Q;  4MV7 A;  4A3F G;  4FDB A;  1ZKO A;  2UUA H;  1EZ1 A;  3UDG A;  4OX9 Q;  1EYD A;  2CH4 A;  3J7Y W;  3FMA A;  1KDA A;  3Q8R B;  3HKZ G;  4A3M H;  5DQH A;  1IL2 A;  1TWH H;  2KVM A;  4DXG A;  4LF7 L;  4DL7 A;  2EJM A;  1ZHQ A;  2VOB A;  3SK4 A;  2CCZ A;  1DON A;  3H0G H;  3L3O C;  4IJH A;  1CKO A;  4AQY Q;  5E3F A;  3Q2O A;  1VQ5 A;  3GIK A;  2EY1 A;  5T14 A;  1PTO F;  1L0W A;  1VF5 C;  4O2A F;  3LWB A;  5M9O A;  5GAD C;  4GLA C;  3S14 B;  3PGZ A;  5ELO A;  1RJR A;  1M0W A;  4UP7 A;  3S16 H;  3F8N A;  4B3R H;  1RDP D;  2K28 A;  1FNU A;  1Q1B A;  1X3P A;  4HJA A;  4DRF A;  1D2B A;  3S1Q H;  3HKZ B;  3AW8 A;  4PMC A;  1BXR A;  1DAA A;  1S72 A;  1EY7 A;  3DLL A;  2WB1 A;  4POG A;  4DR5 H;  3VNN A;  4Q8E A;  2MUY A;  2Q7D A;  2ZJT A;  5CV8 A;  5LP6 F;  2BQU A;  1JIH A;  4TQS A;  4OX9 H;  3DM3 A;  1J5E L;  2EYM A;  3Q22 A;  1RL2 A;  4DV7 H;  4LF7 H;  1BXT A;  2WDT A;  5K36 G;  4LUV A;  1LTR D;  3BS1 A;  4O81 A;  4IOA A;  3BQ2 A;  1ET0 A;  1XK5 A;  2R92 A;  3EA6 A;  1PRT D;  2ZXP A;  3PO3 H;  4GOP C;  4LFC H;  4NXM H;  3GTM B;  5JJL A;  3F2C A;  2M9V A;  1LYL A;  2KHJ A;  4CJ2 C;  3RZO H;  3VPD A;  1BR9 A;  2NN6 G;  4AH6 A;  5GAH C;  4UUG A;  3IN5 A;  2EYP A;  2MHV A;  1PVO A;  2LMC B;  1BKB A;  4DV5 L;  1IBL Q;  5M3M G;  4C1N K;  3KLR A;  3S2D H;  3GJX B;  3GTL B;  4LF8 H;  4OIJ A;  2W7P A;  1KL9 A;  2FPG B;  4BA2 I;  3P20 A;  2LXK A;  4K2L A;  4MV3 A;  3A54 A;  1XNQ L;  4BBS B;  1SSO A;  3TZD A;  2E5L L;  1CI3 M;  3M9O B;  4E4T A;  4FM9 A;  4LH6 A;  3UYY A;  4DV7 Q;  3NBH A;  3KJP A;  2QGQ A;  1ZAU A;  5I5S A;  4YCU A;  1VKZ A;  3F8T A;  3MWE A;  1F77 A;  1IW7 C;  4XYO A;  1S5F D;  4M1U B;  4B3S L;  4F8M A;  3M7N A;  1VQN A;  4A93 H;  2E76 C;  1G91 A;  4UY8 C;  1S5E D;  2NB0 A;  3I91 A;  2N55 A;  4KKT A;  2JA8 G;  2UUB H;  1CM9 A;  1KJ8 A;  1EY5 A;  1IBK H;  4DV6 H;  1A3V A;  1TR5 A;  1JJC B;  1XMQ L;  4NLG A;  3ERS X;  1N36 L;  4TUY F;  2VQE Q;  3NUC A;  5C4Z A;  3HOY B;  1S97 A;  1LTT D;  2L15 A;  1W93 A;  3RLF A;  3ORQ A;  4FFN A;  1I5F A;  4DV4 Q;  3V2T A;  4FXG C;  3ULP A;  2IA6 A;  2OWO A;  1FJG L;  2A1A A;  1O7Z A;  1KC8 C;  4JUZ A;  2EDG A;  4C3I G;  3ULJ A;  4QIW E;  3S17 B;  1C0A A;  5KFA A;  1Y8O B;  1B33 N;  3ULL A;  4C3J B;  4RB0 A;  1PH2 A;  1TWG B;  3WO1 A;  1TWC B;  3P75 A;  4JI8 L;  2GLT A;  2EYO A;  2ICI A;  1LTG D;  1QB5 D;  2IHE A;  1S40 A;  3RB0 A;  4X65 L;  1AP0 A;  2BQR A;  3SI8 A;  5IT9 E;  4DV6 Q;  1I6H H;  2R92 G;  3MFH A;  4A3F B;  4RGO S;  5ELF A;  2HHH H;  1D6E C;  2F52 A;  4RHS A;  5JOB A;  3M4I A;  4TV9 F;  5KFL A;  4OX9 L;  5EJW A;  3TDQ A;  3VR5 A;  1KXL A;  1KLU D;  1JMC A;  2NU7 B;  3OHX C;  2E2H A;  4J1M A;  3RLO A;  5C3E G;  4DV4 H;  5EPJ A;  2IWH A;  2CW8 A;  3GDE A;  4GS3 A;  1IOV A;  1TU2 B;  3RFC A;  3T5K A;  3RLN A;  4IUR A;  4A3K G;  1PYS B;  1JQY D;  1LTB D;  3KF8 B;  3PO3 B;  2HIV A;  2COI A;  1W96 A;  2F0F A;  4KTA A;  2KA7 A;  1YNX A;  4ABN A;  3JAM i;  1JKJ B;  5BWR A;  2L9H A;  2W8L A;  5FLM H;  1LT5 D;  5KFU A;  4BWS C;  4DUY L;  4X66 L;  1KNA A;  4DV5 H;  5KFI A;  4O3R A;  1G2S A;  5FD5 A;  3I12 A;  4X62 Q;  1Q12 A;  5L37 A;  3C3L A;  1MD2 D;  4KHZ A;  1EYG A;  5E4X A;  1PRT C;  5M3M B;  3A56 A;  5ELE A;  4POF A;  2I0Q A;  3UE0 A;  4JI1 Q;  2HHH L;  5FJ8 H;  3HOZ G;  4QQB X;  3PUX A;  2UVV A;  1PZK D;  1VQJ A;  5D1P A;  3AB9 A;  4UAI A;  1VQ8 A;  5EZY F;  2UXC Q;  3MFI A;  4JBJ A;  1TII D;  3HKZ A;  4APV A;  2YRW A;  2PZU A;  1B9M A;  2BH2 A;  2JEA I;  3VOT A;  2RDF A;  1GJX A;  2J9G A;  3RNU A;  1HFN A;  5KG5 A;  1N33 Q;  4XYM B;  5T1I A;  1Q90 A;  2B2V C;  5HNE A;  2WII B;  3NSW A;  3OSN A;  4XQQ A;  3Q1K A;  4RB1 A;  4OIK A;  1F2M A;  2F0U A;  1NE3 A;  2UUC Q;  2EJG C;  5A2Q E;  1T5X D;  1EFI D;  4C3H B;  1YJW A;  5F9N A;  4JXU A;  1TWA A