2Q2UA

Structure of chlorella virus dna ligase-product dna complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
total genus 78
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2uA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2uA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2uA01
4JOIC 3NEMA 3UDIA 1VCIA 1VQ5A 4DNIA 2OTJA 1CSQA 4GLXA 4UCSA 3KJPA 4JBWA 1PH8A 4KLKA 4BXXH 2LXKA 4JI1Q 4A3FG 4LW1A 4JI3Q 1AH9A 3A74A 4RG1A 3ULJA 1LM0A 1C0AA 3RZDH 1PYBA 2R7ZH 3TS2A 3TEHB 5DLQE 2VW9A 2E5LQ 4JI3L 2NN6G 2NVQH 1L1OC 4GKKL 2HQLA 4GN5A 1JMCA 1VQ7A 1PH4A 4A3KG 4YY3L 1Z47A 3G4SA 3DLLA 1N36Q 3PSIA 5JJLA 2A19A 2FXQA 2KBNA 1B04A 4DR5Q 2I5MX 2VS1A 3UDFA 3I4MG 4GKKQ 3BABA 1XNQL 3CXCA 3GTQH 3GD7A 3ULLA 5IT9c 5M3FH 3H0GG 4MNOA 4DV2L 2UXCQ 4B3RL 4B3TQ 4AYBG 3F2BA 4B3MQ 3KJOA 4B3RQ 4MTNA 3H15A 1KQSA 2F4VL 4EX5A 2JA5G 1XNRQ 2NVYH 1LTLA 2DUDA 2N78A 4DV0Q 4Y52H 2F3IA 1JT8A 5C4JH 1B8AA 2JEAI 1X56A 1X65A 2RHQB 3JAMc 3NBYB 1HNXQ 1IYJB 1CKNB 1PYSB 4DR3Q 1WOCA 1BVSA 2Q2IA 2VZAA 3JC66 4QJFA 4DR2L 3UDGA 4AYBE 4C3HH 4TQUS 1IXRA 2N49A 3TY5A 4MZ9A 1MIUA 3OYYA 3KF6A 1J6QA 1J5EL 2K14A 3UDXA 1YZ6A 2JA8H 3J81c 4DK6C 4WJ3M 1Y1VG 4EEQA 5IP7G 2EIFA 1PH2A 4OXPA 4HJ9A 3FHWA 2Q2UA 3TRZA 4DR4L 2E5LL 3T1YQ 2F52A 1PH5A 1XNRL 1VQCA 3K7AH 1KAWA 2HHHL 1FL0A 4OWWB 3QWUA 4AQYQ 3PUXA 5AJ3Q 3KDFA 1GM5A 2OTLA 3KFUA 1Y1VH 3HOWG 3U50C 2NZHA 1G291 4R4CA 4HJ8A 3RTXA 3CCLA 3L2PA 2WB1E 1K9MC 2HVRA 4LF7L 1J5EQ 4UCVA 1K0RA 4DR5L 1PFSA 3GTPH 5FLXc 4IO9A 4DUZQ 2LSSA 1E22A 2VUGA 4CC6A 1SFOH 1HNZL 2ZJPA 1IL2A 3RZOH 3HKSA 1E3PA 1S3OA 2AMCB 2ZTEA 5HGQA 3GTLH 2AWOA 4X64L 3F1ZA 3GTMH 4GS3A 4NXNQ 2RCNA 4TVAB 4A75A 2Y0SE 4B3SL 3CMAA 5IP9H 1QVGA 1EIYB 5C0XI 4A3FH 4L5QA 3TQYA 1KD1C 3UE1A 1Y1WG 3ER0A 1Q86C 1OXUA 1YVCA 4HIDA 1IBML 1YI2A 1CKOA 3GO5A 1X3FA 5LMNW 1HZBA 2CWAA 1YJWA 2WFWA 2R7ZG 1Z9FA 4DV5Q 4GN4B 2KCMA 3CD6A 4A3IH 1G6PA 1XTDA 3J7A5 3I56A 3CF5A 3CCJA 2OWOA 2N8NA 4P72A 1AE3A 3LGJA 4R4OA 2R93H 4LF8L 3NELA 1WFQA 4UP8A 5C4XH 3F2CA 2B29A 3KF8B 1X9NA 4K0KQ 1HZ9A 3TY8A 5FPOA 3U4VA 4LFBQ 4E6NA 1L1OA 5H1SE 4JG2A 1QVFA 3JSLA 3GJXB 2ATWA 3W5OA 1U5KA 2R92G 3S1RH 4JI4L 2JJQA 2Z0SA 4GOPB 1L0WA 5GADC 3I55A 4JYAL 1PH7A 1OTCA 3AFPA 1FVIA 2GN5A 4BA1I 5M5WH 5FLMG 3HKZG 3GTKH 1VQBA 3NENA 3HOWH 5FPRA 3VNNA 5C0XJ 4UCUA 1XMOQ 3CC2A 3KF6B 1Q7YC 4YCVA 3CQZH 2CFMA 4UCTA 1NJIC 4QIWE 4AIMA 2CKZB 1KRTA 3J81j 1XMOL 1PH3A 3M9BA 1SMXA 4DR6Q 3HOUH 1V43A 4LF6Q 3I4NH 1IZ6A 3PUWA 3PF4A 4DR7Q 3PUZA 4JI0Q 4JV5L 4JYAQ 3CCMA 2IX1A 5C3EG 5AJ3L 2VL6A 4UFZA 2JK8A 4A3DH 1E24A 4OO1I 4BBSH 2XGTA 4P74A 5JJIA 4J15A 1EFWA 2K50A 2Y0SG 5IWAL 4DV7Q 4GOPC 4DR4Q 4JV5Q 2C35B 1OXVA 1MJEA 4OX9Q 4A3KH 1BKBA 1K3RA 4R4IA 4JI1L 3PGZA 4HJAA 1XPOA 4JI5L 1JJ2A 5M5YH 4PZ6A 3EIVA 2NZOA 1I6HH 1HNZQ 3G48A 3W1BA 2AHOB 4GNXC 3M3YH 2Z6KC 2K75A 1GVPA 1JJGA 2MQHA 4R1JA 3KYHC 1VQ8A 4IPDA 3FKIH 1K83H 1P8LA 2IT1A 3PCOB 4P75A 3M85A 2EQSA 1PH1A 2B63H 1DGSA 1D7QA 4BY1H 4A3GH 3RLOA 2I5HA 4BXXG 1XK5A 4ME3A 4OX9L 2JA6H 3BAAA 2CWPA 1A8VA 5IYCH 4QL5A 1K73C 1TWGH 3HFZB 4LUZA 1Q46A 1WCMH 4JC0A 1I3QH 4BY1G 4LFAQ 2BA1A 4IJLA 2UUBL 2UU9Q 2B63G 2JA7G 1KXLA 4NXNL 1YITA 3S2DH 2JQOA 1CUKA 3UE0A 3M4PA 4L5TA 2OQKA 3OTOQ 4EQ5A 4BY7H 4A3CH 5GROA 2KENA 1G51A 2K5NA 4YWKA 3CC7A 2E2IH 1SROA 1TXYA 2AWNA 1SN8A 1JE5A 2UUCL 1H95A 3ERSX 1EQQA 1HR0L 3AYHB 2YTYA 1X6OA 2VQFQ 1MJCA 5IE8A 1NE3A 4OO1G 5K36G 4A3LG 1EOVA 2E2HH 4LF7Q 1D8LA 1SR3A 1VQ4A 2DGYA 1CKNA 1W3SA 1PHJA 3HOZG 2UXDQ 4A3MH 5IWAQ 4DV7L 3H0GH 2UU9L 1VQFA 2WAQE 3G6EA 5C3EH 4A76A 3S2HH 3UQ8A 2IHEA 3I2ZA 3AEVA 3VDYA 1KRSA 1EQRA 1XJVA 4QGUA 1N34L 2JA5H 3S1QH 1HH2P 1L1OB 2EXDA 2UXDL 3BA8A 2E8GA 3G71A 1UE7A 1VQHA 3PO2H 1A62A 1I5FA 1VQAA 2YYZA 4X65Q 3S17H 4L5SA 3FP9A 4UCOA 3DM3A 1Q81C 4GLVB 5FJ8H 3HOVG 3HOUG 4C3IH 4A3BG 4PZ8A 4BBRH 3TS0A 2QA4A 2UUAL 1TWFH 1HR0W 4HJ5A 2R93G 4DV5L 1WCMG 1S68A 1UE5A 5GQOA 1M90C 4FDBA 1WJJA 5HY6A 4HIKA 4IFDI 3L0OA 5E7NA 4IFDG 3CCQA 4XTCS 4IOAA 3GTJH 4H02A 1SE8A 1VQLA 3D0FA 4OONA 2UUBQ 4LFAL 1S72A 3I4NG 3NBZB 1K8AC 1X55A 1C7YA 4CC5A 2IY5B 4A93H 1FJGL 1RIPA 1P16A 1XPUA 1VQ6A 4JBJA 4A3DG 1CSPA 3CCRA 1E7ZA 5GAGC 1L2FA 3BZKA 4DV4L 3T1HQ 3BU2A 2JE6I 2VUMH 1VQ9A 3CW2C 1QZHA 1X54A 4IPGA 3GTGH 1B7YB 1YEZA 1N36L 4DR2Q 1YJ9A 2PMZE 1PH9A 3K80C 1FGUA 4LF5L 1YBYA 4DR6L 2PI2A 2IHFA 3B6YA 3U4ZA 5C0XG 3RNUA 4DV1Q 4JBMA 4JI6Q 3STBC 1TWHH 3PIPA 4DAYB 2R92H 2XTIA 3JAMi 5LMUL 4GKJL 3IRBA 3GB8B 3PO2G 1VQMA 2MFIA 1BBWA 1YHQA 2Q2TA 5M3MH 5GAHC 3GTOH 1LYLA 4JCVE 2Q2HA 4B3ML 4Y7NH 4DUYQ 1Q12A 2NVXH 2BH2A 3S16H 2HIXA 3I4MH 4NXMQ 2KCTA 4KHZA 3PO3G 4BBRG 4JOIA 1IBKL 1IBLL 1EUJA 2CCZA 1N32Q 1JJCB 4A4IA 3PUYA 4JI8Q 2KHIA 5IYBG 2AKWB 4X64Q 2ZJRA 2YV5A 1C9OA 5IP7H 3EBEA 3CCVA 4JI6L 3PN1A 4YWMA 3OW2A 1HR0Q 2UUAQ 4BA2I 3HOXG 4C3JH 1EWIA 1GO3E 3AQQA 1Y1WH 3STBD 4KHPL 5IYBH 1QUQB 2YU9H 3ZJYC 2ZJQA 5D1OA 3MXNB 2YTXA 4YHHQ 4APVA 5BR8Q 2PQAB 4O0AA 4YWLA 4DRFA 5C44H 1YIJA 2PNHA 4A3BH 2A8VA 4LNQA 4NXML 1N32L 4UP9A 1PA6A 1K8GA 3ICEA 3F8TA 2UXCL 2RHSB 1Q1BA 3EN2A 4AQYL 5EAYA 4B3TL 5C4XG 4PZ7A 3KLWA 4HJ7A 2V1CC 5LMNL 3CAMA 2OCEA 1NBWA 1A0IA 2NVTH 4EFEA 2WB1G 2QEXA 2N3SA 2VQEQ 1OXXK 5J3BA 4JI2Q 2VUMG 1HNWQ 4YHHL 3S15H 2H5XA 5IYDH 1E1TA 4DV6Q 1WYDA 4LF4L 3H3VI 3S1MH 2I5LX 4X65L 1PH6A 4JI5Q 2R7DA 2QGQA 5IP9G 4L5RC 4A3LH 4GN3B 3W1GA 4R4TA 5IYCG 4A3MG 1XDNA 2UXBQ 3Q8DA 1I50H 3K7UC 1Y14B 5IYDG 3E9HA 4NPSA 3A5ZB 2GVAA 3PV0A 1IBKQ 1IBLQ 1W2BA 4LF9L 1EYGA 3T1YL 1N33L 4B3SQ 4JI7L 4X66L 1QVCA 2YTVA 1B70B 4LFCL 3NC0B 4XIGS 1KC8C 5ELOA 3AFQA 2ID0A 1YHAA 1RL2A 3RLNA 1Q8KA 3PIOA 1V1QA 2D0OA 4GLAC 1OXSC 4LF6L 1NY4A 4YCWA 1XNQQ 4P73A 3HOYH 3MEFA 4BY7G 4DV1L 4YCUA 5GAEC 4LF5Q 4EFBA 1V9PA 4DUZL 2OQ0A 3RLFA 3WWVA 3HOZH 2ES2A 2R7FA 1VS0A 3S24A 4DPGA 2IX0A 5DISC 2K5VA 1GKHA 4POFA 5LMNQ 1WI5A 4HIOA 4DUYL 4GNXA 4ALPA 4RMFA 2Z6KA 1PV4A 3KOJA 2ALYB 1VQJA 4A93G 4A3JH 4UCRA 4LWCA 3J80c 3CPWA 3RN5A 4DV3L 5D1PA 1X3GA 2RF4A 4DR1L 4WJ4A 2JA9A 1UWVA 3CCEA 1UE1A 2HIVA 2WP8J 5ELNA 3PO3H 3M7NA 4LUOA 1I94L 1HZCA 2BH8A 4DV6L 4IPHA 3RR5A 2HVSA 4KHPQ 2JA7H 4OWXB 3E0EA 5FLMH 1OXTA 2MO1A 5M5XH 1N9WA 5JEAJ 4BBSG 5FJ8G 3HOVH 1UE6A 2CQOA 3OTOL 1VQKA 1PVOA 3K0XA 2UUCQ 2GVBA 4DV3Q 4LFCQ 4DV0L 5M3FG 4DR1Q 3HOYG 1N33Q 4X6AH 1ASYA 4JI4Q 1QUQA 2ASBA 4QQBX 3JSNA 5D1OB 4PMWA 3GDEA 5C44G 1EIFA 3TREA 4IOCA 4X62Q 3PF5A 3BJUA 2PQAA 4IJHA 4LFBL 1TWCH 5LMUQ 2K4KA 4LUVA 4GKJQ 1NTGA 2L15A 3FKIG 3D31A 3SGIA 1HJPA 3NBHB 1CKMA 3J81i 2ZM6L 1S40A 2VNUD 1LUZA 3J80i 3CCUA 3U58A 4IPCA 2VQFL 4C2MH 1HZAA 1T9HA 1BBUA 3RN2A 4LF4Q 4POGA 2R6GA 3S14H 4IFDJ 4O2DA 4YY3Q 4LH7A 2VY3A 3S1NH 4UPAA 1AE2A 1QZGA 4UP7A 4A3JG 3CP0A 4DV4Q 3T1HL 4JI8L 2E2JH 2ZM6Q 4A3IG 3A0JA 4A3EG 4DAMA 1Q82C 3I7FA 4UY8C 2F4VQ 4A3CG 1VQDA 1YNXA 4AH6A 1YHBA 4X66Q 3J7ZC 1KIXA 1NMGA 4LF9Q 1XPRA 2A1AA 2MNAA 1VQOA 1N34Q 1VQIA 2BA0A 3A5UA 1SLJA 2KHJA 4DKAC 5IY0A 4JI7Q 4PG3A 1XMQL 1X3EA 1R9TH 4A3GG 2K5HA 1Q1EA 4QY7A 4DR7L 4P71A 2JA6G 4JI0L 3K8AA 3HOXH 2HT1A 2MO0A 2ZTCA 3L7ZC 3F2DA 2LXJA 5JEAG 3CCSA 3BZCA 2D0PA 1SRUA 1VQGA 2K52A 1M1KC 5JJKA 4DR3L 4JBKA 4LH6A 1KHIA 4HIMA 1JB7A 2WAQG 1VQPA 4JI2L 1TWAH 3E9IA 3CPFA 3I4OA 4GOPA 1HNWL 2VQEL 4KI0A 3KDFB 1VQNA 3M4OH 4DK3C 1XMQQ 3CC4A 3HKZE 1IBMQ 5M3MG 1O7IA 4X62L 2ZTDA 2JA8G 1FJGQ 2D62A 1KL9A 3ULPA 1TA8A 4R4QA 3K81C 3BA9A 3H3VH 1UEBA 2HHHQ 4DV2Q 1NMFA 1U0LA 5BR8L 2UXBL 3TY9A 4K0KL 3PUVA 4GNXB 4LF8Q 4A3EH 1TAEA 2NN6I 1ASZA 1VQEA 1N8RC 1E1OA 3M4QA 1MKHA 2JEBI 2HVQA 4OWTB 2I0QA 4NB3A 3CMEA 2PI2E 1GD7A 1YJNA 1HNXL 1I94Q 2B3GA 1A63A
chains in the Genus database with same CATH superfamily
5KFGA 2EYPA 2V4RA 4GLXA 3GTOA 1ZHSA 4KLKA 4EGQA 4BXXH 4JI3Q 1AH9A 4LW1A 2F03A 1LM0A 3A56A 1DONA 3LQSA 1C0AA 2EXZA 2QEJC 4C3HB 4DXFA 1ULZA 3V6JA 4FXKC 3MJFA 2NN6G 2K05A 4YY3H 1Y69U 4OIKA 4GKKL 4K6LA 1RD9D 2HQLA 4B3SH 3EFXD 1N33H 1STYA 1YNND 2EY2A 2K5DA 3OMCA 3DLLA 1PXUA 3CEBA 3PSIA 2K5QA 4L8JA 2HUGA 2ZJTA 4LMQD 1I50B 3I4MG 1CHPD 3UDFA 3OHBA 3RGXA 3KLSX 3N41B 1JX4A 1B9NA 2XWBB 3GTQH 1DOLA 3OWEB 5AFWA 3H0GG 1EY8A 1PRTF 4RH6A 1E4FT 4B3TQ 1JDBB 4B3RQ 4MV9A 3KJOA 4MV6A 2AQ4A 1NSNS 2O2LD 2WDTA 5FO8B 4ECWA 1JT8A 2Q8IB 3NE5B 4FYDA 1B8AA 3X3MA 1ZYRC 2F4VH 3JAMc 3NBYB 4X66H 2PNRC 3UDGA 2N55A 3T5HA 2ZXRA 4C3HH 4R8NA 1IXRA 3KF6A 1YZ6A 2R7NA 4DK6C 1Y1VG 3DM1A 5NUCA 2EIFA 2Q2UA 4OXPA 5D3IB 4M0JA 4IR1A 2SCUB 4DR4L 4NW2A 1XNRL 3K7AH 1FYCA 2KQ3A 4KKTA 1GM5A 2OTLA 4HYKA 5IGFA 1X3QA 4ZQIA 3TSSA 1JLLB 1G291 1I4HA 4R4CA 4HJ8A 2BE5D 1EUDB 1J5EQ 1E2ZA 1EIGA 1I4GA 1PFSA 2IPKD 2OLSA 4IO9A 1JORA 4QWCA 1QNUA 3T5LA 3H91A 3E5SA 4JI1H 4P2CB 5I9PA 3HKSA 5LOVF 3GIJA 1SNMA 5HGQA 3GTLH 2EPBA 5DLGA 2B63B 1SSOA 2EYHA 1LV9A 1V51A 1RYRA 4IALA 4NXNQ 1A3TA 4DF7A 5KG4A 3Q6SA 4JW0A 4B3SL 2BOSA 2NB0A 1E4EB 4K2LA 4A3FH 4L5QA 3TQYA 2XIWA 3WDNA 3V4SA 2RQXA 4HIDA 1BCPC 2YZNA 1CKOA 5CV4A 3NUCA 5KFEA 2ZXPA 2CWAA 2CW8A 2R84A 2UXDH 1BXRA 2C5CA 1IKMA 3ONAB 4RB0A 3I91A 4BBSB 2N8NA 4P72A 1AE3A 2R93B 4RKBA 3NGDA 1SYGA 3L4KA 3BYYB 3EROA 1WFQA 3F2CA 1GHJA 2C9OA 1UC8A 1L1OA 3PIP3 4G7HC 3TIGA 2ATWA 2M2LA 3W5OA 1DAAA 4R7RA 1KT8A 2R92G 2DZDA 1L0WA 5A35A 3I55A 1FGBD 4JI6H 5EJWA 4CJ0B 1PH7A 1I94H 1OTCA 4O7ZA 5FLMG 5FPRA 3OSNA 3HKZG 3NUAA 1Y8NB 1S5CD 4UCUA 4KY6A 1BCPB 2B8GA 2NTTA 1CZGA 3HOZB 4JI3H 4YCVA 1G2SA 4ZRZA 2F0WA 4UCTA 4QWAA 3PW7A 2V4QA 1AN7A 2CKZB 1U4RA 3KBGA 3RIZA 5JOBA 4BY7B 3HB9A 2JEFA 4DR6Q 4EBEA 1JKJB 4LF6Q 3PF4A 1IZ6A 5KT5A 4JV5L 3T5JA 2PVPA 1TWAB 2BDNA 5C3EG 4TUYF 4ED0A 3D4RA 4UFZA 1IL8A 3P7JA 4OO1I 4BBSH 1DZ1A 5JJIA 1OWTA 1KAAA 2MPMA 4DV7Q 4XZ3B 1I4XA 2C35B 4NDXA 1BKBA 2IX3A 1GJXA 3PGZA 1XPOA 1IYDA 5L9XA 2XIGA 3G48A 2JA5A 1CQIB 3M3YH 1VQ8A 4RU9A 2VA3A 1T94A 4IPDA 5E1FA 1EY0A 1FKAH 3M85A 1PH1A 3C46A 1D5ZC 4BY1H 2W71A 4X3KA 2XGPA 4BXXG 1V1PB 2FP4B 4ME3A 1NNXA 2JA6H 1A8VA 4QL5A 4V0BA 1XTCD 5JPMC 1K73C 4LUZA 3VMMA 1S0MA 1S10A 3LWBA 5EWGA 1UUPA 1KXLA 2UUBL 2BA1A 3T9FA 4H0LC 5D14A 1D6EC 4HTHA 3UE0A 3OTOQ 1VMPA 4L5TA 4BY7H 1HUMA 4A3CH 2VR1A 4O82A 1ILQA 3M7GA 3MWEA 3C1FA 1SN8A 4ECZA 2B2UA 3ERSX 2SOBA 5BWWA 4O2BF 1NE3A 4ULLA 4DK0A 5K36G 3HOWB 1SR3A 2DGYA 1XXGA 2I07B 4DV7L 3H0GH 4MN3A 1VQFA 2UU9L 1CT1D 4O7NA 5BWRA 1E0BA 2Q8TA 2RBMA 5BR8H 3VDYA 5KFLA 4KKUA 3PFFA 2JA5H 4DK1A 3BQ0A 1L0YB 1UE7A 3T1YH 2XNAC 3PO2B 1A62A 2JA7A 3BDLA 4L5SA 3FP9A 5E25A 2FMCA 1Q81C 3RV4A 5FD6A 5EDWA 2PZUA 4DR6H 3S16B 4AYBA 1IOVA 1C30A 4BBRH 4RKLA 2UUAL 1HR0W 4U7CA 1WCMG 2COGA 5C8YF 5DGBA 1RJTA 1KDBA 4CDFC 3DWAA 3OIPA 4HEDA 4KN4C 5EBDA 1JWMD 4XYOA 4IOAA 3N42B 2KCNA 4A3DB 2CZGA 4OONA 1EYAA 3CRKC 4FFNA 5CV8A 3NBZB 5IIFA 1K8AC 3CKIB 4KN7C 4A93H 2CW0D 1SAPA 1XPUA 1VQ6A 4A3DG 5C3WA 5DQHA 1L2FA 2VUMH 1QG7A 4J6HA 4O42A 1O75A 2R3ZA 1GUGA 1QZHA 1R9TB 3GTGH 3D3RA 2D2CC 5KG3A 5EWEA 1KDCA 2NVYB 2ASJA 1N36L 2FINB 2R8GA 2PMZE 3K80C 4ZYSA 1YBYA 5I47A 1I6HB 3KAKA 4X62H 4JBMA 4JI6Q 4MV4A 4O4IF 3GV6A 5T1GA 4O7YA 1M0TA 4QUFA 3BG3A 1PRTB 2L12A 5LMUL 3IRBA 4GKJL 1XMOH 3PO2G 2YRXA 2D5DA 3VR5A 2YU9A 4K0KH 2Q2HA 3S16H 3GB8B 3I4MH 2ICEC 2SNMA 1GSHA 3RUZA 4JOIA 2CCZA 1NR4A 2AUJD 2RDFA 1WTWA 1N32Q 5C3XA 2KHIA 2AKWB 5DQIA 5KG6A 2LS01 3KHHA 1K28A 3EBEA 3PN1A 4BA2I 4OO1H 4C3JH 5DG9A 1EWIA 1GO3E 1GGOA 1A15A 1KTKA 3ZJYC 2EJ0A 2A6EC 2R8IA 2DY8A 3KXYT 4Q4DA 5I2XA 4KHPH 4HMJA 4NXML 1PA6A 2VB3X 1M4VA 3F8TA 1BBXC 4AQYL 3PMFA 3DF7A 3OHAA 2W9BA 4HJ7A 2CHBD 3SK4A 2V1CC 5LMNL 2FFKB 1NBWA 1A0IA 3QOLA 2QEXA 4ZUJA 5BPFA 4O3NA 1SE4A 1EYZA 2B2TC 1XMQH 1HNWQ 3SK8A 4YHHL 2H5XA 3QR8A 1B53A 2L5TA 3M4OB 1E1TA 4DV6Q 1WYDA 4LF4L 5KG2A 4WBNF 2A68D 4ZKBB 3H4BA 4X65L 1SYDA 2QGQA 4HR7B 4A3LH 3ETJA 5IYCG 4K5WA 1TWFB 4X3SA 3E9HA 4C2MB 1O7ZA 1W2BA 1EYGA 2J9GA 4KK7A 4B3SQ 4X66L 3SI8A 4KJNA 4DR2H 1PYWD 5ELOA 2ID0A 1CS0A 3UI2A 1RJRA 1YHAA 1SFOA 3I4LA 1Q8KA 1OXSC 1F2LA 4BY7G 1Z2NX 2ES2A 2R7LA 5BMVF 2F0UA 2R7FA 3BQ2A 1TS4A 1CA5A 3T54A 2UXCH 2JEGA 2UVUA 3VA5A 3GTMA 1STBA 2K5VA 1TIID 2K33A 3TW7A 1S4ZA 5LMNQ 2CQYA 2I46A 4HIOA 4EQNA 4QMGA 1VQJA 4A93G 4UCRA 3VOTA 3CPWA 4GKKH 1X3GA 4WJ4A 3WWJA 1B1ZA 3JZ6A 2XRSD 3A8KE 3PO3H 5ELNA 4LUOA 4IUQA 3HOUB 1K1QA 5KT4A 4OWXB 3E0EA 2XN9C 2WAQB 1N9WA 4MTKA 4BBSG 3KTMA 1EFID 4DV0H 1EZ8A 4PMBA 4ZLTF 1UE6A 2XCAA 4F4YA 2XGQA 5I5TA 5DQGA 3K0XA 2GVBA 4HSPA 3UZBA 3J7AV 4DR3H 3U0GA 4DR1Q 1B4OA 2W57A 3LP8A 1N33Q 1B50A 2DY7A 1ASYA 1JQYD 3KK7A 1JWSD 4G7ZC 4JV1A 4JPBW 1DJRD 3JSNA 4C5CA 1KLUD 3J80W 4J9PA 3HS0C 2W6MA 2PQAA 2DPJA 4ZAIA 2Z04A 2K4KA 1QWYA 4DL5A 3FKIG 3D31A 4I65A 3M9OB 1AZPA 4CMDA 3J80i 1N56A 3K0YA 1TT2A 4IPCA 1WTHA 3NSWA 4LF4Q 3RN2A 2R6GA 4LH7A 3GILA 2F0LA 4A3JG 4G7OC 4DV4Q 1RODA 4WD3A 4A3EG 4IFDH 1N36H 2NVYA 5FLXW 4UHVA 4UY8C 4A3CG 3J7ZC 4AH6A 1HNXH 5KFSA 3CU7A 4FFRA 1VQIA 4A3MB 5C44B 1XMQL 1X3EA 1R9TH 3GTGB 4A3GG 2HGSA 2C22A 4DR7L 4P71A 4YHHH 2JA6G 5J1ZA 3HOYB 3HOXH 2J0TD 3GV5B 3BYTB 4NXNH 2LXJA 4KY5A 2AGOA 5BN4A 1ICFB 4O83A 4JBKA 4X64H 1OBDA 4HIMA 4KD4A 5KS8A 3I4OA 3CPFA 4Q0YA 4O84A 3FMCA 3MWDA 1KDAA 2Y0SB 1HNWH 1IBMQ 3V2TA 1AP0A 5IT9E 4QIWB 5KX5F 2ZTDA 3BDCA 3ULPA 5BWTA 4CKBA 1I4PA 5KIXA 1RHPA 3H0GB 2AUKA 4KV6A 4MTDA 5BR8L 4GNXB 4LF8Q 2RDIA 1N8RC 4N9PA 1E1OA 1MKHA 3M4QA 3SNOA 4EG0A 3IFDA 1EHIA 3GJXB 3MVVA 1I94Q 4OEMB 4JOIC 1DM0B 3UDIA 1V1OA 1G8ZD 4DNIA 1Z2PX 1CSQA 4UCSA 1EU4A 3TINA 2ODTX 1IOWA 2YZGA 2LXKA 1PTOH 4RG1A 2ZDGA 4YAJB 1JIHA 3R2IA 2WTFA 4FO2A 4ED7A 5IGDA 2R7ZH 4EYHB 3TEHB 1MHWC 5DLQE 3J81L 4MA5A 2E5LQ 1VMCA 4DNTB 3OOCA 2NVQH 2FE3A 1H9SA 1JMCA 2R8HA 1PH4A 1EOTA 1MZBA 3G4SA 3TZDA 1N36Q 3S14B 1CQJB 1UAPA 5JJLA 2A19A 4DL4A 1B04A 1VDZA 2L55A 5C5LA 4PNYA 1GLVA 1KJ8A 2F3WA 2NU6B 3T9AA 3ULLA 5M3FH 1A6XA 2WB1B 2UXCQ 3NPPA 3RB6A 4AYBG 3F2BA 3CSWA 3H15A 2F4VL 4EX5A 2JA5G 3TQ1A 2DUDA 2N78A 2NVYH 4DV0Q 2MCTA 4IRCA 5EQ0A 4ME5A 2WKCA 3AU7A 5I60A 2RHQB 2K28A 1H9RA 1IYJB 3R5FA 1PYSB 3IKJA 2VZAA 1WTVA 4LFCH 2I8CA 2PQEA 4DR2L 5EKKA 1TWAA 3MAQA 2UU9H 2A6HC 2QKIC 4TQUS 2R82A 5BYAA 1J6QA 4EEQA 3TBIB 5I5WA 5KT7A 2BQ3A 4WJ3M 2XSCA 5FO9B 1PH2A 4HJ9A 2YCHA 2E5LL 3WOEA 1TWCB 2F52A 3E5NA 1TWGB 1LO5D 1CFMA 1FL0A 4BBRB 1ILPA 1TY0A 4AQYQ 3PUXA 3KFUA 5DNFA 3GQCA 4FM9A 2ENBA 3HZXA 2NZHA 5KNDA 3BVZA 4QW9A 4CJ2C 4LF7L 2HVRA 1F9QA 3T5KA 3GTPH 3L9AX 5FLXc 5JVG3 4DUZQ 3T4AC 1E22A 4CC6A 5IT9L 3G8DA 1SFOH 2R92A 4ETSA 1E3PA 1PDQA 1S3OA 4Z9CB 3ZYYX 2AWOA 3V05A 3IFTA 4Q5VA 2YYAA 4RUCA 2JN4A 4GS3A 1SCUB 2RCNA 4A75A 1KEEA 2PW7A 5LP6F 5IP9H 1RKNA 1EIYB 5C0XI 4KKSA 3GTOB 3ER0A 1OXUA 1LACA 2G9HD 2HGWA 1YI2A 2JP1A 3I4NB 2HJWA 2I80A 5LMNW 4M8AA 2IMWP 1YJWA 5H80A 4JI7H 4IZ8A 5JJZA 1G6PA 2M05A 3CF5A 4E4TA 4FFMA 4F50A 4OGQC 4R4OA 2R93H 5BWUA 1Z2OX 2W9CA 2FMAA 3NELA 5C4XH 4A3BB 4K0KQ 1WR2A 1HZ9A 3DHQA 4XT3B 4RZRA 3U4VA 4B3TH 5H1SE 3J81E 1QVFA 3TMEA 4Q8EA 2HQEA 1A2TA 4J9NA 3FPUB 2JJQA 2Z0SA 1M8AA 5GADC 4UDUC 1QILA 2A74C 2TMPA 3AFPA 1FVIA 3A7LA 4BA1I 1RTNA 1VQBA 3NENA 5C0XJ 1JDEA 2A69D 4C3IG 1XMOQ 3CC2A 2BDOA 1HHVA 4I4TF 3HKZA 3K7AB 1NJIC 4C3IB 4NXMH 4AIMA 1XNRH 3RMHA 1KRTA 1TR5A 3J81j 2QW7A 3M9BA 1SMXA 3F8NA 3HOUH 1V43A 3I4NH 2XCLA 4CKEA 4LJZC 3PUZA 3Q22A 4JI0Q 4RB1A 2C2RA 5JEAH 2IX1A 2VL6A 3H20A 1MI2A 2JK8A 4FP5D 4HN7A 4HMIA 3VPDA 2VQEH 1WH2A 2VOBA 4P74A 4O7SA 4J15A 2K7VA 4EGVA 4XDXA 4OX9Q 3DTFA 4DUZH 4ID6A 3QZ8A 2JA6A 3CHBD 2NBFA 2X5RA 4PZ6A 2NZOA 3EIVA 1HNZQ 1TS5A 2AHOB 4IAJA 3RZDB 4R1JA 1CHQD 3OPOA 3FKIH 3PCOB 1AUXA 2B63H 1D7QA 3RLOA 4KY7A 2O5JC 2IP4A 3VR4A 5C4ZA 1HTLD 4EBCA 2EJ3A 1PK8A 2CWPA 5CMDA 2W6QA 5IYCH 3NXWA 5KFBA 1K8OA 1TWGH 3HFZB 1A48A 1Q46A 2R8KA 1O78A 4JVZA 1I3QH 4HR7A 5LL6X 4I55F 3U55A 1CUKA 4K14A 5EBCA 4F4ZA 2KENA 1F2YA 2WB1A 1G51A 2GA4B 2K5NA 2DABA 4JK1C 4YWKA 3CC7A 3QFFA 1F77A 1E4EA 4CE5A 1AUVA 2X6LA 5JPNC 3HOXB 1TS3A 4TQSA 4ED2A 2FLLA 4OO1G 2FLPA 2E2HH 2W9BB 2F0MA 1ML0D 4NMZA 1CKNA 3JAME 3SE0A 5IOCA 1F9PA 1SDFA 1VBGA 3S2HH 1GUNA 1ZYRD 5FLXL 3UQ8A 1JXLA 2IHEA 1SE3A 4ME6A 4TKOB 4N8X1 4HAEA 5J22A 3S1QH 2UVRA 3QO2A 1PRTD 2KSWA 1L1OB 2UXDL 3G71A 3FEWX 1MSGA 3PO2H 1I5FA 3EJIA 2NYZD 5KFAA 1VQAA 2F0NA 2YYZA 2LKVA 4ILWA 1QB5D 5CBAE 4X65Q 3R5XA 1T36A 3DM3A 3GIKA 3H94A 4A3BG 1X32A 4PZ8A 3TS0A 2EJMA 3DXJC 4HJ5A 4DV5L 1UE5A 4CDDC 2MUYA 4FDBA 1I2LA 5HY6A 4IFDI 3L0OA 2EYOA 5I5SA 4XTCS 1C3OA 4RNOA 2LY7A 5ELFA 1CE8A 2UUBQ 3I4NG 4ECUA 3VPCA 1SYCA 1WTPA 3TP6A 1CA6A 1J8IA 3CQZA 1RIPA 4G57A 1ZETA 4JBJA 2F4IA 1CSPA 4EYIB 1S9FA 1CZWA 3BG5A 3T1HQ 3K3PA 2JE6I 1TS2A 1VQ9A 3CW2C 3GTMB 3RB0A 1BUVT 3AB9A 1SYEA 3Q24A 1YEZA 4OIJA 1YJ9A 3TP7A 1FGUA 4LF5L 1H9KA 2YS7A 1PTOB 2NN6H 5C0XG 4I50F 4YJ3F 3GIMA 2YW2A 3PIPA 3LWUA 3P20A 4DAYB 4BWSC 2XTIA 1K3BC 2B2WA 4DL3A 3N6XA 1K83B 1HNZH 4XXEA 1PFMA 1VQMA 2Q2TA 3C3LA 5M3MH 3GTOH 1N48A 4JCVE 4H44C 4YIJA 3T56B 4B3ML 1H9MA 4DUYQ 4JV0A 1L0XB 4MV1A 3KHLA 2HIXA 3PO3G 4C3JG 1WSCA 4BBRG 2XRQD 1IBKL 4MV3A 2KECA 2ZM6H 2IBKA 3TQTA 4J9OA 1Z6HA 2R85A 2EY1A 1C9OA 5IP7H 4YWMA 4F87A 4WJWA 3OW2A 2UUAQ 3N8DA 1KJIA 3E0JA 3STBD 1AN8A 3W3AA 2FKLA 2YU9H 4S3SA 1PMRA 2YTXA 2R6FA 3JAMW 5CV7A 4APVA 2K03A 2W8KA 3OWFA 4YWLA 4DRFA 1YIJA 2PNHA 4A3BH 1N32L 5C4XB 3F2UA 5BN3A 5IT9W 1K8GA 2HDKA 2JA7B 3HP3A 3T51B 4DR7H 2JA5B 2Q7DA 4ED1A 4RHSA 4AYBB 2NVTH 1KNAA 4EFEA 4K5VA 2WB1G 2J6UA 1KNEA 1E2VA 5J3BA 2VUMG 1W93A 4CKCA 3Q23A 3S15H 4IZOA 4YR0A 5C4HA 1V1PA 3NWSA 3H0GA 3S1MH 4ZI7F 5HV6A 2I5LX 2JA6B 4L5RC 5I4DA 3W1GA 5I5XA 4R4TA 1EKFA 1SMYD 4A3MG 3V4ZA 2NVXA 1IW7C 2L11A 4FF4A 1IBKQ 3T9CA 2GVAA 2AQ3B 3KALA 4RNMA 2H4OA 4LF9L 3H4DA 3T1YL 4A3EB 1B70B 4LFCL 5DGIA 2EE1A 4GC6A 4PQXA 4XQNA 1H95A 1RL2A 4B9WA 4DR6L 1I1LA 1V1QA 2D0OA 4LF6L 5CB4F 1ZKOA 1XNQQ 3TIIA 2NUAB 3RZOB 1EZ1A 3K5MA 1PTOF 1Z7TA 1TKWB 5KNBA 5GAEC 4LF5Q 1V9PA 2YZLA 4DIMA 2Y0SA 3WO0A 3HOZH 3J7AF 3R5HA 3EQLC 2E5LH 3GV8B 2AQ1B 4RFBA 2EOTA 4CHTB 3T9DA 2IX0A 5DEHA 4DAVA 3K59A 3MR2A 1S0OA 1SNQA 4LF8H 4DUYL 1PV4A 4JI8H 3KOJA 3DWQA 3GV3A 5KFIA 3J80c 3RN5A 1RK5A 1CK1A 3MZ5A 1F2ZA 2WP8J 3PR4A 1I94L 5IGCA 4FF1A 2BH8A 4DV6L 4IPHA 3I12A 2M9VA 2NU8B 4FU0A 3QQMA 1ESFA 2HVSA 2ABJA 5FLMH 1OXTA 1I6UA 4QF4A 4J1MA 5KFDA 3HOVH 3RD4A 3OTOL 1PVOA 5EOYA 4TQRA 4A93B 4UUGA 4LFCQ 4FE2A 4FFLA 2CH4W 3HOYG 2E2HB 3R8BA 2GPSA 2FK1A 4ECXA 2WINB 2V58A 2AU0A 4IR9A 2PCFB 4JI4Q 1A9XA 4QQBX 1R9TA 2DJGC 2A6ED 5C44G 3GDEA 1EIFA 3S2HB 4IOCA 4X62Q 5KFNA 1WTXA 1EY9A 2W6PA 4LFBL 1NTGA 3J81i 2VNUD 4O3RA 1EWHA 2L9HA 3CCUA 1YNJC 2EY6A 2F0JA 2OF1A 3BZDB 3U58A 4C2MH 1HZAA 1BNCA 1XX8A 4O81A 1TWFA 3GV7B 4A3JB 5A2QW 2H1EA 4G3IA 4O2DA 4YY3Q 2EYFA 3GTLA 3S1NH 1QZGA 1EQVA 4JI8L 2ZM6Q 4FF3A 3A0JA 3T13A 4KTAA 4TV8F 5CE8A 2F4VQ 4RAZA 1YNXA 3FKIB 1FNUA 4LF9Q 1IKLA 5KNCA 2PMZA 2BA0A 4UAIA 1PZID 3A5UA 2KHJA 4HNUA 5E4XA 1XNQH 3UYYA 2OEOA 2K5HA 4ECSA 2NVTB 1ONLA 3K5HA 4PWQA 1EY5A 2PPBC 2A73B 1WD0A 4B3MH 2ZTCA 3L7ZC 5JEAG 3BDOA 1D2BA 1SRUA 1M1KC 2VXWA 2EVBA 2CNVA 3S1MB 4LH6A 1KHIA 2Z8LA 2WAQG 5T1IA 1VQPA 4JI2L 2E74C 3NQTA 4KI0A 2VQEL 3M4OH 1HR0H 1DIKA 1SJED 2F3VA 2VB2X 4O3OA 2PBZA 1I3QB 3Q8RB 3U9OA 5KFOA 1XMQQ 4JI2H 1O7IA 2QDBA 4X62L 2G5DA 2BR0A 3TW6A 3K57A 1UEBA 3BVMA 1SE2A 4DV2Q 5J39A 3VPBA 3HGBA 5F2DA 1E4GT 1U0LA 2J6TA 4K0KL 3PUVA 5CGKA 4FGRA 4YAKB 1EKVA 4TV9F 1KBLA 2OT2A 4NLGA 1ICWA 3MA2B 2NN6I 5I9OA 1HA5A 3KAJA 1IBLH 3OHXC 2I0QA 4K8IA 1LT6D 2EY5A 3A54A 1C48A 1GD7A 4HCEA 1SNDA 5BN5A 1O7LA 1A63A 1VCIA 3MC0B 1VQ5A 4RAUC 3GTQB 2COJA 4JBWA 1PH8A 4JI1Q 2QILA 4A3FG 5FKAC 3A74A 3ULJA 2WAQA 1AFPA 4JI5H 3RZDH 4QB4A 5KFHA 3J80L 4RUAA 1ZXTA 4BWGB 3TS2A 3K5OA 3BACA 1SXTA 1JOOA 2R7ZA 4JI3L 4TRDA 3NTKA 2W9CB 2EDGA 2K6AA 3KHRA 2RGRA 1L1OC 4DV3H 2FPPB 4BS9A 4GN5A 1FNWA 2V59A 1VQ7A 4A3KG 5LMNH 5A2QE 5F9NA 4YY3L 1U4PA 2XC9A 1ZEQX 2W7OA 4GKKQ 3SK5A 3ITPA 4LF5H 3GD7A 4LK1C 3LMLA 2C2EA 4MNOA 5KFUA 1M7JA 1SMYC 1WTQA 4B3MQ 3WWIA 3T9BA 4O7WA 1XNRQ 1GXDC 5DM63 2VPQA 1LTLA 2JEIA 2L1BA 3NWTA 2F3IA 1Y8PB 2GQRA 1S03G 1X56A 4L6TB 2VQFH 1X65A 3TP5A 2VQDA 4DR3Q 1QOHA 1BVSA 5IYZF 3KBXA 4FFOA 3RFCA 3C0FB 4AYBE 1W96A 4H13C 4QIWA 2UVWA 3M9NB 5C6AA 2N49A 3DUZA 3GTJB 4FXDA 4OX9H 2JA8H 3J81c 2JYOA 5IP7G 5CBEE 2V4DA 3TRZA 4RGMA 5EPKA 3T1YQ 1PH5A 3LNNA 3KUPA 3OMGA 3QWUA 1KAWA 4C5BA 4RGOS 2IJ0A 4FBTA 3MWYW 3KDFA 4JI0H 3PIO3 3HOWG 3U50C 3O13A 3QOJA 3RTXA 4JI4H 2Z02A 3E6ZX 3HG9A 4YBZB 1K9MC 4J9QA 4FBUA 4QWBA 1WVLA 3K58A 1RCVD 2HDLA 2LSSA 2VUGA 1HNZL 1IL2A 3RAXA 1QNKA 4X64L 2PN1A 3F1ZA 3GLKA 1TWHB 3BJYA 2VPSA 4ZK9B 5HNEA 1HA6A 2Y0SE 2B2UC 4PV1C 3CMAA 3T1HH 3OW7A 4DNRB 1KD1C 1GUWA 3UE1A 1YVCA 1X3FA 3P1HA 4IUVA 1HZBA 2R7ZG 2NVQB 2WFWA 2A1HA 4DAAA 3FKIA 1Z9FA 1HQMC 2KCMA 3CD6A 1T5EA 3J7A5 1RDPD 2OXPA 3CCJA 2B2VA 1WCMB 4XT1B 3LGJA 1X9NA 3KF8B 3TY8A 1FNVA 2WKDA 2ZGIA 4DUYH 1H9SB 1WRVA 2F0KA 3OUUA 4E6NA 2HD3A 5EGTA 4O4JF 3A8JE 5KKNB 4YQWA 3PW2A 5EPJA 5C3EB 4QCLA 3S1RH 1BQQT 2JSOA 4EQPA 2PYKA 4GOPB 4DAYA 4DQNA 2EJGC 4A3FB 2YL2A 4J0MA 3ERQA 1WTRA 4JYAL 2FK3A 4DR5H 5M5WH 2G9DA 3VNNA 4ECYA 5KFZA 1KJQA 1Q8IA 5T14A 2BE5C 1Q7YC 1HUNA 3CQZH 3NQIA 3C2PA 3Q0AA 2HGXA 3J7YW 4KJOA 5C0XH 4QIWE 1B9MA 2Z4HA 5KFVA 4C1NK 1PH3A 1EYCA 4DR7Q 1JE4A 4IUNA 3DAAA 1HTPA 4X3TA 2AQ2B 1O7YA 1U4LA 5AJ3L 5KFYA 1S97A 3D4DA 1E24A 2ZDHA 3FPPA 3K6OA 5CAEB 3HT5A 5L1IA 5IWAL 3U54A 5CV5A 4WORA 4GOPC 4JV5Q 4RGTA 3K5NA 1EY6A 4A3KH 5E4WC 1K3RA 4R4IA 4HJAA 3J81W 3GIDA 2O4XA 4JI5L 1XYIA 2CNQA 2ZDQA 4J9SA 1TWGA 3DWPA 1B3QA 1I6HH 3PW4A 3W1BA 1Y1WA 1BCPF 2F0OA 4NP5A 2Z6KC 1K83A 1DOMA 2K75A 1JJGA 3IL8A 3N6RA 2UXBH 3KYHC 2RKSA 3VA7A 1KLGD 4A3GH 1LTGD 2I5HA 5L1JA 4OX9L 1SNPA 3BAAA 1G6ZA 2COIA 3OSPA 1STAA 1JCKB 1TQOA 4J9KA 2UU9Q 4LFAQ 4IJLA 2B63G 3I8ZA 2MHVA 5K2MA 2OQKA 4EQ5A 3R3OA 2W6NA 5GROA 4CMFA 2RVLA 3PW5A 2E2IH 1SROA 5DAUA 2AWNA 1JE5A 3GIIA 1PTOD 1HR0L 1L2ZA 1TWCA 3AYHB 2YTYA 4RCNA 2VQFQ 1M6VA 4F7XA 5A2QL 4A3LG 1D8LA 2I87A 1VQ4A 5C4JB 1N34H 1IHZA 1W3SA 1PHJA 4KMUC 3HOZG 1EKPA 2DPIA 5IWAQ 4MHEA 4A76A 2WAQE 3G6EA 5C5JA 1IW7D 4PMCA 3HKZB 3HEJA 3LULA 3C1EA 4ECQA 3H09A 3R23A 4DV6H 3GTJA 1ENAA 3KLSA 1D1KA 4IWXA 4RNNA 5G3LD 4J9LA 2EXDA 3GTPB 1R4QB 3LX0A 2R92B 4ED8A 3G6VA 3SVMA 3GQBA 4AQYH 1O80A 4UCOA 2QDLA 5JAVA 1HPCA 5FJ8H 1ENFA 1A3VA 2NVXB 4C3IH 3AMUA 1Q3LA 4LMYA 1Q90A 3KHGA 1TWFH 4WFN3 2R93G 5JUMA 1RK6A 2KCCA 1S68A 3K3VA 5I5UA 2HHFB 1WJJA 2CVRA 1SJHD 1SEBD 4MV7A 3RF2A 1MD2D 5DG8A 3CCQA 4YR3A 1A2UA 1R4PB 4YB8B 3GTJH 4H02A 3Q1KA 1VQLA 2FB9A 3JRWA 4F4WA 1X55A 1C7YA 4MAMA 2W7PA 5CYUA 4CC5A 1UEAB 1FJGL 2ASLA 1P16A 2EJ2A 5HURA 2P5ZX 4YJ2F 5L37A 3I70A 1EIHA 3BZKA 4JYAH 3BU2A 1HXYD 3FVQA 1X54A 2CW7A 2Y4RA 2F0FA 4I7AA 1B7YB 4DXGA 4DR2Q 1PH9A 4EBDA 5COYA 3U9SA 1CTMA 4DV7H 2IHFA 1STNA 4FS1A 4EVOA 1TWHH 4ECRA 3RB4A 4DL6A 3NBHA 5KFJA 1K0SA 5FO7B 2R92H 3I3CA 3JAMi 4XYMB 3ND9A 1YHQA 1WCMA 5GAHC 3OTOH 2R93A 1I6VC 3GIPA 2J7ZA 2BH2A 2NVXH 1TU2B 2X69A 2KCTA 4KHZA 4NXMQ 2YRWA 4OELB 2VUMA 1DV2A 1EUJA 1JJCB 3FRPB 4JI8Q 4O2AF 5IYBG 1T5XD 2EYJA 4I7ZC 2PMZB 4MV8A 3HXLA 2L4NA 2YV5A 5LL6b 1EY7A 1Y1VB 1F2MA 3TEKA 4JI6L 1BJTA 1HR0Q 4ZOLF 3MR6A 2K1BA 2ATLA 1MBYA 3EPGA 5KYIA 1LTID 2ZJQA 1RJPA 3MXNB 2WIIB 5BR8Q 2E2IA 4IRDA 5FK9C 4O0AA 3JRXA 3PVXA 3QG1A 5D3DA 1RYSA 2A8VA 4LNQA 3ETHA 3TN2A 1S5BD 4UP9A 1VBHA 5JVDF 2VA2A 5KRUA 2RHSB 3D4WA 3EN2A 4B3TL 5C4XG 2KHSA 3KLWA 1AW7A 3CAMA 1I1MA 1BR9A 2A6HD 4RB3C 2N3SA 3GP7A 2VQEQ 5KFXA 1OXXK 3M9MB 2UUCH 2FMMA 3HBLA 4H7BA 1SNCA 1ZAUA 4R8UB 1HFNA 4IUTA 5IYDH 2KVMA 3I4MB 4ZQ3A 4DN4M 1PH6A 4HSVA 1PRTC 3DMUA 5IP9G 4ED6A 4GN3B 2BQRA 5KFMA 1XDNA 2IW3A 2QF7A 4DAPA 4X65H 3PO3B 2A5HA 3K7UC 5I2YA 1CQFA 1QVCA 2YTVA 4A3IB 4K2KA 4C3HG 3NC0B 3IG0A 1KC8C 1UC9A 2RCFA 3AFQA 3D6CA 1J9OA 3PIOA 4GLAC 1NY4A 4YCWA 4P73A 2GPWA 4DR1H 1IBMH 3UZOA 4DV1L 4YCUA 4EFBA 3FDSA 3G6JB 3EPIA 3WWVA 3PW0A 1GUTA 5EKLA 2ASDA 3S24A 3NTIA 2HDMA 1TVXA 3S1QB 4POFA 4G4KA 1MGSA 3GTKA 4LWCA 3N52A 1B44D 4DV3L 1FR3A 4HQ6A 3VYRA 5D1PA 4J8QA 2RF4A 2HCIA 5ISRA 2NWGA 2JA8B 2JA9A 2O03A 1UWVA 5DGHA 2IWHA 1FJGH 1BDOA 2QCPX 4F8MA 1UE1A 3CCEA 4O7TA 3M7NA 4RA8A 2JA7H 1LT4D 5M5XB 5KG0A 2MO1A 5JEAJ 1F9SA 5K36H 5FJ8G 4KHVA 4DL2A 2BQUA 3CQZB 3L3OC 3OIQA 1VQKA 2R7ZB 4RCOA 4QWEA 4DV0L 1YNNC 5M3FG 4APMA 4N8FA 3R2TA 1QUQA 2ASBA 5D1OB 4ODGA 5M5YB 2HHFA 4J9RA 3TREA 4MA0A 2CQAA 3MWMA 1PZJD 1PLFA 4DV1H 3BJUA 4IJHA 2FJ2A 3SK6A 4M7EA 3OUZA 1AEXA 2L15A 2JXMB 3SGIA 1B2TA 1S40A 5ELBA 3QWNA 4ED3A 1OO9B 3S2DB 1AZQA 2GLTA 3WWHA 2VQFL 5LHY1 1T9HA 1A0GA 5F9LA 1AE2A 4UP7A 4CJ1B 3AW8A 3CP0A 3T1HL 2E2JH 3WO1A 5FOBB 4NZNA 1N32H 4NZOA 4IRKA 4DAMA 3SEBA 1Q82C 2DLNA 4ABNA 4RAYA 3MHBA 4V190 2O5IC 4LSXA 1KIXA 1NMGA 4FS2A 1XPRA 4RHRA 5KGUA 1VQOA 1I50A 1SLJA 4R9WA 2DWCA 2EJFC 4IWYA 5KG1A 1Q1EA 4QY7A 1UNSA 2HT1A 2MO0A 4IIJF 1I4QA 2YU9B 3N43B 2IA6A 2V9WA 3F2DA 1LLRD 1EU3A 5LL6S 3S1RB 3ORRA 1BOSA 2K52A 5JJKA 3R9RA 4DR3L 3T16A 4O7LA 1HNWL 4F88A 3S17B 3KDFB 2R7MA 2W70A 1QCBD 3LWEA 2LFNA 5DLFA 5M3MG 2PZWA 5CM0A 3BS1A 2D62A 1FJGQ 1GOZA 3BA9A 3MXNA 4HCSA 3H3VH 2HHHQ 3N40P 4DA2A 1GSOA 2E2IB 5I6WA 1NMFA 2FPIB 2UXBL 1S5FD 4A3EH 2B63A 3SXHA 1TAEA 1I7NA 3RJ0A 3EVQA 3CMEA 2MJ8A 5KFCA 2E2HA 4E6IA 2UUCQ 3GTMH 1HNXL 2B3GA 4U6PA 2OTJA 3NEMA 4A3KB 3KJPA 2L0CA 2SNSA 1CI3M 4O3SA 1PYBA 2ZXOA 5ELCA 4FNFA 2VW9A 1G91A 3RBEA 3VYSA 3D8GA 3GTLB 1I2KA 4O3PA 4F4XA 5I6YA 4O3QA 1A3UA 2YWVA 4C2MA 4ECVA 3VYTA 3V6HA 1IYVA 3S9WA 1JR0D 4CBVA 2CH4A 2X6GA 3AX6A 1Z47A 3HRZC 2RA4A 2FXQA 2KBNA 2KEDA 4JV5H 4DR5Q 2I5MX 2VS1A 3BABA 4Y8VB 1XNQL 2B2YC 4K5XA 3CXCA 4ZCKA 5JVLA 1CQVA 5IT9c 1VKZA 1TY2A 3I73A 2P0AA 4DV2L 1U9RA 1STEA 2NU7B 5KG5A 1C8CA 1EEFD 1IYEA 3KF8A 5BWVA 4MTNA 1KQSA 4ZUIA 1B3AA 4ZHQF 4Y52H 2A68C 5C4JH 2JEAI 1W6KA 5EKIA 1HNXQ 3HOVB 1CKNB 2F0SA 1WOCA 4QJFA 2Q2IA 3JC66 2ZT9C 4QW8A 1I3QA 2K01A 2X0SA 5FR9A 1K1SA 5JQGF 4O86A 1I1KA 2DNEA 3TY5A 2K5WA 4MZ9A 1MIUA 1PTOC 3OYYA 1J5EL 3K5IA 2K14A 3UDXA 3W2DA 1KJJA 3U9TA 3N44B 2B8FA 5JH7F 1BXTA 4GZYC 4O1NA 5DMXA 5C1OA 3FHWA 5CV6A 2NUCA 1VQCA 2HHHL 4OWWB 1EL0A 1V4YA 2Z9HA 2GQSA 1DV1A 5AJ3Q 2RDGA 1Y1VH 2W6OA 4LF7H 3J80E 3VR6A 5LA6F 2F0PA 1KJ9A 3CCLA 1B33N 3L2PA 2WB1E 2PZTA 1K0RA 4DR5L 4X3UA 5M9OA 3M3YB 2RDJA 2ZJPA 3V96A 3RZOH 2SDFA 4M1UB 2OH2A 4LFAH 2EYLA 3MR5A 2AMCB 2ZTEA 1GUSA 2C00A 4BY1B 4LF4H 1Y8OB 5FLXE 4JV2A 1DYQA 2F0QA 1II3A 4TVAB 4RGNA 5KFKA 1W6JA 1QJOA 2CNUA 1QVGA 3L4JA 4QUCA 1DCZA 5TSSA 1HRJA 3GTQA 3K5LA 1Y1WG 2KOLA 1Q86C 3I90A 5CR3A 1IBML 3TP8A 4I7HA 3T99A 3GO5A 1I4RA 4DV5Q 4HNTA 4GN4B 3DEPA 5HGTA 4A3IH 3BVGA 1XTDA 2UUBH 3I56A 3J7AK 2OWOA 4J9MA 3NBIA 3WOFA 4DV2H 4LF8L 4UP8A 1RJQA 4CHIA 2B29A 4IURA 3QIAA 3JZIA 5FPOA 3IAYA 4LFBQ 3GTPA 4JG2A 3MEHA 3JSLA 1ZQ7A 5EPLA 5CA0F 2E2JB 1U5KA 4QWDA 4QSHA 4JI4L 1WD1A 2R87A 1F9RA 3HO8A 4K6NA 3NHHA 3HOWH 2GN5A 3SDZA 2DIKA 3GTKH 4O4LF 3EYYA 2W9AA 4RB2C 4L63B 5D65A 5KT6A 3KF6B 5FNVF 1H9JA 1BNZA 2CFMA 1LT3D 4NYEA 3P75A 1ENCA 4CGYB 5GONF 2MP1A 3A8IE 1XMOL 3V6KA 4DGZA 3PUWA 3S1NB 4JYAQ 3CCMA 5C5MA 1GSAA 4A3DH 5DGAA 2XGTA 5KFFA 1IYUA 2M00A 2K50A 2Y0SG 1EFWA 3RGZA 2NU9B 4DR4Q 2KEEA 1OXVA 2NZ1D 1MJEA 4JI1L 2DN8A 3URYA 3NP8A 4Q43A 3T7AA 1BO0A 4MIUA 3PZPA 1JJ2A 5M5YH 2KJXA 4ECTA 2F0EA 1LTBD 1JWUD 4GNXC 1D1IA 2R61A 1GVPA 2MQHA 5DAAA 1B6RA 5I5YA 2NTSA 3NK9A 4O7VA 1I7LA 1K83H 1P8LA 2IT1A 4P75A 2C28A 2EQSA 2XD4A 1DGSA 2MGSA 2VUMB 3ORQA 4A3GB 3CRLC 3TZUA 1XK5A 1SEIA 1J5EH 4CDEC 1WTOA 1M0WA 3Q8PB 1KUTA 4PBCA 1WCMH 1QE6A 4JC0A 4BY1G 3SHLA 2JA7G 4NXNL 1YITA 3S2DH 2JQOA 5JQWA 3M4PA 1EYDA 1DD2A 4IN3A 2N88A 4U68A 5FD5A 1NAPA 1HFGA 3JZFA 4FXGC 1TXYA 5DM73 2UUCL 1NUCA 1EQQA 2Z4IA 1X6OA 1EY4A 1MJCA 4CDCC 5K3WA 3R93A 5IE8A 5LXTF 1EOVA 4LF7Q 5M5WB 2XWJB 4NZMA 1RTOA 4HNVA 2RSNA 3DEOA 3VR3A 1Y1VA 4DL7A 2UXDQ 3H40A 4A3MH 5C3EH 3G6YA 4JXUA 4C3JB 3I2ZA 3AEVA 5ELDA 1KRSA 1EQRA 1S5ED 1XJVA 1GYFA 4QGUA 1N34L 3Q8QB 1HH2P 3BA8A 2E8GA 1VQHA 2FPGB 1VAJA 5LYJF 3S17H 1EEID 1T3NA 4GLVB 3D6WA 3HOVG 4WRDA 4Y7NB 4GLWA 3HOUG 1TWHA 3X3NA 1SYFA 3RB3A 2QA4A 2UVVA 3MXUA 4LSAA 5GQOA 3PQIA 3PR5B 1M90C 4Q4CA 2KUMA 1LTSD 4HIKA 2FJZA 5E7NA 4IFDG 4TVIA 4DV5H 1RF2D 1SE8A 3D0FA 4LFAL 1S72A 3SR1A 4TSSA 4K6DA 3A55A 2K32A 1Y1WB 2IY5B 4IUPA 1JB3A 3CCRA 4C5AA 3RAQA 1E7ZA 4DLKA 1U4MA 3G7LA 5GAGC 4DV4L 4IPGA 2R8JA 4EEYA 2AGQA 1KABA 1PFBA 1PZKD 2PI2A 2ICIA 3B6YA 4OL7A 3U4ZA 4DU9A 5IGGA 4DV1Q 3RNUA 3STBC 5KT3A 1ET9A 2XCPA 2TSSA 1A3GA 3QZ7A 5I5VA 1JOKA 3I72A 3H3VC 2MFIA 1BBWA 2Q8RE 4FVMA 1LYLA 4B3RL 4Y7NH 2FK2A 1Q12A 4LFBH 1LT5D 1SBBB 4FF2A 3DTGA 2DNCA 1SYXB 4EQOA 1IBLL 1S0NA 3GIQA 4A4IA 3CVZA 3PUYA 2K04A 4X64Q 2ZJRA 3CCVA 5J2TF 4KD3A 1OBGA 1ET6A 3HOXG 5KFTA 2ALZA 3AQQA 1FD7D 1Y1WH 4KHPL 5IYBH 1QUQB 5D1OA 2W6ZA 2DJFC 1D5XC 4YHHQ 4DR4H 2CW0C 1ET0A 1HCZA 4A2AA 2HHHH 2PQAB 5C44H 3RUPA 3T9EA 1GUOA 3KREA 5M3MB 5E3FA 5IGBA 3ICEA 1LTTD 2UXCL 1Q1BA 2B2VC 5EAYA 4Q0FA 4PZ7A 5KT2A 1LTAD 1VF5C 2YS6A 2OCEA 5ELEA 2RGVA 3M4YA 2IL8A 5JVH3 2HCCA 4JI2Q 1DXMA 5HBRB 3Q8SB 4L1KA 2F0GA 2Z6BA 3EA6A 2EYMA 4R8IA 2XVSA 4O7RA 5LMUH 2EIYA 1G2WA 4GKJH 3H3VI 5C1PA 3IN5A 4U673 2YZMA 4A2BA 4JI5Q 2R7DA 5DG7A 1YNJD 3JAML 1PX2A 2UXBQ 1VF7A 2F0IA 3Q8DA 5EZYF 3RV3A 2D9UA 1I50H 4M9UA 1Y14B 5IYDG 1IBLQ 4NPSA 3A5ZB 3PV0A 4DV4H 3E3XA 1STHA 1N33L 4JI7L 5BPHA 1SYBA 5KFWA 4FFPA 4XIGS 2F0HA 4LF9H 4IQZA 4C56C 4C1NI 1JICA 3NTHA 1MSHA 3RLNA 4Q45A 1STGA 3KLRA 3HOYH 3FMAA 1X3PA 2R86A 2QB5A 3MEFA 5IWAH 3MTSA 3SE7A 4XYQA 4K8JA 4B08A 2F0VA 2OQ0A 4DUZL 1BGWA 3GTGA 3RLFA 1E2WA 4OHJA 5BYBA 2FLNA 1VS0A 2F1MA 2WE6A 4DPGA 5DISC 3TDQA 4XX0B 1GKHA 1WI5A 4GNXA 4ALPA 4RMFA 2Z6KA 2RSOA 1HQRD 2ALYB 3FDTA 5G3LF 3MFYA 4A3JH 3G6XA 4XQJA 2SEBD 5K5PA 4WHXA 1JOQA 5CR5A 4DR1L 3QB3A 4B9XA 4YP3A 1DOKA 1XWEA 3A7AB 2B2WC 2HIVA 5KYLA 5KFRA 2C2DA 2PO4A 1HZCA 1NR2A 3MXGA 5D8DA 3RR5A 1PFNA 4KHPQ 2RDHA 3G8CA 2PW5A 5J2UF 5M5XH 2B39A 4IHJF 4LAAA 3ND8A 5KEEA 3WNZA 2CQOA 4EGJA 5CV9A 1ESRA 4DV3Q 2Z1CA 4XYLB 5CC4A 1CM9A 4ZKCB 1EUCB 4X6AH 2UUAH 4IUUA 3Q2OA 4PMWA 3MR3A 4R8UA 1NCVA 5KFQA 4NKLA 3PF5A 4N9TA 1TWCH 2EZVA 5LMUQ 4LUVA 2BCOA 2B2YA 4GKJQ 3MFIA 4XQQA 2AGPA 1HJPA 3NBHB 1CKMA 2ZM6L 3BQ1A 4YR2A 1LUZA 2LMCB 3MFHA 4POGA 1BBUA 2FHTA 4IFDJ 2QK4A 3S14H 4MTEA 1BF4A 2VY3A 3S15B 5KFPA 4UPAA 2E75C 3MFGA 4HN2A 5EWFA 1D5MC 4A3IG 1KTAA 1S5DD 2F0TA 4RZQA 3RBDA 1LABA 2B2TA 1LTRD 3I7FA 3M4IA 1SFOB 5L1LA 1EZ6A 1VQDA 5CORA 3OSOA 1YHBA 2A69C 4X66Q 2J4XA 4JUZA 1V8QA 1N34Q 2A1AA 2MNAA 4JI7Q 4O4HF 5BWXA 5IY0A 4DKAC 4PG3A 1K8MA 5IODA 1ZHQA 3QJYA 4JI0L 3K8AA 2W8LA 2E2DC 5M3FB 2V5AA 4B3RH 4DFAA 3UFXB 1KC7A 3CCSA 3BZCA 2D0PA 1VQGA 2HG8A 2J6SA 1JB7A 1B6SA 1BCPD 4RWSC 3VYUA 1TWAH 3E9IA 4GOPA 3GTKB 4UCVA 1JC7A 2E76C 3T53B 1VQNA 3VR2A 4TM5A 5IGEA 4DK3C 3CC4A 2WV6D 3HKZE 5CA1F 2KA7A 4Q44A 2JA8G 1G2TA 1KL9A 1TA8A 4R4QA 3K81C 2QYZA 2F0DA 4PDBA 1GHKA 1SNOA 4GC7A 4Q8FA 3TY9A 2R7KA 1EWCA 3MXPA 2WYOA 2DAAA 5KG7A 1ASZA 1EQTA 1VQEA 1C4QA 1IBKH 2HVQA 1UNNC 2JEBI 3H6MA 4OWTB 2JEJA 4LF6H 2WACA 4NB3A 2PI2E 5L1KA 1YJNA
chains in the Genus database with same CATH topology
4JOIC 3NEMA 3UDIA 1VCIA 1VQ5A 4DNIA 2OTJA 1CSQA 4GLXA 4UCSA 3KJPA 4JBWA 1PH8A 1ZHSA 4KLKA 4BXXH 2LXKA 4JI1Q 4A3FG 4LW1A 4JI3Q 1AH9A 3A74A 4RG1A 3ULJA 1LM0A 4JI5H 1C0AA 3RZDH 1PYBA 2R7ZH 3TS2A 3TEHB 5DLQE 2VW9A 4RAYA 2E5LQ 4JI3L 2NN6G 2RGRA 2NVQH 1L1OC 4YY3H 4GKKL 4DV3H 2HQLA 2FE3A 4GN5A 4B3SH 1JMCA 1VQ7A 1N33H 1PH4A 4A3KG 1MZBA 5LMNH 4YY3L 1Z47A 3G4SA 3DLLA 1N36Q 3PSIA 5JJLA 2A19A 2FXQA 2KBNA 1B04A 2ZJTA 4JV5H 4DR5Q 2I5MX 2VS1A 3UDFA 3I4MG 4GKKQ 3BABA 3N41B 3RGXA 1XNQL 4LF5H 3CXCA 3GTQH 3GD7A 3ULLA 5IT9c 5M3FH 3LMLA 3H0GG 4MNOA 1E4FT 4DV2L 2UXCQ 4B3RL 4B3TQ 4AYBG 3F2BA 4B3MQ 3KJOA 4B3RQ 4MV9A 4MTNA 3H15A 1KQSA 2F4VL 4EX5A 2JA5G 1XNRQ 2NVYH 1LTLA 2DUDA 2N78A 4DV0Q 4Y52H 2F3IA 1JT8A 5C4JH 2MCTA 2WDTA 1B8AA 2JEAI 1S03G 1X56A 2VQFH 2F4VH 1X65A 2RHQB 3JAMc 3NBYB 1HNXQ 4X66H 1IYJB 1CKNB 1PYSB 4DR3Q 1WOCA 1BVSA 2Q2IA 2VZAA 3JC66 4QJFA 3C0FB 4DR2L 3UDGA 4AYBE 2UU9H 4C3HH 4TQUS 1IXRA 2N49A 3TY5A 4MZ9A 1MIUA 3OYYA 3KF6A 1J6QA 1J5EL 2K14A 3UDXA 1YZ6A 2JA8H 3J81c 4DK6C 4WJ3M 1Y1VG 4EEQA 3N44B 5IP7G 2EIFA 1PH2A 4OXPA 4HJ9A 3FHWA 2Q2UA 3TRZA 2YCHA 4DR4L 2E5LL 3T1YQ 2F52A 1PH5A 1XNRL 1VQCA 3K7AH 1KAWA 2HHHL 1FL0A 4OWWB 3QWUA 4AQYQ 3PUXA 5AJ3Q 3KDFA 1GM5A 2OTLA 3KFUA 1Y1VH 4FM9A 3HOWG 4JI0H 4LF7H 3U50C 2NZHA 1G291 4R4CA 4HJ8A 3RTXA 4JI4H 3CCLA 3L2PA 2WB1E 1K9MC 2HVRA 4LF7L 1J5EQ 4UCVA 1K0RA 4DR5L 1PFSA 3GTPH 5FLXc 4IO9A 4DUZQ 2LSSA 1E22A 2VUGA 4CC6A 4JI1H 1SFOH 1HNZL 2ZJPA 1IL2A 3RZOH 3HKSA 4ETSA 4LFAH 1E3PA 1S3OA 2AMCB 2ZTEA 5HGQA 3GTLH 2AWOA 4X64L 4LF4H 3F1ZA 3GTMH 4GS3A 4LFCH 4NXNQ 2VPSA 2RCNA 4TVAB 4A75A 2Y0SE 4B3SL 3CMAA 3T1HH 5IP9H 1QVGA 1EIYB 5C0XI 4A3FH 4L5QA 3TQYA 1KD1C 3L4JA 3UE1A 1Y1WG 3ER0A 1Q86C 1OXUA 1YVCA 4HIDA 1IBML 1YI2A 1CKOA 4I7HA 3GO5A 1X3FA 5LMNW 1HZBA 2CWAA 1YJWA 2WFWA 2R7ZG 2CW8A 1N34H 1Z9FA 4DV5Q 4JI7H 2UXDH 4GN4B 2KCMA 3CD6A 4A3IH 1G6PA 4RB0A 1XTDA 3J7A5 2UUBH 3I56A 3CF5A 3J7AK 3CCJA 2OWOA 2N8NA 4P72A 1AE3A 3LGJA 4R4OA 3L4KA 2R93H 1Z2OX 4DV2H 4LF8L 3NELA 1WFQA 4UP8A 5C4XH 3F2CA 2B29A 3KF8B 1X9NA 4K0KQ 1HZ9A 3TY8A 5FPOA 4DUYH 3U4VA 4LFBQ 4B3TH 4E6NA 1L1OA 5H1SE 4JG2A 1QVFA 3JSLA 3GJXB 2ATWA 3W5OA 4R7RA 1U5KA 2R92G 3S1RH 4JI4L 2JJQA 2Z0SA 4GOPB 1L0WA 5GADC 3I55A 4JI6H 4J0MA 4DR5H 4JYAL 1PH7A 1I94H 1OTCA 3AFPA 1FVIA 2GN5A 4BA1I 5M5WH 5FLMG 3HKZG 3GTKH 1VQBA 3NENA 3HOWH 5FPRA 3VNNA 1Z2PX 5C0XJ 4UCUA 3EYYA 1XMOQ 3CC2A 4RB2C 3KF6B 4JI3H 1Q7YC 4YCVA 3CQZH 2CFMA 4UCTA 1AN7A 1NJIC 4NXMH 4QIWE 4AIMA 2CKZB 1XNRH 1KRTA 3J81j 1XMOL 1PH3A 3M9BA 1SMXA 4DR6Q 3HOUH 3F8NA 1V43A 3RIZA 4LF6Q 3I4NH 1IZ6A 3PUWA 3PF4A 4DR7Q 3PUZA 4JI0Q 4JV5L 4JYAQ 4RB1A 3CCMA 2IX1A 5C3EG 5AJ3L 2VL6A 4UFZA 3H20A 2JK8A 4A3DH 1E24A 4OO1I 4BBSH 2VQEH 4OX9H 2XGTA 1WH2A 2VOBA 4P74A 5JJIA 4J15A 1EFWA 2K50A 2Y0SG 5IWAL 4DV7Q 3RGZA 4GOPC 4DR4Q 4JV5Q 2C35B 1OXVA 1MJEA 4OX9Q 4A3KH 4DUZH 1BKBA 1K3RA 4R4IA 4JI1L 3PGZA 4HJAA 1XPOA 3J81W 4JI5L 1JJ2A 5M5YH 4PZ6A 3EIVA 2NZOA 1I6HH 1HNZQ 2XIGA 3G48A 3W1BA 2AHOB 4GNXC 5IT9W 3M3YH 2Z6KC 2K75A 1GVPA 1JJGA 2MQHA 4IAJA 2UXBH 4R1JA 3KYHC 1VQ8A 4IPDA 3FKIH 1K83H 1P8LA 2IT1A 3PCOB 4P75A 3M85A 2EQSA 1PH1A 2B63H 1DGSA 1D7QA 4BY1H 4A3GH 3RLOA 1FKAH 2I5HA 4BXXG 1XK5A 1SEIA 1J5EH 4ME3A 4OX9L 2JA6H 3BAAA 1M0WA 2CWPA 1A8VA 5IYCH 4QL5A 1K73C 1TWGH 3HFZB 4LUZA 1Q46A 1WCMH 4JC0A 1I3QH 4BY1G 4LFAQ 2BA1A 4IJLA 2UUBL 2UU9Q 2B63G 2JA7G 1KXLA 4NXNL 1YITA 3S2DH 2JQOA 1CUKA 3UE0A 3M4PA 4L5TA 2OQKA 3OTOQ 4EQ5A 4BY7H 4A3CH 5GROA 2KENA 1G51A 2K5NA 4YWKA 3CC7A 5FD5A 2E2IH 1SROA 1TXYA 2AWNA 1SN8A 1JE5A 2UUCL 1H95A 3ERSX 1EQQA 1HR0L 1L2ZA 3AYHB 2YTYA 1X6OA 2VQFQ 1MJCA 5IE8A 1NE3A 4OO1G 5K36G 4A3LG 1EOVA 2E2HH 4LF7Q 1D8LA 1SR3A 1VQ4A 2DGYA 1CKNA 1W3SA 1PHJA 3HOZG 2UXDQ 4A3MH 5IWAQ 4DV7L 3H0GH 2UU9L 1VQFA 2WAQE 3G6EA 5C3EH 4A76A 3S2HH 3UQ8A 2IHEA 3I2ZA 3AEVA 5BR8H 3VDYA 1KRSA 1EQRA 1GYFA 1XJVA 4QGUA 1N34L 2JA5H 3S1QH 4DV6H 2KSWA 1HH2P 1L1OB 2EXDA 2UXDL 3BA8A 2E8GA 3G71A 1UE7A 3T1YH 1VQHA 3PO2H 1A62A 1I5FA 1VQAA 2YYZA 4AQYH 4X65Q 3S17H 4L5SA 3FP9A 4UCOA 4DR6H 3DM3A 1Q81C 5FD6A 4GLVB 5FJ8H 3HOVG 3HOUG 4C3IH 4A3BG 4LMYA 4PZ8A 4BBRH 3TS0A 2QA4A 2UUAL 1TWFH 1HR0W 4HJ5A 2R93G 1IBLH 4DV5L 1WCMG 1S68A 1UE5A 5GQOA 3K3VA 4LSAA 1M90C 4FDBA 1WJJA 5HY6A 4HIKA 4IFDI 3L0OA 5E7NA 4IFDG 3CCQA 4MV7A 3RF2A 4XTCS 3N42B 4DV5H 4IOAA 3GTJH 4H02A 1SE8A 1VQLA 3D0FA 4OONA 2UUBQ 4LFAL 1S72A 3I4NG 3NBZB 1K8AC 1X55A 1C7YA 4CC5A 2IY5B 4A93H 1FJGL 1RIPA 1P16A 1XPUA 1VQ6A 4JBJA 4A3DG 1CSPA 3CCRA 1E7ZA 5GAGC 1L2FA 3BZKA 4DV4L 3T1HQ 3BU2A 2JE6I 2VUMH 4JYAH 1VQ9A 3CW2C 1QZHA 1X54A 4IPGA 3GTGH 1O75A 2CW7A 4DR1H 4LFBH 1B7YB 1YEZA 1N36L 4DR2Q 1YJ9A 2PMZE 1PH9A 3K80C 1FGUA 4LF5L 1YBYA 4DR6L 2PI2A 2IHFA 3B6YA 3U4ZA 5C0XG 3RNUA 4DV1Q 4JBMA 4JI6Q 3STBC 1TWHH 3PIPA 3KAKA 4X62H 4DAYB 1M0TA 2R92H 4BWSC 2XTIA 3JAMi 5LMUL 4GKJL 3IRBA 3GB8B 3N6XA 3PO2G 1XMOH 1HNZH 1VQMA 2MFIA 1BBWA 1YHQA 2Q2TA 5M3MH 5GAHC 3GTOH 3OTOH 1LYLA 4JCVE 4K0KH 2Q2HA 4B3ML 4Y7NH 4DUYQ 1Q12A 2NVXH 2BH2A 3S16H 2HIXA 3I4MH 4NXMQ 2KCTA 4KHZA 3PO3G 1SYXB 4BBRG 4JOIA 1IBKL 1IBLL 1EUJA 2CCZA 1N32Q 2ZM6H 1JJCB 4A4IA 3CVZA 3PUYA 4JI8Q 2KHIA 5IYBG 2AKWB 4X64Q 2ZJRA 3HXLA 2YV5A 5LL6b 1C9OA 5IP7H 3EBEA 3CCVA 4JI6L 3PN1A 4YWMA 3OW2A 1HR0Q 2UUAQ 4BA2I 1BJTA 3HOXG 4C3JH 1EWIA 1GO3E 3AQQA 1Y1WH 3STBD 4KHPL 5IYBH 1QUQB 2YU9H 3ZJYC 2ZJQA 5D1OA 3MXNB 2YTXA 4YHHQ 4DR4H 3JAMW 4APVA 5BR8Q 3KXYT 4A2AA 4KHPH 2HHHH 2PQAB 4O0AA 4YWLA 4DRFA 5C44H 1YIJA 2PNHA 4A3BH 2A8VA 4LNQA 4NXML 1N32L 4UP9A 1PA6A 1K8GA 3ICEA 3F8TA 2UXCL 2RHSB 1Q1BA 3EN2A 4AQYL 5EAYA 4B3TL 3DF7A 4DR7H 5C4XG 4PZ7A 3KLWA 4HJ7A 2V1CC 5LMNL 3CAMA 2OCEA 1NBWA 1A0IA 2NVTH 2RGVA 4EFEA 2WB1G 2QEXA 2N3SA 2VQEQ 4RB3C 1OXXK 5J3BA 1XMQH 2UUCH 4JI2Q 2VUMG 1HNWQ 4YHHL 3S15H 2H5XA 5IYDH 1E1TA 5LMUH 4GKJH 4DV6Q 1WYDA 4LF4L 3H3VI 3S1MH 2I5LX 4X65L 4A2BA 1PH6A 4JI5Q 2R7DA 2QGQA 5IP9G 4L5RC 4A3LH 4GN3B 3W1GA 4R4TA 5IYCG 4A3MG 1XDNA 2UXBQ 4X65H 3Q8DA 1I50H 3K7UC 1Y14B 5IYDG 3E9HA 4NPSA 3A5ZB 2GVAA 3PV0A 1IBKQ 1IBLQ 4DV4H 1W2BA 3KALA 4LF9L 1EYGA 3T1YL 1N33L 4B3SQ 4JI7L 4X66L 1QVCA 2YTVA 1B70B 4LFCL 3IG0A 3NC0B 4XIGS 1KC8C 4DR2H 5ELOA 3AFQA 2ID0A 4LF9H 1YHAA 1RL2A 3RLNA 1Q8KA 3PIOA 1V1QA 2D0OA 4GLAC 1OXSC 4LF6L 1NY4A 4YCWA 1XNQQ 4P73A 3HOYH 3FMAA 5IWAH 3MEFA 1IBMH 4BY7G 4DV1L 4YCUA 5GAEC 4LF5Q 4EFBA 1V9PA 4DUZL 2OQ0A 1BGWA 1Z2NX 4DV7H 3RLFA 3WWVA 3HOZH 2ES2A 2E5LH 2R7FA 2UXCH 1VS0A 2WE6A 3S24A 4DPGA 2IX0A 5DISC 2K5VA 4LF8H 1GKHA 4POFA 5LMNQ 1WI5A 4HIOA 4DUYL 4GNXA 4ALPA 4RMFA 2Z6KA 1PV4A 3KOJA 4JI8H 2ALYB 1VQJA 4A93G 4A3JH 4UCRA 4LWCA 3J80c 3CPWA 3RN5A 4DV3L 5D1PA 4GKKH 1X3GA 2RF4A 4DR1L 4WJ4A 2JA9A 2O03A 1UWVA 1FJGH 3CCEA 1UE1A 2HIVA 2WP8J 5ELNA 3PO3H 3M7NA 4LUOA 1I94L 1HZCA 2BH8A 4DV6L 4IPHA 3RR5A 2HVSA 4KHPQ 2JA7H 4OWXB 3E0EA 5FLMH 1OXTA 2MO1A 5M5XH 1N9WA 5JEAJ 1I6UA 4BBSG 4DV0H 5FJ8G 3HOVH 1UE6A 2CQOA 3OTOL 1VQKA 1PVOA 5EOYA 3K0XA 2UUCQ 2GVBA 4DV3Q 4LFCQ 4DV0L 5M3FG 4DR1Q 4DR3H 3HOYG 2W57A 1N33Q 4X6AH 4APMA 1ASYA 2UUAH 4JI4Q 1QUQA 2ASBA 4QQBX 3JSNA 5D1OB 4PMWA 3GDEA 5C44G 1EIFA 3TREA 3J80W 3MWMA 4IOCA 4X62Q 4DV1H 3PF5A 3BJUA 2PQAA 4IJHA 4M7EA 4LFBL 1TWCH 5LMUQ 2K4KA 4LUVA 4GKJQ 1NTGA 2L15A 3FKIG 3D31A 3SGIA 1HJPA 3NBHB 1CKMA 3J81i 2ZM6L 1S40A 2VNUD 1LUZA 3J80i 3CCUA 3U58A 4IPCA 2VQFL 4C2MH 1HZAA 1T9HA 1BBUA 3RN2A 4LF4Q 4POGA 2R6GA 3S14H 4IFDJ 4MTEA 4O2DA 4YY3Q 4LH7A 2VY3A 5A2QW 3S1NH 4UPAA 1AE2A 1QZGA 4UP7A 4A3JG 3CP0A 4DV4Q 3T1HL 4JI8L 2E2JH 2ZM6Q 1N32H 4A3IG 4RZQA 3A0JA 4A3EG 4DAMA 1N36H 1Q82C 5FLXW 3I7FA 4UY8C 2F4VQ 4A3CG 3M4IA 4RAZA 1VQDA 1YNXA 4AH6A 1YHBA 4X66Q 3J7ZC 1KIXA 4LSXA 1NMGA 4LF9Q 1HNXH 1XPRA 2A1AA 2MNAA 1VQOA 1N34Q 1VQIA 2BA0A 3A5UA 1SLJA 2KHJA 4DKAC 5IY0A 4JI7Q 1XNQH 4PG3A 1XMQL 1X3EA 1R9TH 4A3GG 2K5HA 2HGSA 1Q1EA 4QY7A 4DR7L 4P71A 4YHHH 2JA6G 1ZHQA 4JI0L 3K8AA 3HOXH 2HT1A 2MO0A 3N43B 4B3MH 4B3RH 2ZTCA 4NXNH 3L7ZC 3F2DA 2LXJA 5JEAG 3CCSA 3BZCA 2D0PA 1SRUA 1VQGA 2K52A 1M1KC 5JJKA 4DR3L 4JBKA 4LH6A 4X64H 1KHIA 4HIMA 1JB7A 2WAQG 1VQPA 4JI2L 1TWAH 3E9IA 3CPFA 3I4OA 4GOPA 1HNWL 2VQEL 4KI0A 3KDFB 1VQNA 3M4OH 4Q0YA 1HR0H 4DK3C 1XMQQ 3CC4A 4JI2H 1HNWH 3HKZE 1IBMQ 5M3MG 1O7IA 4X62L 2ZTDA 2JA8G 1FJGQ 2D62A 1KL9A 3ULPA 1TA8A 4R4QA 3K81C 3BA9A 3H3VH 3N40P 1UEBA 2HHHQ 4PDBA 4DV2Q 1NMFA 1E4GT 4MTDA 1U0LA 5BR8L 2UXBL 3TY9A 4K0KL 3PUVA 4GNXB 4LF8Q 4A3EH 2WYOA 1TAEA 2NN6I 1ASZA 1VQEA 1N8RC 1E1OA 3M4QA 1MKHA 2JEBI 2HVQA 4OWTB 2I0QA 3KAJA 3RJ0A 1IBKH 4LF6H 4NB3A 3CMEA 2PI2E 1GD7A 1YJNA 1HNXL 1I94Q 2B3GA 1A63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOI C;  3NEM A;  3UDI A;  1VCI A;  1VQ5 A;  4DNI A;  2OTJ A;  1CSQ A;  4GLX A;  4UCS A;  3KJP A;  4JBW A;  1PH8 A;  4KLK A;  4BXX H;  2LXK A;  4JI1 Q;  4A3F G;  4LW1 A;  4JI3 Q;  1AH9 A;  3A74 A;  4RG1 A;  3ULJ A;  1LM0 A;  1C0A A;  3RZD H;  1PYB A;  2R7Z H;  3TS2 A;  3TEH B;  5DLQ E;  2VW9 A;  2E5L Q;  4JI3 L;  2NN6 G;  2NVQ H;  1L1O C;  4GKK L;  2HQL A;  4GN5 A;  1JMC A;  1VQ7 A;  1PH4 A;  4A3K G;  4YY3 L;  1Z47 A;  3G4S A;  3DLL A;  1N36 Q;  3PSI A;  5JJL A;  2A19 A;  2FXQ A;  2KBN A;  1B04 A;  4DR5 Q;  2I5M X;  2VS1 A;  3UDF A;  3I4M G;  4GKK Q;  3BAB A;  1XNQ L;  3CXC A;  3GTQ H;  3GD7 A;  3ULL A;  5IT9 c;  5M3F H;  3H0G G;  4MNO A;  4DV2 L;  2UXC Q;  4B3R L;  4B3T Q;  4AYB G;  3F2B A;  4B3M Q;  3KJO A;  4B3R Q;  4MTN A;  3H15 A;  1KQS A;  2F4V L;  4EX5 A;  2JA5 G;  1XNR Q;  2NVY H;  1LTL A;  2DUD A;  2N78 A;  4DV0 Q;  4Y52 H;  2F3I A;  1JT8 A;  5C4J H;  1B8A A;  2JEA I;  1X56 A;  1X65 A;  2RHQ B;  3JAM c;  3NBY B;  1HNX Q;  1IYJ B;  1CKN B;  1PYS B;  4DR3 Q;  1WOC A;  1BVS A;  2Q2I A;  2VZA A;  3JC6 6;  4QJF A;  4DR2 L;  3UDG A;  4AYB E;  4C3H H;  4TQU S;  1IXR A;  2N49 A;  3TY5 A;  4MZ9 A;  1MIU A;  3OYY A;  3KF6 A;  1J6Q A;  1J5E L;  2K14 A;  3UDX A;  1YZ6 A;  2JA8 H;  3J81 c;  4DK6 C;  4WJ3 M;  1Y1V G;  4EEQ A;  5IP7 G;  2EIF A;  1PH2 A;  4OXP A;  4HJ9 A;  3FHW A;  2Q2U A;  3TRZ A;  4DR4 L;  2E5L L;  3T1Y Q;  2F52 A;  1PH5 A;  1XNR L;  1VQC A;  3K7A H;  1KAW A;  2HHH L;  1FL0 A;  4OWW B;  3QWU A;  4AQY Q;  3PUX A;  5AJ3 Q;  3KDF A;  1GM5 A;  2OTL A;  3KFU A;  1Y1V H;  3HOW G;  3U50 C;  2NZH A;  1G29 1;  4R4C A;  4HJ8 A;  3RTX A;  3CCL A;  3L2P A;  2WB1 E;  1K9M C;  2HVR A;  4LF7 L;  1J5E Q;  4UCV A;  1K0R A;  4DR5 L;  1PFS A;  3GTP H;  5FLX c;  4IO9 A;  4DUZ Q;  2LSS A;  1E22 A;  2VUG A;  4CC6 A;  1SFO H;  1HNZ L;  2ZJP A;  1IL2 A;  3RZO H;  3HKS A;  1E3P A;  1S3O A;  2AMC B;  2ZTE A;  5HGQ A;  3GTL H;  2AWO A;  4X64 L;  3F1Z A;  3GTM H;  4GS3 A;  4NXN Q;  2RCN A;  4TVA B;  4A75 A;  2Y0S E;  4B3S L;  3CMA A;  5IP9 H;  1QVG A;  1EIY B;  5C0X I;  4A3F H;  4L5Q A;  3TQY A;  1KD1 C;  3UE1 A;  1Y1W G;  3ER0 A;  1Q86 C;  1OXU A;  1YVC A;  4HID A;  1IBM L;  1YI2 A;  1CKO A;  3GO5 A;  1X3F A;  5LMN W;  1HZB A;  2CWA A;  1YJW A;  2WFW A;  2R7Z G;  1Z9F A;  4DV5 Q;  4GN4 B;  2KCM A;  3CD6 A;  4A3I H;  1G6P A;  1XTD A;  3J7A 5;  3I56 A;  3CF5 A;  3CCJ A;  2OWO A;  2N8N A;  4P72 A;  1AE3 A;  3LGJ A;  4R4O A;  2R93 H;  4LF8 L;  3NEL A;  1WFQ A;  4UP8 A;  5C4X H;  3F2C A;  2B29 A;  3KF8 B;  1X9N A;  4K0K Q;  1HZ9 A;  3TY8 A;  5FPO A;  3U4V A;  4LFB Q;  4E6N A;  1L1O A;  5H1S E;  4JG2 A;  1QVF A;  3JSL A;  3GJX B;  2ATW A;  3W5O A;  1U5K A;  2R92 G;  3S1R H;  4JI4 L;  2JJQ A;  2Z0S A;  4GOP B;  1L0W A;  5GAD C;  3I55 A;  4JYA L;  1PH7 A;  1OTC A;  3AFP A;  1FVI A;  2GN5 A;  4BA1 I;  5M5W H;  5FLM G;  3HKZ G;  3GTK H;  1VQB A;  3NEN A;  3HOW H;  5FPR A;  3VNN A;  5C0X J;  4UCU A;  1XMO Q;  3CC2 A;  3KF6 B;  1Q7Y C;  4YCV A;  3CQZ H;  2CFM A;  4UCT A;  1NJI C;  4QIW E;  4AIM A;  2CKZ B;  1KRT A;  3J81 j;  1XMO L;  1PH3 A;  3M9B A;  1SMX A;  4DR6 Q;  3HOU H;  1V43 A;  4LF6 Q;  3I4N H;  1IZ6 A;  3PUW A;  3PF4 A;  4DR7 Q;  3PUZ A;  4JI0 Q;  4JV5 L;  4JYA Q;  3CCM A;  2IX1 A;  5C3E G;  5AJ3 L;  2VL6 A;  4UFZ A;  2JK8 A;  4A3D H;  1E24 A;  4OO1 I;  4BBS H;  2XGT A;  4P74 A;  5JJI A;  4J15 A;  1EFW A;  2K50 A;  2Y0S G;  5IWA L;  4DV7 Q;  4GOP C;  4DR4 Q;  4JV5 Q;  2C35 B;  1OXV A;  1MJE A;  4OX9 Q;  4A3K H;  1BKB A;  1K3R A;  4R4I A;  4JI1 L;  3PGZ A;  4HJA A;  1XPO A;  4JI5 L;  1JJ2 A;  5M5Y H;  4PZ6 A;  3EIV A;  2NZO A;  1I6H H;  1HNZ Q;  3G48 A;  3W1B A;  2AHO B;  4GNX C;  3M3Y H;  2Z6K C;  2K75 A;  1GVP A;  1JJG A;  2MQH A;  4R1J A;  3KYH C;  1VQ8 A;  4IPD A;  3FKI H;  1K83 H;  1P8L A;  2IT1 A;  3PCO B;  4P75 A;  3M85 A;  2EQS A;  1PH1 A;  2B63 H;  1DGS A;  1D7Q A;  4BY1 H;  4A3G H;  3RLO A;  2I5H A;  4BXX G;  1XK5 A;  4ME3 A;  4OX9 L;  2JA6 H;  3BAA A;  2CWP A;  1A8V A;  5IYC H;  4QL5 A;  1K73 C;  1TWG H;  3HFZ B;  4LUZ A;  1Q46 A;  1WCM H;  4JC0 A;  1I3Q H;  4BY1 G;  4LFA Q;  2BA1 A;  4IJL A;  2UUB L;  2UU9 Q;  2B63 G;  2JA7 G;  1KXL A;  4NXN L;  1YIT A;  3S2D H;  2JQO A;  1CUK A;  3UE0 A;  3M4P A;  4L5T A;  2OQK A;  3OTO Q;  4EQ5 A;  4BY7 H;  4A3C H;  5GRO A;  2KEN A;  1G51 A;  2K5N A;  4YWK A;  3CC7 A;  2E2I H;  1SRO A;  1TXY A;  2AWN A;  1SN8 A;  1JE5 A;  2UUC L;  1H95 A;  3ERS X;  1EQQ A;  1HR0 L;  3AYH B;  2YTY A;  1X6O A;  2VQF Q;  1MJC A;  5IE8 A;  1NE3 A;  4OO1 G;  5K36 G;  4A3L G;  1EOV A;  2E2H H;  4LF7 Q;  1D8L A;  1SR3 A;  1VQ4 A;  2DGY A;  1CKN A;  1W3S A;  1PHJ A;  3HOZ G;  2UXD Q;  4A3M H;  5IWA Q;  4DV7 L;  3H0G H;  2UU9 L;  1VQF A;  2WAQ E;  3G6E A;  5C3E H;  4A76 A;  3S2H H;  3UQ8 A;  2IHE A;  3I2Z A;  3AEV A;  3VDY A;  1KRS A;  1EQR A;  1XJV A;  4QGU A;  1N34 L;  2JA5 H;  3S1Q H;  1HH2 P;  1L1O B;  2EXD A;  2UXD L;  3BA8 A;  2E8G A;  3G71 A;  1UE7 A;  1VQH A;  3PO2 H;  1A62 A;  1I5F A;  1VQA A;  2YYZ A;  4X65 Q;  3S17 H;  4L5S A;  3FP9 A;  4UCO A;  3DM3 A;  1Q81 C;  4GLV B;  5FJ8 H;  3HOV G;  3HOU G;  4C3I H;  4A3B G;  4PZ8 A;  4BBR H;  3TS0 A;  2QA4 A;  2UUA L;  1TWF H;  1HR0 W;  4HJ5 A;  2R93 G;  4DV5 L;  1WCM G;  1S68 A;  1UE5 A;  5GQO A;  1M90 C;  4FDB A;  1WJJ A;  5HY6 A;  4HIK A;  4IFD I;  3L0O A;  5E7N A;  4IFD G;  3CCQ A;  4XTC S;  4IOA A;  3GTJ H;  4H02 A;  1SE8 A;  1VQL A;  3D0F A;  4OON A;  2UUB Q;  4LFA L;  1S72 A;  3I4N G;  3NBZ B;  1K8A C;  1X55 A;  1C7Y A;  4CC5 A;  2IY5 B;  4A93 H;  1FJG L;  1RIP A;  1P16 A;  1XPU A;  1VQ6 A;  4JBJ A;  4A3D G;  1CSP A;  3CCR A;  1E7Z A;  5GAG C;  1L2F A;  3BZK A;  4DV4 L;  3T1H Q;  3BU2 A;  2JE6 I;  2VUM H;  1VQ9 A;  3CW2 C;  1QZH A;  1X54 A;  4IPG A;  3GTG H;  1B7Y B;  1YEZ A;  1N36 L;  4DR2 Q;  1YJ9 A;  2PMZ E;  1PH9 A;  3K80 C;  1FGU A;  4LF5 L;  1YBY A;  4DR6 L;  2PI2 A;  2IHF A;  3B6Y A;  3U4Z A;  5C0X G;  3RNU A;  4DV1 Q;  4JBM A;  4JI6 Q;  3STB C;  1TWH H;  3PIP A;  4DAY B;  2R92 H;  2XTI A;  3JAM i;  5LMU L;  4GKJ L;  3IRB A;  3GB8 B;  3PO2 G;  1VQM A;  2MFI A;  1BBW A;  1YHQ A;  2Q2T A;  5M3M H;  5GAH C;  3GTO H;  1LYL A;  4JCV E;  2Q2H A;  4B3M L;  4Y7N H;  4DUY Q;  1Q12 A;  2NVX H;  2BH2 A;  3S16 H;  2HIX A;  3I4M H;  4NXM Q;  2KCT A;  4KHZ A;  3PO3 G;  4BBR G;  4JOI A;  1IBK L;  1IBL L;  1EUJ A;  2CCZ A;  1N32 Q;  1JJC B;  4A4I A;  3PUY A;  4JI8 Q;  2KHI A;  5IYB G;  2AKW B;  4X64 Q;  2ZJR A;  2YV5 A;  1C9O A;  5IP7 H;  3EBE A;  3CCV A;  4JI6 L;  3PN1 A;  4YWM A;  3OW2 A;  1HR0 Q;  2UUA Q;  4BA2 I;  3HOX G;  4C3J H;  1EWI A;  1GO3 E;  3AQQ A;  1Y1W H;  3STB D;  4KHP L;  5IYB H;  1QUQ B;  2YU9 H;  3ZJY C;  2ZJQ A;  5D1O A;  3MXN B;  2YTX A;  4YHH Q;  4APV A;  5BR8 Q;  2PQA B;  4O0A A;  4YWL A;  4DRF A;  5C44 H;  1YIJ A;  2PNH A;  4A3B H;  2A8V A;  4LNQ A;  4NXM L;  1N32 L;  4UP9 A;  1PA6 A;  1K8G A;  3ICE A;  3F8T A;  2UXC L;  2RHS B;  1Q1B A;  3EN2 A;  4AQY L;  5EAY A;  4B3T L;  5C4X G;  4PZ7 A;  3KLW A;  4HJ7 A;  2V1C C;  5LMN L;  3CAM A;  2OCE A;  1NBW A;  1A0I A;  2NVT H;  4EFE A;  2WB1 G;  2QEX A;  2N3S A;  2VQE Q;  1OXX K;  5J3B A;  4JI2 Q;  2VUM G;  1HNW Q;  4YHH L;  3S15 H;  2H5X A;  5IYD H;  1E1T A;  4DV6 Q;  1WYD A;  4LF4 L;  3H3V I;  3S1M H;  2I5L X;  4X65 L;  1PH6 A;  4JI5 Q;  2R7D A;  2QGQ A;  5IP9 G;  4L5R C;  4A3L H;  4GN3 B;  3W1G A;  4R4T A;  5IYC G;  4A3M G;  1XDN A;  2UXB Q;  3Q8D A;  1I50 H;  3K7U C;  1Y14 B;  5IYD G;  3E9H A;  4NPS A;  3A5Z B;  2GVA A;  3PV0 A;  1IBK Q;  1IBL Q;  1W2B A;  4LF9 L;  1EYG A;  3T1Y L;  1N33 L;  4B3S Q;  4JI7 L;  4X66 L;  1QVC A;  2YTV A;  1B70 B;  4LFC L;  3NC0 B;  4XIG S;  1KC8 C;  5ELO A;  3AFQ A;  2ID0 A;  1YHA A;  1RL2 A;  3RLN A;  1Q8K A;  3PIO A;  1V1Q A;  2D0O A;  4GLA C;  1OXS C;  4LF6 L;  1NY4 A;  4YCW A;  1XNQ Q;  4P73 A;  3HOY H;  3MEF A;  4BY7 G;  4DV1 L;  4YCU A;  5GAE C;  4LF5 Q;  4EFB A;  1V9P A;  4DUZ L;  2OQ0 A;  3RLF A;  3WWV A;  3HOZ H;  2ES2 A;  2R7F A;  1VS0 A;  3S24 A;  4DPG A;  2IX0 A;  5DIS C;  2K5V A;  1GKH A;  4POF A;  5LMN Q;  1WI5 A;  4HIO A;  4DUY L;  4GNX A;  4ALP A;  4RMF A;  2Z6K A;  1PV4 A;  3KOJ A;  2ALY B;  1VQJ A;  4A93 G;  4A3J H;  4UCR A;  4LWC A;  3J80 c;  3CPW A;  3RN5 A;  4DV3 L;  5D1P A;  1X3G A;  2RF4 A;  4DR1 L;  4WJ4 A;  2JA9 A;  1UWV A;  3CCE A;  1UE1 A;  2HIV A;  2WP8 J;  5ELN A;  3PO3 H;  3M7N A;  4LUO A;  1I94 L;  1HZC A;  2BH8 A;  4DV6 L;  4IPH A;  3RR5 A;  2HVS A;  4KHP Q;  2JA7 H;  4OWX B;  3E0E A;  5FLM H;  1OXT A;  2MO1 A;  5M5X H;  1N9W A;  5JEA J;  4BBS G;  5FJ8 G;  3HOV H;  1UE6 A;  2CQO A;  3OTO L;  1VQK A;  1PVO A;  3K0X A;  2UUC Q;  2GVB A;  4DV3 Q;  4LFC Q;  4DV0 L;  5M3F G;  4DR1 Q;  3HOY G;  1N33 Q;  4X6A H;  1ASY A;  4JI4 Q;  1QUQ A;  2ASB A;  4QQB X;  3JSN A;  5D1O B;  4PMW A;  3GDE A;  5C44 G;  1EIF A;  3TRE A;  4IOC A;  4X62 Q;  3PF5 A;  3BJU A;  2PQA A;  4IJH A;  4LFB L;  1TWC H;  5LMU Q;  2K4K A;  4LUV A;  4GKJ Q;  1NTG A;  2L15 A;  3FKI G;  3D31 A;  3SGI A;  1HJP A;  3NBH B;  1CKM A;  3J81 i;  2ZM6 L;  1S40 A;  2VNU D;  1LUZ A;  3J80 i;  3CCU A;  3U58 A;  4IPC A;  2VQF L;  4C2M H;  1HZA A;  1T9H A;  1BBU A;  3RN2 A;  4LF4 Q;  4POG A;  2R6G A;  3S14 H;  4IFD J;  4O2D A;  4YY3 Q;  4LH7 A;  2VY3 A;  3S1N H;  4UPA A;  1AE2 A;  1QZG A;  4UP7 A;  4A3J G;  3CP0 A;  4DV4 Q;  3T1H L;  4JI8 L;  2E2J H;  2ZM6 Q;  4A3I G;  3A0J A;  4A3E G;  4DAM A;  1Q82 C;  3I7F A;  4UY8 C;  2F4V Q;  4A3C G;  1VQD A;  1YNX A;  4AH6 A;  1YHB A;  4X66 Q;  3J7Z C;  1KIX A;  1NMG A;  4LF9 Q;  1XPR A;  2A1A A;  2MNA A;  1VQO A;  1N34 Q;  1VQI A;  2BA0 A;  3A5U A;  1SLJ A;  2KHJ A;  4DKA C;  5IY0 A;  4JI7 Q;  4PG3 A;  1XMQ L;  1X3E A;  1R9T H;  4A3G G;  2K5H A;  1Q1E A;  4QY7 A;  4DR7 L;  4P71 A;  2JA6 G;  4JI0 L;  3K8A A;  3HOX H;  2HT1 A;  2MO0 A;  2ZTC A;  3L7Z C;  3F2D A;  2LXJ A;  5JEA G;  3CCS A;  3BZC A;  2D0P A;  1SRU A;  1VQG A;  2K52 A;  1M1K C;  5JJK A;  4DR3 L;  4JBK A;  4LH6 A;  1KHI A;  4HIM A;  1JB7 A;  2WAQ G;  1VQP A;  4JI2 L;  1TWA H;  3E9I A;  3CPF A;  3I4O A;  4GOP A;  1HNW L;  2VQE L;  4KI0 A;  3KDF B;  1VQN A;  3M4O H;  4DK3 C;  1XMQ Q;  3CC4 A;  3HKZ E;  1IBM Q;  5M3M G;  1O7I A;  4X62 L;  2ZTD A;  2JA8 G;  1FJG Q;  2D62 A;  1KL9 A;  3ULP A;  1TA8 A;  4R4Q A;  3K81 C;  3BA9 A;  3H3V H;  1UEB A;  2HHH Q;  4DV2 Q;  1NMF A;  1U0L A;  5BR8 L;  2UXB L;  3TY9 A;  4K0K L;  3PUV A;  4GNX B;  4LF8 Q;  4A3E H;  1TAE A;  2NN6 I;  1ASZ A;  1VQE A;  1N8R C;  1E1O A;  3M4Q A;  1MKH A;  2JEB I;  2HVQ A;  4OWT B;  2I0Q A;  4NB3 A;  3CME A;  2PI2 E;  1GD7 A;  1YJN A;  1HNX L;  1I94 Q;  2B3G A;  1A63 A; 
#chains in the Genus database with same CATH topology
 5KFG A;  2EYP A;  2V4R A;  4GLX A;  3GTO A;  1ZHS A;  4KLK A;  4EGQ A;  4BXX H;  4JI3 Q;  1AH9 A;  4LW1 A;  2F03 A;  1LM0 A;  3A56 A;  1DON A;  3LQS A;  1C0A A;  2EXZ A;  2QEJ C;  4C3H B;  4DXF A;  1ULZ A;  3V6J A;  4FXK C;  3MJF A;  2NN6 G;  2K05 A;  4YY3 H;  1Y69 U;  4OIK A;  4GKK L;  4K6L A;  1RD9 D;  2HQL A;  4B3S H;  3EFX D;  1N33 H;  1STY A;  1YNN D;  2EY2 A;  2K5D A;  3OMC A;  3DLL A;  1PXU A;  3CEB A;  3PSI A;  2K5Q A;  4L8J A;  2HUG A;  2ZJT A;  4LMQ D;  1I50 B;  3I4M G;  1CHP D;  3UDF A;  3OHB A;  3RGX A;  3KLS X;  3N41 B;  1JX4 A;  1B9N A;  2XWB B;  3GTQ H;  1DOL A;  3OWE B;  5AFW A;  3H0G G;  1EY8 A;  1PRT F;  4RH6 A;  1E4F T;  4B3T Q;  1JDB B;  4B3R Q;  4MV9 A;  3KJO A;  4MV6 A;  2AQ4 A;  1NSN S;  2O2L D;  2WDT A;  5FO8 B;  4ECW A;  1JT8 A;  2Q8I B;  3NE5 B;  4FYD A;  1B8A A;  3X3M A;  1ZYR C;  2F4V H;  3JAM c;  3NBY B;  4X66 H;  2PNR C;  3UDG A;  2N55 A;  3T5H A;  2ZXR A;  4C3H H;  4R8N A;  1IXR A;  3KF6 A;  1YZ6 A;  2R7N A;  4DK6 C;  1Y1V G;  3DM1 A;  5NUC A;  2EIF A;  2Q2U A;  4OXP A;  5D3I B;  4M0J A;  4IR1 A;  2SCU B;  4DR4 L;  4NW2 A;  1XNR L;  3K7A H;  1FYC A;  2KQ3 A;  4KKT A;  1GM5 A;  2OTL A;  4HYK A;  5IGF A;  1X3Q A;  4ZQI A;  3TSS A;  1JLL B;  1G29 1;  1I4H A;  4R4C A;  4HJ8 A;  2BE5 D;  1EUD B;  1J5E Q;  1E2Z A;  1EIG A;  1I4G A;  1PFS A;  2IPK D;  2OLS A;  4IO9 A;  1JOR A;  4QWC A;  1QNU A;  3T5L A;  3H91 A;  3E5S A;  4JI1 H;  4P2C B;  5I9P A;  3HKS A;  5LOV F;  3GIJ A;  1SNM A;  5HGQ A;  3GTL H;  2EPB A;  5DLG A;  2B63 B;  1SSO A;  2EYH A;  1LV9 A;  1V51 A;  1RYR A;  4IAL A;  4NXN Q;  1A3T A;  4DF7 A;  5KG4 A;  3Q6S A;  4JW0 A;  4B3S L;  2BOS A;  2NB0 A;  1E4E B;  4K2L A;  4A3F H;  4L5Q A;  3TQY A;  2XIW A;  3WDN A;  3V4S A;  2RQX A;  4HID A;  1BCP C;  2YZN A;  1CKO A;  5CV4 A;  3NUC A;  5KFE A;  2ZXP A;  2CWA A;  2CW8 A;  2R84 A;  2UXD H;  1BXR A;  2C5C A;  1IKM A;  3ONA B;  4RB0 A;  3I91 A;  4BBS B;  2N8N A;  4P72 A;  1AE3 A;  2R93 B;  4RKB A;  3NGD A;  1SYG A;  3L4K A;  3BYY B;  3ERO A;  1WFQ A;  3F2C A;  1GHJ A;  2C9O A;  1UC8 A;  1L1O A;  3PIP 3;  4G7H C;  3TIG A;  2ATW A;  2M2L A;  3W5O A;  1DAA A;  4R7R A;  1KT8 A;  2R92 G;  2DZD A;  1L0W A;  5A35 A;  3I55 A;  1FGB D;  4JI6 H;  5EJW A;  4CJ0 B;  1PH7 A;  1I94 H;  1OTC A;  4O7Z A;  5FLM G;  5FPR A;  3OSN A;  3HKZ G;  3NUA A;  1Y8N B;  1S5C D;  4UCU A;  4KY6 A;  1BCP B;  2B8G A;  2NTT A;  1CZG A;  3HOZ B;  4JI3 H;  4YCV A;  1G2S A;  4ZRZ A;  2F0W A;  4UCT A;  4QWA A;  3PW7 A;  2V4Q A;  1AN7 A;  2CKZ B;  1U4R A;  3KBG A;  3RIZ A;  5JOB A;  4BY7 B;  3HB9 A;  2JEF A;  4DR6 Q;  4EBE A;  1JKJ B;  4LF6 Q;  3PF4 A;  1IZ6 A;  5KT5 A;  4JV5 L;  3T5J A;  2PVP A;  1TWA B;  2BDN A;  5C3E G;  4TUY F;  4ED0 A;  3D4R A;  4UFZ A;  1IL8 A;  3P7J A;  4OO1 I;  4BBS H;  1DZ1 A;  5JJI A;  1OWT A;  1KAA A;  2MPM A;  4DV7 Q;  4XZ3 B;  1I4X A;  2C35 B;  4NDX A;  1BKB A;  2IX3 A;  1GJX A;  3PGZ A;  1XPO A;  1IYD A;  5L9X A;  2XIG A;  3G48 A;  2JA5 A;  1CQI B;  3M3Y H;  1VQ8 A;  4RU9 A;  2VA3 A;  1T94 A;  4IPD A;  5E1F A;  1EY0 A;  1FKA H;  3M85 A;  1PH1 A;  3C46 A;  1D5Z C;  4BY1 H;  2W71 A;  4X3K A;  2XGP A;  4BXX G;  1V1P B;  2FP4 B;  4ME3 A;  1NNX A;  2JA6 H;  1A8V A;  4QL5 A;  4V0B A;  1XTC D;  5JPM C;  1K73 C;  4LUZ A;  3VMM A;  1S0M A;  1S10 A;  3LWB A;  5EWG A;  1UUP A;  1KXL A;  2UUB L;  2BA1 A;  3T9F A;  4H0L C;  5D14 A;  1D6E C;  4HTH A;  3UE0 A;  3OTO Q;  1VMP A;  4L5T A;  4BY7 H;  1HUM A;  4A3C H;  2VR1 A;  4O82 A;  1ILQ A;  3M7G A;  3MWE A;  3C1F A;  1SN8 A;  4ECZ A;  2B2U A;  3ERS X;  2SOB A;  5BWW A;  4O2B F;  1NE3 A;  4ULL A;  4DK0 A;  5K36 G;  3HOW B;  1SR3 A;  2DGY A;  1XXG A;  2I07 B;  4DV7 L;  3H0G H;  4MN3 A;  1VQF A;  2UU9 L;  1CT1 D;  4O7N A;  5BWR A;  1E0B A;  2Q8T A;  2RBM A;  5BR8 H;  3VDY A;  5KFL A;  4KKU A;  3PFF A;  2JA5 H;  4DK1 A;  3BQ0 A;  1L0Y B;  1UE7 A;  3T1Y H;  2XNA C;  3PO2 B;  1A62 A;  2JA7 A;  3BDL A;  4L5S A;  3FP9 A;  5E25 A;  2FMC A;  1Q81 C;  3RV4 A;  5FD6 A;  5EDW A;  2PZU A;  4DR6 H;  3S16 B;  4AYB A;  1IOV A;  1C30 A;  4BBR H;  4RKL A;  2UUA L;  1HR0 W;  4U7C A;  1WCM G;  2COG A;  5C8Y F;  5DGB A;  1RJT A;  1KDB A;  4CDF C;  3DWA A;  3OIP A;  4HED A;  4KN4 C;  5EBD A;  1JWM D;  4XYO A;  4IOA A;  3N42 B;  2KCN A;  4A3D B;  2CZG A;  4OON A;  1EYA A;  3CRK C;  4FFN A;  5CV8 A;  3NBZ B;  5IIF A;  1K8A C;  3CKI B;  4KN7 C;  4A93 H;  2CW0 D;  1SAP A;  1XPU A;  1VQ6 A;  4A3D G;  5C3W A;  5DQH A;  1L2F A;  2VUM H;  1QG7 A;  4J6H A;  4O42 A;  1O75 A;  2R3Z A;  1GUG A;  1QZH A;  1R9T B;  3GTG H;  3D3R A;  2D2C C;  5KG3 A;  5EWE A;  1KDC A;  2NVY B;  2ASJ A;  1N36 L;  2FIN B;  2R8G A;  2PMZ E;  3K80 C;  4ZYS A;  1YBY A;  5I47 A;  1I6H B;  3KAK A;  4X62 H;  4JBM A;  4JI6 Q;  4MV4 A;  4O4I F;  3GV6 A;  5T1G A;  4O7Y A;  1M0T A;  4QUF A;  3BG3 A;  1PRT B;  2L12 A;  5LMU L;  3IRB A;  4GKJ L;  1XMO H;  3PO2 G;  2YRX A;  2D5D A;  3VR5 A;  2YU9 A;  4K0K H;  2Q2H A;  3S16 H;  3GB8 B;  3I4M H;  2ICE C;  2SNM A;  1GSH A;  3RUZ A;  4JOI A;  2CCZ A;  1NR4 A;  2AUJ D;  2RDF A;  1WTW A;  1N32 Q;  5C3X A;  2KHI A;  2AKW B;  5DQI A;  5KG6 A;  2LS0 1;  3KHH A;  1K28 A;  3EBE A;  3PN1 A;  4BA2 I;  4OO1 H;  4C3J H;  5DG9 A;  1EWI A;  1GO3 E;  1GGO A;  1A15 A;  1KTK A;  3ZJY C;  2EJ0 A;  2A6E C;  2R8I A;  2DY8 A;  3KXY T;  4Q4D A;  5I2X A;  4KHP H;  4HMJ A;  4NXM L;  1PA6 A;  2VB3 X;  1M4V A;  3F8T A;  1BBX C;  4AQY L;  3PMF A;  3DF7 A;  3OHA A;  2W9B A;  4HJ7 A;  2CHB D;  3SK4 A;  2V1C C;  5LMN L;  2FFK B;  1NBW A;  1A0I A;  3QOL A;  2QEX A;  4ZUJ A;  5BPF A;  4O3N A;  1SE4 A;  1EYZ A;  2B2T C;  1XMQ H;  1HNW Q;  3SK8 A;  4YHH L;  2H5X A;  3QR8 A;  1B53 A;  2L5T A;  3M4O B;  1E1T A;  4DV6 Q;  1WYD A;  4LF4 L;  5KG2 A;  4WBN F;  2A68 D;  4ZKB B;  3H4B A;  4X65 L;  1SYD A;  2QGQ A;  4HR7 B;  4A3L H;  3ETJ A;  5IYC G;  4K5W A;  1TWF B;  4X3S A;  3E9H A;  4C2M B;  1O7Z A;  1W2B A;  1EYG A;  2J9G A;  4KK7 A;  4B3S Q;  4X66 L;  3SI8 A;  4KJN A;  4DR2 H;  1PYW D;  5ELO A;  2ID0 A;  1CS0 A;  3UI2 A;  1RJR A;  1YHA A;  1SFO A;  3I4L A;  1Q8K A;  1OXS C;  1F2L A;  4BY7 G;  1Z2N X;  2ES2 A;  2R7L A;  5BMV F;  2F0U A;  2R7F A;  3BQ2 A;  1TS4 A;  1CA5 A;  3T54 A;  2UXC H;  2JEG A;  2UVU A;  3VA5 A;  3GTM A;  1STB A;  2K5V A;  1TII D;  2K33 A;  3TW7 A;  1S4Z A;  5LMN Q;  2CQY A;  2I46 A;  4HIO A;  4EQN A;  4QMG A;  1VQJ A;  4A93 G;  4UCR A;  3VOT A;  3CPW A;  4GKK H;  1X3G A;  4WJ4 A;  3WWJ A;  1B1Z A;  3JZ6 A;  2XRS D;  3A8K E;  3PO3 H;  5ELN A;  4LUO A;  4IUQ A;  3HOU B;  1K1Q A;  5KT4 A;  4OWX B;  3E0E A;  2XN9 C;  2WAQ B;  1N9W A;  4MTK A;  4BBS G;  3KTM A;  1EFI D;  4DV0 H;  1EZ8 A;  4PMB A;  4ZLT F;  1UE6 A;  2XCA A;  4F4Y A;  2XGQ A;  5I5T A;  5DQG A;  3K0X A;  2GVB A;  4HSP A;  3UZB A;  3J7A V;  4DR3 H;  3U0G A;  4DR1 Q;  1B4O A;  2W57 A;  3LP8 A;  1N33 Q;  1B50 A;  2DY7 A;  1ASY A;  1JQY D;  3KK7 A;  1JWS D;  4G7Z C;  4JV1 A;  4JPB W;  1DJR D;  3JSN A;  4C5C A;  1KLU D;  3J80 W;  4J9P A;  3HS0 C;  2W6M A;  2PQA A;  2DPJ A;  4ZAI A;  2Z04 A;  2K4K A;  1QWY A;  4DL5 A;  3FKI G;  3D31 A;  4I65 A;  3M9O B;  1AZP A;  4CMD A;  3J80 i;  1N56 A;  3K0Y A;  1TT2 A;  4IPC A;  1WTH A;  3NSW A;  4LF4 Q;  3RN2 A;  2R6G A;  4LH7 A;  3GIL A;  2F0L A;  4A3J G;  4G7O C;  4DV4 Q;  1ROD A;  4WD3 A;  4A3E G;  4IFD H;  1N36 H;  2NVY A;  5FLX W;  4UHV A;  4UY8 C;  4A3C G;  3J7Z C;  4AH6 A;  1HNX H;  5KFS A;  3CU7 A;  4FFR A;  1VQI A;  4A3M B;  5C44 B;  1XMQ L;  1X3E A;  1R9T H;  3GTG B;  4A3G G;  2HGS A;  2C22 A;  4DR7 L;  4P71 A;  4YHH H;  2JA6 G;  5J1Z A;  3HOY B;  3HOX H;  2J0T D;  3GV5 B;  3BYT B;  4NXN H;  2LXJ A;  4KY5 A;  2AGO A;  5BN4 A;  1ICF B;  4O83 A;  4JBK A;  4X64 H;  1OBD A;  4HIM A;  4KD4 A;  5KS8 A;  3I4O A;  3CPF A;  4Q0Y A;  4O84 A;  3FMC A;  3MWD A;  1KDA A;  2Y0S B;  1HNW H;  1IBM Q;  3V2T A;  1AP0 A;  5IT9 E;  4QIW B;  5KX5 F;  2ZTD A;  3BDC A;  3ULP A;  5BWT A;  4CKB A;  1I4P A;  5KIX A;  1RHP A;  3H0G B;  2AUK A;  4KV6 A;  4MTD A;  5BR8 L;  4GNX B;  4LF8 Q;  2RDI A;  1N8R C;  4N9P A;  1E1O A;  1MKH A;  3M4Q A;  3SNO A;  4EG0 A;  3IFD A;  1EHI A;  3GJX B;  3MVV A;  1I94 Q;  4OEM B;  4JOI C;  1DM0 B;  3UDI A;  1V1O A;  1G8Z D;  4DNI A;  1Z2P X;  1CSQ A;  4UCS A;  1EU4 A;  3TIN A;  2ODT X;  1IOW A;  2YZG A;  2LXK A;  1PTO H;  4RG1 A;  2ZDG A;  4YAJ B;  1JIH A;  3R2I A;  2WTF A;  4FO2 A;  4ED7 A;  5IGD A;  2R7Z H;  4EYH B;  3TEH B;  1MHW C;  5DLQ E;  3J81 L;  4MA5 A;  2E5L Q;  1VMC A;  4DNT B;  3OOC A;  2NVQ H;  2FE3 A;  1H9S A;  1JMC A;  2R8H A;  1PH4 A;  1EOT A;  1MZB A;  3G4S A;  3TZD A;  1N36 Q;  3S14 B;  1CQJ B;  1UAP A;  5JJL A;  2A19 A;  4DL4 A;  1B04 A;  1VDZ A;  2L55 A;  5C5L A;  4PNY A;  1GLV A;  1KJ8 A;  2F3W A;  2NU6 B;  3T9A A;  3ULL A;  5M3F H;  1A6X A;  2WB1 B;  2UXC Q;  3NPP A;  3RB6 A;  4AYB G;  3F2B A;  3CSW A;  3H15 A;  2F4V L;  4EX5 A;  2JA5 G;  3TQ1 A;  2DUD A;  2N78 A;  2NVY H;  4DV0 Q;  2MCT A;  4IRC A;  5EQ0 A;  4ME5 A;  2WKC A;  3AU7 A;  5I60 A;  2RHQ B;  2K28 A;  1H9R A;  1IYJ B;  3R5F A;  1PYS B;  3IKJ A;  2VZA A;  1WTV A;  4LFC H;  2I8C A;  2PQE A;  4DR2 L;  5EKK A;  1TWA A;  3MAQ A;  2UU9 H;  2A6H C;  2QKI C;  4TQU S;  2R82 A;  5BYA A;  1J6Q A;  4EEQ A;  3TBI B;  5I5W A;  5KT7 A;  2BQ3 A;  4WJ3 M;  2XSC A;  5FO9 B;  1PH2 A;  4HJ9 A;  2YCH A;  2E5L L;  3WOE A;  1TWC B;  2F52 A;  3E5N A;  1TWG B;  1LO5 D;  1CFM A;  1FL0 A;  4BBR B;  1ILP A;  1TY0 A;  4AQY Q;  3PUX A;  3KFU A;  5DNF A;  3GQC A;  4FM9 A;  2ENB A;  3HZX A;  2NZH A;  5KND A;  3BVZ A;  4QW9 A;  4CJ2 C;  4LF7 L;  2HVR A;  1F9Q A;  3T5K A;  3GTP H;  3L9A X;  5FLX c;  5JVG 3;  4DUZ Q;  3T4A C;  1E22 A;  4CC6 A;  5IT9 L;  3G8D A;  1SFO H;  2R92 A;  4ETS A;  1E3P A;  1PDQ A;  1S3O A;  4Z9C B;  3ZYY X;  2AWO A;  3V05 A;  3IFT A;  4Q5V A;  2YYA A;  4RUC A;  2JN4 A;  4GS3 A;  1SCU B;  2RCN A;  4A75 A;  1KEE A;  2PW7 A;  5LP6 F;  5IP9 H;  1RKN A;  1EIY B;  5C0X I;  4KKS A;  3GTO B;  3ER0 A;  1OXU A;  1LAC A;  2G9H D;  2HGW A;  1YI2 A;  2JP1 A;  3I4N B;  2HJW A;  2I80 A;  5LMN W;  4M8A A;  2IMW P;  1YJW A;  5H80 A;  4JI7 H;  4IZ8 A;  5JJZ A;  1G6P A;  2M05 A;  3CF5 A;  4E4T A;  4FFM A;  4F50 A;  4OGQ C;  4R4O A;  2R93 H;  5BWU A;  1Z2O X;  2W9C A;  2FMA A;  3NEL A;  5C4X H;  4A3B B;  4K0K Q;  1WR2 A;  1HZ9 A;  3DHQ A;  4XT3 B;  4RZR A;  3U4V A;  4B3T H;  5H1S E;  3J81 E;  1QVF A;  3TME A;  4Q8E A;  2HQE A;  1A2T A;  4J9N A;  3FPU B;  2JJQ A;  2Z0S A;  1M8A A;  5GAD C;  4UDU C;  1QIL A;  2A74 C;  2TMP A;  3AFP A;  1FVI A;  3A7L A;  4BA1 I;  1RTN A;  1VQB A;  3NEN A;  5C0X J;  1JDE A;  2A69 D;  4C3I G;  1XMO Q;  3CC2 A;  2BDO A;  1HHV A;  4I4T F;  3HKZ A;  3K7A B;  1NJI C;  4C3I B;  4NXM H;  4AIM A;  1XNR H;  3RMH A;  1KRT A;  1TR5 A;  3J81 j;  2QW7 A;  3M9B A;  1SMX A;  3F8N A;  3HOU H;  1V43 A;  3I4N H;  2XCL A;  4CKE A;  4LJZ C;  3PUZ A;  3Q22 A;  4JI0 Q;  4RB1 A;  2C2R A;  5JEA H;  2IX1 A;  2VL6 A;  3H20 A;  1MI2 A;  2JK8 A;  4FP5 D;  4HN7 A;  4HMI A;  3VPD A;  2VQE H;  1WH2 A;  2VOB A;  4P74 A;  4O7S A;  4J15 A;  2K7V A;  4EGV A;  4XDX A;  4OX9 Q;  3DTF A;  4DUZ H;  4ID6 A;  3QZ8 A;  2JA6 A;  3CHB D;  2NBF A;  2X5R A;  4PZ6 A;  2NZO A;  3EIV A;  1HNZ Q;  1TS5 A;  2AHO B;  4IAJ A;  3RZD B;  4R1J A;  1CHQ D;  3OPO A;  3FKI H;  3PCO B;  1AUX A;  2B63 H;  1D7Q A;  3RLO A;  4KY7 A;  2O5J C;  2IP4 A;  3VR4 A;  5C4Z A;  1HTL D;  4EBC A;  2EJ3 A;  1PK8 A;  2CWP A;  5CMD A;  2W6Q A;  5IYC H;  3NXW A;  5KFB A;  1K8O A;  1TWG H;  3HFZ B;  1A48 A;  1Q46 A;  2R8K A;  1O78 A;  4JVZ A;  1I3Q H;  4HR7 A;  5LL6 X;  4I55 F;  3U55 A;  1CUK A;  4K14 A;  5EBC A;  4F4Z A;  2KEN A;  1F2Y A;  2WB1 A;  1G51 A;  2GA4 B;  2K5N A;  2DAB A;  4JK1 C;  4YWK A;  3CC7 A;  3QFF A;  1F77 A;  1E4E A;  4CE5 A;  1AUV A;  2X6L A;  5JPN C;  3HOX B;  1TS3 A;  4TQS A;  4ED2 A;  2FLL A;  4OO1 G;  2FLP A;  2E2H H;  2W9B B;  2F0M A;  1ML0 D;  4NMZ A;  1CKN A;  3JAM E;  3SE0 A;  5IOC A;  1F9P A;  1SDF A;  1VBG A;  3S2H H;  1GUN A;  1ZYR D;  5FLX L;  3UQ8 A;  1JXL A;  2IHE A;  1SE3 A;  4ME6 A;  4TKO B;  4N8X 1;  4HAE A;  5J22 A;  3S1Q H;  2UVR A;  3QO2 A;  1PRT D;  2KSW A;  1L1O B;  2UXD L;  3G71 A;  3FEW X;  1MSG A;  3PO2 H;  1I5F A;  3EJI A;  2NYZ D;  5KFA A;  1VQA A;  2F0N A;  2YYZ A;  2LKV A;  4ILW A;  1QB5 D;  5CBA E;  4X65 Q;  3R5X A;  1T36 A;  3DM3 A;  3GIK A;  3H94 A;  4A3B G;  1X32 A;  4PZ8 A;  3TS0 A;  2EJM A;  3DXJ C;  4HJ5 A;  4DV5 L;  1UE5 A;  4CDD C;  2MUY A;  4FDB A;  1I2L A;  5HY6 A;  4IFD I;  3L0O A;  2EYO A;  5I5S A;  4XTC S;  1C3O A;  4RNO A;  2LY7 A;  5ELF A;  1CE8 A;  2UUB Q;  3I4N G;  4ECU A;  3VPC A;  1SYC A;  1WTP A;  3TP6 A;  1CA6 A;  1J8I A;  3CQZ A;  1RIP A;  4G57 A;  1ZET A;  4JBJ A;  2F4I A;  1CSP A;  4EYI B;  1S9F A;  1CZW A;  3BG5 A;  3T1H Q;  3K3P A;  2JE6 I;  1TS2 A;  1VQ9 A;  3CW2 C;  3GTM B;  3RB0 A;  1BUV T;  3AB9 A;  1SYE A;  3Q24 A;  1YEZ A;  4OIJ A;  1YJ9 A;  3TP7 A;  1FGU A;  4LF5 L;  1H9K A;  2YS7 A;  1PTO B;  2NN6 H;  5C0X G;  4I50 F;  4YJ3 F;  3GIM A;  2YW2 A;  3PIP A;  3LWU A;  3P20 A;  4DAY B;  4BWS C;  2XTI A;  1K3B C;  2B2W A;  4DL3 A;  3N6X A;  1K83 B;  1HNZ H;  4XXE A;  1PFM A;  1VQM A;  2Q2T A;  3C3L A;  5M3M H;  3GTO H;  1N48 A;  4JCV E;  4H44 C;  4YIJ A;  3T56 B;  4B3M L;  1H9M A;  4DUY Q;  4JV0 A;  1L0X B;  4MV1 A;  3KHL A;  2HIX A;  3PO3 G;  4C3J G;  1WSC A;  4BBR G;  2XRQ D;  1IBK L;  4MV3 A;  2KEC A;  2ZM6 H;  2IBK A;  3TQT A;  4J9O A;  1Z6H A;  2R85 A;  2EY1 A;  1C9O A;  5IP7 H;  4YWM A;  4F87 A;  4WJW A;  3OW2 A;  2UUA Q;  3N8D A;  1KJI A;  3E0J A;  3STB D;  1AN8 A;  3W3A A;  2FKL A;  2YU9 H;  4S3S A;  1PMR A;  2YTX A;  2R6F A;  3JAM W;  5CV7 A;  4APV A;  2K03 A;  2W8K A;  3OWF A;  4YWL A;  4DRF A;  1YIJ A;  2PNH A;  4A3B H;  1N32 L;  5C4X B;  3F2U A;  5BN3 A;  5IT9 W;  1K8G A;  2HDK A;  2JA7 B;  3HP3 A;  3T51 B;  4DR7 H;  2JA5 B;  2Q7D A;  4ED1 A;  4RHS A;  4AYB B;  2NVT H;  1KNA A;  4EFE A;  4K5V A;  2WB1 G;  2J6U A;  1KNE A;  1E2V A;  5J3B A;  2VUM G;  1W93 A;  4CKC A;  3Q23 A;  3S15 H;  4IZO A;  4YR0 A;  5C4H A;  1V1P A;  3NWS A;  3H0G A;  3S1M H;  4ZI7 F;  5HV6 A;  2I5L X;  2JA6 B;  4L5R C;  5I4D A;  3W1G A;  5I5X A;  4R4T A;  1EKF A;  1SMY D;  4A3M G;  3V4Z A;  2NVX A;  1IW7 C;  2L11 A;  4FF4 A;  1IBK Q;  3T9C A;  2GVA A;  2AQ3 B;  3KAL A;  4RNM A;  2H4O A;  4LF9 L;  3H4D A;  3T1Y L;  4A3E B;  1B70 B;  4LFC L;  5DGI A;  2EE1 A;  4GC6 A;  4PQX A;  4XQN A;  1H95 A;  1RL2 A;  4B9W A;  4DR6 L;  1I1L A;  1V1Q A;  2D0O A;  4LF6 L;  5CB4 F;  1ZKO A;  1XNQ Q;  3TII A;  2NUA B;  3RZO B;  1EZ1 A;  3K5M A;  1PTO F;  1Z7T A;  1TKW B;  5KNB A;  5GAE C;  4LF5 Q;  1V9P A;  2YZL A;  4DIM A;  2Y0S A;  3WO0 A;  3HOZ H;  3J7A F;  3R5H A;  3EQL C;  2E5L H;  3GV8 B;  2AQ1 B;  4RFB A;  2EOT A;  4CHT B;  3T9D A;  2IX0 A;  5DEH A;  4DAV A;  3K59 A;  3MR2 A;  1S0O A;  1SNQ A;  4LF8 H;  4DUY L;  1PV4 A;  4JI8 H;  3KOJ A;  3DWQ A;  3GV3 A;  5KFI A;  3J80 c;  3RN5 A;  1RK5 A;  1CK1 A;  3MZ5 A;  1F2Z A;  2WP8 J;  3PR4 A;  1I94 L;  5IGC A;  4FF1 A;  2BH8 A;  4DV6 L;  4IPH A;  3I12 A;  2M9V A;  2NU8 B;  4FU0 A;  3QQM A;  1ESF A;  2HVS A;  2ABJ A;  5FLM H;  1OXT A;  1I6U A;  4QF4 A;  4J1M A;  5KFD A;  3HOV H;  3RD4 A;  3OTO L;  1PVO A;  5EOY A;  4TQR A;  4A93 B;  4UUG A;  4LFC Q;  4FE2 A;  4FFL A;  2CH4 W;  3HOY G;  2E2H B;  3R8B A;  2GPS A;  2FK1 A;  4ECX A;  2WIN B;  2V58 A;  2AU0 A;  4IR9 A;  2PCF B;  4JI4 Q;  1A9X A;  4QQB X;  1R9T A;  2DJG C;  2A6E D;  5C44 G;  3GDE A;  1EIF A;  3S2H B;  4IOC A;  4X62 Q;  5KFN A;  1WTX A;  1EY9 A;  2W6P A;  4LFB L;  1NTG A;  3J81 i;  2VNU D;  4O3R A;  1EWH A;  2L9H A;  3CCU A;  1YNJ C;  2EY6 A;  2F0J A;  2OF1 A;  3BZD B;  3U58 A;  4C2M H;  1HZA A;  1BNC A;  1XX8 A;  4O81 A;  1TWF A;  3GV7 B;  4A3J B;  5A2Q W;  2H1E A;  4G3I A;  4O2D A;  4YY3 Q;  2EYF A;  3GTL A;  3S1N H;  1QZG A;  1EQV A;  4JI8 L;  2ZM6 Q;  4FF3 A;  3A0J A;  3T13 A;  4KTA A;  4TV8 F;  5CE8 A;  2F4V Q;  4RAZ A;  1YNX A;  3FKI B;  1FNU A;  4LF9 Q;  1IKL A;  5KNC A;  2PMZ A;  2BA0 A;  4UAI A;  1PZI D;  3A5U A;  2KHJ A;  4HNU A;  5E4X A;  1XNQ H;  3UYY A;  2OEO A;  2K5H A;  4ECS A;  2NVT B;  1ONL A;  3K5H A;  4PWQ A;  1EY5 A;  2PPB C;  2A73 B;  1WD0 A;  4B3M H;  2ZTC A;  3L7Z C;  5JEA G;  3BDO A;  1D2B A;  1SRU A;  1M1K C;  2VXW A;  2EVB A;  2CNV A;  3S1M B;  4LH6 A;  1KHI A;  2Z8L A;  2WAQ G;  5T1I A;  1VQP A;  4JI2 L;  2E74 C;  3NQT A;  4KI0 A;  2VQE L;  3M4O H;  1HR0 H;  1DIK A;  1SJE D;  2F3V A;  2VB2 X;  4O3O A;  2PBZ A;  1I3Q B;  3Q8R B;  3U9O A;  5KFO A;  1XMQ Q;  4JI2 H;  1O7I A;  2QDB A;  4X62 L;  2G5D A;  2BR0 A;  3TW6 A;  3K57 A;  1UEB A;  3BVM A;  1SE2 A;  4DV2 Q;  5J39 A;  3VPB A;  3HGB A;  5F2D A;  1E4G T;  1U0L A;  2J6T A;  4K0K L;  3PUV A;  5CGK A;  4FGR A;  4YAK B;  1EKV A;  4TV9 F;  1KBL A;  2OT2 A;  4NLG A;  1ICW A;  3MA2 B;  2NN6 I;  5I9O A;  1HA5 A;  3KAJ A;  1IBL H;  3OHX C;  2I0Q A;  4K8I A;  1LT6 D;  2EY5 A;  3A54 A;  1C48 A;  1GD7 A;  4HCE A;  1SND A;  5BN5 A;  1O7L A;  1A63 A;  1VCI A;  3MC0 B;  1VQ5 A;  4RAU C;  3GTQ B;  2COJ A;  4JBW A;  1PH8 A;  4JI1 Q;  2QIL A;  4A3F G;  5FKA C;  3A74 A;  3ULJ A;  2WAQ A;  1AFP A;  4JI5 H;  3RZD H;  4QB4 A;  5KFH A;  3J80 L;  4RUA A;  1ZXT A;  4BWG B;  3TS2 A;  3K5O A;  3BAC A;  1SXT A;  1JOO A;  2R7Z A;  4JI3 L;  4TRD A;  3NTK A;  2W9C B;  2EDG A;  2K6A A;  3KHR A;  2RGR A;  1L1O C;  4DV3 H;  2FPP B;  4BS9 A;  4GN5 A;  1FNW A;  2V59 A;  1VQ7 A;  4A3K G;  5LMN H;  5A2Q E;  5F9N A;  4YY3 L;  1U4P A;  2XC9 A;  1ZEQ X;  2W7O A;  4GKK Q;  3SK5 A;  3ITP A;  4LF5 H;  3GD7 A;  4LK1 C;  3LML A;  2C2E A;  4MNO A;  5KFU A;  1M7J A;  1SMY C;  1WTQ A;  4B3M Q;  3WWI A;  3T9B A;  4O7W A;  1XNR Q;  1GXD C;  5DM6 3;  2VPQ A;  1LTL A;  2JEI A;  2L1B A;  3NWT A;  2F3I A;  1Y8P B;  2GQR A;  1S03 G;  1X56 A;  4L6T B;  2VQF H;  1X65 A;  3TP5 A;  2VQD A;  4DR3 Q;  1QOH A;  1BVS A;  5IYZ F;  3KBX A;  4FFO A;  3RFC A;  3C0F B;  4AYB E;  1W96 A;  4H13 C;  4QIW A;  2UVW A;  3M9N B;  5C6A A;  2N49 A;  3DUZ A;  3GTJ B;  4FXD A;  4OX9 H;  2JA8 H;  3J81 c;  2JYO A;  5IP7 G;  5CBE E;  2V4D A;  3TRZ A;  4RGM A;  5EPK A;  3T1Y Q;  1PH5 A;  3LNN A;  3KUP A;  3OMG A;  3QWU A;  1KAW A;  4C5B A;  4RGO S;  2IJ0 A;  4FBT A;  3MWY W;  3KDF A;  4JI0 H;  3PIO 3;  3HOW G;  3U50 C;  3O13 A;  3QOJ A;  3RTX A;  4JI4 H;  2Z02 A;  3E6Z X;  3HG9 A;  4YBZ B;  1K9M C;  4J9Q A;  4FBU A;  4QWB A;  1WVL A;  3K58 A;  1RCV D;  2HDL A;  2LSS A;  2VUG A;  1HNZ L;  1IL2 A;  3RAX A;  1QNK A;  4X64 L;  2PN1 A;  3F1Z A;  3GLK A;  1TWH B;  3BJY A;  2VPS A;  4ZK9 B;  5HNE A;  1HA6 A;  2Y0S E;  2B2U C;  4PV1 C;  3CMA A;  3T1H H;  3OW7 A;  4DNR B;  1KD1 C;  1GUW A;  3UE1 A;  1YVC A;  1X3F A;  3P1H A;  4IUV A;  1HZB A;  2R7Z G;  2NVQ B;  2WFW A;  2A1H A;  4DAA A;  3FKI A;  1Z9F A;  1HQM C;  2KCM A;  3CD6 A;  1T5E A;  3J7A 5;  1RDP D;  2OXP A;  3CCJ A;  2B2V A;  1WCM B;  4XT1 B;  3LGJ A;  1X9N A;  3KF8 B;  3TY8 A;  1FNV A;  2WKD A;  2ZGI A;  4DUY H;  1H9S B;  1WRV A;  2F0K A;  3OUU A;  4E6N A;  2HD3 A;  5EGT A;  4O4J F;  3A8J E;  5KKN B;  4YQW A;  3PW2 A;  5EPJ A;  5C3E B;  4QCL A;  3S1R H;  1BQQ T;  2JSO A;  4EQP A;  2PYK A;  4GOP B;  4DAY A;  4DQN A;  2EJG C;  4A3F B;  2YL2 A;  4J0M A;  3ERQ A;  1WTR A;  4JYA L;  2FK3 A;  4DR5 H;  5M5W H;  2G9D A;  3VNN A;  4ECY A;  5KFZ A;  1KJQ A;  1Q8I A;  5T14 A;  2BE5 C;  1Q7Y C;  1HUN A;  3CQZ H;  3NQI A;  3C2P A;  3Q0A A;  2HGX A;  3J7Y W;  4KJO A;  5C0X H;  4QIW E;  1B9M A;  2Z4H A;  5KFV A;  4C1N K;  1PH3 A;  1EYC A;  4DR7 Q;  1JE4 A;  4IUN A;  3DAA A;  1HTP A;  4X3T A;  2AQ2 B;  1O7Y A;  1U4L A;  5AJ3 L;  5KFY A;  1S97 A;  3D4D A;  1E24 A;  2ZDH A;  3FPP A;  3K6O A;  5CAE B;  3HT5 A;  5L1I A;  5IWA L;  3U54 A;  5CV5 A;  4WOR A;  4GOP C;  4JV5 Q;  4RGT A;  3K5N A;  1EY6 A;  4A3K H;  5E4W C;  1K3R A;  4R4I A;  4HJA A;  3J81 W;  3GID A;  2O4X A;  4JI5 L;  1XYI A;  2CNQ A;  2ZDQ A;  4J9S A;  1TWG A;  3DWP A;  1B3Q A;  1I6H H;  3PW4 A;  3W1B A;  1Y1W A;  1BCP F;  2F0O A;  4NP5 A;  2Z6K C;  1K83 A;  1DOM A;  2K75 A;  1JJG A;  3IL8 A;  3N6R A;  2UXB H;  3KYH C;  2RKS A;  3VA7 A;  1KLG D;  4A3G H;  1LTG D;  2I5H A;  5L1J A;  4OX9 L;  1SNP A;  3BAA A;  1G6Z A;  2COI A;  3OSP A;  1STA A;  1JCK B;  1TQO A;  4J9K A;  2UU9 Q;  4LFA Q;  4IJL A;  2B63 G;  3I8Z A;  2MHV A;  5K2M A;  2OQK A;  4EQ5 A;  3R3O A;  2W6N A;  5GRO A;  4CMF A;  2RVL A;  3PW5 A;  2E2I H;  1SRO A;  5DAU A;  2AWN A;  1JE5 A;  3GII A;  1PTO D;  1HR0 L;  1L2Z A;  1TWC A;  3AYH B;  2YTY A;  4RCN A;  2VQF Q;  1M6V A;  4F7X A;  5A2Q L;  4A3L G;  1D8L A;  2I87 A;  1VQ4 A;  5C4J B;  1N34 H;  1IHZ A;  1W3S A;  1PHJ A;  4KMU C;  3HOZ G;  1EKP A;  2DPI A;  5IWA Q;  4MHE A;  4A76 A;  2WAQ E;  3G6E A;  5C5J A;  1IW7 D;  4PMC A;  3HKZ B;  3HEJ A;  3LUL A;  3C1E A;  4ECQ A;  3H09 A;  3R23 A;  4DV6 H;  3GTJ A;  1ENA A;  3KLS A;  1D1K A;  4IWX A;  4RNN A;  5G3L D;  4J9L A;  2EXD A;  3GTP B;  1R4Q B;  3LX0 A;  2R92 B;  4ED8 A;  3G6V A;  3SVM A;  3GQB A;  4AQY H;  1O80 A;  4UCO A;  2QDL A;  5JAV A;  1HPC A;  5FJ8 H;  1ENF A;  1A3V A;  2NVX B;  4C3I H;  3AMU A;  1Q3L A;  4LMY A;  1Q90 A;  3KHG A;  1TWF H;  4WFN 3;  2R93 G;  5JUM A;  1RK6 A;  2KCC A;  1S68 A;  3K3V A;  5I5U A;  2HHF B;  1WJJ A;  2CVR A;  1SJH D;  1SEB D;  4MV7 A;  3RF2 A;  1MD2 D;  5DG8 A;  3CCQ A;  4YR3 A;  1A2U A;  1R4P B;  4YB8 B;  3GTJ H;  4H02 A;  3Q1K A;  1VQL A;  2FB9 A;  3JRW A;  4F4W A;  1X55 A;  1C7Y A;  4MAM A;  2W7P A;  5CYU A;  4CC5 A;  1UEA B;  1FJG L;  2ASL A;  1P16 A;  2EJ2 A;  5HUR A;  2P5Z X;  4YJ2 F;  5L37 A;  3I70 A;  1EIH A;  3BZK A;  4JYA H;  3BU2 A;  1HXY D;  3FVQ A;  1X54 A;  2CW7 A;  2Y4R A;  2F0F A;  4I7A A;  1B7Y B;  4DXG A;  4DR2 Q;  1PH9 A;  4EBD A;  5COY A;  3U9S A;  1CTM A;  4DV7 H;  2IHF A;  1STN A;  4FS1 A;  4EVO A;  1TWH H;  4ECR A;  3RB4 A;  4DL6 A;  3NBH A;  5KFJ A;  1K0S A;  5FO7 B;  2R92 H;  3I3C A;  3JAM i;  4XYM B;  3ND9 A;  1YHQ A;  1WCM A;  5GAH C;  3OTO H;  2R93 A;  1I6V C;  3GIP A;  2J7Z A;  2BH2 A;  2NVX H;  1TU2 B;  2X69 A;  2KCT A;  4KHZ A;  4NXM Q;  2YRW A;  4OEL B;  2VUM A;  1DV2 A;  1EUJ A;  1JJC B;  3FRP B;  4JI8 Q;  4O2A F;  5IYB G;  1T5X D;  2EYJ A;  4I7Z C;  2PMZ B;  4MV8 A;  3HXL A;  2L4N A;  2YV5 A;  5LL6 b;  1EY7 A;  1Y1V B;  1F2M A;  3TEK A;  4JI6 L;  1BJT A;  1HR0 Q;  4ZOL F;  3MR6 A;  2K1B A;  2ATL A;  1MBY A;  3EPG A;  5KYI A;  1LTI D;  2ZJQ A;  1RJP A;  3MXN B;  2WII B;  5BR8 Q;  2E2I A;  4IRD A;  5FK9 C;  4O0A A;  3JRX A;  3PVX A;  3QG1 A;  5D3D A;  1RYS A;  2A8V A;  4LNQ A;  3ETH A;  3TN2 A;  1S5B D;  4UP9 A;  1VBH A;  5JVD F;  2VA2 A;  5KRU A;  2RHS B;  3D4W A;  3EN2 A;  4B3T L;  5C4X G;  2KHS A;  3KLW A;  1AW7 A;  3CAM A;  1I1M A;  1BR9 A;  2A6H D;  4RB3 C;  2N3S A;  3GP7 A;  2VQE Q;  5KFX A;  1OXX K;  3M9M B;  2UUC H;  2FMM A;  3HBL A;  4H7B A;  1SNC A;  1ZAU A;  4R8U B;  1HFN A;  4IUT A;  5IYD H;  2KVM A;  3I4M B;  4ZQ3 A;  4DN4 M;  1PH6 A;  4HSV A;  1PRT C;  3DMU A;  5IP9 G;  4ED6 A;  4GN3 B;  2BQR A;  5KFM A;  1XDN A;  2IW3 A;  2QF7 A;  4DAP A;  4X65 H;  3PO3 B;  2A5H A;  3K7U C;  5I2Y A;  1CQF A;  1QVC A;  2YTV A;  4A3I B;  4K2K A;  4C3H G;  3NC0 B;  3IG0 A;  1KC8 C;  1UC9 A;  2RCF A;  3AFQ A;  3D6C A;  1J9O A;  3PIO A;  4GLA C;  1NY4 A;  4YCW A;  4P73 A;  2GPW A;  4DR1 H;  1IBM H;  3UZO A;  4DV1 L;  4YCU A;  4EFB A;  3FDS A;  3G6J B;  3EPI A;  3WWV A;  3PW0 A;  1GUT A;  5EKL A;  2ASD A;  3S24 A;  3NTI A;  2HDM A;  1TVX A;  3S1Q B;  4POF A;  4G4K A;  1MGS A;  3GTK A;  4LWC A;  3N52 A;  1B44 D;  4DV3 L;  1FR3 A;  4HQ6 A;  3VYR A;  5D1P A;  4J8Q A;  2RF4 A;  2HCI A;  5ISR A;  2NWG A;  2JA8 B;  2JA9 A;  2O03 A;  1UWV A;  5DGH A;  2IWH A;  1FJG H;  1BDO A;  2QCP X;  4F8M A;  1UE1 A;  3CCE A;  4O7T A;  3M7N A;  4RA8 A;  2JA7 H;  1LT4 D;  5M5X B;  5KG0 A;  2MO1 A;  5JEA J;  1F9S A;  5K36 H;  5FJ8 G;  4KHV A;  4DL2 A;  2BQU A;  3CQZ B;  3L3O C;  3OIQ A;  1VQK A;  2R7Z B;  4RCO A;  4QWE A;  4DV0 L;  1YNN C;  5M3F G;  4APM A;  4N8F A;  3R2T A;  1QUQ A;  2ASB A;  5D1O B;  4ODG A;  5M5Y B;  2HHF A;  4J9R A;  3TRE A;  4MA0 A;  2CQA A;  3MWM A;  1PZJ D;  1PLF A;  4DV1 H;  3BJU A;  4IJH A;  2FJ2 A;  3SK6 A;  4M7E A;  3OUZ A;  1AEX A;  2L15 A;  2JXM B;  3SGI A;  1B2T A;  1S40 A;  5ELB A;  3QWN A;  4ED3 A;  1OO9 B;  3S2D B;  1AZQ A;  2GLT A;  3WWH A;  2VQF L;  5LHY 1;  1T9H A;  1A0G A;  5F9L A;  1AE2 A;  4UP7 A;  4CJ1 B;  3AW8 A;  3CP0 A;  3T1H L;  2E2J H;  3WO1 A;  5FOB B;  4NZN A;  1N32 H;  4NZO A;  4IRK A;  4DAM A;  3SEB A;  1Q82 C;  2DLN A;  4ABN A;  4RAY A;  3MHB A;  4V19 0;  2O5I C;  4LSX A;  1KIX A;  1NMG A;  4FS2 A;  1XPR A;  4RHR A;  5KGU A;  1VQO A;  1I50 A;  1SLJ A;  4R9W A;  2DWC A;  2EJF C;  4IWY A;  5KG1 A;  1Q1E A;  4QY7 A;  1UNS A;  2HT1 A;  2MO0 A;  4IIJ F;  1I4Q A;  2YU9 B;  3N43 B;  2IA6 A;  2V9W A;  3F2D A;  1LLR D;  1EU3 A;  5LL6 S;  3S1R B;  3ORR A;  1BOS A;  2K52 A;  5JJK A;  3R9R A;  4DR3 L;  3T16 A;  4O7L A;  1HNW L;  4F88 A;  3S17 B;  3KDF B;  2R7M A;  2W70 A;  1QCB D;  3LWE A;  2LFN A;  5DLF A;  5M3M G;  2PZW A;  5CM0 A;  3BS1 A;  2D62 A;  1FJG Q;  1GOZ A;  3BA9 A;  3MXN A;  4HCS A;  3H3V H;  2HHH Q;  3N40 P;  4DA2 A;  1GSO A;  2E2I B;  5I6W A;  1NMF A;  2FPI B;  2UXB L;  1S5F D;  4A3E H;  2B63 A;  3SXH A;  1TAE A;  1I7N A;  3RJ0 A;  3EVQ A;  3CME A;  2MJ8 A;  5KFC A;  2E2H A;  4E6I A;  2UUC Q;  3GTM H;  1HNX L;  2B3G A;  4U6P A;  2OTJ A;  3NEM A;  4A3K B;  3KJP A;  2L0C A;  2SNS A;  1CI3 M;  4O3S A;  1PYB A;  2ZXO A;  5ELC A;  4FNF A;  2VW9 A;  1G91 A;  3RBE A;  3VYS A;  3D8G A;  3GTL B;  1I2K A;  4O3P A;  4F4X A;  5I6Y A;  4O3Q A;  1A3U A;  2YWV A;  4C2M A;  4ECV A;  3VYT A;  3V6H A;  1IYV A;  3S9W A;  1JR0 D;  4CBV A;  2CH4 A;  2X6G A;  3AX6 A;  1Z47 A;  3HRZ C;  2RA4 A;  2FXQ A;  2KBN A;  2KED A;  4JV5 H;  4DR5 Q;  2I5M X;  2VS1 A;  3BAB A;  4Y8V B;  1XNQ L;  2B2Y C;  4K5X A;  3CXC A;  4ZCK A;  5JVL A;  1CQV A;  5IT9 c;  1VKZ A;  1TY2 A;  3I73 A;  2P0A A;  4DV2 L;  1U9R A;  1STE A;  2NU7 B;  5KG5 A;  1C8C A;  1EEF D;  1IYE A;  3KF8 A;  5BWV A;  4MTN A;  1KQS A;  4ZUI A;  1B3A A;  4ZHQ F;  4Y52 H;  2A68 C;  5C4J H;  2JEA I;  1W6K A;  5EKI A;  1HNX Q;  3HOV B;  1CKN B;  2F0S A;  1WOC A;  4QJF A;  2Q2I A;  3JC6 6;  2ZT9 C;  4QW8 A;  1I3Q A;  2K01 A;  2X0S A;  5FR9 A;  1K1S A;  5JQG F;  4O86 A;  1I1K A;  2DNE A;  3TY5 A;  2K5W A;  4MZ9 A;  1MIU A;  1PTO C;  3OYY A;  1J5E L;  3K5I A;  2K14 A;  3UDX A;  3W2D A;  1KJJ A;  3U9T A;  3N44 B;  2B8F A;  5JH7 F;  1BXT A;  4GZY C;  4O1N A;  5DMX A;  5C1O A;  3FHW A;  5CV6 A;  2NUC A;  1VQC A;  2HHH L;  4OWW B;  1EL0 A;  1V4Y A;  2Z9H A;  2GQS A;  1DV1 A;  5AJ3 Q;  2RDG A;  1Y1V H;  2W6O A;  4LF7 H;  3J80 E;  3VR6 A;  5LA6 F;  2F0P A;  1KJ9 A;  3CCL A;  1B33 N;  3L2P A;  2WB1 E;  2PZT A;  1K0R A;  4DR5 L;  4X3U A;  5M9O A;  3M3Y B;  2RDJ A;  2ZJP A;  3V96 A;  3RZO H;  2SDF A;  4M1U B;  2OH2 A;  4LFA H;  2EYL A;  3MR5 A;  2AMC B;  2ZTE A;  1GUS A;  2C00 A;  4BY1 B;  4LF4 H;  1Y8O B;  5FLX E;  4JV2 A;  1DYQ A;  2F0Q A;  1II3 A;  4TVA B;  4RGN A;  5KFK A;  1W6J A;  1QJO A;  2CNU A;  1QVG A;  3L4J A;  4QUC A;  1DCZ A;  5TSS A;  1HRJ A;  3GTQ A;  3K5L A;  1Y1W G;  2KOL A;  1Q86 C;  3I90 A;  5CR3 A;  1IBM L;  3TP8 A;  4I7H A;  3T99 A;  3GO5 A;  1I4R A;  4DV5 Q;  4HNT A;  4GN4 B;  3DEP A;  5HGT A;  4A3I H;  3BVG A;  1XTD A;  2UUB H;  3I56 A;  3J7A K;  2OWO A;  4J9M A;  3NBI A;  3WOF A;  4DV2 H;  4LF8 L;  4UP8 A;  1RJQ A;  4CHI A;  2B29 A;  4IUR A;  3QIA A;  3JZI A;  5FPO A;  3IAY A;  4LFB Q;  3GTP A;  4JG2 A;  3MEH A;  3JSL A;  1ZQ7 A;  5EPL A;  5CA0 F;  2E2J B;  1U5K A;  4QWD A;  4QSH A;  4JI4 L;  1WD1 A;  2R87 A;  1F9R A;  3HO8 A;  4K6N A;  3NHH A;  3HOW H;  2GN5 A;  3SDZ A;  2DIK A;  3GTK H;  4O4L F;  3EYY A;  2W9A A;  4RB2 C;  4L63 B;  5D65 A;  5KT6 A;  3KF6 B;  5FNV F;  1H9J A;  1BNZ A;  2CFM A;  1LT3 D;  4NYE A;  3P75 A;  1ENC A;  4CGY B;  5GON F;  2MP1 A;  3A8I E;  1XMO L;  3V6K A;  4DGZ A;  3PUW A;  3S1N B;  4JYA Q;  3CCM A;  5C5M A;  1GSA A;  4A3D H;  5DGA A;  2XGT A;  5KFF A;  1IYU A;  2M00 A;  2K50 A;  2Y0S G;  1EFW A;  3RGZ A;  2NU9 B;  4DR4 Q;  2KEE A;  1OXV A;  2NZ1 D;  1MJE A;  4JI1 L;  2DN8 A;  3URY A;  3NP8 A;  4Q43 A;  3T7A A;  1BO0 A;  4MIU A;  3PZP A;  1JJ2 A;  5M5Y H;  2KJX A;  4ECT A;  2F0E A;  1LTB D;  1JWU D;  4GNX C;  1D1I A;  2R61 A;  1GVP A;  2MQH A;  5DAA A;  1B6R A;  5I5Y A;  2NTS A;  3NK9 A;  4O7V A;  1I7L A;  1K83 H;  1P8L A;  2IT1 A;  4P75 A;  2C28 A;  2EQS A;  2XD4 A;  1DGS A;  2MGS A;  2VUM B;  3ORQ A;  4A3G B;  3CRL C;  3TZU A;  1XK5 A;  1SEI A;  1J5E H;  4CDE C;  1WTO A;  1M0W A;  3Q8P B;  1KUT A;  4PBC A;  1WCM H;  1QE6 A;  4JC0 A;  4BY1 G;  3SHL A;  2JA7 G;  4NXN L;  1YIT A;  3S2D H;  2JQO A;  5JQW A;  3M4P A;  1EYD A;  1DD2 A;  4IN3 A;  2N88 A;  4U68 A;  5FD5 A;  1NAP A;  1HFG A;  3JZF A;  4FXG C;  1TXY A;  5DM7 3;  2UUC L;  1NUC A;  1EQQ A;  2Z4I A;  1X6O A;  1EY4 A;  1MJC A;  4CDC C;  5K3W A;  3R93 A;  5IE8 A;  5LXT F;  1EOV A;  4LF7 Q;  5M5W B;  2XWJ B;  4NZM A;  1RTO A;  4HNV A;  2RSN A;  3DEO A;  3VR3 A;  1Y1V A;  4DL7 A;  2UXD Q;  3H40 A;  4A3M H;  5C3E H;  3G6Y A;  4JXU A;  4C3J B;  3I2Z A;  3AEV A;  5ELD A;  1KRS A;  1EQR A;  1S5E D;  1XJV A;  1GYF A;  4QGU A;  1N34 L;  3Q8Q B;  1HH2 P;  3BA8 A;  2E8G A;  1VQH A;  2FPG B;  1VAJ A;  5LYJ F;  3S17 H;  1EEI D;  1T3N A;  4GLV B;  3D6W A;  3HOV G;  4WRD A;  4Y7N B;  4GLW A;  3HOU G;  1TWH A;  3X3N A;  1SYF A;  3RB3 A;  2QA4 A;  2UVV A;  3MXU A;  4LSA A;  5GQO A;  3PQI A;  3PR5 B;  1M90 C;  4Q4C A;  2KUM A;  1LTS D;  4HIK A;  2FJZ A;  5E7N A;  4IFD G;  4TVI A;  4DV5 H;  1RF2 D;  1SE8 A;  3D0F A;  4LFA L;  1S72 A;  3SR1 A;  4TSS A;  4K6D A;  3A55 A;  2K32 A;  1Y1W B;  2IY5 B;  4IUP A;  1JB3 A;  3CCR A;  4C5A A;  3RAQ A;  1E7Z A;  4DLK A;  1U4M A;  3G7L A;  5GAG C;  4DV4 L;  4IPG A;  2R8J A;  4EEY A;  2AGQ A;  1KAB A;  1PFB A;  1PZK D;  2PI2 A;  2ICI A;  3B6Y A;  4OL7 A;  3U4Z A;  4DU9 A;  5IGG A;  4DV1 Q;  3RNU A;  3STB C;  5KT3 A;  1ET9 A;  2XCP A;  2TSS A;  1A3G A;  3QZ7 A;  5I5V A;  1JOK A;  3I72 A;  3H3V C;  2MFI A;  1BBW A;  2Q8R E;  4FVM A;  1LYL A;  4B3R L;  4Y7N H;  2FK2 A;  1Q12 A;  4LFB H;  1LT5 D;  1SBB B;  4FF2 A;  3DTG A;  2DNC A;  1SYX B;  4EQO A;  1IBL L;  1S0N A;  3GIQ A;  4A4I A;  3CVZ A;  3PUY A;  2K04 A;  4X64 Q;  2ZJR A;  3CCV A;  5J2T F;  4KD3 A;  1OBG A;  1ET6 A;  3HOX G;  5KFT A;  2ALZ A;  3AQQ A;  1FD7 D;  1Y1W H;  4KHP L;  5IYB H;  1QUQ B;  5D1O A;  2W6Z A;  2DJF C;  1D5X C;  4YHH Q;  4DR4 H;  2CW0 C;  1ET0 A;  1HCZ A;  4A2A A;  2HHH H;  2PQA B;  5C44 H;  3RUP A;  3T9E A;  1GUO A;  3KRE A;  5M3M B;  5E3F A;  5IGB A;  3ICE A;  1LTT D;  2UXC L;  1Q1B A;  2B2V C;  5EAY A;  4Q0F A;  4PZ7 A;  5KT2 A;  1LTA D;  1VF5 C;  2YS6 A;  2OCE A;  5ELE A;  2RGV A;  3M4Y A;  2IL8 A;  5JVH 3;  2HCC A;  4JI2 Q;  1DXM A;  5HBR B;  3Q8S B;  4L1K A;  2F0G A;  2Z6B A;  3EA6 A;  2EYM A;  4R8I A;  2XVS A;  4O7R A;  5LMU H;  2EIY A;  1G2W A;  4GKJ H;  3H3V I;  5C1P A;  3IN5 A;  4U67 3;  2YZM A;  4A2B A;  4JI5 Q;  2R7D A;  5DG7 A;  1YNJ D;  3JAM L;  1PX2 A;  2UXB Q;  1VF7 A;  2F0I A;  3Q8D A;  5EZY F;  3RV3 A;  2D9U A;  1I50 H;  4M9U A;  1Y14 B;  5IYD G;  1IBL Q;  4NPS A;  3A5Z B;  3PV0 A;  4DV4 H;  3E3X A;  1STH A;  1N33 L;  4JI7 L;  5BPH A;  1SYB A;  5KFW A;  4FFP A;  4XIG S;  2F0H A;  4LF9 H;  4IQZ A;  4C56 C;  4C1N I;  1JIC A;  3NTH A;  1MSH A;  3RLN A;  4Q45 A;  1STG A;  3KLR A;  3HOY H;  3FMA A;  1X3P A;  2R86 A;  2QB5 A;  3MEF A;  5IWA H;  3MTS A;  3SE7 A;  4XYQ A;  4K8J A;  4B08 A;  2F0V A;  2OQ0 A;  4DUZ L;  1BGW A;  3GTG A;  3RLF A;  1E2W A;  4OHJ A;  5BYB A;  2FLN A;  1VS0 A;  2F1M A;  2WE6 A;  4DPG A;  5DIS C;  3TDQ A;  4XX0 B;  1GKH A;  1WI5 A;  4GNX A;  4ALP A;  4RMF A;  2Z6K A;  2RSO A;  1HQR D;  2ALY B;  3FDT A;  5G3L F;  3MFY A;  4A3J H;  3G6X A;  4XQJ A;  2SEB D;  5K5P A;  4WHX A;  1JOQ A;  5CR5 A;  4DR1 L;  3QB3 A;  4B9X A;  4YP3 A;  1DOK A;  1XWE A;  3A7A B;  2B2W C;  2HIV A;  5KYL A;  5KFR A;  2C2D A;  2PO4 A;  1HZC A;  1NR2 A;  3MXG A;  5D8D A;  3RR5 A;  1PFN A;  4KHP Q;  2RDH A;  3G8C A;  2PW5 A;  5J2U F;  5M5X H;  2B39 A;  4IHJ F;  4LAA A;  3ND8 A;  5KEE A;  3WNZ A;  2CQO A;  4EGJ A;  5CV9 A;  1ESR A;  4DV3 Q;  2Z1C A;  4XYL B;  5CC4 A;  1CM9 A;  4ZKC B;  1EUC B;  4X6A H;  2UUA H;  4IUU A;  3Q2O A;  4PMW A;  3MR3 A;  4R8U A;  1NCV A;  5KFQ A;  4NKL A;  3PF5 A;  4N9T A;  1TWC H;  2EZV A;  5LMU Q;  4LUV A;  2BCO A;  2B2Y A;  4GKJ Q;  3MFI A;  4XQQ A;  2AGP A;  1HJP A;  3NBH B;  1CKM A;  2ZM6 L;  3BQ1 A;  4YR2 A;  1LUZ A;  2LMC B;  3MFH A;  4POG A;  1BBU A;  2FHT A;  4IFD J;  2QK4 A;  3S14 H;  4MTE A;  1BF4 A;  2VY3 A;  3S15 B;  5KFP A;  4UPA A;  2E75 C;  3MFG A;  4HN2 A;  5EWF A;  1D5M C;  4A3I G;  1KTA A;  1S5D D;  2F0T A;  4RZQ A;  3RBD A;  1LAB A;  2B2T A;  1LTR D;  3I7F A;  3M4I A;  1SFO B;  5L1L A;  1EZ6 A;  1VQD A;  5COR A;  3OSO A;  1YHB A;  2A69 C;  4X66 Q;  2J4X A;  4JUZ A;  1V8Q A;  1N34 Q;  2A1A A;  2MNA A;  4JI7 Q;  4O4H F;  5BWX A;  5IY0 A;  4DKA C;  4PG3 A;  1K8M A;  5IOD A;  1ZHQ A;  3QJY A;  4JI0 L;  3K8A A;  2W8L A;  2E2D C;  5M3F B;  2V5A A;  4B3R H;  4DFA A;  3UFX B;  1KC7 A;  3CCS A;  3BZC A;  2D0P A;  1VQG A;  2HG8 A;  2J6S A;  1JB7 A;  1B6S A;  1BCP D;  4RWS C;  3VYU A;  1TWA H;  3E9I A;  4GOP A;  3GTK B;  4UCV A;  1JC7 A;  2E76 C;  3T