2Q2UA

Structure of chlorella virus dna ligase-product dna complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
293
structure length
293
Chain Sequence
MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNSVMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDYVTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQYERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISMTALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTGFDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*CP*GP*AP*TP*AP*GP*TP*GP*GP*GP*GP*TP*CP*GP*CP*
publication title Structural basis for nick recognition by a minimal pluripotent DNA ligase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Ligase/dna
total genus 78
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF14743 DNA_ligase_OB_2 DNA ligase OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2q2uA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 2q2uA02
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2q2uA01
2JA5G 1C0AA 2NZHA 3I4OA 3JAMi 4A75A 1L2FA 4DK3C 4DR1Q 5C4JH 5FLMH 4JBJA 5LMNL 4X6AH 2KCTA 2WAQE 4DR7L 1X55A 4C3JH 1HNWQ 1S68A 2HHHQ 2K5VA 1PH9A 1YHAA 4LF8L 1EIFA 2JK8A 1CUKA 4IO9A 1Y1WH 1TWGH 3M7NA 2MO1A 1VQ7A 4LNQA 1WFQA 3OYYA 3OW2A 3HOWH 4BY7H 4IFDI 1KL9A 1VQHA 4JI4Q 4DV4L 4HIKA 4YCWA 4OX9L 3D0FA 4DV3L 2UXBQ 4A4IA 4DV7L 5C3EG 1HR0L 4R4IA 2VUMG 2NZOA 4IJLA 4P73A 1HNXQ 4JI8Q 2UUCQ 2NVQH 2F52A 4IPCA 1S72A 2HQLA 2IX0A 1MKHA 1PH5A 3I4MG 5IE8A 3GJXB 4P75A 3PUXA 5IP9G 3U58A 2VZAA 1B04A 1Z9FA 2WAQG 1N33Q 4L5TA 3M3YH 4Y7NH 3F2DA 1G291 1SFOH 3OTOQ 3SGIA 1U5KA 4TVAB 1SMXA 1IBLL 2UUAL 2UXDQ 2VUGA 4IFDG 4JI2L 2E5LQ 1LUZA 5C44G 1VQOA 4B3TQ 4LW1A 1FJGL 1L1OB 3BZCA 4JV5Q 1L1OA 3WWVA 1PHJA 3M4OH 1X3EA 4O2DA 1YIJA 1WOCA 4UCVA 2N8NA 1T9HA 4UPAA 3A5UA 1HZCA 1X9NA 3S2DH 3EN2A 1A62A 2K50A 3KF6B 2Z6KC 3S1MH 1A63A 5K36G 2PMZE 1OTCA 3KF6A 1HNZL 2JJQA 2K52A 5C0XJ 4BA2I 1VQCA 1OXSC 3W1GA 3PUZA 1I6HH 1VQEA 4YY3Q 4JI1Q 3RLOA 1IBKL 4AQYL 3UDGA 1UEBA 1AE2A 1E24A 2KENA 4GS3A 4BA1I 4A3EH 3RN5A 1N34L 2MQHA 3OTOL 4B3RL 4C2MH 4LFAL 4KI0A 4DV0Q 4A3CH 1V43A 2HVRA 3UDXA 1FVIA 2QEXA 4K0KL 1XK5A 2XGTA 3AQQA 2KHIA 1EQQA 3CC7A 1X3GA 4DUZQ 1JJCB 4JI0Q 3UQ8A 5JJLA 4O0AA 4A3KG 4A3GG 1XNQL 1P16A 1YJNA 3JC66 1JT8A 2VQEQ 2JA8G 3IRBA 3CCVA 3PO2G 3DLLA 3ULPA 3BZKA 3L0OA 4LFCL 4JI5L 5M3MG 1Z47A 2HIXA 3GTJH 3JSNA 2ID0A 4PG3A 4DPGA 2ZM6Q 4R1JA 3ER0A 3NC0B 1AE3A 2YYZA 4JI3L 4B3SQ 4A3JH 4DAYB 2YTYA 3CPFA 4X66Q 3CCJA 4GOPB 3HOVH 1MJCA 1TWCH 5D1PA 2B29A 3PUYA 3GO5A 4GOPA 4LF5L 4A3DH 1A0IA 3S1NH 3JAMc 1PH3A 3S16H 2GN5A 5IYBH 4UFZA 3K7UC 4QJFA 4C3HH 4LF6Q 2MFIA 1LYLA 1OXVA 3S14H 4IPDA 4JC0A 4A3IH 1YI2A 1N32L 1WI5A 5IYDH 4DR5L 1VQ6A 3HOZG 2MO0A 5LMNQ 1YITA 4DR7Q 4DV6L 5IYCG 3G4SA 2OCEA 1HH2P 3KJPA 4WJ3M 3VDYA 2K75A 1PH2A 3F1ZA 4LF8Q 4UCOA 4LH7A 1Q86C 3GTQH 1VQBA 2JA5H 1PH7A 5LMNW 2IHEA 2IY5B 1VQDA 2B3GA 4JBKA 2GVBA 5M5YH 4DV4Q 4OX9Q 4QY7A 4DV7Q 3KYHC 4J15A 1CSPA 1HR0Q 4KHPL 1NY4A 1PV4A 3LGJA 3M4PA 1JE5A 3S15H 1H95A 1QZGA 1FL0A 2AWNA 3I4NG 4BY1G 1C7YA 3F8TA 5ELOA 5JEAJ 1XNRQ 5IWAL 3K7AH 1HR0W 1EIYB 4LF6L 1VS0A 1Y1VG 3KDFB 4EX5A 4X64L 4YWLA 3KDFA 5C3EH 1SRUA 3CF5A 2VUMH 1IBLQ 2UUAQ 4DV5L 1EYGA 3HOYG 1XDNA 4UCRA 5BR8L 1I50H 4JI2Q 1XMOQ 2BH2A 3I56A 1VQ8A 1N9WA 3I4MH 2E2HH 5IP9H 1FJGQ 1IL2A 4UP9A 4L5SA 2F3IA 3UDFA 1K8AC 3W1BA 1ASZA 5JEAG 4LF7L 1CKNB 3PV0A 2KCMA 2KBNA 2UU9L 3A5ZB 1CKNA 1J5EL 4DR4L 1NBWA 3HOUG 3I55A 2DUDA 3J7ZC 1G51A 4IJHA 5C44H 1S40A 4IFDJ 2FXQA 4R4OA 4NPSA 4JBWA 2QA4A 1N36L 1HNZQ 1L1OC 3MXNB 1KQSA 3HOXG 4UY8C 2CKZB 3PUWA 1M90C 2A8VA 3J7A5 1K83H 1QVGA 1IBKQ 2HVSA 4AQYQ 3E0EA 1XNRL 2YTVA 4UCSA 4EFEA 4YHHL 2Q2HA 1N34Q 3GTMH 3CC4A 4B3RQ 3Q8DA 4APVA 1JJ2A 5AJ3L 4RG1A 2QGQA 4LFAQ 3TREA 3BU2A 3PUVA 2B63G 4GN5A 3NBYB 2K5HA 1XMOL 3TRZA 4K0KQ 3T1HL 1CSQA 4GNXB 3MEFA 4A76A 1IBML 4BXXG 2ZJQA 1VQPA 4GNXA 4IOCA 3AFPA 5LMUL 2NVTH 2AHOB 4OWTB 2I5LX 2E8GA 5JJIA 1HZAA 1K3RA 2ZJPA 3S17H 1VQLA 2IHFA 2NVXH 1XNQQ 4PZ7A 2WB1E 3E9HA 1VQMA 4E6NA 5DISC 5M5WH 3CCEA 4ALPA 2UUBQ 3I7FA 4LFCQ 2D0PA 2L15A 1UE6A 2R6GA 3A0JA 4JI5Q 4GKKL 1JJGA 3L2PA 2PNHA 3M4QA 3UE0A 2PI2A 4JI3Q 2PQAB 4JBMA 1KIXA 2PQAA 4DV1L 1BBUA 4DRFA 2LSSA 1SR3A 4A3KH 4A3GH 4DKAC 3M85A 3GTLH 2I5HA 3BABA 1PYSB 1M1KC 1WCMG 4LF5Q 5FJ8G 3PO2H 5IT9c 1YBYA 3F2CA 2VL6A 3NELA 5M3MH 3FKIG 4NXNL 4LFBL 4QIWE 3BAAA 4AYBE 3CPWA 2JQOA 3U4ZA 1VQKA 1CKOA 1OXUA 1Q8KA 1RL2A 3FP9A 4B3ML 1N32Q 3CCMA 1HZ9A 4DR5Q 1VQ9A 4GOPC 2YU9H 3S1QH 4POFA 1LM0A 4XIGS 4DV6Q 1B8AA 3CW2C 3RN2A 3K80C 4JYAL 4HJ7A 2R7FA 2E2JH 3H0GG 2ALYB 2LXKA 4GKJL 4A93G 1Q82C 2ATWA 3H15A 3ZJYC 4KLKA 2UUBL 4UP7A 2V1CC 2OQ0A 2ASBA 4HIMA 4YCVA 2CWPA 5IP7G 4BBRG 3RTXA 3HOZH 1RIPA 3E9IA 3RR5A 3J80i 4HIOA 3CCQA 5IYCH 4LUOA 4L5RC 1QVFA 4AYBG 1K8GA 4KHPQ 4IPHA 1ASYA 4BBSG 3TY9A 4OWWB 3CXCA 3G6EA 1VQFA 1W3SA 1BKBA 1B7YB 3CP0A 2JA6G 3W5OA 5IWAQ 2A1AA 1E3PA 5GQOA 4AIMA 4DAMA 5M3FG 2CCZA 4UCUA 5D1OA 1NTGA 1XJVA 2Y0SE 3KLWA 3S2HH 4X64Q 1TAEA 4P74A 1TWAH 1D8LA 4DV5Q 2EXDA 2R7DA 5BR8Q 1QZHA 1VQNA 3CQZH 3TY8A 2JE6I 4OO1I 4GLXA 1Q1EA 3PF4A 1YNXA 1XMQL 3I4NH 1V9PA 4BY1H 4JI6L 4DK6C 3PSIA 2Q2UA 4HIDA 2ZTDA 2D62A 2HVQA 2CWAA 3GB8B 1YJWA 3RLFA 1Y1VH 1MIUA 3CAMA 4LF7Q 4LF9L 3J81j 3TQYA 3CCUA 2JA9A 4QGUA 2RCNA 1KHIA 4TQUS 4A3MG 2UU9Q 1J5EQ 3HOYH 4DR4Q 4H02A 1X65A 2VW9A 3S1RH 4YCUA 1PH6A 3VNNA 4CC6A 1IZ6A 5GAGC 4GLAC 1GKHA 1N36Q 3B6YA 4X62L 3NEMA 4MZ9A 2C35B 1GVPA 5FPOA 3CD6A 2BA0A 3CCLA 4OO1G 3NENA 4JI7L 4PZ6A 3JSLA 4YHHQ 4NB3A 1KRTA 2ZJRA 3H3VI 3TS0A 3CCSA 4HJ8A 1I5FA 5AJ3Q 3HOUH 5C4XG 1FGUA 1NMFA 1KAWA 4C3IH 1YZ6A 2MNAA 2JA7H 4A3BG 2JEAI 3M9BA 3PGZA 3T1HQ 1IBMQ 1X56A 2R93G 2N49A 3HOXH 1TA8A 1U0LA 5LMUQ 1PYBA 4LUZA 4LWCA 4EEQA 2N3SA 2ZTEA 3D31A 2EIFA 4A3FG 2YTXA 1X6OA 2WP8J 2KHJA 1CKMA 3CCRA 2OWOA 3PO3G 1JMCA 4YWMA 3AFQA 4NXML 3EIVA 3PIOA 2B63H 1QVCA 5ELNA 3U50C 3A74A 2DGYA 4GKKQ 4DUYL 2AKWB 4GNXC 1E1OA 2R7ZG 4BXXH 4RMFA 2R92G 1I3QH 3PIPA 1R9TH 2JA7G 1E7ZA 1XPOA 2HIVA 1IXRA 1I94L 3UE1A 2BH8A 4DV1Q 4KHZA 3ERSX 4PMWA 5GAEC 5E7NA 1NMGA 3HKZE 3G71A 2F4VL 3GTPH 4DR6L 1YVCA 4LH6A 3J81i 4LF4L 4A3LH 4R4CA 4X65L 4P72A 3ULJA 2A19A 3ULLA 3CMAA 2JEBI 1BBWA 1KRSA 4DV2L 1AH9A 5GAHC 1A8VA 4DR3L 2OQKA 4NXNQ 3L7ZC 3BJUA 4LFBQ 2EQSA 1Y14B 4OONA 1YHBA 4B3MQ 3G48A 4Y52H 5M5XH 5GROA 4JOIA 3T1YL 2NVYH 2IX1A 4DR2L 1Q46A 1WCMH 5FLMG 5FJ8H 4JYAQ 1LTLA 3TS2A 1J6QA 4GKJQ 5DLQE 4A3LG 3FKIH 3TY5A 3J80c 2H5XA 2UXCL 3QWUA 1V1QA 1UWVA 3HKZG 1N8RC 1MJEA 1K0RA 3GDEA 2HT1A 1Y1WG 1VQGA 3STBC 1UE1A 2VQFQ 3HOWG 4BY7G 2ZTCA 1YEZA 1VCIA 4JCVE 4CC5A 4DR1L 1Q1BA 3EBEA 4IPGA 4YWKA 4JG2A 3H0GH 1HNWL 4A93H 4GN3B 2HHHL 1D7QA 1E1TA 1SE8A 2IT1A 2BA1A 1PH1A 1IYJB 4PZ8A 4MTNA 3HKSA 5IP7H 5FLXc 2XTIA 4BBRH 3PCOB 1SN8A 4JI4L 1EQRA 2WB1G 3RNUA 1KC8C 2Q2IA 1VQAA 5C0XI 2UXBL 1TWFH 1TXYA 3FHWA 4BBSH 1Q12A 1HNXL 4JI8L 2UUCL 3PN1A 3GTOH 5J3BA 1XMQQ 1UE5A 3AEVA 3NBZB 1DGSA 4EQ5A 3K0XA 3I2ZA 4LUVA 4JI6Q 4AH6A 1GM5A 2JA6H 4P71A 5M3FH 1KXLA 2RHQB 1N33L 2RHSB 1G6PA 4LF9Q 1EWIA 3BA9A 2VQFL 3PF5A 4UP8A 4HJ9A 1UE7A 2N78A 1HJPA 2I0QA 2NN6I 1VQJA 3ICEA 5JJKA 2UXDL 4L5QA 2PI2E 3UDIA 3HFZB 2E5LL 3GD7A 1GD7A 5C0XG 4B3TL 4X62Q 2Z6KA 3K8AA 4DNIA 4JV5L 4XTCS 1VQ5A 5D1OB 4JI7Q 1B70B 1WJJA 1GO3E 2RF4A 4QL5A 1JB7A 2JA8H 4A3MH 2AWOA 3RZOH 1TWHH 5EAYA 5GADC 2LXJA 4MNOA 4A3EG 1XPRA 1PVOA 3CC2A 3TEHB 2AMCB 1EFWA 2GVAA 4GLVB 1HZBA 3KFUA 4A3CG 1SLJA 1E22A 4GN4B 2NN6G 4R4QA 4IOAA 1Q81C 4OXPA 4YY3L 4JI1L 1K73C 4POGA 4HJ5A 4FDBA 4OWXB 5FPRA 2K14A 1K9MC 5C4XH 2K5NA 1X3FA 4NXMQ 4WJ4A 3KF8B 1PH8A 2D0OA 4A3BH 4DV0L 1S3OA 2VS1A 5IY0A 2R93H 1EUJA 4DUYQ 4EFBA 1VQ4A 2VNUD 3J81c 2K4KA 1C9OA 3DM3A 3KOJA 1PA6A 2OTJA 3U4VA 1QUQB 2Y0SG 3RZDH 1NJIC 1I94Q 4ME3A 1XPUA 4DUZL 1QUQA 4JI0L 3GTKH 3BA8A 4A3FH 4A3JG 4R4TA 4DR6Q 1VQIA 2F4VQ 3PO3H 1OXXK 2Z0SA 2YV5A 4LF4Q 3HOVG 4X65Q 1L0WA 1XTDA 2VQEL 4DV2Q 4A3DG 1P8LA 1W2BA 3CMEA 4DR3Q 2R7ZH 3H3VH 1YJ9A 2R92H 2E2IH 2VY3A 5IYBG 3GTGH 2ZM6L 4HJAA 2CFMA 3STBD 2OTLA 1YHQA 5HGQA 3T1YQ 1Q7YC 4B3SL 4X66L 2CQOA 1NE3A 3KJOA 5IYDG 4DV3Q 1SROA 4A3IG 2ES2A 4UCTA 1PFSA 4DR2Q 3RLNA 4QQBX 1OXTA 5H1SE 3S24A 2Q2TA 5HY6A 1EOVA 2I5MX 3AYHB 1X54A 3K81C 3NBHB 1KD1C 1PH4A 3F2BA 1BVSA 2UXCQ 1WYDA 2WFWA 1O7IA 4JOIC
chains in the Genus database with same CATH superfamily
4Y8VB 4JI7H 1XYIA 3TEKA 2OXPA 2TMPA 3JAMi 1WCMA 2X6GA 3MHBA 3ITPA 4JBJA 4X6AH 2KCTA 3FKIB 4O3SA 4DR7L 2HD3A 1X55A 4C3JH 3I12A 4WD3A 2JEJA 1S68A 3N52A 5KG0A 1YHAA 2MGSA 1CUKA 1TWGH 3HOWH 2RDIA 3OYYA 4J9KA 5EPLA 4RNMA 1KL9A 4JI4Q 2PMZB 4DV4L 4F88A 4KY6A 3JZ6A 2O5JC 3T9BA 4A4IA 3GLKA 1HR0L 4R4IA 4P73A 2UUCQ 3JAML 1PH5A 1MKHA 4YIJA 4P75A 4JV1A 2HUGA 1FNWA 1B04A 2O5IC 3TZUA 1N33Q 1SEBD 4L5TA 1A0GA 4RUAA 3F2DA 4YQWA 3MWDA 4UUGA 4LF4H 1NR4A 4TVAB 3GTOB 1IBLL 1KJIA 2CW8A 1GXDC 4E6IA 2FLPA 1VQOA 2JA6A 4WORA 1QG7A 1KLUD 4K6NA 3WWVA 1X3EA 2VB2X 3SDZA 4O7LA 1YIJA 2F0FA 4UCVA 3GV3A 3SEBA 4UPAA 4MV8A 1M4VA 4ECSA 4Q8FA 5D65A 1D1IA 4HSVA 1F9QA 4R8NA 1EKVA 3S1MH 4IN3A 1HNZL 5C0XJ 5KFBA 1VQCA 1OXSC 1TWHB 3R5FA 4JI1Q 4AQYL 1UEBA 4O4LF 1DYQA 1GUGA 2W6QA 5LHY1 3RN5A 5E3FA 4LFAL 3C0FB 2HHHH 4KI0A 3KBGA 2FHTA 2HVRA 2ABJA 4XYOA 4QW8A 4X3TA 3K5NA 1GHJA 1PZID 2KHIA 3I73A 3CC7A 4Q5VA 1VAJA 5E25A 4DUZQ 3UQ8A 5JJLA 1O7ZA 4CBVA 1B6SA 1IYEA 4GZYC 1P16A 2R93B 1O75A 1WTRA 3DXJC 5C5LA 3PO2G 1O78A 2DIKA 4I55F 5KT7A 1BXRA 1VDZA 1Z47A 3GTJH 1O7YA 4DPGA 4A3FB 3NC0B 4JI3L 3A7LA 1KAAA 4B3SQ 4A3JH 2YTYA 4X66Q 5JH7F 1MJCA 3HOUB 5D1PA 3PUYA 3BDOA 1KDBA 3OHAA 2E2IB 3S1NH 4ZK9B 1PH3A 2JA7A 1K8OA 4KD3A 4B3TH 1A3GA 1HFNA 4QJFA 1N32L 1YI2A 3L3OC 4O2AF 1K3BC 4DR5L 3AX6A 4MTDA 5IT9W 1EY9A 3D3RA 2EE1A 2EY5A 2EXZA 2MO0A 4IUPA 1YITA 2ASJA 1STBA 4FBUA 2XC9A 2K75A 2F3VA 3FVQA 1Q86C 2VA3A 4RB3C 1PH7A 5HNEA 2VXWA 3MR6A 3M7GA 2IHEA 4A2BA 4YY3H 1VQDA 4DK0A 5CBEE 1EKFA 3KXYT 4FVMA 1EUDB 1QJOA 1YNJC 5HV6A 3KYHC 4J15A 1CSPA 2FFKB 3RBDA 3CU7A 2COGA 1NY4A 1S10A 2AQ4A 3L9AX 4DF7A 1H95A 1Y1WA 1CT1D 1FL0A 2AWNA 1LT5D 5KEEA 1C7YA 2HCIA 5JEAJ 1ENCA 3HEJA 3K7AH 1HR0W 1EIYB 4LF6L 1GJXA 2UVWA 3WOEA 1KABA 3RAXA 1D2BA 3JAMW 3CF5A 3HOYG 4LSXA 4UCRA 1I50H 2EJ3A 3HXLA 5KFKA 1S5DD 3I4MH 2E2HH 2W7OA 3V96A 3HO8A 2WB1B 4Y7NB 2J6SA 3RAQA 3LQSA 2K01A 1K8AC 3V2TA 4LF7L 1ENAA 3VA5A 2KBNA 3ONAB 4J1MA 4K2KA 1CKNA 2PVPA 5KFJA 3KK7A 3QFFA 2F4IA 3I55A 2DUDA 1BDOA 5C5JA 5C44H 1JOKA 2FXQA 1D5XC 1GSHA 5ELCA 1EYDA 2FKLA 4LF6H 3MXNB 1KQSA 3HOXG 2A8VA 2CKZB 2BQRA 4OEMB 1U9RA 1O7LA 2MPMA 2ZDGA 1EQVA 3QZ7A 3Q8QB 2HVSA 3E0EA 4RNOA 3NUCA 2Q2HA 3TP7A 4YHHL 4ED2A 4RAYA 3E5NA 1JJ2A 3TREA 2FMMA 2GLTA 4YR0A 5KNDA 4GN5A 3TBIB 5J2UF 3T1HL 1NR2A 5IIFA 1IBML 5EGTA 4BXXG 5KFXA 4RGTA 1B44D 1VQPA 4LF7H 5KYIA 4FYDA 2NVTH 2ASDA 2HQEA 1ILPA 3W3AA 4ABNA 3H4BA 1L0XB 1QNUA 2ZJPA 3HGBA 3S17H 3K5OA 1VQLA 5BMVF 2IHFA 4C2MA 1CQFA 1XNQQ 4DV7H 4PZ7A 5FK9C 4UHVA 1G91A 2D0PA 2R6GA 5IGDA 4GKKL 2KECA 1KNEA 2PQAB 4YHHH 4M1UB 2WKCA 4DV1L 1HUNA 3MEHA 4DRFA 3OSPA 2LSSA 1SNPA 2B2YA 5I6YA 3M85A 4EVOA 4LMYA 2UUAH 1JOOA 5GONF 1PLFA 1S5FD 4JI2H 5FJ8G 3RGZA 5DGAA 4RCNA 1IBMH 1EFID 1YBYA 1H9SA 3H09A 4OGQC 1KDAA 3U4ZA 3ZYYX 1VQKA 4OHJA 1VQ9A 2YU9H 3PQIA 4A3DB 5KFAA 2W9BB 1YNJD 4PBCA 2R8KA 4DV6Q 1B8AA 3OHXC 3RN2A 2OH2A 2KA7A 2ALYB 2F0OA 4A93G 5DG8A 4NZOA 2YZGA 3ZJYC 4KLKA 5ELEA 2UUBL 3TINA 5KFVA 1RK6A 2MP1A 2KEDA 5IGGA 4YCVA 1GYFA 4XT3B 5EPKA 3RTXA 1N34H 2WINB 4HIOA 3UI2A 4L5RC 4HCEA 1CHPD 3A54A 3NTIA 4IPHA 2NU8B 1RTOA 2ZXPA 1UC8A 4OWWB 5KG2A 4CHTB 2JA5A 1Z2OX 1E2ZA 2EJ2A 3V6JA 1BKBA 1B7YB 2FJZA 1SYDA 1STNA 2K04A 2LY7A 5IWAQ 5D1OA 3RUPA 2CCZA 4IAJA 1XJVA 3S2HH 3QWNA 3KLWA 3X3MA 2EY2A 1U4MA 1TT2A 5I5XA 1AW7A 1D8LA 1TWAH 1QZHA 3S15B 3TY8A 2UUBH 2JE6I 4LFCH 5KFRA 1CQIB 4J9MA 4BY1H 4C1NI 1U4RA 2H1EA 2Q2UA 2HVQA 3GB8B 1KLGD 4MA0A 1MIUA 4PNYA 4LF9L 3IFDA 5LL6S 2UU9Q 3C2PA 1KHIA 4LF5H 2A5HA 1SYFA 3OSOA 5JVG3 4EEYA 3S1RH 1IOWA 3TDQA 1PH6A 3VNNA 4CC6A 5KS8A 4ZUIA 1PRTC 5FNVF 2WAQA 5EWEA 3N41B 2C35B 3U55A 5JEAH 5JAVA 3OUZA 4PZ6A 3JSLA 4ZYSA 5BWTA 1LTBD 3S9WA 2ZJRA 3A55A 2ZGIA 5F9LA 3CCSA 4KD4A 4C5BA 1B1ZA 4K6DA 1FGUA 5C4XG 1NMFA 1KAWA 1LTTD 3CEBA 2JA7H 2BDOA 4A3BG 2N49A 1HHVA 1K83A 2B2VA 1TIID 2QYZA 5KG6A 1PK8A 4KMUC 3M3YB 3CRKC 2V4QA 4UDUC 3KLSA 1SFOB 1ZQ7A 3GTMA 2AGPA 4UAIA 4O4IF 5H80A 1ZHQA 2WP8J 2KHJA 4KHPH 2VA2A 3AFQA 4NXML 2CHBD 5EBDA 2AKWB 3IFTA 5I9PA 4RMFA 2R92G 3GIDA 1R9TH 4YAKB 3UZOA 1E7ZA 1SYCA 1I94L 3BDLA 4KHZA 3ERSX 3BG3A 5E7NA 1NMGA 3HKZE 3G71A 3GTPH 4YB8B 3J81i 1S5ED 5BR8H 4X65L 2DJGC 3PR5B 4P72A 4DK1A 2JEBI 1KRSA 3CKIB 2V59A 4CKCA 1A8VA 4DXGA 4LFBQ 1RODA 2EQSA 2HHFA 1KJ8A 3GTLB 4B3MQ 2YRWA 4Y52H 5M5XH 3T1YL 2ODTX 4XQNA 1KDCA 3Q22A 4V190 4IRKA 3PO2B 4NXMH 4DR4H 4JYAQ 3VPBA 3TQTA 5IOCA 4C3JG 2A74C 2L55A 4FS2A 4O4HF 1Z2NX 5LL6b 1N36H 1SE2A 2UXCL 1V1QA 1DOMA 1N8RC 1MJEA 3J81L 1VQGA 4FFOA 3HOWG 2ZTCA 2L5TA 2X69A 2E2JB 1Q1BA 3GILA 2YS6A 3EBEA 4DXFA 2Z1CA 4JG2A 2PO4A 1DJRD 3H0GH 4N8FA 4CHIA 2VOBA 3RB4A 1H9SB 1SE8A 1CZWA 2IT1A 1WTVA 4F4YA 5LMUH 4TQRA 4PZ8A 2BQUA 5FLXc 2XTIA 4BBRH 3PCOB 4YJ3F 1SN8A 4JI4L 3RUZA 4IR1A 1VQAA 4NDXA 1TWFH 1GHKA 5FKAC 3DHQA 5EJWA 4XYQA 2UUCL 3EJIA 4ZRZA 4C56C 3SXHA 2W6NA 3NBZB 1PRTD 5I5SA 3HP3A 1QNKA 4X3KA 4AH6A 1GM5A 2WACA 5M3FH 2F0PA 4FE2A 2W6MA 3MR5A 3MFYA 4FXKC 1N33L 5JVLA 1Y8NB 1J8IA 2FLNA 4Q8EA 4O3QA 3PIO3 1I7LA 1KNAA 3ICEA 2SNSA 3SNOA 1PFNA 3QJYA 5BPFA 2L1BA 3OSNA 1SYBA 3GTQB 3WO0A 2JA5B 1QB5D 4XZ3B 1RF2D 4DNIA 3IKJA 4HN2A 1WR2A 1Y1VA 5KFCA 4IRDA 1TR5A 3HOYB 2B2WA 5D1OB 5NUCA 2EJFC 1JB7A 3T99A 3RZOH 1UC9A 2PW7A 2A6EC 4MN3A 3WWIA 2C9OA 5GADC 1GLVA 2DLNA 2SDFA 1ILQA 3NQIA 4GLVB 3KFUA 4GN4B 1E22A 3SK5A 4IOAA 1PTOC 3UYYA 4ZQ3A 5K3WA 1EY0A 5L1IA 4JI1L 5I9OA 1RJRA 4O3PA 1D5MC 3RB6A 4OWXB 5FPRA 2K14A 5C4HA 2C00A 1X3FA 3ERQA 3HOXB 1VQ4A 2B2VC 4IALA 1PDQA 2WAQB 3DM3A 2UVRA 3T9DA 2W9CB 1NJIC 4DUZL 4EQNA 3GTKH 4A3JG 4DR6Q 2CQAA 2F4VQ 2NU9B 4NP5A 3MXUA 4TUYF 1L2ZA 4L6TB 2R82A 2R85A 4J9SA 1I3QB 1XMQH 2R7ZH 3DMUA 2VY3A 1RTNA 1I4GA 2NTTA 5EWGA 4JI1H 3FMAA 2CFMA 2PZWA 2A68C 4B3SL 5HGQA 4UCSA 4X66L 3KJOA 1NE3A 2BOSA 3Q6SA 1OXTA 3TQ1A 1TKWB 1XTCD 3SK4A 4H44C 1EOVA 4DL4A 3J7YW 1ESRA 1E4FT 4X62H 3BYTB 2CH4A 1O7IA 2NVYA 1LLRD 4A75A 4DK3C 1CM9A 1BOSA 5FLMH 1EQTA 2HG8A 2RGVA 4ME5A 3Q23A 4OIJA 5C1OA 1V1PB 1HNWQ 3DAAA 2WV6D 3FKIA 3J81W 1PH9A 4ZQIA 1W93A 4B3SH 2JK8A 3Q24A 5IT9E 3BG5A 5JJZA 1A2TA 4ED0A 1WFQA 3D4RA 2W6PA 4IFDI 1GUSA 1VQHA 3N40P 4A93B 2PMZA 2UXBQ 5CC4A 5M3MB 4JI8Q 4IUUA 1U4LA 2ZDHA 2F52A 4IPCA 1S72A 2F0TA 4ED3A 3I4MG 5IE8A 1DAAA 5I5WA 2QB5A 2BCOA 1JX4A 4K6LA 3S1QB 5KFEA 2PPBC 1CTMA 1IKMA 4RHSA 3SGIA 4FFMA 2A6ED 4AYBA 1EUCB 1SMXA 4DV2H 4C1NK 2FINB 2UXDQ 2VUGA 5JUMA 3GTOA 4DR3H 1LUZA 1EIGA 3BVZA 5C44G 4QSHA 1B2TA 3JZFA 3BZCA 1PTOD 4JV5Q 3JAME 3M4OH 5CAEB 1WOCA 1C48A 1HZCA 3S2DH 1S5BD 5DAUA 1GUNA 5J39A 2K50A 3KF6B 3I70A 2PMZE 1OTCA 4O82A 4XYLB 4BA2I 2B2WC 4CKEA 4TSSA 1I6HH 1SEIA 1ULZA 1VQEA 1TWHA 4DR1H 4CDEC 1GGOA 4O7TA 2ASLA 5FO7B 2Q7DA 4A3EH 2MQHA 3OTOL 4DA2A 5EWFA 3CRLC 4K2LA 3DWAA 3UDXA 1B4OA 1FVIA 3I4NB 4YP3A 3AQQA 1T94A 1JJCB 2A68D 4JI0Q 4O0AA 5C4XB 1QCBD 3SVMA 3QG1A 4A3BB 1XNQL 1JT8A 2R93A 2VQEQ 4IZOA 5KFGA 3DLLA 3L0OA 1E2WA 4H13C 4R1JA 3ER0A 3I3CA 4ED1A 4R8UB 2R8JA 3CPFA 3GQCA 3OTOH 5TSSA 3FPUB 1C4QA 5KIXA 4GOPB 1GSAA 1FR3A 1TWCH 4IWXA 4L1KA 2B29A 3V4ZA 5LOVF 2ALZA 2R92B 1HRJA 3GIMA 3JAMc 2E5LH 3S16H 2E2IA 2PYKA 4J9LA 5DQIA 4WBNF 2KHSA 2QW7A 2NTSA 4C3HH 1L0YB 4GLWA 1Q3LA 3VR5A 3BZDB 2O2LD 4IPDA 5CV4A 1XNQH 1UNNC 1WI5A 3H6MA 1R4QB 1VQ6A 2IW3A 5LMNQ 3BJYA 1EKPA 4YBZB 1I4QA 4DV6L 3G4SA 2OCEA 1HH2P 3KJPA 1AUVA 4EBEA 1X3PA 1PH2A 1JORA 4LF8Q 3GTGA 4LH7A 1EZ8A 1VQBA 2J0TD 1RJQA 1H9KA 4JBKA 4C3JB 5IGFA 5M5YH 4QY7A 4OX9Q 3G8DA 1F77A 3CSWA 1LTAD 4DV0H 1H9JA 3LGJA 3HOWB 1JE5A 3HB9A 1CA5A 3M9NB 1WTXA 4BY1G 1XNRQ 5IWAL 1HTLD 4JPBW 3RFCA 1VS0A 3BVGA 4QW9A 3KDFB 4KKTA 5C3EH 2VUMH 5C3WA 1KC7A 2J9GA 4ECVA 3U54A 2AU0A 3BVMA 4F4XA 1VQ8A 1UNSA 2ZM6H 5IP9H 1FJGQ 4O3NA 1M0WA 3T54A 2COIA 3GP7A 2WB1A 2F3IA 4MV9A 4B9XA 1ASZA 5JEAG 1KJ9A 1SE3A 2XGPA 1I2KA 3TSSA 4MAMA 2UU9L 3GV8B 2G9DA 2QK4A 4IFDH 1OBDA 1NBWA 1SNDA 1K8MA 3VA7A 2XRQD 1RYSA 4UY8C 1EYZA 3MXNA 2E74C 4I50F 1QVGA 1IBKQ 3GIIA 4QIWB 1JIHA 4AYBB 4B3RQ 3MA2B 3OUUA 4DR7H 1YNNC 1IYDA 5KFMA 4RG1A 1A3TA 2EY1A 1XMOL 3R8BA 2PW5A 1CSQA 2ZJQA 1BCPF 4IOCA 2HGWA 2AHOB 4DV4H 2I5LX 2E8GA 3VYSA 1K3RA 4LK1C 2IL8A 3BQ1A 1HR0H 3MAQA 2WB1E 3KBXA 1VQMA 1HQRD 5M5WH 1LT4D 2EYJA 5KFPA 1E2VA 3I7FA 4YR3A 4JVZA 3A0JA 3KLRA 1V4YA 2PNHA 3M4QA 3UE0A 3L4JA 1MSGA 4JBMA 5KNBA 2DWCA 2PQAA 3FDTA 4A3MB 4A3KH 4A3GH 5KFDA 4DKAC 3IG0A 2ZXOA 1XXGA 4XDXA 2EIYA 1IBLH 3BABA 1C3OA 1XMOH 4HN7A 4CKBA 3GTJB 1DD2A 2VL6A 2K5QA 4FF1A 4LFBL 4A3JB 3URYA 1OXUA 4B3ML 1RL2A 1EZ1A 5F9NA 3NK9A 2DPIA 2N88A 1HZ9A 3C3LA 3BQ0A 2Z6BA 3S1NB 3EPIA 1LM0A 3H3VC 4F50A 2W9BA 4JYAL 3IL8A 1VBHA 3T5JA 2R7FA 3G6JB 3H0GG 1Q82C 5E4WC 4TV9F 1HNZH 2HDMA 4O2BF 4RB1A 4ID6A 2ASBA 2XNAC 4AQYH 3PW2A 1UEAB 2CWPA 4K5WA 5EKIA 4BBRG 5KG3A 3RR5A 2HDKA 4DL3A 1LT6D 3G7LA 4LUOA 5IYCH 4LFAH 3VYUA 1K8GA 4LFBH 1F9RA 1C8CA 5FO8B 1J9OA 3G6EA 5I5TA 3OHBA 1SYEA 1ML0D 3W5OA 3RGXA 4AIMA 4DAMA 5M3FG 4U673 5E4XA 1EYCA 4JYAH 3H4DA 1T5XD 4X64Q 1CI3M 1D1KA 1ET6A 4P74A 2C2RA 4DV5Q 2EXDA 3VYTA 2R7DA 5C3XA 3CQZH 3DUZA 4FFPA 1GUOA 3F2UA 2IPKD 3K7AB 3GTGB 4QUCA 4JI3H 3DWPA 3PSIA 4HIDA 4DIMA 3N44B 3RLFA 3BQ2A 1SSOA 1FYCA 1KT8A 3J81j 3TQYA 5KKNB 4QGUA 4DLKA 3MR2A 3A8KE 1YNND 1G6ZA 1OWTA 1ET0A 5BWXA 3DM1A 1STGA 1IZ6A 5CM0A 2CH4W 3B6YA 1N32H 1DXMA 1GVPA 4Z9CB 2BA0A 4DR5H 1LTID 5KT4A 2K05A 1MHWC 4TVIA 2I07B 1R4PB 5C44B 2MJ8A 3TS0A 1ZETA 2QILA 1I5FA 5AJ3Q 3HOUH 5DLGA 2C2EA 4C3IH 3LULA 4LMQD 1X56A 1TA8A 1EY5A 5FO9B 1PYBA 5KFUA 2N3SA 4QF4A 2IWHA 1UAPA 2ZTEA 2AQ3B 4EQOA 2PNRC 4Q4DA 5DAAA 2YTXA 5DMXA 3DEOA 1X6OA 1SFOA 3CCRA 2QKIC 2OWOA 1JMCA 3MWMA 4YWMA 1FKAH 4EGQA 2Z8LA 4MIUA 3PIOA 2B63H 1QVCA 1A2UA 3A74A 2NVTB 2R7ZG 1A3VA 3RF2A 2XD4A 1XPOA 4DR6L 4LH6A 2F4VL 5KFQA 3R2TA 1WVLA 2K5WA 4A3LH 3KHGA 2BR0A 1B9MA 2DAAA 4IUQA 4RGMA 4B08A 2EJ0A 4X3SA 1GOZA 4NXNQ 3RBEA 3BJUA 1Y14B 3NQTA 4OONA 1YHBA 2MHVA 1PYWD 3GTLA 4JOIA 5C1PA 4I4TF 4CMDA 1WCMH 2L4NA 2KVMA 5FLMG 1FNUA 1J6QA 2EY6A 4GKJQ 1K28A 1W6KA 2Z04A 1Y69U 3RV4A 3QWUA 5BWVA 1UWVA 3HKZG 3K57A 1B33N 2YU9B 2F4VH 1STAA 1STYA 4CE5A 1VCIA 2F03A 4JCVE 4MV7A 1V8QA 3EA6A 2TSSA 1HNWL 2WTFA 3T1HH 1RDPD 3X3NA 3U9SA 3J7AV 4RCOA 5T1IA 1BJTA 5CR5A 2J6TA 4LJZC 2W6ZA 4DGZA 3RNUA 3J81E 2Q2IA 2P0AA 2UXBL 3FHWA 1TXYA 4O4JF 4BBSH 1Q12A 4JI8L 3PN1A 4GKKH 1TS5A 4DAPA 5FD5A 3AEVA 3K5IA 4EQ5A 4IURA 4JI6Q 2JA6H 3S2HB 1XX8A 4DV1H 4G4KA 1TWAB 3MWEA 3BA9A 1JWSD 2VQFL 4UP8A 2XGQA 3PVXA 4HJ9A 2I0QA 1BGWA 2NN6I 1VQJA 2XWJB 3P1HA 3UDIA 3K5LA 4BY1B 2NYZD 3HFZB 2UXDL 1AUXA 1G2TA 1GD7A 3TZDA 3GTQA 1JDEA 3UZBA 3K8AA 2BQ3A 4JV5L 4XTCS 1JWUD 3KLSX 2PBZA 3WO1A 5KT2A 4JI7Q 2JA8H 2F0SA 2NBFA 4J9RA 3S1RB 2EDGA 2F0HA 4RKLA 5EAYA 4JI8H 4MNOA 4A3EG 1XPRA 2W8KA 1I1LA 2GVAA 4FF3A 1PRTF 1SE4A 3A7AB 1RD9D 1SLJA 2B2TA 2HDLA 5L1JA 2NU6B 2QDLA 2B8GA 1JWMD 2VQFH 4M7EA 4CDCC 4POGA 2UXDH 1TVXA 4KY5A 1K9MC 1MZBA 3KF8B 2D0OA 1S3OA 2VS1A 1H9MA 2VNUD 1JOQA 3J81c 2AQ2B 4JV2A 2OTJA 2Y0SG 3RZDH 5I5YA 4JI0L 1U4PA 2W9CA 3PO3H 2Z0SA 4G7ZC 2YV5A 2VPQA 4LF4Q 2F0KA 4QCLA 2VQEL 4EG0A 1P8LA 1R9TB 5C8YF 1I3QA 1SJHD 3T9EA 1EL0A 3VYRA 3GTPB 3PMFA 4C3HG 4HJAA 2FJ2A 5KGUA 1S0NA 4LF9H 2CQOA 4G7HC 2YZNA 3FEWX 4MV6A 1PFSA 4DR2Q 3GIQA 3HT5A 4MV4A 4ECUA 5CB4F 3GIJA 2YL2A 4U68A 5F2DA 2QF7A 3VR3A 1I2LA 5KFNA 1BNCA 4IUVA 4DFAA 5M5XB 4JI0H 1WYDA 3O13A 1NCVA 4JOIC 2XIWA 2K1BA 1B50A 3OMGA 2D2CC 1L2FA 2PN1A 2NVXB 5C4JH 2R87A 3N42B 5LMNL 2WAQE 4HSPA 3NTKA 5AFWA 1SCUB 4Q0YA 1V1PA 2JSOA 2HHHQ 4HNTA 2K5VA 3QZ8A 4LF8L 1Z6HA 4F7XA 1EIFA 1SNOA 5EBCA 4TV8F 1EWCA 1Y1WH 4O84A 2FK2A 2MO1A 1VQ7A 5IGCA 3OW2A 2Z9HA 4BY7H 1SJED 2R8GA 2K5DA 2CNUA 2JN4A 3E0JA 4HIKA 3H0GB 4OX9L 1BQQT 5KT5A 4DV3L 3EYYA 5C3EG 2VUMG 2NVQH 1HNXQ 2KJXA 2F1MA 3ETJA 3NXWA 3R3OA 3KHRA 2HQLA 4BBRB 3U58A 1I94H 5IP9G 2VZAA 1T5EA 1TWFB 1TQOA 3M3YH 1G291 1SFOH 1U5KA 1EEID 4X65H 4U7CA 1DONA 1D5ZC 5K5PA 4IFDG 2M05A 1WTHA 4B3TQ 4FP5D 3RV3A 3Q8RB 1FJGL 1L1OB 4RUCA 1WTOA 3PZPA 1RKNA 3GV5B 3T1YH 3PFFA 4CDFC 3FRPB 1PHJA 4DV3H 2B8FA 1B3AA 2N8NA 4ZUJA 1X9NA 4QB4A 2JEGA 1A62A 2UXCH 3KF6A 1WRVA 2JJQA 2K52A 3C1FA 3W1GA 3C46A 3PUZA 2RQXA 1IBKL 4YY3Q 1XWEA 3NPPA 3UDGA 2KENA 4GS3A 2G9HD 4B3RL 1ZKOA 3RB3A 1RYRA 3AW8A 4C2MH 4XXEA 5D3IB 4A3CH 2B2TC 5G3LD 1XK5A 4O86A 2NN6H 1PTOF 2XGTA 1EQQA 4ME6A 4JI4H 1PXUA 3T16A 4NZNA 2EYFA 4CDDC 4A3KG 4A3GG 2HGSA 4XYMB 2CW0C 3M4YA 3JC66 2CW7A 3K6OA 2UUCH 3IRBA 4K5XA 2ZT9C 4DNTB 2PQEA 2HIXA 3JSNA 3GTKB 5EQ0A 1AE3A 2YYZA 4HR7B 3D6CA 1N33H 3E3XA 3GIPA 3Q8PB 4KTAA 3T53B 4DAYB 4RB0A 4R8UA 1PX2A 1KUTA 3HOVH 1RJPA 2VPSA 4BWSC 4GOPA 2D9UA 3GO5A 2FE3A 4FF4A 2R7ZB 2XWBB 4J9OA 1A0IA 4F8MA 4EGVA 2R92A 4ECTA 2GN5A 5IYBH 3K7UC 2CNQA 2A73B 4LF6Q 2L0CA 3TIIA 4QWAA 1LYLA 3S14H 4A3IH 3T7AA 5IYDH 5IYZF 2OF1A 4O7VA 4DL7A 5CORA 1LT3D 5IYCG 3VR6A 4MTKA 3MFIA 4WJ3M 4IZ8A 4MA5A 3F1ZA 4UCOA 4CJ1B 3HS0C 5BN3A 3GTQH 2JA5H 5LMNW 3V6KA 1WTWA 2GVBA 5DM73 3OIQA 3KAKA 2KQ3A 4QWBA 4KHVA 5J22A 4DV7Q 1F9SA 3HKZB 2NU7B 1I6UA 1PV4A 5EDWA 3KAJA 3M4PA 3L4KA 1VF7A 1WTPA 1TWGA 5K36H 5CV8A 3GIKA 2YS7A 1GUTA 2V9WA 4DUZH 5ELOA 5FLXL 1SXTA 3J80E 4X64L 1ZEQX 2FK1A 4YWLA 3KDFA 1SRUA 2AUJD 2UUAQ 4DV5L 2Q8IB 5DGBA 1T3NA 4JI2Q 5KFTA 1NAPA 2BH2A 3IN5A 1N9WA 1AEXA 2LMCB 1K1SA 4ED8A 2XCPA 1DCZA 3W1BA 4X66H 4RB2C 4XQQA 2FPGB 1PTOH 3PV0A 2KCMA 5T14A 5KG7A 2DZDA 1BR9A 4EYHB 3HOUG 4IFDJ 1G51A 3NE5B 4IJHA 4WRDA 4C3IG 5IGBA 2QA4A 3Q1KA 1JXLA 3M4OB 4K14A 3NP8A 3PUWA 3J7A5 3J7AF 1EY4A 2AGOA 1K83H 2A69C 1VKZA 2UVVA 2JEIA 2F0VA 3S2DB 1ICFB 3KREA 1N34Q 3GTMH 4NKLA 3CC4A 2CW0D 4QIWA 2GA4B 3Q8DA 5AJ3L 5DGIA 2QGQA 5BWRA 3R93A 3N8DA 1F2LA 2Q8RE 3PUVA 4ZCKA 2B63G 2K5HA 3QOJA 4K0KQ 4PQXA 1I6HB 4A76A 4GNXB 4HTHA 5A2QW 4ED7A 2HCCA 3P20A 5JOBA 2KSWA 4WJWA 3AFPA 1CK1A 4OWTB 3IAYA 2UVUA 5JJIA 2L11A 1HZAA 3V4SA 1HCZA 5CV6A 1MSHA 1HA5A 1CS0A 2D5DA 4TM5A 4DAAA 4RU9A 3E9HA 4A2AA 4E6NA 5DISC 2J6UA 3U0GA 4ALPA 2UUBQ 4RGNA 4LFCQ 4JI5Q 2L15A 1UE6A 3QOLA 4RFBA 1FGBD 3OIPA 4HMJA 3T9FA 2JEFA 2PI2A 3T5LA 5CYUA 1STHA 1KIXA 4HNVA 2F0GA 1BBUA 3SE0A 1SR3A 1PMRA 4KJNA 4F4WA 5JPMC 1WCMG 4LF5Q 3TP6A 5IT9c 3F2CA 5IGEA 3NELA 2Y0SB 5T1GA 1DZ1A 3TP5A 5M3MH 5L9XA 3GTJA 4NXNL 1EY6A 4QIWE 3EVQA 2F0IA 4AYBE 2Y4RA 3BAAA 1TWCB 4HAEA 3Q8SB 4C5CA 3S1QH 2FLLA 4GOPC 5KT3A 4POFA 4XQJA 4ECYA 1SMYC 2EYHA 3S16B 1LTSD 4XIGS 5LP6F 3CW2C 1DV2A 4HJ7A 1CFMA 1EEFD 2LXKA 4C3HB 4GKJL 4IHJF 2SOBA 2COJA 1MBYA 3SK6A 3H15A 2C28A 4CJ2C 1HQMC 1SNCA 2V1CC 2OQ0A 2WIIB 5CA1F 3EFXD 1SDFA 3K3VA 3HOZH 2JXMB 5KRUA 3J80i 4FU0A 4KHPQ 5EKKA 1Z7TA 4EBDA 4TKOB 3GV7B 1ASYA 4BBSG 1M7JA 1BXTA 4FXGC 1M6VA 3TW7A 4JV0A 5KG4A 1SNMA 1ONLA 3CP0A 5DNFA 3T4AC 5M5YB 2JA6G 4F4ZA 5GQOA 5L37A 4O7YA 3HG9A 1A6XA 1NTGA 4UCUA 3RJ0A 4FF2A 2K6AA 1TAEA 4I7ZC 4XT1B 1JICA 2M00A 2MCTA 5BR8Q 1VQNA 5HURA 2KEEA 4OO1I 4H7BA 1YNXA 5FLXW 2R86A 3HZXA 1E4EB 3I4NH 1V9PA 4NW2A 3R5XA 4JI6L 2M2LA 3J80L 2F3WA 4DK6C 3TMEA 1AZQA 2ZTDA 2D62A 5CR3A 2CWAA 1S97A 2A69D 3OMCA 2VUMB 1Y1VH 2HJWA 3CAMA 4ED6A 2JA8G 2JA9A 4TQUS 1J5EQ 4DR4Q 5KFWA 1X65A 2VW9A 5BPHA 3I72A 1AN8A 3LWEA 1GKHA 1QILA 1EU3A 1TWGB 1N36Q 3I91A 3A56A 4JI7L 1ENFA 2ENBA 3N6XA 1KRTA 3H3VI 1K1QA 4DV6H 4HJ8A 2EYOA 2EYPA 4IRCA 1YZ6A 5I6WA 1JE4A 3I8ZA 5KG1A 2JEAI 2MUYA 3M9BA 3PGZA 2XIGA 5I2YA 5LMUQ 4LWCA 4EEQA 5LL6X 3D31A 2EIFA 5A35A 5HBRB 2RSOA 3PO3G 2YZLA 4ULLA 2IP4A 2EPBA 4YJ2F 3EIVA 1X32A 3MR3A 3ETHA 4FBTA 5JVDF 5ELNA 2E2DC 3H91A 3U50C 2R7LA 4O7NA 1E1OA 3OPOA 5LA6F 2JA7G 5ELDA 5IWAH 3N6RA 2NWGA 2BH8A 4PMWA 2W57A 1V1OA 5M5WB 1SMYD 4LF4L 3FPPA 1SNQA 3C1EA 3ULJA 3ULLA 2A19A 1BBWA 3S1MB 5DM63 5GAHC 3LP8A 4HNUA 1DM0B 5JQGF 4A3KB 4A3GB 5KX5F 3G48A 5GROA 2NVYH 5K2MA 3VR2A 3JRXA 2UU9H 4DR2L 4ZKCB 4RAZA 3DEPA 3TIGA 1SYGA 3FKIH 3TY5A 3J7AK 2CZGA 4DNRB 2H5XA 1I6VC 1K0SA 1CE8A 1D6EC 4PMBA 1Y1WG 4ZOLF 1IYVA 2YU9A 1UE1A 1BUVT 4BY7G 1YEZA 4P2CB 2PZUA 1DOLA 1LO5D 4IPGA 5I4DA 1RK5A 3NUAA 4GN3B 2HHHL 1D7QA 3JRWA 3Q2OA 4IIJF 1B9NA 1IYJB 2KCNA 4RWSC 5EKLA 4MTNA 3HKSA 5IP7H 5D3DA 4IUTA 2FMCA 4DR2H 2N55A 2L12A 2DY7A 5KT6A 1S4ZA 5C0XI 1BNZA 4Q45A 1I1KA 2EJGC 2Z4HA 2XSCA 3QB3A 1HNXL 3PW4A 3RD4A 3GTOH 1A3UA 5J3BA 1XMQQ 1UE5A 1CA6A 3R2IA 1DGSA 2YW2A 3K0XA 3I2ZA 2SEBD 4HEDA 1BCPC 4LUVA 3K0YA 3FDSA 4P71A 4O42A 2RHQB 4EQPA 3QR8A 1A9XA 1G6PA 5I47A 5CE8A 1TWAA 3CQZB 3PF5A 4KKUA 4TQSA 2N78A 4H0LC 3MFHA 1JC7A 1E0BA 3J80W 1PFMA 4HCSA 3SR1A 3PIP3 1RCVD 3GD7A 1V51A 4MV1A 1BBXC 4B3TL 4X62Q 2Z6KA 4JW0A 2R84A 1E4GT 5KFZA 4RA8A 1N48A 4B3MH 2CVRA 1BCPB 2R6FA 1B70B 2AGQA 4A3MH 1TWHH 1HNXH 2LXJA 2VB3X 1MD2D 1PVOA 3JZIA 2EYLA 2AMCB 4TRDA 3SE7A 1EY8A 4U6PA 4A3CG 3R5HA 2NN6G 3V6HA 1G8ZD 4OO1H 2LKVA 4KN7C 2FPPB 4YY3L 2GPSA 3KTMA 4HJ5A 3UFXB 2K03A 4C3IB 3LWBA 1HUMA 2F0LA 1I50B 1ZHSA 2K5NA 4WJ4A 3T5KA 3HRZC 4GC7A 3I4MB 2DNCA 3KF8A 2E2HB 2R93H 1EUJA 4DUYQ 2YRXA 4EFBA 2K4KA 1H9RA 1C9OA 1PA6A 3U4VA 1QUQB 3PR4A 4FGRA 3BA8A 4A3FH 4R4TA 2RSNA 1HA6A 2C2DA 1OXXK 2B63B 4JXUA 2I46A 5CV5A 3HOVG 4DV2Q 3H20A 1W2BA 3CMEA 4DR3Q 3H3VH 2Z4IA 1R9TA 1YJ9A 4ZKBB 2E2IH 5IYBG 2KUMA 2Z02A 1JR0D 3MZ5A 3GTPA 2OTLA 2ES2A 4A3IG 2V5AA 5IYDG 1SROA 4UCTA 4ECXA 3RLNA 1KEEA 5H1SE 1STEA 3VR4A 3CHBD 2Q2TA 5HY6A 1S03G 3AYHB 1X54A 3K81C 1TU2B 3NBHB 1KD1C 3F2BA 3CVZA 5L1KA 3ORRA 3K3PA 3GTGH 3PW0A 2JA5G 3BYYB 1C0AA 3GQBA 2NZHA 1WCMB 3I4OA 3S17B 1KTAA 4FFRA 4PWQA 1I4HA 4QUFA 3NWTA 4DR1Q 2C22A 2NVXA 4FNFA 2EOTA 3GV6A 2F0QA 4CMFA 2OEOA 1HTPA 5DQGA 1BCPD 4IO9A 3M7NA 5K36G 2W70A 4LNQA 5L1LA 3K58A 4PV1C 2CNVA 3MWYW 4GC6A 4YCWA 4BS9A 1KJJA 2A1HA 1B53A 3D0FA 3E6ZX 4K8IA 3H0GA 4DV7L 4RAUC 2NZOA 4IJLA 4JK1C 4G7OC 2AQ1B 2IX0A 3GJXB 1DOKA 3A8JE 3PUXA 3DWQA 2NZ1D 2RDHA 1JLLB 5HGTA 1Z9FA 2WAQG 4OELB 3OOCA 4DR6H 4Y7NH 3OTOQ 1TWFA 2RVLA 4BBSB 3A8IE 2K7VA 1NUCA 2UUAL 3D4WA 2ICIA 1LTGD 4JI2L 1AFPA 1KTKA 2JA6B 2E5LQ 2K33A 1ICWA 2J7ZA 4LW1A 2ATLA 1VMCA 2W8LA 4B9WA 3DTFA 1L1OA 4J9PA 3R9RA 5M9OA 2V58A 4O2DA 2X0SA 1T9HA 3A5UA 3EQLC 3EN2A 1F9PA 4NZMA 1CZGA 4MHEA 5C0XH 2Z6KC 1A63A 3T56B 2H4OA 2R7KA 2R8IA 5IODA 5KYLA 2JA8B 3F8NA 2JYOA 3RLOA 4CJ0B 1G2SA 1AE2A 1E24A 1F2MA 2PZTA 3MTSA 4BA1I 1N34L 3N43B 5I5UA 1HNWH 1EOTA 4K5VA 2WYOA 4DV0Q 1V43A 5BN4A 2QEXA 4K0KL 1A15A 4APMA 3H94A 1EHIA 2YZMA 1TS2A 1X3GA 1F2YA 3OW7A 4DAVA 4N9PA 1C30A 2UXBH 3D4DA 1OO9B 1YJNA 2GPWA 3WDNA 4ETSA 1QWYA 5A2QE 4EGJA 1EWHA 3CCVA 3ULPA 3BZKA 2RCFA 4LFCL 4JI5L 3RZDB 5M3MG 3RIZA 2RDJA 2ID0A 4PG3A 2ZM6Q 3VPCA 5C4ZA 3PO3B 5KFIA 5KFOA 3GTKA 4HR7A 2B2UA 1DIKA 3ND9A 4DAYA 4KK7A 3D6WA 2C5CA 3CCJA 2FMAA 4RGOS 3G6XA 1ZYRC 4LF5L 4A3DH 3AB9A 5J1ZA 2JA7B 1BF4A 3KHHA 4K0KH 2R7ZA 4RH6A 4BWGB 5G3LF 3BACA 4UFZA 4JV5H 2IMWP 2MFIA 5DLFA 1AN7A 1OXVA 2F0MA 4JC0A 2A6HC 1IHZA 3K5MA 1B3QA 3HOZG 4RHRA 4O3OA 1PFBA 4DR7Q 3P7JA 4JI5H 2GQRA 2DNEA 3VDYA 3U9TA 4QMGA 5BYBA 4FM9A 4S3SA 2WE6A 3WNZA 5BN5A 2O4XA 3H40A 5C4JB 3M4IA 2IY5B 2RDFA 2B3GA 2RKSA 1UUPA 4DV4Q 4N9TA 5KFFA 5CA0F 1HR0Q 3V05A 1G2WA 4NYEA 3T9CA 4KHPL 2G5DA 3HKZA 1Y1WB 4O1NA 1I4PA 2V4RA 1X3QA 4BY7B 3S15H 2XRSD 2V4DA 1QZGA 1SYXB 3I4NG 3VMMA 3F8TA 4F87A 3K59A 1Y1VG 4EX5A 2F0JA 4RKBA 2NVQB 1IBLQ 1EYGA 1XDNA 4RNNA 2VQEH 5BR8L 1XMOQ 1M8AA 1W96A 3I56A 2YYAA 1EU4A 1IL2A 1SAPA 1PRTB 2DY8A 4UP9A 3DTGA 3D8GA 4L5SA 1IL8A 5BWWA 5COYA 2EYMA 3UDFA 1S0OA 4NLGA 3QQMA 2ZXRA 1CKNB 4DL2A 3A5ZB 4L63B 5FLXE 1J5EL 4DR4L 1CQVA 1S40A 3J7ZC 1VMPA 5LYJF 3T9AA 4R4OA 4NPSA 4JBWA 5FR9A 1N36L 1HNZQ 1L1OC 3NHHA 4O3RA 2R7NA 1M90C 5ELBA 2HGXA 3I90A 4AQYQ 1XNRL 2YTVA 4EFEA 1KBLA 1I4XA 5LMNH 3T5HA 1O80A 2JP1A 2QDBA 4ZI7F 2FP4B 4APVA 4LFAQ 4O7SA 3BU2A 3KUPA 4LF8H 3NBYB 4IR9A 3TRZA 4J8QA 4DN4M 1CQJB 1T36A 3MEFA 4O7ZA 2B2YC 5M3FB 3BS1A 2R8HA 1BO0A 3NSWA 5ISRA 4GNXA 2KOLA 4J6HA 5LMUL 1NSNS 4HYKA 4KV6A 4OX9H 3LWUA 3PW7A 4C2MB 5JQWA 1J5EH 3WOFA 2NVXH 3MXGA 3ORQA 1TY0A 1ZYRD 1JQYD 3CCEA 4IWYA 5DG9A 5I5VA 1JJGA 5EOYA 3L2PA 1OBGA 1Q90A 4LAAA 1WD0A 3KHLA 4JI3Q 4R7RA 1XNRH 2K28A 2A6HD 3ND8A 3RZOB 1GUWA 1PZJD 1ET9A 3GTLH 2I5HA 4ZAIA 5A2QL 4Q44A 2WKDA 1PYSB 1M1KC 3PO2H 3G6YA 1I4RA 2NB0A 5CV7A 1JDBB 2Y0SA 1FJGH 3FKIG 1FD7D 3CPWA 1WD1A 2JQOA 3TP8A 2B2UC 3AMUA 5KFLA 2IJ0A 2R3ZA 1CKOA 4DL5A 1Q8KA 3HOVB 1HFGA 3FP9A 1N32Q 2I87A 3CCMA 2RA4A 4DR5Q 1TWCA 3TN2A 1PZKD 2IBKA 1TS3A 3K80C 2E2JH 1ZAUA 4O81A 1S9FA 2ATWA 1GSOA 3VPDA 3S14B 4A3IB 5C6AA 1N56A 5KFHA 4R8IA 4UP7A 2E75C 2XCLA 4HIMA 4JUZA 1EY7A 1IBKH 4OL7A 5IP7G 2F0NA 4ILWA 4NMZA 4B3RH 1RIPA 3E9IA 2NUAB 4ECQA 3CCQA 4PDBA 1Q8IA 3NTHA 1QVFA 4AYBG 3G6VA 3TY9A 3KALA 2IA6A 3CXCA 1VQFA 4I65A 1W3SA 2R7MA 4Q43A 1DV1A 2A1AA 1E3PA 3T13A 3FMCA 1LTRD 2Y0SE 3LMLA 1TS4A 3HBLA 2PCFB 4WHXA 2YWVA 1IOVA 2ZDQA 2NUCA 1Q1EA 4GLXA 3PF4A 1MI2A 5JVH3 1XMQL 2FK3A 3G8CA 4XX0B 4CGYB 1IKLA 2DN8A 1NNXA 5FOBB 1E4EA 3RB0A 4FFLA 3BDCA 1S0MA 1HPCA 1YJWA 4M9UA 4LF7Q 1Z2PX 2IX3A 1I7NA 3EROA 2VUMA 3CCUA 4A3MG 3HOYH 2RCNA 4ECZA 5BWUA 4H02A 4G57A 3MJFA 4YCUA 5GAGC 4GLAC 2XCAA 4X62L 1RJTA 1WTQA 3NEMA 1PTOB 4MZ9A 1AZPA 4MV3A 5FPOA 1LABA 3CD6A 4OO1G 3CCLA 1JKJB 3NENA 1Y8OB 4YHHQ 1EYAA 1IW7C 4NB3A 3MXPA 1EIHA 4QWDA 5DG7A 3SI8A 5DGHA 2BE5C 1LV9A 4RZRA 2B39A 2XVSA 4KKSA 2MNAA 2W6OA 2P5ZX 2LFNA 3T1HQ 2R93G 1IBMQ 1K83B 3HOXH 4OIKA 4X3UA 4E4TA 5JPNC 1SBBB 1WSCA 1U0LA 5D14A 2KCCA 4LUZA 3GTMB 1ZXTA 4QWCA 4J9QA 4EYIB 3TW6A 5E1FA 4A3FG 4M8AA 1CKMA 2L9HA 4J9NA 5CGKA 3P75A 3EPGA 2DABA 5I60A 4N8X1 2O03A 2DGYA 1II3A 4DUYL 4GNXC 2QEJC 4BXXH 4GKKQ 4G3IA 1I3QH 5CV9A 2F0DA 3PIPA 4YAJB 2HIVA 1IXRA 3M9OB 3UE1A 4DV1Q 2I80A 3WWHA 4X64H 5GAEC 5CMDA 2W71A 1YVCA 1M0TA 4DV5H 4Q4CA 1QE6A 2YCHA 4R4CA 4DV2L 3CMAA 2EZVA 1RHPA 1AH9A 3WWJA 4DR3L 2OQKA 3T51B 3L7ZC 5EZYF 2HHFB 4I7HA 4DL6A 2VR1A 3MFGA 4O83A 1EZ6A 1VBGA 2BDNA 5LXTF 2IX1A 4A3EB 2GQSA 1Q46A 2E76C 1F2ZA 2R61A 5FJ8H 1LTLA 3W2DA 3TS2A 5ELFA 2X6LA 4DUYH 2W9AA 1CHQD 5DLQE 2W7PA 1S5CD 4A3LG 2SCUB 4J0MA 1ESFA 3J80c 2SNMA 3NGDA 1K0RA 3GDEA 2HT1A 1KJQA 3STBC 4HQ6A 2VQFQ 5C5MA 4L8JA 2FPIB 2F0EA 1A48A 4DR1L 4IQZA 4O7RA 4CC5A 1WH2A 2X5RA 4YWKA 3VOTA 2I8CA 5D8DA 3DF7A 4A93H 5KFYA 1AP0A 1E1TA 2BA1A 2FB9A 4IUNA 1PH1A 4WFN3 1HXYD 2EVBA 3HOZB 3AU7A 2Q8TA 2EJMA 4FFNA 1EQRA 2WB1G 1KC8C 1IYUA 2XN9C 4FXDA 1VF5C 5DQHA 1KXLA 2ZJTA 3I4LA 4RZQA 5DEHA 2RHSB 1LACA 4K8JA 4LF9Q 1EWIA 3E5SA 4EBCA 1IW7D 1UE7A 3CQZA 1HJPA 1JCKB 2BE5D 5EPJA 5JJKA 4L5QA 2PI2E 4Q0FA 4ZHQF 2WDTA 4M0JA 2E5LL 4NXNH 2DPJA 4R9WA 5C0XG 1Y1VB 2F0WA 1VQ5A 2ICEC 2VQDA 3OWFA 5J2TF 4DQNA 4ECRA 1WJJA 1GO3E 2RF4A 2AWOA 4PMCA 2LS01 2RBMA 3CC2A 5BYAA 4GKJH 2DJFC 3TEHB 1EFWA 3K5HA 3M9MB 4FO2A 3PW5A 3MVVA 1HZBA 4KJOA 5KG5A 2OLSA 4R4QA 3NWSA 2F0UA 1FNVA 3U9OA 4V0BA 3OWEB 1Q81C 4OXPA 2CQYA 1K73C 2M9VA 4HMIA 5C3EB 5KNCA 4C5AA 4FDBA 4ZLTF 1W6JA 5C4XH 4NXMQ 1PH8A 1I50A 4A3BH 4DV0L 5IY0A 5KFSA 2E2HA 4KY7A 3R23A 3KOJA 3QIAA 4DU9A 2J4XA 1I94Q 1XPUA 1B6RA 4ECWA 1Y8PB 4ME3A 1QUQA 1MGSA 1VQIA 4O7WA 1QOHA 5I2XA 2B63A 4X65Q 1L0WA 1XTDA 3SK8A 3RMHA 4A3DG 2QCPX 3MC0B 1TY2A 3NBIA 3QO2A 2AUKA 2R92H 1JB3A 4JI6H 2K32A 4ODGA 2ZM6L 5CBAE 3LNNA 3STBD 3LX0A 5FD6A 4I7AA 3SHLA 3Q0AA 3T1YQ 1YHQA 1Q7YC 4MTEA 4DV3Q 4YR2A 2RGRA 4LSAA 4QQBX 2RDGA 4KN4C 3S24A 1I1MA 5IT9L 2I5MX 4FS1A 2UXCQ 1PH4A 1BVSA 4QWEA 2OT2A 3NBHA 2NVYB 2WFWA 4QL5A
chains in the Genus database with same CATH topology
4JI7H 3JAMi 4JBJA 4X6AH 2KCTA 4DR7L 1X55A 4C3JH 1S68A 1YHAA 1CUKA 1TWGH 3HOWH 3OYYA 1KL9A 4JI4Q 4DV4L 4A4IA 1HR0L 4R4IA 4P73A 2UUCQ 1PH5A 1MKHA 4P75A 1B04A 1N33Q 4L5TA 3F2DA 4LF4H 4TVAB 1IBLL 2CW8A 1VQOA 3WWVA 1X3EA 1YIJA 4UCVA 4UPAA 3S1MH 1HNZL 5C0XJ 1VQCA 1OXSC 4JI1Q 4AQYL 1UEBA 3RN5A 3C0FB 4LFAL 2HHHH 4KI0A 2HVRA 2KHIA 3CC7A 4DUZQ 3UQ8A 5JJLA 1P16A 1O75A 3PO2G 1Z47A 3GTJH 4DPGA 3NC0B 4JI3L 4B3SQ 4A3JH 2YTYA 4X66Q 1MJCA 5D1PA 3PUYA 3S1NH 1PH3A 4B3TH 4QJFA 1N32L 1YI2A 5IT9W 4MTDA 4DR5L 2MO0A 1YITA 2K75A 1Q86C 4RB3C 1PH7A 2IHEA 4A2BA 4YY3H 1VQDA 3KXYT 3KYHC 4J15A 1CSPA 1NY4A 1H95A 1FL0A 2AWNA 1C7YA 5JEAJ 3K7AH 1HR0W 1EIYB 4LF6L 3JAMW 3CF5A 3HOYG 4LSXA 4UCRA 1I50H 3HXLA 3I4MH 2E2HH 1K8AC 4LF7L 2KBNA 1CKNA 3I55A 2DUDA 5C44H 2FXQA 4LF6H 3MXNB 1KQSA 3HOXG 2A8VA 2CKZB 2HVSA 3E0EA 4YHHL 2Q2HA 4RAYA 1JJ2A 3TREA 4GN5A 3T1HL 1IBML 4BXXG 1VQPA 4LF7H 2NVTH 2ZJPA 3S17H 1VQLA 4DV7H 2IHFA 1XNQQ 4PZ7A 2D0PA 2R6GA 4GKKL 2PQAB 4YHHH 4DV1L 4DRFA 2LSSA 3M85A 4LMYA 2UUAH 4JI2H 5FJ8G 3RGZA 1IBMH 1YBYA 3U4ZA 1VQKA 1VQ9A 2YU9H 4DV6Q 1B8AA 3RN2A 2ALYB 4A93G 3ZJYC 4KLKA 2UUBL 4YCVA 1GYFA 3RTXA 1N34H 4HIOA 4L5RC 4IPHA 4OWWB 1Z2OX 1BKBA 1B7YB 5IWAQ 5D1OA 2CCZA 4IAJA 1XJVA 3S2HH 3KLWA 1TWAH 1D8LA 1QZHA 3TY8A 2UUBH 2JE6I 4LFCH 4BY1H 2Q2UA 2HVQA 3GB8B 1MIUA 4LF9L 2UU9Q 1KHIA 4LF5H 3S1RH 1PH6A 3VNNA 4CC6A 3N41B 2C35B 4PZ6A 3JSLA 2ZJRA 3CCSA 5C4XG 1FGUA 1NMFA 1KAWA 2JA7H 4A3BG 2N49A 1ZHQA 2WP8J 2KHJA 4KHPH 3AFQA 4NXML 2AKWB 4RMFA 2R92G 1R9TH 1E7ZA 1I94L 4KHZA 3ERSX 5E7NA 1NMGA 3HKZE 3G71A 3GTPH 3J81i 5BR8H 4X65L 4P72A 2JEBI 1KRSA 1A8VA 4LFBQ 2EQSA 4B3MQ 4Y52H 5M5XH 3T1YL 4NXMH 4DR4H 4JYAQ 1Z2NX 5LL6b 1N36H 2UXCL 1V1QA 1N8RC 1MJEA 1VQGA 3HOWG 2ZTCA 1Q1BA 3EBEA 4JG2A 2VOBA 3H0GH 1SE8A 2IT1A 5LMUH 4PZ8A 5FLXc 2XTIA 4BBRH 3PCOB 1SN8A 4JI4L 1VQAA 1TWFH 2UUCL 3NBZB 4AH6A 1GM5A 5M3FH 1N33L 3ICEA 4DNIA 5D1OB 1JB7A 3RZOH 5GADC 4GLVB 3KFUA 1E22A 4GN4B 4IOAA 4JI1L 4OWXB 5FPRA 2K14A 1X3FA 1VQ4A 3DM3A 1NJIC 4DUZL 3GTKH 4A3JG 4DR6Q 2F4VQ 1L2ZA 1XMQH 2R7ZH 2VY3A 4JI1H 3FMAA 2CFMA 4B3SL 5HGQA 4UCSA 4X66L 3KJOA 1NE3A 1OXTA 1EOVA 1E4FT 4X62H 1O7IA 4A75A 4DK3C 5FLMH 2RGVA 1HNWQ 3J81W 1PH9A 4B3SH 2JK8A 1WFQA 4IFDI 1VQHA 3N40P 2UXBQ 4JI8Q 2F52A 4IPCA 1S72A 3I4MG 5IE8A 3SGIA 1SMXA 4DV2H 2UXDQ 2VUGA 4DR3H 1LUZA 5C44G 3BZCA 4JV5Q 3M4OH 1WOCA 1HZCA 3S2DH 2K50A 3KF6B 2PMZE 1OTCA 4BA2I 1I6HH 1SEIA 1VQEA 4DR1H 4A3EH 2MQHA 3OTOL 3UDXA 1FVIA 3AQQA 1JJCB 4JI0Q 4O0AA 1XNQL 1JT8A 2VQEQ 3DLLA 3L0OA 4R1JA 3ER0A 3CPFA 3OTOH 4GOPB 1TWCH 2B29A 3JAMc 2E5LH 3S16H 4C3HH 4IPDA 1XNQH 1WI5A 1VQ6A 5LMNQ 4DV6L 3G4SA 2OCEA 1HH2P 3KJPA 1PH2A 4LF8Q 4LH7A 1VQBA 4JBKA 5M5YH 4OX9Q 4QY7A 4DV0H 3LGJA 1JE5A 4BY1G 1XNRQ 5IWAL 1VS0A 3KDFB 5C3EH 2VUMH 1VQ8A 2ZM6H 5IP9H 1FJGQ 1M0WA 2F3IA 4MV9A 1ASZA 5JEAG 2UU9L 1NBWA 4UY8C 1QVGA 1IBKQ 4B3RQ 4DR7H 4RG1A 1XMOL 1CSQA 2ZJQA 4IOCA 2AHOB 4DV4H 2I5LX 2E8GA 1K3RA 1HR0H 2WB1E 1VQMA 5M5WH 3I7FA 3A0JA 2PNHA 3M4QA 3UE0A 3L4JA 4JBMA 2PQAA 4A3KH 4A3GH 4DKAC 3IG0A 1IBLH 3BABA 1XMOH 2VL6A 4LFBL 1OXUA 4B3ML 1RL2A 1HZ9A 1LM0A 4JYAL 2R7FA 3H0GG 1Q82C 1HNZH 4RB1A 2ASBA 4AQYH 2CWPA 4BBRG 3RR5A 5IYCH 4LUOA 4LFAH 1K8GA 4LFBH 3G6EA 3W5OA 3RGXA 4AIMA 4DAMA 5M3FG 4JYAH 4X64Q 4P74A 4DV5Q 2EXDA 2R7DA 3CQZH 4JI3H 3PSIA 4HIDA 3N44B 3RLFA 3J81j 3TQYA 4QGUA 1IZ6A 3B6YA 1N32H 1GVPA 2BA0A 4DR5H 3TS0A 1I5FA 5AJ3Q 3HOUH 4C3IH 1X56A 1TA8A 1PYBA 2N3SA 2ZTEA 2YTXA 1X6OA 3CCRA 2OWOA 3MWMA 1JMCA 4YWMA 1FKAH 3PIOA 2B63H 1QVCA 3A74A 2R7ZG 3RF2A 1XPOA 4DR6L 4LH6A 2F4VL 4A3LH 4NXNQ 3BJUA 1Y14B 4OONA 1YHBA 4JOIA 1WCMH 5FLMG 1J6QA 4GKJQ 3QWUA 1UWVA 3HKZG 2F4VH 1VCIA 4JCVE 4MV7A 1HNWL 3T1HH 1BJTA 3RNUA 2Q2IA 2UXBL 3FHWA 1TXYA 4BBSH 1Q12A 4JI8L 3PN1A 4GKKH 5FD5A 3AEVA 4EQ5A 4JI6Q 2JA6H 4DV1H 3BA9A 2VQFL 4UP8A 4HJ9A 2I0QA 1BGWA 2NN6I 1VQJA 2UXDL 3UDIA 3HFZB 1GD7A 3K8AA 4JV5L 4XTCS 4JI7Q 2JA8H 5EAYA 4JI8H 4MNOA 4A3EG 1XPRA 2GVAA 1SLJA 2VQFH 4M7EA 4POGA 2UXDH 1K9MC 1MZBA 3KF8B 2D0OA 1S3OA 2VS1A 2VNUD 3J81c 2OTJA 2Y0SG 3RZDH 4JI0L 3PO3H 2Z0SA 2YV5A 4LF4Q 2VQEL 1P8LA 4HJAA 4LF9H 2CQOA 1PFSA 4DR2Q 4JI0H 1WYDA 4JOIC 1L2FA 5C4JH 3N42B 5LMNL 2WAQE 4Q0YA 2HHHQ 2K5VA 4LF8L 1EIFA 1Y1WH 2MO1A 1VQ7A 4BY7H 3OW2A 4HIKA 4OX9L 4DV3L 3EYYA 5C3EG 2VUMG 2NVQH 1HNXQ 2HQLA 3U58A 1I94H 5IP9G 2VZAA 3M3YH 1G291 1SFOH 1U5KA 4X65H 4IFDG 4B3TQ 1FJGL 1L1OB 3T1YH 1PHJA 4DV3H 2N8NA 1X9NA 1A62A 2UXCH 3KF6A 2JJQA 2K52A 3W1GA 3PUZA 1IBKL 4YY3Q 3UDGA 2KENA 4GS3A 4B3RL 4C2MH 4A3CH 1XK5A 2XGTA 1EQQA 4JI4H 2HGSA 4A3KG 4A3GG 3JC66 2CW7A 2UUCH 3IRBA 2HIXA 3JSNA 1AE3A 2YYZA 1N33H 4DAYB 4RB0A 3HOVH 2VPSA 4BWSC 4GOPA 2FE3A 3GO5A 1A0IA 2GN5A 5IYBH 3K7UC 4LF6Q 1LYLA 3S14H 4A3IH 5IYDH 5IYCG 4WJ3M 3F1ZA 4UCOA 3GTQH 2JA5H 5LMNW 2GVBA 3KAKA 4DV7Q 1I6UA 1PV4A 3KAJA 3M4PA 3L4KA 4DUZH 5ELOA 4X64L 4YWLA 3KDFA 1SRUA 2UUAQ 4DV5L 4JI2Q 2BH2A 1N9WA 4X66H 3W1BA 4RB2C 3PV0A 2KCMA 3HOUG 4IFDJ 1G51A 4IJHA 2QA4A 3PUWA 3J7A5 1K83H 1N34Q 3GTMH 3CC4A 3Q8DA 5AJ3L 2QGQA 3PUVA 2B63G 2K5HA 4K0KQ 5A2QW 4A76A 4GNXB 2KSWA 3AFPA 4OWTB 5JJIA 1HZAA 3E9HA 4A2AA 4E6NA 5DISC 4ALPA 2UUBQ 4LFCQ 4JI5Q 2L15A 1UE6A 2PI2A 1KIXA 1BBUA 1SR3A 1WCMG 4LF5Q 5IT9c 3F2CA 3NELA 5M3MH 4NXNL 4QIWE 3BAAA 4AYBE 3S1QH 4GOPC 4POFA 4XIGS 3CW2C 4HJ7A 4GKJL 2LXKA 3H15A 2V1CC 2OQ0A 3K3VA 3HOZH 3J80i 4KHPQ 1ASYA 4BBSG 3CP0A 2JA6G 5GQOA 4UCUA 1NTGA 3RJ0A 1TAEA 2MCTA 5BR8Q 1VQNA 4OO1I 5FLXW 1YNXA 3I4NH 1V9PA 4JI6L 4DK6C 2ZTDA 2D62A 2CWAA 1Y1VH 3CAMA 2JA8G 2JA9A 4TQUS 1J5EQ 4DR4Q 1X65A 2VW9A 1GKHA 1N36Q 4JI7L 3N6XA 1KRTA 3H3VI 4DV6H 4HJ8A 1YZ6A 2JEAI 3M9BA 3PGZA 2XIGA 5LMUQ 4LWCA 4EEQA 3D31A 2EIFA 3PO3G 3EIVA 5ELNA 3U50C 1E1OA 2JA7G 5IWAH 2BH8A 4PMWA 2W57A 4LF4L 3ULJA 3ULLA 2A19A 1BBWA 5GAHC 3G48A 5GROA 2NVYH 2UU9H 4DR2L 4RAZA 3TY5A 3FKIH 3J7AK 2H5XA 1Y1WG 1UE1A 4BY7G 1YEZA 4IPGA 4GN3B 2HHHL 1D7QA 1IYJB 4MTNA 3HKSA 5IP7H 4DR2H 5C0XI 1HNXL 3GTOH 5J3BA 1XMQQ 1UE5A 1DGSA 3K0XA 3I2ZA 4LUVA 4P71A 2RHQB 1G6PA 3PF5A 2N78A 3J80W 3GD7A 4B3TL 4X62Q 2Z6KA 1E4GT 4B3MH 1B70B 4A3MH 1TWHH 1HNXH 2LXJA 1PVOA 2AMCB 4A3CG 2NN6G 4YY3L 4HJ5A 1ZHSA 2K5NA 4WJ4A 2R93H 1EUJA 4DUYQ 4EFBA 2K4KA 1C9OA 1PA6A 3U4VA 1QUQB 3BA8A 4A3FH 4R4TA 1OXXK 3HOVG 4DV2Q 3H20A 1W2BA 3CMEA 4DR3Q 3H3VH 1YJ9A 2E2IH 5IYBG 2OTLA 2ES2A 4A3IG 5IYDG 1SROA 4UCTA 3RLNA 5H1SE 2Q2TA 5HY6A 1S03G 3AYHB 1X54A 3K81C 3NBHB 1KD1C 3CVZA 3F2BA 3GTGH 2JA5G 1C0AA 2NZHA 3I4OA 4DR1Q 4IO9A 3M7NA 5K36G 4LNQA 4YCWA 3D0FA 4DV7L 2NZOA 4IJLA 2IX0A 3GJXB 3PUXA 1Z9FA 2WAQG 4DR6H 4Y7NH 3OTOQ 2UUAL 4JI2L 2E5LQ 4LW1A 1L1OA 4O2DA 1T9HA 3A5UA 3EN2A 2Z6KC 1A63A 3F8NA 3RLOA 1AE2A 1E24A 4BA1I 1N34L 3N43B 1HNWH 2WYOA 4DV0Q 1V43A 2QEXA 4K0KL 4APMA 1X3GA 2UXBH 1YJNA 4ETSA 3CCVA 3ULPA 3BZKA 4LFCL 4JI5L 5M3MG 3RIZA 2ID0A 4PG3A 2ZM6Q 3CCJA 4LF5L 4A3DH 4K0KH 4UFZA 4JV5H 2MFIA 1AN7A 1OXVA 4JC0A 3HOZG 4DR7Q 4JI5H 3VDYA 4FM9A 2WE6A 3M4IA 2IY5B 2B3GA 4DV4Q 1HR0Q 4KHPL 3S15H 1QZGA 1SYXB 3I4NG 3F8TA 1Y1VG 4EX5A 1IBLQ 1EYGA 1XDNA 2VQEH 5BR8L 1XMOQ 3I56A 1IL2A 4UP9A 4L5SA 3UDFA 1CKNB 3A5ZB 1J5EL 4DR4L 1S40A 3J7ZC 4R4OA 4NPSA 4JBWA 1N36L 1HNZQ 1L1OC 1M90C 4AQYQ 1XNRL 2YTVA 4EFEA 5LMNH 4APVA 4LFAQ 3BU2A 4LF8H 3NBYB 3TRZA 3MEFA 4GNXA 5LMUL 4OX9H 1J5EH 2NVXH 3CCEA 1JJGA 5EOYA 3L2PA 1XNRH 4JI3Q 4R7RA 3GTLH 2I5HA 1PYSB 1M1KC 3PO2H 1FJGH 3FKIG 3CPWA 2JQOA 1CKOA 1Q8KA 1N32Q 3FP9A 3CCMA 4DR5Q 3K80C 2E2JH 2ATWA 4UP7A 1IBKH 4HIMA 5IP7G 4B3RH 1RIPA 3E9IA 3CCQA 4PDBA 1QVFA 4AYBG 3TY9A 3KALA 3CXCA 1VQFA 1W3SA 2A1AA 1E3PA 2Y0SE 3LMLA 4GLXA 1Q1EA 3PF4A 1XMQL 1YJWA 4LF7Q 1Z2PX 3CCUA 4A3MG 3HOYH 2RCNA 4H02A 4YCUA 5GAGC 4GLAC 4X62L 3NEMA 4MZ9A 5FPOA 3CD6A 4OO1G 3CCLA 3NENA 4YHHQ 4NB3A 2MNAA 3T1HQ 2R93G 1IBMQ 3HOXH 1U0LA 4LUZA 4A3FG 1CKMA 2O03A 2DGYA 4GKKQ 4DUYL 4GNXC 4BXXH 1I3QH 3PIPA 2HIVA 1IXRA 3UE1A 4DV1Q 4X64H 5GAEC 1YVCA 1M0TA 4DV5H 2YCHA 4R4CA 4DV2L 3CMAA 1AH9A 4DR3L 2OQKA 3L7ZC 4I7HA 2IX1A 1Q46A 5FJ8H 1LTLA 3TS2A 4DUYH 5DLQE 4A3LG 4J0MA 3J80c 1K0RA 3GDEA 2HT1A 3STBC 2VQFQ 4CC5A 1WH2A 4DR1L 4YWKA 3DF7A 4A93H 1E1TA 2BA1A 1PH1A 1EQRA 2WB1G 1KC8C 1KXLA 2ZJTA 4RZQA 2RHSB 4LF9Q 1EWIA 1UE7A 1HJPA 5JJKA 4L5QA 2PI2E 2WDTA 2E5LL 4NXNH 5C0XG 1VQ5A 1WJJA 1GO3E 2RF4A 2AWOA 3CC2A 4GKJH 3TEHB 1EFWA 1HZBA 4R4QA 1Q81C 4OXPA 1K73C 4FDBA 5C4XH 4NXMQ 1PH8A 4A3BH 4DV0L 5IY0A 3KOJA 1I94Q 1XPUA 4ME3A 1QUQA 1VQIA 4X65Q 1L0WA 1XTDA 4A3DG 2R92H 4JI6H 2ZM6L 3STBD 5FD6A 1YHQA 3T1YQ 1Q7YC 4MTEA 4DV3Q 2RGRA 4LSAA 4QQBX 3S24A 2I5MX 2UXCQ 1PH4A 1BVSA 2WFWA 4QL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 G;  1C0A A;  2NZH A;  3I4O A;  3JAM i;  4A75 A;  1L2F A;  4DK3 C;  4DR1 Q;  5C4J H;  5FLM H;  4JBJ A;  5LMN L;  4X6A H;  2KCT A;  2WAQ E;  4DR7 L;  1X55 A;  4C3J H;  1HNW Q;  1S68 A;  2HHH Q;  2K5V A;  1PH9 A;  1YHA A;  4LF8 L;  1EIF A;  2JK8 A;  1CUK A;  4IO9 A;  1Y1W H;  1TWG H;  3M7N A;  2MO1 A;  1VQ7 A;  4LNQ A;  1WFQ A;  3OYY A;  3OW2 A;  3HOW H;  4BY7 H;  4IFD I;  1KL9 A;  1VQH A;  4JI4 Q;  4DV4 L;  4HIK A;  4YCW A;  4OX9 L;  3D0F A;  4DV3 L;  2UXB Q;  4A4I A;  4DV7 L;  5C3E G;  1HR0 L;  4R4I A;  2VUM G;  2NZO A;  4IJL A;  4P73 A;  1HNX Q;  4JI8 Q;  2UUC Q;  2NVQ H;  2F52 A;  4IPC A;  1S72 A;  2HQL A;  2IX0 A;  1MKH A;  1PH5 A;  3I4M G;  5IE8 A;  3GJX B;  4P75 A;  3PUX A;  5IP9 G;  3U58 A;  2VZA A;  1B04 A;  1Z9F A;  2WAQ G;  1N33 Q;  4L5T A;  3M3Y H;  4Y7N H;  3F2D A;  1G29 1;  1SFO H;  3OTO Q;  3SGI A;  1U5K A;  4TVA B;  1SMX A;  1IBL L;  2UUA L;  2UXD Q;  2VUG A;  4IFD G;  4JI2 L;  2E5L Q;  1LUZ A;  5C44 G;  1VQO A;  4B3T Q;  4LW1 A;  1FJG L;  1L1O B;  3BZC A;  4JV5 Q;  1L1O A;  3WWV A;  1PHJ A;  3M4O H;  1X3E A;  4O2D A;  1YIJ A;  1WOC A;  4UCV A;  2N8N A;  1T9H A;  4UPA A;  3A5U A;  1HZC A;  1X9N A;  3S2D H;  3EN2 A;  1A62 A;  2K50 A;  3KF6 B;  2Z6K C;  3S1M H;  1A63 A;  5K36 G;  2PMZ E;  1OTC A;  3KF6 A;  1HNZ L;  2JJQ A;  2K52 A;  5C0X J;  4BA2 I;  1VQC A;  1OXS C;  3W1G A;  3PUZ A;  1I6H H;  1VQE A;  4YY3 Q;  4JI1 Q;  3RLO A;  1IBK L;  4AQY L;  3UDG A;  1UEB A;  1AE2 A;  1E24 A;  2KEN A;  4GS3 A;  4BA1 I;  4A3E H;  3RN5 A;  1N34 L;  2MQH A;  3OTO L;  4B3R L;  4C2M H;  4LFA L;  4KI0 A;  4DV0 Q;  4A3C H;  1V43 A;  2HVR A;  3UDX A;  1FVI A;  2QEX A;  4K0K L;  1XK5 A;  2XGT A;  3AQQ A;  2KHI A;  1EQQ A;  3CC7 A;  1X3G A;  4DUZ Q;  1JJC B;  4JI0 Q;  3UQ8 A;  5JJL A;  4O0A A;  4A3K G;  4A3G G;  1XNQ L;  1P16 A;  1YJN A;  3JC6 6;  1JT8 A;  2VQE Q;  2JA8 G;  3IRB A;  3CCV A;  3PO2 G;  3DLL A;  3ULP A;  3BZK A;  3L0O A;  4LFC L;  4JI5 L;  5M3M G;  1Z47 A;  2HIX A;  3GTJ H;  3JSN A;  2ID0 A;  4PG3 A;  4DPG A;  2ZM6 Q;  4R1J A;  3ER0 A;  3NC0 B;  1AE3 A;  2YYZ A;  4JI3 L;  4B3S Q;  4A3J H;  4DAY B;  2YTY A;  3CPF A;  4X66 Q;  3CCJ A;  4GOP B;  3HOV H;  1MJC A;  1TWC H;  5D1P A;  2B29 A;  3PUY A;  3GO5 A;  4GOP A;  4LF5 L;  4A3D H;  1A0I A;  3S1N H;  3JAM c;  1PH3 A;  3S16 H;  2GN5 A;  5IYB H;  4UFZ A;  3K7U C;  4QJF A;  4C3H H;  4LF6 Q;  2MFI A;  1LYL A;  1OXV A;  3S14 H;  4IPD A;  4JC0 A;  4A3I H;  1YI2 A;  1N32 L;  1WI5 A;  5IYD H;  4DR5 L;  1VQ6 A;  3HOZ G;  2MO0 A;  5LMN Q;  1YIT A;  4DR7 Q;  4DV6 L;  5IYC G;  3G4S A;  2OCE A;  1HH2 P;  3KJP A;  4WJ3 M;  3VDY A;  2K75 A;  1PH2 A;  3F1Z A;  4LF8 Q;  4UCO A;  4LH7 A;  1Q86 C;  3GTQ H;  1VQB A;  2JA5 H;  1PH7 A;  5LMN W;  2IHE A;  2IY5 B;  1VQD A;  2B3G A;  4JBK A;  2GVB A;  5M5Y H;  4DV4 Q;  4OX9 Q;  4QY7 A;  4DV7 Q;  3KYH C;  4J15 A;  1CSP A;  1HR0 Q;  4KHP L;  1NY4 A;  1PV4 A;  3LGJ A;  3M4P A;  1JE5 A;  3S15 H;  1H95 A;  1QZG A;  1FL0 A;  2AWN A;  3I4N G;  4BY1 G;  1C7Y A;  3F8T A;  5ELO A;  5JEA J;  1XNR Q;  5IWA L;  3K7A H;  1HR0 W;  1EIY B;  4LF6 L;  1VS0 A;  1Y1V G;  3KDF B;  4EX5 A;  4X64 L;  4YWL A;  3KDF A;  5C3E H;  1SRU A;  3CF5 A;  2VUM H;  1IBL Q;  2UUA Q;  4DV5 L;  1EYG A;  3HOY G;  1XDN A;  4UCR A;  5BR8 L;  1I50 H;  4JI2 Q;  1XMO Q;  2BH2 A;  3I56 A;  1VQ8 A;  1N9W A;  3I4M H;  2E2H H;  5IP9 H;  1FJG Q;  1IL2 A;  4UP9 A;  4L5S A;  2F3I A;  3UDF A;  1K8A C;  3W1B A;  1ASZ A;  5JEA G;  4LF7 L;  1CKN B;  3PV0 A;  2KCM A;  2KBN A;  2UU9 L;  3A5Z B;  1CKN A;  1J5E L;  4DR4 L;  1NBW A;  3HOU G;  3I55 A;  2DUD A;  3J7Z C;  1G51 A;  4IJH A;  5C44 H;  1S40 A;  4IFD J;  2FXQ A;  4R4O A;  4NPS A;  4JBW A;  2QA4 A;  1N36 L;  1HNZ Q;  1L1O C;  3MXN B;  1KQS A;  3HOX G;  4UY8 C;  2CKZ B;  3PUW A;  1M90 C;  2A8V A;  3J7A 5;  1K83 H;  1QVG A;  1IBK Q;  2HVS A;  4AQY Q;  3E0E A;  1XNR L;  2YTV A;  4UCS A;  4EFE A;  4YHH L;  2Q2H A;  1N34 Q;  3GTM H;  3CC4 A;  4B3R Q;  3Q8D A;  4APV A;  1JJ2 A;  5AJ3 L;  4RG1 A;  2QGQ A;  4LFA Q;  3TRE A;  3BU2 A;  3PUV A;  2B63 G;  4GN5 A;  3NBY B;  2K5H A;  1XMO L;  3TRZ A;  4K0K Q;  3T1H L;  1CSQ A;  4GNX B;  3MEF A;  4A76 A;  1IBM L;  4BXX G;  2ZJQ A;  1VQP A;  4GNX A;  4IOC A;  3AFP A;  5LMU L;  2NVT H;  2AHO B;  4OWT B;  2I5L X;  2E8G A;  5JJI A;  1HZA A;  1K3R A;  2ZJP A;  3S17 H;  1VQL A;  2IHF A;  2NVX H;  1XNQ Q;  4PZ7 A;  2WB1 E;  3E9H A;  1VQM A;  4E6N A;  5DIS C;  5M5W H;  3CCE A;  4ALP A;  2UUB Q;  3I7F A;  4LFC Q;  2D0P A;  2L15 A;  1UE6 A;  2R6G A;  3A0J A;  4JI5 Q;  4GKK L;  1JJG A;  3L2P A;  2PNH A;  3M4Q A;  3UE0 A;  2PI2 A;  4JI3 Q;  2PQA B;  4JBM A;  1KIX A;  2PQA A;  4DV1 L;  1BBU A;  4DRF A;  2LSS A;  1SR3 A;  4A3K H;  4A3G H;  4DKA C;  3M85 A;  3GTL H;  2I5H A;  3BAB A;  1PYS B;  1M1K C;  1WCM G;  4LF5 Q;  5FJ8 G;  3PO2 H;  5IT9 c;  1YBY A;  3F2C A;  2VL6 A;  3NEL A;  5M3M H;  3FKI G;  4NXN L;  4LFB L;  4QIW E;  3BAA A;  4AYB E;  3CPW A;  2JQO A;  3U4Z A;  1VQK A;  1CKO A;  1OXU A;  1Q8K A;  1RL2 A;  3FP9 A;  4B3M L;  1N32 Q;  3CCM A;  1HZ9 A;  4DR5 Q;  1VQ9 A;  4GOP C;  2YU9 H;  3S1Q H;  4POF A;  1LM0 A;  4XIG S;  4DV6 Q;  1B8A A;  3CW2 C;  3RN2 A;  3K80 C;  4JYA L;  4HJ7 A;  2R7F A;  2E2J H;  3H0G G;  2ALY B;  2LXK A;  4GKJ L;  4A93 G;  1Q82 C;  2ATW A;  3H15 A;  3ZJY C;  4KLK A;  2UUB L;  4UP7 A;  2V1C C;  2OQ0 A;  2ASB A;  4HIM A;  4YCV A;  2CWP A;  5IP7 G;  4BBR G;  3RTX A;  3HOZ H;  1RIP A;  3E9I A;  3RR5 A;  3J80 i;  4HIO A;  3CCQ A;  5IYC H;  4LUO A;  4L5R C;  1QVF A;  4AYB G;  1K8G A;  4KHP Q;  4IPH A;  1ASY A;  4BBS G;  3TY9 A;  4OWW B;  3CXC A;  3G6E A;  1VQF A;  1W3S A;  1BKB A;  1B7Y B;  3CP0 A;  2JA6 G;  3W5O A;  5IWA Q;  2A1A A;  1E3P A;  5GQO A;  4AIM A;  4DAM A;  5M3F G;  2CCZ A;  4UCU A;  5D1O A;  1NTG A;  1XJV A;  2Y0S E;  3KLW A;  3S2H H;  4X64 Q;  1TAE A;  4P74 A;  1TWA H;  1D8L A;  4DV5 Q;  2EXD A;  2R7D A;  5BR8 Q;  1QZH A;  1VQN A;  3CQZ H;  3TY8 A;  2JE6 I;  4OO1 I;  4GLX A;  1Q1E A;  3PF4 A;  1YNX A;  1XMQ L;  3I4N H;  1V9P A;  4BY1 H;  4JI6 L;  4DK6 C;  3PSI A;  2Q2U A;  4HID A;  2ZTD A;  2D62 A;  2HVQ A;  2CWA A;  3GB8 B;  1YJW A;  3RLF A;  1Y1V H;  1MIU A;  3CAM A;  4LF7 Q;  4LF9 L;  3J81 j;  3TQY A;  3CCU A;  2JA9 A;  4QGU A;  2RCN A;  1KHI A;  4TQU S;  4A3M G;  2UU9 Q;  1J5E Q;  3HOY H;  4DR4 Q;  4H02 A;  1X65 A;  2VW9 A;  3S1R H;  4YCU A;  1PH6 A;  3VNN A;  4CC6 A;  1IZ6 A;  5GAG C;  4GLA C;  1GKH A;  1N36 Q;  3B6Y A;  4X62 L;  3NEM A;  4MZ9 A;  2C35 B;  1GVP A;  5FPO A;  3CD6 A;  2BA0 A;  3CCL A;  4OO1 G;  3NEN A;  4JI7 L;  4PZ6 A;  3JSL A;  4YHH Q;  4NB3 A;  1KRT A;  2ZJR A;  3H3V I;  3TS0 A;  3CCS A;  4HJ8 A;  1I5F A;  5AJ3 Q;  3HOU H;  5C4X G;  1FGU A;  1NMF A;  1KAW A;  4C3I H;  1YZ6 A;  2MNA A;  2JA7 H;  4A3B G;  2JEA I;  3M9B A;  3PGZ A;  3T1H Q;  1IBM Q;  1X56 A;  2R93 G;  2N49 A;  3HOX H;  1TA8 A;  1U0L A;  5LMU Q;  1PYB A;  4LUZ A;  4LWC A;  4EEQ A;  2N3S A;  2ZTE A;  3D31 A;  2EIF A;  4A3F G;  2YTX A;  1X6O A;  2WP8 J;  2KHJ A;  1CKM A;  3CCR A;  2OWO A;  3PO3 G;  1JMC A;  4YWM A;  3AFQ A;  4NXM L;  3EIV A;  3PIO A;  2B63 H;  1QVC A;  5ELN A;  3U50 C;  3A74 A;  2DGY A;  4GKK Q;  4DUY L;  2AKW B;  4GNX C;  1E1O A;  2R7Z G;  4BXX H;  4RMF A;  2R92 G;  1I3Q H;  3PIP A;  1R9T H;  2JA7 G;  1E7Z A;  1XPO A;  2HIV A;  1IXR A;  1I94 L;  3UE1 A;  2BH8 A;  4DV1 Q;  4KHZ A;  3ERS X;  4PMW A;  5GAE C;  5E7N A;  1NMG A;  3HKZ E;  3G71 A;  2F4V L;  3GTP H;  4DR6 L;  1YVC A;  4LH6 A;  3J81 i;  4LF4 L;  4A3L H;  4R4C A;  4X65 L;  4P72 A;  3ULJ A;  2A19 A;  3ULL A;  3CMA A;  2JEB I;  1BBW A;  1KRS A;  4DV2 L;  1AH9 A;  5GAH C;  1A8V A;  4DR3 L;  2OQK A;  4NXN Q;  3L7Z C;  3BJU A;  4LFB Q;  2EQS A;  1Y14 B;  4OON A;  1YHB A;  4B3M Q;  3G48 A;  4Y52 H;  5M5X H;  5GRO A;  4JOI A;  3T1Y L;  2NVY H;  2IX1 A;  4DR2 L;  1Q46 A;  1WCM H;  5FLM G;  5FJ8 H;  4JYA Q;  1LTL A;  3TS2 A;  1J6Q A;  4GKJ Q;  5DLQ E;  4A3L G;  3FKI H;  3TY5 A;  3J80 c;  2H5X A;  2UXC L;  3QWU A;  1V1Q A;  1UWV A;  3HKZ G;  1N8R C;  1MJE A;  1K0R A;  3GDE A;  2HT1 A;  1Y1W G;  1VQG A;  3STB C;  1UE1 A;  2VQF Q;  3HOW G;  4BY7 G;  2ZTC A;  1YEZ A;  1VCI A;  4JCV E;  4CC5 A;  4DR1 L;  1Q1B A;  3EBE A;  4IPG A;  4YWK A;  4JG2 A;  3H0G H;  1HNW L;  4A93 H;  4GN3 B;  2HHH L;  1D7Q A;  1E1T A;  1SE8 A;  2IT1 A;  2BA1 A;  1PH1 A;  1IYJ B;  4PZ8 A;  4MTN A;  3HKS A;  5IP7 H;  5FLX c;  2XTI A;  4BBR H;  3PCO B;  1SN8 A;  4JI4 L;  1EQR A;  2WB1 G;  3RNU A;  1KC8 C;  2Q2I A;  1VQA A;  5C0X I;  2UXB L;  1TWF H;  1TXY A;  3FHW A;  4BBS H;  1Q12 A;  1HNX L;  4JI8 L;  2UUC L;  3PN1 A;  3GTO H;  5J3B A;  1XMQ Q;  1UE5 A;  3AEV A;  3NBZ B;  1DGS A;  4EQ5 A;  3K0X A;  3I2Z A;  4LUV A;  4JI6 Q;  4AH6 A;  1GM5 A;  2JA6 H;  4P71 A;  5M3F H;  1KXL A;  2RHQ B;  1N33 L;  2RHS B;  1G6P A;  4LF9 Q;  1EWI A;  3BA9 A;  2VQF L;  3PF5 A;  4UP8 A;  4HJ9 A;  1UE7 A;  2N78 A;  1HJP A;  2I0Q A;  2NN6 I;  1VQJ A;  3ICE A;  5JJK A;  2UXD L;  4L5Q A;  2PI2 E;  3UDI A;  3HFZ B;  2E5L L;  3GD7 A;  1GD7 A;  5C0X G;  4B3T L;  4X62 Q;  2Z6K A;  3K8A A;  4DNI A;  4JV5 L;  4XTC S;  1VQ5 A;  5D1O B;  4JI7 Q;  1B70 B;  1WJJ A;  1GO3 E;  2RF4 A;  4QL5 A;  1JB7 A;  2JA8 H;  4A3M H;  2AWO A;  3RZO H;  1TWH H;  5EAY A;  5GAD C;  2LXJ A;  4MNO A;  4A3E G;  1XPR A;  1PVO A;  3CC2 A;  3TEH B;  2AMC B;  1EFW A;  2GVA A;  4GLV B;  1HZB A;  3KFU A;  4A3C G;  1SLJ A;  1E22 A;  4GN4 B;  2NN6 G;  4R4Q A;  4IOA A;  1Q81 C;  4OXP A;  4YY3 L;  4JI1 L;  1K73 C;  4POG A;  4HJ5 A;  4FDB A;  4OWX B;  5FPR A;  2K14 A;  1K9M C;  5C4X H;  2K5N A;  1X3F A;  4NXM Q;  4WJ4 A;  3KF8 B;  1PH8 A;  2D0O A;  4A3B H;  4DV0 L;  1S3O A;  2VS1 A;  5IY0 A;  2R93 H;  1EUJ A;  4DUY Q;  4EFB A;  1VQ4 A;  2VNU D;  3J81 c;  2K4K A;  1C9O A;  3DM3 A;  3KOJ A;  1PA6 A;  2OTJ A;  3U4V A;  1QUQ B;  2Y0S G;  3RZD H;  1NJI C;  1I94 Q;  4ME3 A;  1XPU A;  4DUZ L;  1QUQ A;  4JI0 L;  3GTK H;  3BA8 A;  4A3F H;  4A3J G;  4R4T A;  4DR6 Q;  1VQI A;  2F4V Q;  3PO3 H;  1OXX K;  2Z0S A;  2YV5 A;  4LF4 Q;  3HOV G;  4X65 Q;  1L0W A;  1XTD A;  2VQE L;  4DV2 Q;  4A3D G;  1P8L A;  1W2B A;  3CME A;  4DR3 Q;  2R7Z H;  3H3V H;  1YJ9 A;  2R92 H;  2E2I H;  2VY3 A;  5IYB G;  3GTG H;  2ZM6 L;  4HJA A;  2CFM A;  3STB D;  2OTL A;  1YHQ A;  5HGQ A;  3T1Y Q;  1Q7Y C;  4B3S L;  4X66 L;  2CQO A;  1NE3 A;  3KJO A;  5IYD G;  4DV3 Q;  1SRO A;  4A3I G;  2ES2 A;  4UCT A;  1PFS A;  4DR2 Q;  3RLN A;  4QQB X;  1OXT A;  5H1S E;  3S24 A;  2Q2T A;  5HY6 A;  1EOV A;  2I5M X;  3AYH B;  1X54 A;  3K81 C;  3NBH B;  1KD1 C;  1PH4 A;  3F2B A;  1BVS A;  2UXC Q;  1WYD A;  2WFW A;  1O7I A;  4JOI C; 
#chains in the Genus database with same CATH topology
 4Y8V B;  4JI7 H;  1XYI A;  3TEK A;  2OXP A;  2TMP A;  3JAM i;  1WCM A;  2X6G A;  3MHB A;  3ITP A;  4JBJ A;  4X6A H;  2KCT A;  3FKI B;  4O3S A;  4DR7 L;  2HD3 A;  1X55 A;  4C3J H;  3I12 A;  4WD3 A;  2JEJ A;  1S68 A;  3N52 A;  5KG0 A;  1YHA A;  2MGS A;  1CUK A;  1TWG H;  3HOW H;  2RDI A;  3OYY A;  4J9K A;  5EPL A;  4RNM A;  1KL9 A;  4JI4 Q;  2PMZ B;  4DV4 L;  4F88 A;  4KY6 A;  3JZ6 A;  2O5J C;  3T9B A;  4A4I A;  3GLK A;  1HR0 L;  4R4I A;  4P73 A;  2UUC Q;  3JAM L;  1PH5 A;  1MKH A;  4YIJ A;  4P75 A;  4JV1 A;  2HUG A;  1FNW A;  1B04 A;  2O5I C;  3TZU A;  1N33 Q;  1SEB D;  4L5T A;  1A0G A;  4RUA A;  3F2D A;  4YQW A;  3MWD A;  4UUG A;  4LF4 H;  1NR4 A;  4TVA B;  3GTO B;  1IBL L;  1KJI A;  2CW8 A;  1GXD C;  4E6I A;  2FLP A;  1VQO A;  2JA6 A;  4WOR A;  1QG7 A;  1KLU D;  4K6N A;  3WWV A;  1X3E A;  2VB2 X;  3SDZ A;  4O7L A;  1YIJ A;  2F0F A;  4UCV A;  3GV3 A;  3SEB A;  4UPA A;  4MV8 A;  1M4V A;  4ECS A;  4Q8F A;  5D65 A;  1D1I A;  4HSV A;  1F9Q A;  4R8N A;  1EKV A;  3S1M H;  4IN3 A;  1HNZ L;  5C0X J;  5KFB A;  1VQC A;  1OXS C;  1TWH B;  3R5F A;  4JI1 Q;  4AQY L;  1UEB A;  4O4L F;  1DYQ A;  1GUG A;  2W6Q A;  5LHY 1;  3RN5 A;  5E3F A;  4LFA L;  3C0F B;  2HHH H;  4KI0 A;  3KBG A;  2FHT A;  2HVR A;  2ABJ A;  4XYO A;  4QW8 A;  4X3T A;  3K5N A;  1GHJ A;  1PZI D;  2KHI A;  3I73 A;  3CC7 A;  4Q5V A;  1VAJ A;  5E25 A;  4DUZ Q;  3UQ8 A;  5JJL A;  1O7Z A;  4CBV A;  1B6S A;  1IYE A;  4GZY C;  1P16 A;  2R93 B;  1O75 A;  1WTR A;  3DXJ C;  5C5L A;  3PO2 G;  1O78 A;  2DIK A;  4I55 F;  5KT7 A;  1BXR A;  1VDZ A;  1Z47 A;  3GTJ H;  1O7Y A;  4DPG A;  4A3F B;  3NC0 B;  4JI3 L;  3A7L A;  1KAA A;  4B3S Q;  4A3J H;  2YTY A;  4X66 Q;  5JH7 F;  1MJC A;  3HOU B;  5D1P A;  3PUY A;  3BDO A;  1KDB A;  3OHA A;  2E2I B;  3S1N H;  4ZK9 B;  1PH3 A;  2JA7 A;  1K8O A;  4KD3 A;  4B3T H;  1A3G A;  1HFN A;  4QJF A;  1N32 L;  1YI2 A;  3L3O C;  4O2A F;  1K3B C;  4DR5 L;  3AX6 A;  4MTD A;  5IT9 W;  1EY9 A;  3D3R A;  2EE1 A;  2EY5 A;  2EXZ A;  2MO0 A;  4IUP A;  1YIT A;  2ASJ A;  1STB A;  4FBU A;  2XC9 A;  2K75 A;  2F3V A;  3FVQ A;  1Q86 C;  2VA3 A;  4RB3 C;  1PH7 A;  5HNE A;  2VXW A;  3MR6 A;  3M7G A;  2IHE A;  4A2B A;  4YY3 H;  1VQD A;  4DK0 A;  5CBE E;  1EKF A;  3KXY T;  4FVM A;  1EUD B;  1QJO A;  1YNJ C;  5HV6 A;  3KYH C;  4J15 A;  1CSP A;  2FFK B;  3RBD A;  3CU7 A;  2COG A;  1NY4 A;  1S10 A;  2AQ4 A;  3L9A X;  4DF7 A;  1H95 A;  1Y1W A;  1CT1 D;  1FL0 A;  2AWN A;  1LT5 D;  5KEE A;  1C7Y A;  2HCI A;  5JEA J;  1ENC A;  3HEJ A;  3K7A H;  1HR0 W;  1EIY B;  4LF6 L;  1GJX A;  2UVW A;  3WOE A;  1KAB A;  3RAX A;  1D2B A;  3JAM W;  3CF5 A;  3HOY G;  4LSX A;  4UCR A;  1I50 H;  2EJ3 A;  3HXL A;  5KFK A;  1S5D D;  3I4M H;  2E2H H;  2W7O A;  3V96 A;  3HO8 A;  2WB1 B;  4Y7N B;  2J6S A;  3RAQ A;  3LQS A;  2K01 A;  1K8A C;  3V2T A;  4LF7 L;  1ENA A;  3VA5 A;  2KBN A;  3ONA B;  4J1M A;  4K2K A;  1CKN A;  2PVP A;  5KFJ A;  3KK7 A;  3QFF A;  2F4I A;  3I55 A;  2DUD A;  1BDO A;  5C5J A;  5C44 H;  1JOK A;  2FXQ A;  1D5X C;  1GSH A;  5ELC A;  1EYD A;  2FKL A;  4LF6 H;  3MXN B;  1KQS A;  3HOX G;  2A8V A;  2CKZ B;  2BQR A;  4OEM B;  1U9R A;  1O7L A;  2MPM A;  2ZDG A;  1EQV A;  3QZ7 A;  3Q8Q B;  2HVS A;  3E0E A;  4RNO A;  3NUC A;  2Q2H A;  3TP7 A;  4YHH L;  4ED2 A;  4RAY A;  3E5N A;  1JJ2 A;  3TRE A;  2FMM A;  2GLT A;  4YR0 A;  5KND A;  4GN5 A;  3TBI B;  5J2U F;  3T1H L;  1NR2 A;  5IIF A;  1IBM L;  5EGT A;  4BXX G;  5KFX A;  4RGT A;  1B44 D;  1VQP A;  4LF7 H;  5KYI A;  4FYD A;  2NVT H;  2ASD A;  2HQE A;  1ILP A;  3W3A A;  4ABN A;  3H4B A;  1L0X B;  1QNU A;  2ZJP A;  3HGB A;  3S17 H;  3K5O A;  1VQL A;  5BMV F;  2IHF A;  4C2M A;  1CQF A;  1XNQ Q;  4DV7 H;  4PZ7 A;  5FK9 C;  4UHV A;  1G91 A;  2D0P A;  2R6G A;  5IGD A;  4GKK L;  2KEC A;  1KNE A;  2PQA B;  4YHH H;  4M1U B;  2WKC A;  4DV1 L;  1HUN A;  3MEH A;  4DRF A;  3OSP A;  2LSS A;  1SNP A;  2B2Y A;  5I6Y A;  3M85 A;  4EVO A;  4LMY A;  2UUA H;  1JOO A;  5GON F;  1PLF A;  1S5F D;  4JI2 H;  5FJ8 G;  3RGZ A;  5DGA A;  4RCN A;  1IBM H;  1EFI D;  1YBY A;  1H9S A;  3H09 A;  4OGQ C;  1KDA A;  3U4Z A;  3ZYY X;  1VQK A;  4OHJ A;  1VQ9 A;  2YU9 H;  3PQI A;  4A3D B;  5KFA A;  2W9B B;  1YNJ D;  4PBC A;  2R8K A;  4DV6 Q;  1B8A A;  3OHX C;  3RN2 A;  2OH2 A;  2KA7 A;  2ALY B;  2F0O A;  4A93 G;  5DG8 A;  4NZO A;  2YZG A;  3ZJY C;  4KLK A;  5ELE A;  2UUB L;  3TIN A;  5KFV A;  1RK6 A;  2MP1 A;  2KED A;  5IGG A;  4YCV A;  1GYF A;  4XT3 B;  5EPK A;  3RTX A;  1N34 H;  2WIN B;  4HIO A;  3UI2 A;  4L5R C;  4HCE A;  1CHP D;  3A54 A;  3NTI A;  4IPH A;  2NU8 B;  1RTO A;  2ZXP A;  1UC8 A;  4OWW B;  5KG2 A;  4CHT B;  2JA5 A;  1Z2O X;  1E2Z A;  2EJ2 A;  3V6J A;  1BKB A;  1B7Y B;  2FJZ A;  1SYD A;  1STN A;  2K04 A;  2LY7 A;  5IWA Q;  5D1O A;  3RUP A;  2CCZ A;  4IAJ A;  1XJV A;  3S2H H;  3QWN A;  3KLW A;  3X3M A;  2EY2 A;  1U4M A;  1TT2 A;  5I5X A;  1AW7 A;  1D8L A;  1TWA H;  1QZH A;  3S15 B;  3TY8 A;  2UUB H;  2JE6 I;  4LFC H;  5KFR A;  1CQI B;  4J9M A;  4BY1 H;  4C1N I;  1U4R A;  2H1E A;  2Q2U A;  2HVQ A;  3GB8 B;  1KLG D;  4MA0 A;  1MIU A;  4PNY A;  4LF9 L;  3IFD A;  5LL6 S;  2UU9 Q;  3C2P A;  1KHI A;  4LF5 H;  2A5H A;  1SYF A;  3OSO A;  5JVG 3;  4EEY A;  3S1R H;  1IOW A;  3TDQ A;  1PH6 A;  3VNN A;  4CC6 A;  5KS8 A;  4ZUI A;  1PRT C;  5FNV F;  2WAQ A;  5EWE A;  3N41 B;  2C35 B;  3U55 A;  5JEA H;  5JAV A;  3OUZ A;  4PZ6 A;  3JSL A;  4ZYS A;  5BWT A;  1LTB D;  3S9W A;  2ZJR A;  3A55 A;  2ZGI A;  5F9L A;  3CCS A;  4KD4 A;  4C5B A;  1B1Z A;  4K6D A;  1FGU A;  5C4X G;  1NMF A;  1KAW A;  1LTT D;  3CEB A;  2JA7 H;  2BDO A;  4A3B G;  2N49 A;  1HHV A;  1K83 A;  2B2V A;  1TII D;  2QYZ A;  5KG6 A;  1PK8 A;  4KMU C;  3M3Y B;  3CRK C;  2V4Q A;  4UDU C;  3KLS A;  1SFO B;  1ZQ7 A;  3GTM A;  2AGP A;  4UAI A;  4O4I F;  5H80 A;  1ZHQ A;  2WP8 J;  2KHJ A;  4KHP H;  2VA2 A;  3AFQ A;  4NXM L;  2CHB D;  5EBD A;  2AKW B;  3IFT A;  5I9P A;  4RMF A;  2R92 G;  3GID A;  1R9T H;  4YAK B;  3UZO A;  1E7Z A;  1SYC A;  1I94 L;  3BDL A;  4KHZ A;  3ERS X;  3BG3 A;  5E7N A;  1NMG A;  3HKZ E;  3G71 A;  3GTP H;  4YB8 B;  3J81 i;  1S5E D;  5BR8 H;  4X65 L;  2DJG C;  3PR5 B;  4P72 A;  4DK1 A;  2JEB I;  1KRS A;  3CKI B;  2V59 A;  4CKC A;  1A8V A;  4DXG A;  4LFB Q;  1ROD A;  2EQS A;  2HHF A;  1KJ8 A;  3GTL B;  4B3M Q;  2YRW A;  4Y52 H;  5M5X H;  3T1Y L;  2ODT X;  4XQN A;  1KDC A;  3Q22 A;  4V19 0;  4IRK A;  3PO2 B;  4NXM H;  4DR4 H;  4JYA Q;  3VPB A;  3TQT A;  5IOC A;  4C3J G;  2A74 C;  2L55 A;  4FS2 A;  4O4H F;  1Z2N X;  5LL6 b;  1N36 H;  1SE2 A;  2UXC L;  1V1Q A;  1DOM A;  1N8R C;  1MJE A;  3J81 L;  1VQG A;  4FFO A;  3HOW G;  2ZTC A;  2L5T A;  2X69 A;  2E2J B;  1Q1B A;  3GIL A;  2YS6 A;  3EBE A;  4DXF A;  2Z1C A;  4JG2 A;  2PO4 A;  1DJR D;  3H0G H;  4N8F A;  4CHI A;  2VOB A;  3RB4 A;  1H9S B;  1SE8 A;  1CZW A;  2IT1 A;  1WTV A;  4F4Y A;  5LMU H;  4TQR A;  4PZ8 A;  2BQU A;  5FLX c;  2XTI A;  4BBR H;  3PCO B;  4YJ3 F;  1SN8 A;  4JI4 L;  3RUZ A;  4IR1 A;  1VQA A;  4NDX A;  1TWF H;  1GHK A;  5FKA C;  3DHQ A;  5EJW A;  4XYQ A;  2UUC L;  3EJI A;  4ZRZ A;  4C56 C;  3SXH A;  2W6N A;  3NBZ B;  1PRT D;  5I5S A;  3HP3 A;  1QNK A;  4X3K A;  4AH6 A;  1GM5 A;  2WAC A;  5M3F H;  2F0P A;  4FE2 A;  2W6M A;  3MR5 A;  3MFY A;  4FXK C;  1N33 L;  5JVL A;  1Y8N B;  1J8I A;  2FLN A;  4Q8E A;  4O3Q A;  3PIO 3;  1I7L A;  1KNA A;  3ICE A;  2SNS A;  3SNO A;  1PFN A;  3QJY A;  5BPF A;  2L1B A;  3OSN A;  1SYB A;  3GTQ B;  3WO0 A;  2JA5 B;  1QB5 D;  4XZ3 B;  1RF2 D;  4DNI A;  3IKJ A;  4HN2 A;  1WR2 A;  1Y1V A;  5KFC A;  4IRD A;  1TR5 A;  3HOY B;  2B2W A;  5D1O B;  5NUC A;  2EJF C;  1JB7 A;  3T99 A;  3RZO H;  1UC9 A;  2PW7 A;  2A6E C;  4MN3 A;  3WWI A;  2C9O A;  5GAD C;  1GLV A;  2DLN A;  2SDF A;  1ILQ A;  3NQI A;  4GLV B;  3KFU A;  4GN4 B;  1E22 A;  3SK5 A;  4IOA A;  1PTO C;  3UYY A;  4ZQ3 A;  5K3W A;  1EY0 A;  5L1I A;  4JI1 L;  5I9O A;  1RJR A;  4O3P A;  1D5M C;  3RB6 A;  4OWX B;  5FPR A;  2K14 A;  5C4H A;  2C00 A;  1X3F A;  3ERQ A;  3HOX B;  1VQ4 A;  2B2V C;  4IAL A;  1PDQ A;  2WAQ B;  3DM3 A;  2UVR A;  3T9D A;  2W9C B;  1NJI C;  4DUZ L;  4EQN A;  3GTK H;  4A3J G;  4DR6 Q;  2CQA A;  2F4V Q;  2NU9 B;  4NP5 A;  3MXU A;  4TUY F;  1L2Z A;  4L6T B;  2R82 A;  2R85 A;  4J9S A;  1I3Q B;  1XMQ H;  2R7Z H;  3DMU A;  2VY3 A;  1RTN A;  1I4G A;  2NTT A;  5EWG A;  4JI1 H;  3FMA A;  2CFM A;  2PZW A;  2A68 C;  4B3S L;  5HGQ A;  4UCS A;  4X66 L;  3KJO A;  1NE3 A;  2BOS A;  3Q6S A;  1OXT A;  3TQ1 A;  1TKW B;  1XTC D;  3SK4 A;  4H44 C;  1EOV A;  4DL4 A;  3J7Y W;  1ESR A;  1E4F T;  4X62 H;  3BYT B;  2CH4 A;  1O7I A;  2NVY A;  1LLR D;  4A75 A;  4DK3 C;  1CM9 A;  1BOS A;  5FLM H;  1EQT A;  2HG8 A;  2RGV A;  4ME5 A;  3Q23 A;  4OIJ A;  5C1O A;  1V1P B;  1HNW Q;  3DAA A;  2WV6 D;  3FKI A;  3J81 W;  1PH9 A;  4ZQI A;  1W93 A;  4B3S H;  2JK8 A;  3Q24 A;  5IT9 E;  3BG5 A;  5JJZ A;  1A2T A;  4ED0 A;  1WFQ A;  3D4R A;  2W6P A;  4IFD I;  1GUS A;  1VQH A;  3N40 P;  4A93 B;  2PMZ A;  2UXB Q;  5CC4 A;  5M3M B;  4JI8 Q;  4IUU A;  1U4L A;  2ZDH A;  2F52 A;  4IPC A;  1S72 A;  2F0T A;  4ED3 A;  3I4M G;  5IE8 A;  1DAA A;  5I5W A;  2QB5 A;  2BCO A;  1JX4 A;  4K6L A;  3S1Q B;  5KFE A;  2PPB C;  1CTM A;  1IKM A;  4RHS A;  3SGI A;  4FFM A;  2A6E D;  4AYB A;  1EUC B;  1SMX A;  4DV2 H;  4C1N K;  2FIN B;  2UXD Q;  2VUG A;  5JUM A;  3GTO A;  4DR3 H;  1LUZ A;  1EIG A;  3BVZ A;  5C44 G;  4QSH A;  1B2T A;  3JZF A;  3BZC A;  1PTO D;  4JV5 Q;  3JAM E;  3M4O H;  5CAE B;  1WOC A;  1C48 A;  1HZC A;  3S2D H;  1S5B D;  5DAU A;  1GUN A;  5J39 A;  2K50 A;  3KF6 B;  3I70 A;  2PMZ E;  1OTC A;  4O82 A;  4XYL B;  4BA2 I;  2B2W C;  4CKE A;  4TSS A;  1I6H H;  1SEI A;  1ULZ A;  1VQE A;  1TWH A;  4DR1 H;  4CDE C;  1GGO A;  4O7T A;  2ASL A;  5FO7 B;  2Q7D A;  4A3E H;  2MQH A;  3OTO L;  4DA2 A;  5EWF A;  3CRL C;  4K2L A;  3DWA A;  3UDX A;  1B4O A;  1FVI A;  3I4N B;  4YP3 A;  3AQQ A;  1T94 A;  1JJC B;  2A68 D;  4JI0 Q;  4O0A A;  5C4X B;  1QCB D;  3SVM A;  3QG1 A;  4A3B B;  1XNQ L;  1JT8 A;  2R93 A;  2VQE Q;  4IZO A;  5KFG A;  3DLL A;  3L0O A;  1E2W A;  4H13 C;  4R1J A;  3ER0 A;  3I3C A;  4ED1 A;  4R8U B;  2R8J A;  3CPF A;  3GQC A;  3OTO H;  5TSS A;  3FPU B;  1C4Q A;  5KIX A;  4GOP B;  1GSA A;  1FR3 A;  1TWC H;  4IWX A;  4L1K A;  2B29 A;  3V4Z A;  5LOV F;  2ALZ A;  2R92 B;  1HRJ A;  3GIM A;  3JAM c;  2E5L H;  3S16 H;  2E2I A;  2PYK A;  4J9L A;  5DQI A;  4WBN F;  2KHS A;  2QW7 A;  2NTS A;  4C3H H;  1L0Y B;  4GLW A;  1Q3L A;  3VR5 A;  3BZD B;  2O2L D;  4IPD A;  5CV4 A;  1XNQ H;  1UNN C;  1WI5 A;  3H6M A;  1R4Q B;  1VQ6 A;  2IW3 A;  5LMN Q;  3BJY A;  1EKP A;  4YBZ B;  1I4Q A;  4DV6 L;  3G4S A;  2OCE A;  1HH2 P;  3KJP A;  1AUV A;  4EBE A;  1X3P A;  1PH2 A;  1JOR A;  4LF8 Q;  3GTG A;  4LH7 A;  1EZ8 A;  1VQB A;  2J0T D;  1RJQ A;  1H9K A;  4JBK A;  4C3J B;  5IGF A;  5M5Y H;  4QY7 A;  4OX9 Q;  3G8D A;  1F77 A;  3CSW A;  1LTA D;  4DV0 H;  1H9J A;  3LGJ A;  3HOW B;  1JE5 A;  3HB9 A;  1CA5 A;  3M9N B;  1WTX A;  4BY1 G;  1XNR Q;  5IWA L;  1HTL D;  4JPB W;  3RFC A;  1VS0 A;  3BVG A;  4QW9 A;  3KDF B;  4KKT A;  5C3E H;  2VUM H;  5C3W A;  1KC7 A;  2J9G A;  4ECV A;  3U54 A;  2AU0 A;  3BVM A;  4F4X A;  1VQ8 A;  1UNS A;  2ZM6 H;  5IP9 H;  1FJG Q;  4O3N A;  1M0W A;  3T54 A;  2COI A;  3GP7 A;  2WB1 A;  2F3I A;  4MV9 A;  4B9X A;  1ASZ A;  5JEA G;  1KJ9 A;  1SE3 A;  2XGP A;  1I2K A;  3TSS A;  4MAM A;  2UU9 L;  3GV8 B;  2G9D A;  2QK4 A;  4IFD H;  1OBD A;  1NBW A;  1SND A;  1K8M A;  3VA7 A;  2XRQ D;  1RYS A;  4UY8 C;  1EYZ A;  3MXN A;  2E74 C;  4I50 F;  1QVG A;  1IBK Q;  3GII A;  4QIW B;  1JIH A;  4AYB B;  4B3R Q;  3MA2 B;  3OUU A;  4DR7 H;  1YNN C;  1IYD A;  5KFM A;  4RG1 A;  1A3T A;  2EY1 A;  1XMO L;  3R8B A;  2PW5 A;  1CSQ A;  2ZJQ A;  1BCP F;  4IOC A;  2HGW A;  2AHO B;  4DV4 H;  2I5L X;  2E8G A;  3VYS A;  1K3R A;  4LK1 C;  2IL8 A;  3BQ1 A;  1HR0 H;  3MAQ A;  2WB1 E;  3KBX A;  1VQM A;  1HQR D;  5M5W H;  1LT4 D;  2EYJ A;  5KFP A;  1E2V A;  3I7F A;  4YR3 A;  4JVZ A;  3A0J A;  3KLR A;  1V4Y A;  2PNH A;  3M4Q A;  3UE0 A;  3L4J A;  1MSG A;  4JBM A;  5KNB A;  2DWC A;  2PQA A;  3FDT A;  4A3M B;  4A3K H;  4A3G H;  5KFD A;  4DKA C;  3IG0 A;  2ZXO A;  1XXG A;  4XDX A;  2EIY A;  1IBL H;  3BAB A;  1C3O A;  1XMO H;  4HN7 A;  4CKB A;  3GTJ B;  1DD2 A;  2VL6 A;  2K5Q A;  4FF1 A;  4LFB L;  4A3J B;  3URY A;  1OXU A;  4B3M L;  1RL2 A;  1EZ1 A;  5F9N A;  3NK9 A;  2DPI A;  2N88 A;  1HZ9 A;  3C3L A;  3BQ0 A;  2Z6B A;  3S1N B;  3EPI A;  1LM0 A;  3H3V C;  4F50 A;  2W9B A;  4JYA L;  3IL8 A;  1VBH A;  3T5J A;  2R7F A;  3G6J B;  3H0G G;  1Q82 C;  5E4W C;  4TV9 F;  1HNZ H;  2HDM A;  4O2B F;  4RB1 A;  4ID6 A;  2ASB A;  2XNA C;  4AQY H;  3PW2 A;  1UEA B;  2CWP A;  4K5W A;  5EKI A;  4BBR G;  5KG3 A;  3RR5 A;  2HDK A;  4DL3 A;  1LT6 D;  3G7L A;  4LUO A;  5IYC H;  4LFA H;  3VYU A;  1K8G A;  4LFB H;  1F9R A;  1C8C A;  5FO8 B;  1J9O A;  3G6E A;  5I5T A;  3OHB A;  1SYE A;  1ML0 D;  3W5O A;  3RGX A;  4AIM A;  4DAM A;  5M3F G;  4U67 3;  5E4X A;  1EYC A;  4JYA H;  3H4D A;  1T5X D;  4X64 Q;  1CI3 M;  1D1K A;  1ET6 A;  4P74 A;  2C2R A;  4DV5 Q;  2EXD A;  3VYT A;  2R7D A;  5C3X A;  3CQZ H;  3DUZ A;  4FFP A;  1GUO A;  3F2U A;  2IPK D;  3K7A B;  3GTG B;  4QUC A;  4JI3 H;  3DWP A;  3PSI A;  4HID A;  4DIM A;  3N44 B;  3RLF A;  3BQ2 A;  1SSO A;  1FYC A;  1KT8 A;  3J81 j;  3TQY A;  5KKN B;  4QGU A;  4DLK A;  3MR2 A;  3A8K E;  1YNN D;  1G6Z A;  1OWT A;  1ET0 A;  5BWX A;  3DM1 A;  1STG A;  1IZ6 A;  5CM0 A;  2CH4 W;  3B6Y A;  1N32 H;  1DXM A;  1GVP A;  4Z9C B;  2BA0 A;  4DR5 H;  1LTI D;  5KT4 A;  2K05 A;  1MHW C;  4TVI A;  2I07 B;  1R4P B;  5C44 B;  2MJ8 A;  3TS0 A;  1ZET A;  2QIL A;  1I5F A;  5AJ3 Q;  3HOU H;  5DLG A;  2C2E A;  4C3I H;  3LUL A;  4LMQ D;  1X56 A;  1TA8 A;  1EY5 A;  5FO9 B;  1PYB A;  5KFU A;  2N3S A;  4QF4 A;  2IWH A;  1UAP A;  2ZTE A;  2AQ3 B;  4EQO A;  2PNR C;  4Q4D A;  5DAA A;  2YTX A;  5DMX A;  3DEO A;  1X6O A;  1SFO A;  3CCR A;  2QKI C;  2OWO A;  1JMC A;  3MWM A;  4YWM A;  1FKA H;  4EGQ A;  2Z8L A;  4MIU A;  3PIO A;  2B63 H;  1QVC A;  1A2U A;  3A74 A;  2NVT B;  2R7Z G;  1A3V A;  3RF2 A;  2XD4 A;  1XPO A;  4DR6 L;  4LH6 A;  2F4V L;  5KFQ A;  3R2T A;  1WVL A;  2K5W A;  4A3L H;  3KHG A;  2BR0 A;  1B9M A;  2DAA A;  4IUQ A;  4RGM A;  4B08 A;  2EJ0 A;  4X3S A;  1GOZ A;  4NXN Q;  3RBE A;  3BJU A;  1Y14 B;  3NQT A;  4OON A;  1YHB A;  2MHV A;  1PYW D;  3GTL A;  4JOI A;  5C1P A;  4I4T F;  4CMD A;  1WCM H;  2L4N A;  2KVM A;  5FLM G;  1FNU A;  1J6Q A;  2EY6 A;  4GKJ Q;  1K28 A;  1W6K A;  2Z04 A;  1Y69 U;  3RV4 A;  3QWU A;  5BWV A;  1UWV A;  3HKZ G;  3K57 A;  1B33 N;  2YU9 B;  2F4V H;  1STA A;  1STY A;  4CE5 A;  1VCI A;  2F03 A;  4JCV E;  4MV7 A;  1V8Q A;  3EA6 A;  2TSS A;  1HNW L;  2WTF A;  3T1H H;  1RDP D;  3X3N A;  3U9S A;  3J7A V;  4RCO A;  5T1I A;  1BJT A;  5CR5 A;  2J6T A;  4LJZ C;  2W6Z A;  4DGZ A;  3RNU A;  3J81 E;  2Q2I A;  2P0A A;  2UXB L;  3FHW A;  1TXY A;  4O4J F;  4BBS H;  1Q12 A;  4JI8 L;  3PN1 A;  4GKK H;  1TS5 A;  4DAP A;  5FD5 A;  3AEV A;  3K5I A;  4EQ5 A;  4IUR A;  4JI6 Q;  2JA6 H;  3S2H B;  1XX8 A;  4DV1 H;  4G4K A;  1TWA B;  3MWE A;  3BA9 A;  1JWS D;  2VQF L;  4UP8 A;  2XGQ A;  3PVX A;  4HJ9 A;  2I0Q A;  1BGW A;  2NN6 I;  1VQJ A;  2XWJ B;  3P1H A;  3UDI A;  3K5L A;  4BY1 B;  2NYZ D;  3HFZ B;  2UXD L;  1AUX A;  1G2T A;  1GD7 A;  3TZD A;  3GTQ A;  1JDE A;  3UZB A;  3K8A A;  2BQ3 A;  4JV5 L;  4XTC S;  1JWU D;  3KLS X;  2PBZ A;  3WO1 A;  5KT2 A;  4JI7 Q;  2JA8 H;  2F0S A;  2NBF A;  4J9R A;  3S1R B;  2EDG A;  2F0H A;  4RKL A;  5EAY A;  4JI8 H;  4MNO A;  4A3E G;  1XPR A;  2W8K A;  1I1L A;  2GVA A;  4FF3 A;  1PRT F;  1SE4 A;  3A7A B;  1RD9 D;  1SLJ A;  2B2T A;  2HDL A;  5L1J A;  2NU6 B;  2QDL A;  2B8G A;  1JWM D;  2VQF H;  4M7E A;  4CDC C;  4POG A;  2UXD H;  1TVX A;  4KY5 A;  1K9M C;  1MZB A;  3KF8 B;  2D0O A;  1S3O A;  2VS1 A;  1H9M A;  2VNU D;  1JOQ A;  3J81 c;  2AQ2 B;  4JV2 A;  2OTJ A;  2Y0S G;  3RZD H;  5I5Y A;  4JI0 L;  1U4P A;  2W9C A;  3PO3 H;  2Z0S A;  4G7Z C;  2YV5 A;  2VPQ A;  4LF4 Q;  2F0K A;  4QCL A;  2VQE L;  4EG0 A;  1P8L A;  1R9T B;  5C8Y F;  1I3Q A;  1SJH D;  3T9E A;  1EL0 A;  3VYR A;  3GTP B;  3PMF A;  4C3H G;  4HJA A;  2FJ2 A;  5KGU A;  1S0N A;  4LF9 H;  2CQO A;  4G7H C;  2YZN A;  3FEW X;  4MV6 A;  1PFS A;  4DR2 Q;  3GIQ A;  3HT5 A;  4MV4 A;  4ECU A;  5CB4 F;  3GIJ A;  2YL2 A;  4U68 A;  5F2D A;  2QF7 A;  3VR3 A;  1I2L A;  5KFN A;  1BNC A;  4IUV A;  4DFA A;  5M5X B;  4JI0 H;  1WYD A;  3O13 A;  1NCV A;  4JOI C;  2XIW A;  2K1B A;  1B50 A;  3OMG A;  2D2C C;  1L2F A;  2PN1 A;  2NVX B;  5C4J H;  2R87 A;  3N42 B;  5LMN L;  2WAQ E;  4HSP A;  3NTK A;  5AFW A;  1SCU B;  4Q0Y A;  1V1P A;  2JSO A;  2HHH Q;  4HNT A;  2K5V A;  3QZ8 A;  4LF8 L;  1Z6H A;  4F7X A;  1EIF A;  1SNO A;  5EBC A;  4TV8 F;  1EWC A;  1Y1W H;  4O84 A;  2FK2 A;  2MO1 A;  1VQ7 A;  5IGC A;  3OW2 A;  2Z9H A;  4BY7 H;  1SJE D;  2R8G A;  2K5D A;  2CNU A;  2JN4 A;  3E0J A;  4HIK A;  3H0G B;  4OX9 L;  1BQQ T;  5KT5 A;  4DV3 L;  3EYY A;  5C3E G;  2VUM G;  2NVQ H;  1HNX Q;  2KJX A;  2F1M A;  3ETJ A;  3NXW A;  3R3O A;  3KHR A;  2HQL A;  4BBR B;  3U58 A;  1I94 H;  5IP9 G;  2VZA A;  1T5E A;  1TWF B;  1TQO A;  3M3Y H;  1G29 1;  1SFO H;  1U5K A;  1EEI D;  4X65 H;  4U7C A;  1DON A;  1D5Z C;  5K5P A;  4IFD G;  2M05 A;  1WTH A;  4B3T Q;  4FP5 D;  3RV3 A;  3Q8R B;  1FJG L;  1L1O B;  4RUC A;  1WTO A;  3PZP A;  1RKN A;  3GV5 B;  3T1Y H;  3PFF A;  4CDF C;  3FRP B;  1PHJ A;  4DV3 H;  2B8F A;  1B3A A;  2N8N A;  4ZUJ A;  1X9N A;  4QB4 A;  2JEG A;  1A62 A;  2UXC H;  3KF6 A;  1WRV A;  2JJQ A;  2K52 A;  3C1F A;  3W1G A;  3C46 A;  3PUZ A;  2RQX A;  1IBK L;  4YY3 Q;  1XWE A;  3NPP A;  3UDG A;  2KEN A;  4GS3 A;  2G9H D;  4B3R L;  1ZKO A;  3RB3 A;  1RYR A;  3AW8 A;  4C2M H;  4XXE A;  5D3I B;  4A3C H;  2B2T C;  5G3L D;  1XK5 A;  4O86 A;  2NN6 H;  1PTO F;  2XGT A;  1EQQ A;  4ME6 A;  4JI4 H;  1PXU A;  3T16 A;  4NZN A;  2EYF A;  4CDD C;  4A3K G;  4A3G G;  2HGS A;  4XYM B;  2CW0 C;  3M4Y A;  3JC6 6;  2CW7 A;  3K6O A;  2UUC H;  3IRB A;  4K5X A;  2ZT9 C;  4DNT B;  2PQE A;  2HIX A;  3JSN A;  3GTK B;  5EQ0 A;  1AE3 A;  2YYZ A;  4HR7 B;  3D6C A;  1N33 H;  3E3X A;  3GIP A;  3Q8P B;  4KTA A;  3T53 B;  4DAY B;  4RB0 A;  4R8U A;  1PX2 A;  1KUT A;  3HOV H;  1RJP A;  2VPS A;  4BWS C;  4GOP A;  2D9U A;  3GO5 A;  2FE3 A;  4FF4 A;  2R7Z B;  2XWB B;  4J9O A;  1A0I A;  4F8M A;  4EGV A;  2R92 A;  4ECT A;  2GN5 A;  5IYB H;  3K7U C;  2CNQ A;  2A73 B;  4LF6 Q;  2L0C A;  3TII A;  4QWA A;  1LYL A;  3S14 H;  4A3I H;  3T7A A;  5IYD H;  5IYZ F;  2OF1 A;  4O7V A;  4DL7 A;  5COR A;  1LT3 D;  5IYC G;  3VR6 A;  4MTK A;  3MFI A;  4WJ3 M;  4IZ8 A;  4MA5 A;  3F1Z A;  4UCO A;  4CJ1 B;  3HS0 C;  5BN3 A;  3GTQ H;  2JA5 H;  5LMN W;  3V6K A;  1WTW A;  2GVB A;  5DM7 3;  3OIQ A;  3KAK A;  2KQ3 A;  4QWB A;  4KHV A;  5J22 A;  4DV7 Q;  1F9S A;  3HKZ B;  2NU7 B;  1I6U A;  1PV4 A;  5EDW A;  3KAJ A;  3M4P A;  3L4K A;  1VF7 A;  1WTP A;  1TWG A;  5K36 H;  5CV8 A;  3GIK A;  2YS7 A;  1GUT A;  2V9W A;  4DUZ H;  5ELO A;  5FLX L;  1SXT A;  3J80 E;  4X64 L;  1ZEQ X;  2FK1 A;  4YWL A;  3KDF A;  1SRU A;  2AUJ D;  2UUA Q;  4DV5 L;  2Q8I B;  5DGB A;  1T3N A;  4JI2 Q;  5KFT A;  1NAP A;  2BH2 A;  3IN5 A;  1N9W A;  1AEX A;  2LMC B;  1K1S A;  4ED8 A;  2XCP A;  1DCZ A;  3W1B A;  4X66 H;  4RB2 C;  4XQQ A;  2FPG B;  1PTO H;  3PV0 A;  2KCM A;  5T14 A;  5KG7 A;  2DZD A;  1BR9 A;  4EYH B;  3HOU G;  4IFD J;  1G51 A;  3NE5 B;  4IJH A;  4WRD A;  4C3I G;  5IGB A;  2QA4 A;  3Q1K A;  1JXL A;  3M4O B;  4K14 A;  3NP8 A;  3PUW A;  3J7A 5;  3J7A F;  1EY4 A;  2AGO A;  1K83 H;  2A69 C;  1VKZ A;  2UVV A;  2JEI A;  2F0V A;  3S2D B;  1ICF B;  3KRE A;  1N34 Q;  3GTM H;  4NKL A;  3CC4 A;  2CW0 D;  4QIW A;  2GA4 B;  3Q8D A;  5AJ3 L;  5DGI A;  2QGQ A;  5BWR A;  3R93 A;  3N8D A;  1F2L A;  2Q8R E;  3PUV A;  4ZCK A;  2B63 G;  2K5H A;  3QOJ A;  4K0K Q;  4PQX A;  1I6H B;  4A76 A;  4GNX B;  4HTH A;  5A2Q W;  4ED7 A;  2HCC A;  3P20 A;  5JOB A;  2KSW A;  4WJW A;  3AFP A;  1CK1 A;  4OWT B;  3IAY A;  2UVU A;  5JJI A;  2L11 A;  1HZA A;  3V4S A;  1HCZ A;  5CV6 A;  1MSH A;  1HA5 A;  1CS0 A;  2D5D A;  4TM5 A;  4DAA A;  4RU9 A;  3E9H A;  4A2A A;  4E6N A;  5DIS C;  2J6U A;  3U0G A;  4ALP A;  2UUB Q;  4RGN A;  4LFC Q;  4JI5 Q;  2L15 A;  1UE6 A;  3QOL A;  4RFB A;  1FGB D;  3OIP A;  4HMJ A;  3T9F A;  2JEF A;  2PI2 A;  3T5L A;  5CYU A;  1STH A;  1KIX A;  4HNV A;  2F0G A;  1BBU A;  3SE0 A;  1SR3 A;  1PMR A;  4KJN A;  4F4W A;  5JPM C;  1WCM G;  4LF5 Q;  3TP6 A;  5IT9 c;  3F2C A;  5IGE A;  3NEL A;  2Y0S B;  5T1G A;  1DZ1 A;  3TP5 A;  5M3M H;  5L9X A;  3GTJ A;  4NXN L;  1EY6 A;  4QIW E;  3EVQ A;  2F0I A;  4AYB E;  2Y4R A;  3BAA A;  1TWC B;  4HAE A;  3Q8S B;  4C5C A;  3S1Q H;  2FLL A;  4GOP C;  5KT3 A;  4POF A;  4XQJ A;  4ECY A;  1SMY C;  2EYH A;  3S16 B;  1LTS D;  4XIG S;  5LP6 F;  3CW2 C;  1DV2 A;  4HJ7 A;  1CFM A;  1EEF D;  2LXK A;  4C3H B;  4GKJ L;  4IHJ F;  2SOB A;  2COJ A;  1MBY A;  3SK6 A;  3H15 A;  2C28 A;  4CJ2 C;  1HQM C;  1SNC A;  2V1C C;  2OQ0 A;  2WII B;  5CA1 F;  3EFX D;  1SDF A;  3K3V A;  3HOZ H;  2JXM B;  5KRU A;  3J80 i;  4FU0 A;  4KHP Q;  5EKK A;  1Z7T A;  4EBD A;  4TKO B;  3GV7 B;  1ASY A;  4BBS G;  1M7J A;  1BXT A;  4FXG C;  1M6V A;  3TW7 A;  4JV0 A;  5KG4 A;  1SNM A;  1ONL A;  3CP0 A;  5DNF A;  3T4A C;  5M5Y B;  2JA6 G;  4F4Z A;  5GQO A;  5L37 A;  4O7Y A;  3HG9 A;  1A6X A;  1NTG A;  4UCU A;  3RJ0 A;  4FF2 A;  2K6A A;  1TAE A;  4I7Z C;  4XT1 B;  1JIC A;  2M00 A;  2MCT A;  5BR8 Q;  1VQN A;  5HUR A;  2KEE A;  4OO1 I;  4H7B A;  1YNX A;  5FLX W;  2R86 A;  3HZX A;  1E4E B;  3I4N H;  1V9P A;  4NW2 A;  3R5X A;  4JI6 L;  2M2L A;  3J80 L;  2F3W A;  4DK6 C;  3TME A;  1AZQ A;  2ZTD A;  2D62 A;  5CR3 A;  2CWA A;  1S97 A;  2A69 D;  3OMC A;  2VUM B;  1Y1V H;  2HJW A;  3CAM A;  4ED6 A;  2JA8 G;  2JA9 A;  4TQU S;  1J5E Q;  4DR4 Q;  5KFW A;  1X65 A;  2VW9 A;  5BPH A;  3I72 A;  1AN8 A;  3LWE A;  1GKH A;  1QIL A;  1EU3 A;  1TWG B;  1N36 Q;  3I91 A;  3A56 A;  4JI7 L;  1ENF A;  2ENB A;  3N6X A;  1KRT A;  3H3V I;  1K1Q A;  4DV6 H;  4HJ8 A;  2EYO A;  2EYP A;  4IRC A;  1YZ6 A;  5I6W A;  1JE4 A;  3I8Z A;  5KG1 A;  2JEA I;  2MUY A;  3M9B A;  3PGZ A;  2XIG A;  5I2Y A;  5LMU Q;  4LWC A;  4EEQ A;  5LL6 X;  3D31 A;  2EIF A;  5A35 A;  5HBR B;  2RSO A;  3PO3 G;  2YZL A;  4ULL A;  2IP4 A;  2EPB A;  4YJ2 F;  3EIV A;  1X32 A;  3MR3 A;  3ETH A;  4FBT A;  5JVD F;  5ELN A;  2E2D C;  3H91 A;  3U50 C;  2R7L A;  4O7N A;  1E1O A;  3OPO A;  5LA6 F;  2JA7 G;  5ELD A;  5IWA H;  3N6R A;  2NWG A;  2BH8 A;  4PMW A;  2W57 A;  1V1O A;  5M5W B;  1SMY D;  4LF4 L;  3FPP A;  1SNQ A;  3C1E A;  3ULJ A;  3ULL A;  2A19 A;  1BBW A;  3S1M B;  5DM6 3;  5GAH C;  3LP8 A;  4HNU A;  1DM0 B;  5JQG F;  4A3K B;  4A3G B;  5KX5 F;  3G48 A;  5GRO A;  2NVY H;  5K2M A;  3VR2 A;  3JRX A;  2UU9 H;  4DR2 L;  4ZKC B;  4RAZ A;  3DEP A;  3TIG A;  1SYG A;  3FKI H;  3TY5 A;  3J7A K;  2CZG A;  4DNR B;  2H5X A;  1I6V C;  1K0S A;  1CE8 A;  1D6E C;  4PMB A;  1Y1W G;  4ZOL F;  1IYV A;  2YU9 A;  1UE1 A;  1BUV T;  4BY7 G;  1YEZ A;  4P2C B;  2PZU A;  1DOL A;  1LO5 D;  4IPG A;  5I4D A;  1RK5 A;  3NUA A;  4GN3 B;  2HHH L;  1D7Q A;  3JRW A;  3Q2O A;  4IIJ F;  1B9N A;  1IYJ B;  2KCN A;  4RWS C;  5EKL A;  4MTN A;  3HKS A;  5IP7 H;  5D3D A;  4IUT A;  2FMC A;  4DR2 H;  2N55 A;  2L12 A;  2DY7 A;  5KT6 A;  1S4Z A;  5C0X I;  1BNZ A;  4Q45 A;  1I1K A;  2EJG C;  2Z4H A;  2XSC A;  3QB3 A;  1HNX L;  3PW4 A;  3RD4 A;  3GTO H;  1A3U A;  5J3B A;  1XMQ Q;  1UE5 A;  1CA6 A;  3R2I A;  1DGS A;  2YW2 A;  3K0X A;  3I2Z A;  2SEB D;  4HED A;  1BCP C;  4LUV A;  3K0Y A;  3FDS A;  4P71 A;  4O42 A;  2RHQ B;  4EQP A;  3QR8 A;  1A9X A;  1G6P A;  5I47 A;  5CE8 A;  1TWA A;  3CQZ B;  3PF5 A;  4KKU A;  4TQS A;  2N78 A;  4H0L C;  3MFH A;  1JC7 A;  1E0B A;  3J80 W;  1PFM A;  4HCS A;  3SR1 A;  3PIP 3;  1RCV D;  3GD7 A;  1V51 A;  4MV1 A;  1BBX C;  4B3T L;  4X62 Q;  2Z6K A;  4JW0 A;  2R84 A;  1E4G T;  5KFZ A;  4RA8 A;  1N48 A;  4B3M H;  2CVR A;  1BCP B;  2R6F A;  1B70 B;  2AGQ A;  4A3M H;  1TWH H;  1HNX H;  2LXJ A;  2VB3 X;  1MD2 D;  1PVO A;  3JZI A;  2EYL A;  2AMC B;  4TRD A;  3SE7 A;  1EY8 A;  4U6P A;  4A3C G;  3R5H A;  2NN6 G;  3V6H A;  1G8Z D;  4OO1 H;  2LKV A;  4KN7 C;  2FPP B;  4YY3 L;  2GPS A;  3KTM A;  4HJ5 A;  3UFX B;  2K03 A;  4C3I B;  3LWB A;  1HUM A;  2F0L A;  1I50 B;  1ZHS A;  2K5N A;  4WJ4 A;  3T5K A;  3HRZ C;  4GC7 A;  3I4M B;  2DNC A;  3KF8 A;  2E2H B;  2R93 H;  1EUJ A;  4DUY Q;  2YRX A;  4EFB A;  2K4K A;  1H9R A;  1C9O A;  1PA6 A;  3U4V A;  1QUQ B;  3PR4 A;  4FGR A;  3BA8 A;  4A3F H;  4R4T A;  2RSN A;  1HA6 A;  2C2D A;  1OXX K;  2B63 B;  4JXU A;  2I46 A;  5CV5 A;  3HOV G;  4DV2 Q;  3H20 A;  1W2B A;  3CME A;  4DR3 Q;  3H3V H;  2Z4I A;  1R9T A;  1YJ9 A;  4ZKB B;  2E2I H;  5IYB G;  2KUM A;  2Z02 A;  1JR0 D;  3MZ5 A;  3GTP A;  2OTL A;  2ES2 A;  4A3I G;  2V5A A;  5IYD G;  1SRO A;  4UCT A;  4ECX A;  3RLN A;  1KEE A;  5H1S E;  1STE A;  3VR4 A;  3CHB D;  2Q2T A;  5HY6 A;  1S03 G;  3AYH B;  1X54 A;  3K81 C;  1TU2 B;  3NBH B;  1KD1 C;  3F2B A;  3CVZ A;  5L1K A;  3ORR A;  3K3P A;  3GTG H;  3PW0 A;  2JA5 G;  3BYY B;  1C0A A;  3GQB A;  2NZH A;  1WCM B;  3I4O A;  3S17 B;  1KTA A;  4FFR A;  4PWQ A;  1I4H A;  4QUF A;  3NWT A;  4DR1 Q;  2C22 A;  2NVX A;  4FNF A;  2EOT A;  3GV6 A;  2F0Q A;  4CMF A;  2OEO A;  1HTP A;  5DQG A;  1BCP D;  4IO9 A;  3M7N A;  5K36 G;  2W70 A;  4LNQ A;  5L1L A;  3K58 A;  4PV1 C;  2CNV A;  3MWY W;  4GC6 A;  4YCW A;  4BS9 A;  1KJJ A;  2A1H A;  1B53 A;  3D0F A;  3E6Z X;  4K8I A;  3H0G A;  4DV7 L;  4RAU C;  2NZO A;  4IJL A;  4JK1 C;  4G7O C;  2AQ1 B;  2IX0 A;  3GJX B;  1DOK A;  3A8J E;  3PUX A;  3DWQ A;  2NZ1 D;  2RDH A;  1JLL B;  5HGT A;  1Z9F A;  2WAQ G;  4OEL B;  3OOC A;  4DR6 H;  4Y7N H;  3OTO Q;  1TWF A;  2RVL A;  4BBS B;  3A8I E;  2K7V A;  1NUC A;  2UUA L;  3D4W A;  2ICI A;  1LTG D;  4JI2 L;  1AFP A;  1KTK A;  2JA6 B;  2E5L Q;  2K33 A;  1ICW A;  2J7Z A;  4LW1 A;  2ATL A;  1VMC A;  2W8L A;  4B9W A;  3DTF A;  1L1O A;  4J9P A;  3R9R A;  5M9O A;  2V58 A;  4O2D A;  2X0S A;  1T9H A;  3A5U A;  3EQL C;  3EN2 A;  1F9P A;  4NZM A;  1CZG A;  4MHE A;  5C0X H;  2Z6K C;  1A63 A;  3T56 B;  2H4O A;  2R7K A;  2R8I A;  5IOD A;  5KYL A;  2JA8 B;  3F8N A;  2JYO A;  3RLO A;  4CJ0 B;  1G2S A;  1AE2 A;  1E24 A;  1F2M A;  2PZT A;  3MTS A;  4BA1 I;  1N34 L;  3N43 B;  5I5U A;  1HNW H;  1EOT A;  4K5V A;  2WYO A;  4DV0 Q;  1V43 A;  5BN4 A;  2QEX A;  4K0K L;  1A15 A;  4APM A;  3H94 A;  1EHI A;  2YZM A;  1TS2 A;  1X3G A;  1F2Y A;  3OW7 A;  4DAV A;  4N9P A;  1C30 A;  2UXB H;  3D4D A;  1OO9 B;  1YJN A;  2GPW A;  3WDN A;  4ETS A;  1QWY A;  5A2Q E;  4EGJ A;  1EWH A;  3CCV A;  3ULP A;  3BZK A;  2RCF A;  4LFC L;  4JI5 L;  3RZD B;  5M3M G;  3RIZ A;  2RDJ A;  2ID0 A;  4PG3 A;  2ZM6 Q;  3VPC A;  5C4Z A;  3PO3 B;  5KFI A;  5KFO A;  3GTK A;  4HR7 A;  2B2U A;  1DIK A;  3ND9 A;  4DAY A;  4KK7 A;  3D6W A;  2C5C A;  3CCJ A;  2FMA A;  4RGO S;  3G6X A;  1ZYR C;  4LF5 L;  4A3D H;  3AB9 A;  5J1Z A;  2JA7 B;  1BF4 A;  3KHH A;  4K0K H;  2R7Z A;  4RH6 A;  4BWG B;  5G3L F;  3BAC A;  4UFZ A;  4JV5 H;  2IMW P;  2MFI A;  5DLF A;  1AN7 A;  1OXV A;  2F0M A;  4JC0 A;  2A6H C;  1IHZ A;  3K5M A;  1B3Q A;  3HOZ G;  4RHR A;  4O3O A;  1PFB A;  4DR7 Q;  3P7J A;  4JI5 H;  2GQR A;  2DNE A;  3VDY A;  3U9T A;  4QMG A;  5BYB A;  4FM9 A;  4S3S A;  2WE6 A;  3WNZ A;  5BN5 A;  2O4X A;  3H40 A;  5C4J B;  3M4I A;  2IY5 B;  2RDF A;  2B3G A;  2RKS A;  1UUP A;  4DV4 Q;  4N9T A;  5KFF A;  5CA0 F;  1HR0 Q;  3V05 A;  1G2W A;  4NYE A;  3T9C A;  4KHP L;  2G5D A;  3HKZ A;  1Y1W B;  4O1N A;  1I4P A;  2V4R A;  1X3Q A;  4BY7 B;  3S15 H;  2XRS D;  2V4D A;  1QZG A;  1SYX B;  3I4N G;  3VMM A;  3F8T A;  4F87 A;  3K59 A;  1Y1V G;  4EX5 A;  2F0J A;  4RKB A;  2NVQ B;  1IBL Q;  1EYG A;  1XDN A;  4RNN A;  2VQE H;  5BR8 L;  1XMO Q;  1M8A A;  1W96 A;  3I56 A;  2YYA A;  1EU4 A;  1IL2 A;  1SAP A;  1PRT B;  2DY8 A;  4UP9 A;  3DTG A;  3D8G A;  4L5S A;  1IL8 A;  5BWW A;  5COY A;  2EYM A;  3UDF A;  1S0O A;  4NLG A;  3QQM A;  2ZXR A;  1CKN B;  4DL2 A;  3A5Z B;  4L63 B;  5FLX E;  1J5E L;  4DR4 L;  1CQV A;  1S40 A;  3J7Z C;  1VMP A;  5LYJ F;  3T9A A;  4R4O A;  4NPS A;  4JBW A;  5FR9 A;  1N36 L;  1HNZ Q;  1L1O C;  3NHH A;  4O3R A;  2R7N A;  1M90 C;  5ELB A;  2HGX A;  3I90 A;  4AQY Q;  1XNR L;  2YTV A;  4EFE A;  1KBL A;  1I4X A;  5LMN H;  3T5H A;  1O80 A;  2JP1 A;  2QDB A;  4ZI7 F;  2FP4 B;  4APV A;  4LFA Q;  4O7S A;  3BU2 A;  3KUP A;  4LF8 H;  3NBY B;  4IR9 A;  3TRZ A;  4J8Q A;  4DN4 M;  1CQJ B;  1T36 A;  3MEF A;  4O7Z A;  2B2Y C;  5M3F B;  3BS1 A;  2R8H A;  1BO0 A;  3NSW A;  5ISR A;  4GNX A;  2KOL A;  4J6H A;  5LMU L;  1NSN S;  4HYK A;  4KV6 A;  4OX9 H;  3LWU A;  3PW7 A;  4C2M B;  5JQW A;  1J5E H;  3WOF A;  2NVX H;  3MXG A;  3ORQ A;  1TY0 A;  1ZYR D;  1JQY D;  3CCE A;  4IWY A;  5DG9 A;  5I5V A;  1JJG A;  5EOY A;  3L2P A;  1OBG A;  1Q90 A;  4LAA A;  1WD0 A;  3KHL A;  4JI3 Q;  4R7R A;  1XNR H;  2K28 A;  2A6H D;  3ND8 A;  3RZO B;  1GUW A;  1PZJ D;  1ET9 A;  3GTL H;  2I5H A;  4ZAI A;  5A2Q L;  4Q44 A;  2WKD A;  1PYS B;  1M1K C;  3PO2 H;  3G6Y A;  1I4R A;  2NB0 A;  5CV7 A;  1JDB B;  2Y0S A;  1FJG H;  3FKI G;  1FD7 D;  3CPW A;  1WD1 A;  2JQO A;  3TP8 A;  2B2U C;  3AMU A;  5KFL A;  2IJ0 A;  2R3Z A;  1CKO A;  4DL5 A;  1Q8K A;  3HOV B;  1HFG A;  3FP9 A;  1N32 Q;  2I87 A;  3CCM A;  2RA4 A;  4DR5 Q;  1TWC A;  3TN2 A;  1PZK D;  2IBK A;  1TS3 A;  3K80 C;  2E2J H;  1ZAU A;  4O81 A;  1S9F A;  2ATW A;  1GSO A;  3VPD A;  3S14 B;  4A3I B;  5C6A A;  1N56 A;  5KFH A;  4R8I A;  4UP7 A;  2E75 C;  2XCL A;  4HIM A;  4JUZ A;  1EY7 A;  1IBK H;  4OL7 A;  5IP7 G;  2F0N A;  4ILW A;  4NMZ A;  4B3R H;  1RIP A;  3E9I A;  2NUA B;  4ECQ A;  3CCQ A;  4PDB A;  1Q8I A;  3NTH A;  1QVF A;  4AYB G;  3G6V A;  3TY9 A;  3KAL A;  2IA6 A;  3CXC A;  1VQF A;  4I65 A;  1W3S A;  2R7M A;  4Q43 A;  1DV1 A;  2A1A A;  1E3P A;  3T13 A;  3FMC A;  1LTR D;  2Y0S E;  3LML A;  1TS4 A;  3HBL A;  2PCF B;  4WHX A;  2YWV A;  1IOV A;  2ZDQ A;  2NUC A;  1Q1E A;  4GLX A;  3PF4 A;  1MI2 A;  5JVH 3;  1XMQ L;  2FK3 A;  3G8C A;  4XX0 B;  4CGY B;  1IKL A;  2DN8 A;  1NNX A;  5FOB B;  1E4E A;  3RB0 A;  4FFL A;  3BDC A;  1S0M A;  1HPC A;  1YJW A;  4M9U A;  4LF7 Q;  1Z2P X;  2IX3 A;  1I7N A;  3ERO A;  2VUM A;  3CCU A;  4A3M G;  3HOY H;  2RCN A;  4ECZ A;  5BWU A;  4H02 A;  4G57 A;  3MJF A;  4YCU A;  5GAG C;  4GLA C;  2XCA A;  4X62 L;  1RJT A;  1WTQ A;  3NEM A;  1PTO B;  4MZ9 A;  1AZP A;  4MV3 A;  5FPO A;  1LAB A;  3CD6 A;  4OO1 G;  3CCL A;  1JKJ B;  3NEN A;  1Y8O B;  4YHH Q;  1EYA A;  1IW7 C;  4NB3 A;  3MXP A;  1EIH A;  4QWD A;  5DG7 A;  3SI8 A;  5DGH A;  2BE5 C;  1LV9 A;  4RZR A;  2B39 A;  2XVS A;  4KKS A;  2MNA A;  2W6O A;  2P5Z X;  2LFN A;  3T1H Q;  2R93 G;  1IBM Q;  1K83 B;  3HOX H;  4OIK A;  4X3U A;  4E4T A;  5JPN C;  1SBB B;  1WSC A;  1U0L A;  5D14 A;  2KCC A;  4LUZ A;  3GTM B;  1ZXT A;  4QWC A;  4J9Q A;  4EYI B;  3TW6 A;  5E1F A;  4A3F G;  4M8A A;  1CKM A;  2L9H A;  4J9N A;  5CGK A;  3P75 A;  3EPG A;  2DAB A;  5I60 A;  4N8X 1;  2O03 A;  2DGY A;  1II3 A;  4DUY L;  4GNX C;  2QEJ C;  4BXX H;  4GKK Q;  4G3I A;  1I3Q H;  5CV9 A;  2F0D A;  3PIP A;  4YAJ B;  2HIV A;  1IXR A;  3M9O B;  3UE1 A;  4DV1 Q;  2I80 A;  3WWH A;  4X64 H;  5GAE C;  5CMD A;  2W71 A;  1YVC A;  1M0T A;  4DV5 H;  4Q4C A;  1QE6 A;  2YCH A;  4R4C A;  4DV2 L;  3CMA A;  2EZV A;  1RHP A;  1AH9 A;  3WWJ A;  4DR3 L;  2OQK A;  3T51 B;  3L7Z C;  5EZY F;  2HHF B;  4I7H A;  4DL6 A;  2VR1 A;  3MFG A;  4O83 A;  1EZ6 A;  1VBG A;  2BDN A;  5LXT F;  2IX1 A;  4A3E B;  2GQS A;  1Q46 A;  2E76 C;  1F2Z A;  2R61 A;  5FJ8 H;  1LTL A;  3W2D A;  3TS2 A;  5ELF A;  2X6L A;  4DUY H;  2W9A A;  1CHQ D;  5DLQ E;  2W7P A;  1S5C D;  4A3L G;  2SCU B;  4J0M A;  1ESF A;  3J80 c;  2SNM A;  3NGD A;  1K0R A;  3GDE A;  2HT1 A;  1KJQ A;  3STB C;  4HQ6 A;  2VQF Q;  5C5M A;  4L8J A;  2FPI B;  2F0E A;  1A48 A;  4DR1 L;  4IQZ A;  4O7R A;  4CC5 A;  1WH2 A;  2X5R A;  4YWK A;  3VOT A;  2I8C A;  5D8D A;  3DF7 A;  4A93 H;  5KFY A;  1AP0 A;  1E1T A;  2BA1 A;  2FB9 A;  4IUN A;  1PH1 A;  4WFN 3;  1HXY D;  2EVB A;  3HOZ B;  3AU7 A;  2Q8T A;  2EJM A;  4FFN A;  1EQR A;  2WB1 G;  1KC8 C;  1IYU A;  2XN9 C;  4FXD A;  1VF5 C;  5DQH A;  1KXL A;  2ZJT A;  3I4L A;  4RZQ A;  5DEH A;  2RHS B;  1LAC A;  4K8J A;  4LF9 Q;  1EWI A;  3E5S A;  4EBC A;  1IW7 D;  1UE7 A;  3CQZ A;  1HJP A;  1JCK B;  2BE5 D;  5EPJ A;  5JJK A;  4L5Q A;  2PI2 E;  4Q0F A;  4ZHQ F;  2WDT A;  4M0J A;  2E5L L;  4NXN H;  2DPJ A;  4R9W A;  5C0X G;  1Y1V B;  2F0W A;  1VQ5 A;  2ICE C;  2VQD A;  3OWF A;  5J2T F;  4DQN A;  4ECR A;  1WJJ A;  1GO3 E;  2RF4 A;  2AWO A;  4PMC A;  2LS0 1;  2RBM A;  3CC2 A;  5BYA A;  4GKJ H;  2DJF C;  3TEH B;  1EFW A;  3K5H A;  3M9M B;  4FO2 A;  3PW5 A;  3MVV A;  1HZB A;  4KJO A;  5KG5 A;  2OLS A;  4R4Q A;  3NWS A;  2F0U A;  1FNV A;  3U9O A;  4V0B A;  3OWE B;  1Q81 C;  4OXP A;  2CQY A;  1K73 C;  2M9V A;  4HMI A;  5C3E B;  5KNC A;  4C5A A;  4FDB A;  4ZLT F;  1W6J A;  5C4X H;  4NXM Q;  1PH8 A;  1I50 A;  4A3B H;  4DV0 L;  5IY0 A;  5KFS A;  2E2H A;  4KY7 A;  3R23 A;  3KOJ A;  3QIA A;  4DU9 A;  2J4X A;  1I94 Q;  1XPU A;  1B6R A;  4ECW A;  1Y8P B;  4ME3 A;  1QUQ A;  1MGS A;  1VQI A;  4O7W A;  1QOH A;  5I2X A;