2Q2WA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
253
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRNGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
total genus 90
structure length 253
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2wA00
1PZFA 3H5AA 3PPIA 3WGGA 4BGEA 2EP5A 2AE1A 1MXFA 5LC1A 1E3IA 1DJQA 4MP8A 5A05A 4CM3A 4BGIA 4I1IA 1U5CA 5ITVA 4MJLA 1Z45A 1W0CA 4RVUA 1QMGA 4EW6A 1IZ9A 2B36A 5G0WA 1GU7A 3E1KA 1D3AA 1EFLA 1SZJG 2FZWA 2ZB8A 3DBLB 3I6IA 4A27A 4DPMA 5CDSA 3NGLA 1FDWA 3DC2A 2P4QA 1YJ8A 1EE2A 4ND5A 1X0XA 2WYVA 3L4SO 1LEHA 1QV7A 2NVUA 2WD7B 4K26A 3OECA 1JWBB 1PZEA 2PD4A 4OMUA 4WJZA 1PJCA 3TPCA 5AXAA 1SAYA 2E37A 1KEWA 4IIUA 4JIGA 1MX3A 3JQBA 4OYRA 4XQCA 3LDHA 3N7UA 1PGJA 1T2DA 4BV9A 1V3UA 2HMTA 4DLBA 3RKRA 2X6TA 4QT0A 1N1GA 4RF4A 1H2HA 4JGBA 2GPTA 3EVNA 4YYZA 1P31A 2VWGA 3S55A 4BQRA 3U49A 1PU2A 3F1KA 4U0JA 1PTJA 1OC2A 2GN4A 2DU8A 5EJ2A 3EK2A 2OZPA 1B8UA 2VRCD 4L4RA 5JYEA 5A02A 4W7IA 4UVHA 3QWIA 4Z0TA 2VTDA 4EGFA 4E31A 2Q49A 1NQ5A 2QRJA 2Y93A 3W8EA 3FPLA 2ZKLA 4TQGA 4YCAA 4CM9D 1D4FA 3RBXA 3IKTA 1Y6JA 3PHJA 4NBUA 3UCFA 1NX6A 1ZK2A 4OM8A 4RPKA 1LC0A 4UREA 5JNLA 1DIBA 3AY3A 4IDGA 4UUPA 5KOIA 5MGBA 1C1XB 1P1KA 3DXFA 1LSJA 1X13A 1MUUA 1NBOA 1PQPA 1T2AA 2DPGA 3QQPA 1PJLA 1HRDA 4UAGA 1NFFA 4J7UA 5KJ6A 2VUTA 5I8ZA 2OL4A 1M66A 3JQ9A 2HK9A 2QQ5A 1ZH8A 3ZU4A 3G79A 3ICPA 4BGUA 4G5HA 4D7AA 2FPGA 2HJSA 4L0QA 4YRAA 5KJFA 2IZ1A 5BNIA 1GUYA 1I3NA 1E77A 5I9LA 3QJ5A 4CLHA 2J3HA 3GGOA 3NTRA 1XKQA 4P38A 4EUEA 5H82A 2BGKA 2GO1A 3KEQA 4CM9A 3DHYA 2HCTA 1IB6A 1X15A 1Y5RA 2FSSA 4GWGA 5I7VA 4JXKA 4CQMD 4IQGA 1Q7CA 3KYCA 3U4HA 4BUCA 4H7PA 3GF4A 4RPLA 5CHEA 4AJLA 4EYEA 3RC2A 3QWFA 1B15A 4MOWA 1HYEA 4JN6B 5BSEA 3DBHB 3P2YA 4PLCA 1EVYA 1U3VA 4FSHA 4IMPA 3QLJA 3GG9A 2NU7A 3HFSA 5CP8A 4FC7A 3DMYA 1AXEA 3NT5A 1Y8QB 4LVUA 2C7GA 1LQTA 3GRPA 3MWDB 3ONEA 5CG1A 4WEOA 5HS4A 1XELA 3HN7A 3G17A 3OIFA 2V6GA 3TOXA 4HFJA 4AJ4A 4OIMA 1B16A 1NM5A 2BI8A 5EQFA 3W4JA 3ADPA 1V0JA 4BNZA 1GAEO 2WD8A 4DTIA 1E7WA 4RZIA 5AXDA 4CQMA 3GDGA 4ZQGA 1CQJA 1DRWA 1JLLA 3R3JA 1ADBA 2LDBA 4XRRA 4P4LA 4BO9A 1AXGA 2J6IA 3OM9A 3QP9A 2Y99A 1G6KA 3IIEA 5K6AC 4HV4A 1CYDA 7ADHA 1Y5MA 4R1NA 1Q7BA 4U5QA 2UDPA 3O03A 3D5QA 1V9LA 4GGOA 3A4VA 3PEFA 3BAZA 1YB5A 3S1LA 1C0KA 2C7VA 4R51A 1W4ZA 4QFDA 4YQYA 2HUNA 4BNMA 1GCUA 1GZ4A 1HTBA 3P5SA 2VZ9A 3L6EA 3OQ1A 4BQPA 5DCYA 3DAFA 4ZA2A 4MVJD 2PZMA 5T57A 1DSSG 2HAEA 3RUFA 1N9GA 3ZV3A 2O4UX 4H15A 4B4VA 5JXWA 3OEYA 3TL3A 3BTSA 2E6UX 2W4QA 1Y8QA 4I9UA 1TLTA 3RUDA 1QKIA 4RVGA 4QFCA 3RUAA 1E6WA 3BMNA 4PLPA 2XOXA 1LX6A 1T24A 1RM3A 3H9GA 3Q2KA 1RKXA 2WYUA 4JNKA 2B4RO 4NNJA 1Y7TA 3GGPA 3DR3A 3JYNA 4ONEA 4WKGA 4CV2A 1V8BA 4ZHSA 2BF7A 3AW9A 3HADA 1G0NA 3D7LA 4Q3DA 4JJIA 4B8WA 3WJ7A 1IYZA 1HE5A 1Y9AA 2D3TA 3ABIA 2GZ2A 5L51A 1A9YA 2ZQYA 3MJ4A 4J7CA 4XB1A 5KJCA 2J3IA 4BB5A 4OOFA 3SC6A 4GQAA 1HEUA 2X9NA 1WDKA 1U7HA 1BSVA 2BD0A 3NKLA 4WUVA 3WYCA 1B8VA 1HLPA 4XGIA 4GGPA 2C07A 5BNFA 1VC2A 1KY5A 3VPXA 4EI2A 5AXBA 1ZMOA 3ROQA 3VH2A 5IAAA 4RV9A 1IPFA 1YONA 3WMWA 5IDWA 2AQIA 5HS6A 4PG4A 1VRWA 4II2A 3ROMA 4B4WA 3TZCA 3KYCB 3UF0A 2GZ3A 1QYDA 3HSKA 4QUKA 1C1XA 1JAXA 5G2OA 3KV3O 3QVTA 2HRZA 3G3EA 4B7UA 4XIJA 1NWCA 1J4AA 3BTVA 1I0ZA 1O6ZA 1KC1A 2P9CA 3JYPA 4IJVA 1LDBA 2EF1A 4OXKA 2FMUA 4BO1A 1U9JA 1D7OA 1BMDA 3L9WA 1WXDA 4IPTA 1BVUA 2Y1OA 2QZZA 3FSRA 3OICA 4NBRA 5HBRA 3GUYA 3FTPA 3NAQA 1YL5A 3BYZA 5GY7A 3ST7A 1F0YA 2VHZA 3GZNB 1EBUA 4L4XA 1O0SA 4HBGA 5F3RA 1MG0A 2DVMA 3BTOA 4TRJA 1P1IA 3VDQA 3UN1A 1N5DA 4M86A 5F21A 2JCYA 1H94A 2OORA 2PGLA 2Q4BA 4Y67A 1NPDA 4OO3A 4F6LA 3A06A 1IOLA 2GN8A 1VJ0A 3NYWA 3PWSA 2Z95A 4DGSA 2X8LA 3EZYA 4R5MA 2OFPA 1NAIA 3KLPX 4I8XA 3WSVA 3WNQA 4WCDA 3AY6A 4IZHA 1KEPA 4WECA 3LQFA 4DQVA 3BTUA 1KOLA 2CD9A 3ONDA 1R12A 4MPDA 4RVDA 4EUHA 3K5PA 5CPFA 3NTOA 3RD5A 4DPKA 2VYND 4CR7A 1B8PA 1H6DA 5K0ZA 3RUCA 1PS0A 2I67A 3NRCA 4AJEA 4CMIA 4A10A 2QG4A 3KHUA 1VJTA 4Z0HO 3DBLA 4A5OA 1GFSA 5IFLA 4MP3A 3ETGA 2IZZA 3EYWA 1U3TA 2WJPA 3FN4A 1ZCJA 3PQFA 4DA9A 1YKFA 1PJTA 4GAEA 1GPDG 1VLLA 5TF4A 3JV7A 1GCOA 4XYGA 2Y0DA 3LU1A 2ZTUA 2GNAA 1NQOA 1KERA 2VZ0A 2NTVA 5DULA 4MIEA 3K9QO 2I3GA 5F1PA 1Z7EA 1E7MA 4KQWA 3MZ0A 2P91A 1MV8A 4UUOA 4LVCA 3HDYA 4RDHA 4CMBA 4ALMA 2Q1SA 1O8CA 3AI1A 4FOOA 3PLNA 4DPLA 3KSZO 2BFOA 5BSFA 5JS6A 5KVSA 1QYXA 3K73O 3F5QA 3LSYA 4A2CA 6ADHA 4YA6A 4OOEA 2Q2VA 4LRSB 3EGOA 5FEUA 3SJUA 1A7KA 4BNWA 3VVBA 1Z82A 3FPCA 1CF2O 3DFUA 5COBA 3JYOA 3DZFA 3IAHA 2YYYA 3ORFA 3OJ0A 3HN2A 4AJ1A 1EEHA 5C7OO 2HO5A 1XWFA 3IQDB 1T1RA 3INGA 4HP8A 1X0VA 2GDZA 2ZIZA 3LYLA 2EWMA 3O8QB 2AW5A 4YJGB 3QY9A 1CEQA 1AGNA 3I23A 3WQRA 4RQUA 2Q2QA 3JQGB 2IZ0A 1QRRA 3CH6A 1YVEI 1VSVA 4J16A 2Z1NA 1DIRA 1T25A 1E6EA 2AE2A 4ZQBA 4ZJUA 5IXSA 1ADGA 1TT5A 2O50A 4XIYA 4B7XA 5JC1A 4ITUA 3KTDA 4Q3EA 2DBVO 4E5NA 3FRJA 4PLGA 4EZBA 3VDRA 1R0LA 3RU7A 1DRVA 3W1VA 5IF3A 1BRMA 2CDBA 4J3FA 4RVHA 5KJEA 1S7CA 1XQ1A 3T4XA 3L4BA 4N54A 3FHLA 4FFMA 4D42A 1E3WB 2HMUA 2FR8A 1QLHA 3GZ4A 4JLWA 4JBGA 4KDEA 3AUUA 1HDCA 3KETA 1YWGO 4M1QA 5L7WA 1UXGA 3LK7A 2CDCA 3WMXA 2VT2A 1HSOA 4GMFA 4KUHA 3DMTC 1YH3A 5JAQA 2EERA 2VWQA 5JDIC 3JQ6A 3U5TA 1K5HA 4BNLA 1BG6A 4R4JA 3AY7A 4RORA 3ZCXA 3RFXA 1HWYA 3D0OA 1EMDA 5GZ3A 1LBEA 3HHPA 1X7DA 3PP8A 4LGVA 2G5CA 3EHEA 3MJCA 1ISFA 1UAYA 3OHSX 3PZRA 1SOVA 1ZK0A 5THQA 3IOYA 1K6XA 3GR6A 4PVCA 2J5RA 4IGEA 1GQ2A 1OOEA 4IBOA 3U0BA 1L7DA 3DTTA 1OAAA 2FSVA 1ISGA 2Y1GA 2GSDA 1KY4A 1MP0A 4P8RA 5CAEA 1V6AA 4BB6A 1R6DA 3WFJA 1I2ZA 4D43A 3WTCA 1U4SA 1ZK3A 1HE3A 2O7QA 1T2FA 2RCYA 2TMGA 3E6AA 2NLOA 1GUFA 2PD6A 4DYVA 1JDJA 4L9RA 2Q50A 3I9MA 1XEAA 1YDEA 1FDVA 4NHEA 4DLAA 3X2EA 3JQEA 5TT0A 4UEKA 3HNPA 4CM8A 2NUAA 4HFRA 4P4GA 3JTMA 2RAFA 2HMWA 5JAMA 2IXBA 4L76A 2IDZA 4GX1A 4CODB 1TT5B 1PR3A 4LK3A 4WCFA 3GDFA 4NI5A 2RBEA 3KYDA 4G81A 1RJWA 3F6YA 4ALKA 2AG8A 1Q2XA 2EXXA 5H81A 2JFHA 2HK7A 1WAMA 1PL6A 1PZGA 3MTJA 4L73A 5ER6A 2PFGA 4FOSA 2Y67A 4XEHA 2OXIA 1DLJA 4OH1A 4AJKA 4G2NA 1HE2A 4Q39A 1SEPA 1MGOA 3OJEA 3WBBA 3V1TC 1LDEA 1P74A 3I83A 1DOHA 4BO0A 2GN9A 4FFNA 2OUIA 4YQZA 2GRAA 2DUUA 1EDZA 2WM3A 4YBZA 4K6FA 2DC1A 4L75A 3CE6A 1A71A 5TGDA 4RZHA 1RM4A 4G65A 5JW6A 1ZK1A 3FCOA 1XA0A 4J4TA 3I6QA 1YQDA 4DL9A 3C7DB 4QX6A 4E21A 3PVZA 1ZIDA 3DTYA 3LT1A 5HA5A 3U62A 3DB2A 2IYPA 2QW8A 4CUZA 4OL9A 4ZVVA 4CLRB 2OOSA 1KETA 2VNAA 1E7SA 3GC6A 4MO2A 1Y1PA 1SPXA 1U1IA 4GH5A 1U2DA 3JYLA 4WASA 2ZTMA 5COAA 1KYQA 4D44A 2XXJA 2DBZA 2YW9A 3HQ4O 2VUSA 3OJOA 4CMAA 4MP6A 5ICMA 3EW7A 1GADO 1HE4A 3C1AA 3GAFA 3PJFA 4IDCA 1E3EA 3TL2A 3C7AA 1XDWA 1AN9A 2GN6A 5G4LA 3OQBA 4W7HA 3PYMA 3QWHA 3VKVA 5BSGA 1PZHA 2IE0A 3GQVA 4YAGA 3E9MA 3QWBA 4ALJA 4NK4A 4BNVA 2AEJA 2B4TO 4QO8A 1M6WA 1PS8A 2NNLD 3PK0A 4IXTA 3AK4A 4QECA 3HDQA 3WQQA 3MCVA 4F45A 2ZCUA 1B7GO 3Q2IA 4GX0A 1P3DA 3JD4A 1C1DB 2NSDA 2O23A 3PWKA 4I08A 1TA4A 2ZTVA 3Q11A 4EJMA 5JCJD 3B20A 1EQUA 1ZXBA 5G4KA 2RHRA 5U4QA 2HDHA 3E03A 3M6IA 1LSSA 3U4CA 2B35A 3EUWA 5FYDA 3BMQA 2QYTA 4NDNE 2BELA 4ZRMA 3V5NA 4AICA 1ENZA 4OSPA 4XDYA 1L7EA 1WZIA 1BGVA 3JYQA 1R4NB 4YEDA 1DEHA 5DT9A 1VSUA 2OP0A 4JX8A 4RO0A 3JQ8A 1LI4A 3GMSA 1O5IA 3QVXA 4I5GA 3S2FA 4YPOA 1DFIA 4N18A 2BGMA 1EUDA 3AI3A 2D5CA 3TFQA 1JTVA 1FK8A 1U7TA 4CV0A 3K92A 4GI2A 1E5QA 5JCJA 3KYBA 1LDMA 2UUOA 3B1JA 1NHWA 1E1MA 4F46A 1Y8RB 4RF3A 2BLLA 3BZUA 1ZBQA 2X5JO 5FI5A 2ZCVA 1E92A 1A7AA 4J0EA 1SCUA 3AU8A 1T4DA 1LC3A 2CVOA 2X0NA 4JCOA 1LA2A 1BXGB 3JQ7B 4UVGA 5EIOA 3GAZA 2DFDA 1WDLA 4XQ9A 3AFMA 2X9VA 4Y9DA 1UP7A 1BTOA 2O2SA 4XB2A 2YHIB 3IMFA 3ANNA 4W9NC 1IHYA 4YJFB 5TX7A 1RWBA 3BMOA 4PG6A 3WGHA 4ZQHA 2FZEA 3BHMA 5JPIA 4BKUA 1GYQA 5CDGA 4OXNA 5EQDA 4ZGWA 3G1TA 1GR0A 4NQZA 1PS9A 1ISIA 1YJQA 3JQFC 5ILGA 1HSZA 2TMDA 4IS2A 4IM7A 4PLTA 4BNXA 1MLDA 2D1YA 4QQRA 3TZ6A 2VOEA 4Z0PA 3CXRA 1VL6A 2BFPA 1Z7BA 5ILOA 1XYGA 3IJRA 2RH8A 4ND4A 1VL0A 3WGIA 3EAGA 1LJ8A 4BKPA 3VPHA 5IDYA 5IN4A 1I24A 4ID9A 4NBVA 2VRBA 1JA9A 2AQKA 4NPCA 3T7EA 3VPSA 1NTOA 3F9IA 4PCVA 1GQQA 2EHDA 1GPJA 2X7HA 4PRLA 3UHAA 3S2EA 1CERA 3ETDA 2GASA 3DAGA 3GH3A 4WLNA 1YQXA 2C0CA 1HT0A 1R37A 5EN4A 2ZQZA 1GTMA 4ALNA 4E4YA 1N9GB 3ZWCA 4DC0A 1DB3A 3PWZA 4IDEA 1WP4A 1KC3A 2B69A 5FI3A 3VC7A 3KVOA 1HDGO 2X9GA 1ADCA 4K1LA 1UDCA 1ISJA 3GNSA 1CWUA 5L3ZA 4OKNA 2W2LA 3RC1A 2NU9A 3ROPA 2PZLA 1U28A 1ZW1A 2Q46A 4DIFA 1XHLA 1SB8A 2XPCA 5T67A 3ADOA 4MINA 3TWOA 5KKAA 2JL1A 3TRIA 2BHLA 1DIHA 2WYWA 3TFOA 2VUUA 2CVZA 1JQBA 4MVJF 2C82A 3GNQA 3I9LA 2GD1O 5A9SB 1XSEA 1UXKA 2CF5A 3L9XA 3ULKA 3V2UA 5IG2A 2I66A 1ENPA 4MIOA 4CQMB 3UFXA 3GRKA 5JO9A 5IZ4A 3CEAA 1QR6A 2A4KA 2DT5A 4KWHA 4DBZA 1LRJA 3H5NA 1DAOA 1EFKA 4ZU3A 3OJLA 1H93A 3K96A 3M2TA 3OIGA 2EGGA 3PHGA 4RL6A 5FF9A 4FGSA 5JLAA 2B0JA 3RKUA 4XZ3A 3L0DA 4RQTA 5LDHA 1B2LA 4ROSA 1B0AA 1PX0A 3GEDA 4R3NA 2Z5LA 9LDTA 4R41A 2A9FA 4I5EA 1DIGA 1A9ZA 3QVSA 4XKJA 3WYBA 4B4UA 4FFOA 4YAKA 2J5KA 1KVRA 1I5RA 3UICA 1TI7A 4NBWA 4EJ0A 3EZLA 3HZZA 5B4VA 2GCGA 1NVMB 4KTTE 3UVEA 5IZCA 3AU9A 4MKRA 4CJXA 4FJ1A 1RYEA 3GGGA 3OMLA 1GEEA 4NR0A 2NM0A 4L74A 4ZICA 1BVRA 2HJRA 4IDAA 3FF4A 3ZHZA 3C7CB 4OGWA 1I2CA 3FNHA 3RBZA 1QSGA 2P4HX 2YDXA 4M8SA 3D5TA 2BH9A 1NWHA 1VL8A 4PG5A 4HUJA 1GYRA 4B8ZA 5BQFA 1XU9A 5ENVA 1LLQA 1H9AA 1UH5A 5COQA 2ZB4A 1JWAB 3QE3A 1DDOA 4LSWA 3K30A 4BO2A 4BO4A 4MVJE 1F8FA 1GDHA 4R9RA 5C7IO 3F5SA 3CPSA 5L4SA 4MVJP 4CLOB 4A0SA 5JMWA 4RGBA 2RIRA 5C5IA 1WWKA 2NU8A 3GDOA 3F4BA 4LW8A 1QLJA 3RUEA 4II3A 1DC4A 4Y98A 4JJFA 4CL3A 4FB5A 3VVCA 3B1FA 3SLKA 1OI7A 1ZVMA 4AJ2A 3L07A 4EJ6A 2JD0A 3AWDA 8LDHA 2V65A 2VQ3A 4PZCA 1AE1A 3I9JA 1I3KA 4OJNA 3AOEA 2FRDA 3I9NA 3PXXA 1MC4A 4BO6A 3ZN2A 2JHFA 5HM8A 2QIOA 4M54A 4U6QA 5TSDA 3TSCA 1MXHA 3FD8A 4FN4A 2W2KA 4WNCA 2CSUA 1YBMA 2EJVA 2B83A 2NVWA 2WD7A 2XF8A 1ULUA 3ZWNA 2C5EA 1NR7A 3RUHA 5AYVA 1KVTA 4CM7A 4PLZA 2EKLA 4YT5A 2OHXA 3OFSA 4P4NA 1M2WA 2ILTA 1LDGA 3DWFA 4CR6A 3QWAA 1KVUA 3FNFA 3BMCB 4GVXA 1HDRA 5A5FA 5TQVA 2JD1A 3CKYA 2DFVA 2Q45A 3H8VA 4NZ9A 4WLEA 3WR5A 3FR8A 5L40A 4IIVA 3DZBA 1WLYA 2YQ4A 4Z6KA 4AJJA 1PWXA 3JQFA 3NEPX 3UGKA 2BMAA 3S2GA 1Y81A 3BXXA 4XYMA 4TROA 1N7HA 4K9DA 2PGDA 3FNGA 5A1TA 2PR2A 3PZBA 4LCEA 3PHHA 1SC6A 5I9MA 3GLQA 3NTQA 3PI7A 4CR8A 4Z3KA 3WTBA 1W6UA 3PDJA 4BKRA 1T26A 1ZNQO 4NU5A 3QW2A 5A9TA 4CM6A 3B70A 3GPDG 4B3IA 3NX4A 1MC5A 2ZB7A 4AG3A 1JVSA 5T6BA 5KNLA 4AL4A 3N74A 1YQGA 4BHTA 1Y9EA 2G0TA 2WMDA 3FBTA 5G0SA 4BNNA 4BNIA 1Q1NA 3SVTA 1VKOA 3PHIA 5LCXA 3H9QA 4BMVA 1F14A 1Q0LA 4YAEA 2IYOA 4WOKA 4E6PA 2H6EA 4BV8A 3GEMA 1MB4A 3GT0A 3JQAB 1NR1A 3I9OA 3PGXA 1H9BA 3KUXA 4UVDA 4NJMA 3VOSA 4YTEA 3RJ9A 1DRUA 2CMDA 1YRLA 2NV6A 4CMHA 2A35A 4Q3NA 4E3ZA 1H6AA 8ADHA 3FI9A 1ZSVA 1CDOA 1LDNA 4ND1A 2OBNA 4M87A 1J6UA 2C5AA 5TRTA 1QV6A 2QRLA 4R16A 2X58A 1VM6A 1WNTA 3ZU2A 4BGVA 4LISA 5CPBA 2EW8A 1J0XO 4K6CA 3R1IA 1HL3A 1BW9B 2DUWA 1Z75A 5F1KA 3KLMX 2NACA 3E9NA 5BR7A 1I3LA 4CMCA 2YFHA 4TRMA 3RCBA 5L53A 4R5HA 3INRA 2HLPA 4H16A 5F5LA 1NQTA 3SX2A 4CMKA 1FMCA 2EP7A 4YVFA 3DDNA 4NG5A 1D1SA 2Y1DA 4JROA 1UAGA 3RI3A 4IDBA 1IZ0A 2BRUA 2X86A 5HWSA 5EERA 4MIYA 3GNTA 3P2OA 1PL8A 4XYEA 3SJ7A 4BO8A 1N7GA 2ZB3A 4BNUA 2Q1TA 3AI2A 4IMRA 3W6UA 1YBVA 3JQBC 3RASA 4J2OA 1C0LA 3ZWYA 1GEGA 3G0OA 4TVOA 4CQLB 5TS3A 4X54A 4R1UA 1T4BA 1E1KA 2V6BA 4XA8A 2C2XA 5GMOA 2FPPA 1YB4A 3H9EO 4MVJM 1W8DA 4FS3A 4I9HA 3E9QA 3E5RA 1QYCA 1UXIA 3A9WA 3CZMA 3AM3A 1X1TA 5EMHA 4IUYA 2YFQA 5A3VA 4XQGA 3PIIA 2P9GA 3P7MA 5CDTA 4WEQA 4P22A 3BMOB 2VN8A 3HDHA 4YRBA 4N7RA 2YHIA 1F8GA 2QHXA 3DOJA 3WYEA 1E3SA 4E33A 5JFOA 1A5ZA 1DC6A 2D5AA 2Z1MA 1HYGA 5GZ1A 1E3JA 3PYXA 5ADHA 3MOGA 2QYSA 4ZRNA 3DO5A 4GKBA 4O5OA 1SBYA 2NQTA 1DJNA 3ASUA 1Y8RA 4FC6A 1H6BA 2VWHA 3ZWPA 3Q0EA 3OJFA 4H3VA 3HG7A 1NFRA 2JJYA 3K2EA 1BDMA 2E49A 1NASA 3OF2A 4DC1A 1E7RA 1C3VA 3EY4A 3ZWAA 4LMPA 1FDSA 1M76A 1LQUA 3ZHBA 1TVEA 3D4NA 4W82A 2J5QA 2VCYA 2WSBA 3AUAA 4XJSA 4EEXA 2Q1WA 3OETA 3TQHA 1WPQA 1YOVB 5JCXA 3F3SA 3JQ8B 4AJNA 4INAA 3GG2A 1Z6ZA 2PKQO 1EVIA 3GVXA 3TF5A 3RAJA 3BMQB 3O38A 4QO7A 3RVDA 2VHYA 1DPGA 3MJEA 1DO8A 5JAIA 4GVLA 3ZU5A 3D3WA 4CV3A 3IUPA 1ZJZA 1MG5A 1K6JA 2Q3EA 3GY0A 1GZ3A 1C1DA 3NGXA 2F1KA 4E5PA 1R0SA 4R69A 2XXBA 1TXGA 4U0KA 1YXMA 5KCZA 4W4TA 5TLSA 1XQ6A 4YXFA 3AM4A 1MA0A 4DBVO 4FIZA 4XJTA 4OHUA 5C37A 3M2PA 1P1FA 1A72A 1DC5A 1Z74A 2Y68A 1DFGA 3GHHA 1EUZA 3OH8A 4IJWA 4BNTA 4LSMA 3I3OA 3S8MA 1M6HA 5JSFA 1F06A 5JE8A 1P0FA 1IY8A 3PHLA 1NQAO 3H65A 2GGSA 3GFGA 5EINA 1QG6A 3C85A 1PGNA 4U6SA 4CLRA 2EG9A 4WPGA 4FGWA 4Y8VA 4DRYA 2JCXA 4TRRA 1P1HA 3RWBA 1EDOA 1ULSA 2EIHA 3W8FA 3R6DA 3PIDA 4GPD1 2POQX 1R66A 3U4DA 3CINA 3Q6IA 2R6JA 4N5MA 3UCEA 4HNGA 1BHSA 4J1QA 2CNBA 5KKCA 1GUZA 2EEZA 4S3MA 3QHAA 4FCCA 4IY1A 4YAIA 2UAGA 3NT4A 5KVQA 2YV2A 1U3WA 3MJSA 5JMPA 3TZKA 5A9RA 2OO5A 3OIDA 5I9NA 4J4HA 4Y6SA 4E32A 5DF1A 4TVBA 2VNSA 2OGUA 1ARZA 1MFZA 5LDGA 1JU9A 4YT4A 4IINA 3IP3A 2AEFA 4M89A 1OFGA 4DVJA 1ZJYA 1D8AA 3WWZA 1H6CA 1PL7A 1U5AA 5G0VA 2HQ1A 1UR5A 2JAHA 3G49A 3O4RA 4N5NA 4GL4A 4A7PA 1LU9A 1YOVA 2X4GA 4XCVA 2C2YA 2GLXA 1ADFA 4YB8A 5KVCA 1IE3A 1G1AA 4D46A 5HTOA 3WG9A 1LTHR 5ENDA 1M75A 4PLVA 4XQEA 5DBIA 4CLDA 1IHXA 2C59A 4WCFB 2YUTA 1X1EA 2B5WA 4OSOA 3PDUA 3TZQA 3E8XA 4ILKA 3D3WB 2JD2A 3LF1A 1ZUD1 3MEQA 3WOHA 4YAJA 4E2ZA 1ZSYA 4IDFA 3GVCA 3ANLA 1DAPA 2EV9A 3E48A 4PN3A 3AM5A 3GUCA 5DOVA 3BHJA 4BO5A 2YV3A 5TC4A 3R0IA 2Y05A 3NUGA 4BVAA 3WLEA 2O3TA 2CVQA 3EMKA 5CEFA 4A73A 2VRCA 5KIAA 1RM5A 5TNXA 3ZW8A 1GV0A 3ZHYA 2DTDA 1GZ6A 2JFFA 3BHIA 2B5VA 4Q3BA 4BNHA 3V2GA 3ZWOA 3M1AA 1ORRA 2UV8A 3I4FA 4YR9A 3HDJA 4F3YA 3DBRA 4BNKA 1G0OA 2X5OA 2BFMA 2I9PA 2IRWA 1I01A 2OBYA 1U3UA 3RROA 4XR9A 4FBGA 3D4OA 2O3RA 2IXAA 3HWRA 2V6MA 3ZWXA 3DMTA 3UW3A 3R3SA 4KZPA 3KXDA 2FPIA 2P2SA 3ZNOA 2AMFA 2PK3A 5EPOA 4AFNA 2AXQA 4BO7A 5DZSA 1U8XX 4I9NA 3VTFA 3A28A 1YL7A 2FHSA 3RFTA 4QTZA 5ITWA 4RLHA 3NT2A 4FFLA 5I8WA 4Y6PA 3JQAD 2WE8A 1ZZEA 5DNAA 3OEWA 3PRJA 2VHVA 5K6AA 1CRWG 4CQLA 2F00A 3LC7O 1N8KA 3ITDA 2FWMX 4PLHA 1JKJA 3H3FA 3PQDA 4D45A 3ZV6A 4AJIA 4J0FA 3ZHXA 1GYPA 1IL0A 1A27A 3SXPA 3NJ4A 3O9ZA 2E4AA 2I76A 4E13A 3CZRA 5JO0A 2YZ7A 1PIWA 1NXQA 4J6FA 5EESA 3VH1A 1ML3A 3IUSA 3WGTA 3I9KA 4NJMB 4YJGA 3CMCO 1WW8A 1LSUA 3PJEA 3ZV4A 3JQAA 2W8ZA 2FR0A 5F1OA 1BW9A 3WIEA 2W90A 3C1OA 5IDQA 4DIBA 3QVOA 5DOZA 4HNHA 3JSAA 1OZAA 2E48A 1B26A 3H9JA 3VPGA 2V6FA 1P33A 3UAGA 3W4KA 5CEJA 1UP4A 1B14A 3ZWMA 4OKIA 5JYDA 4MVJA 4ALLA 4RDIA 4O59O 3HUDA 1LRLA 3CMMA 5H83A 2P9EA 1SOWA 1E0DA 4WE3A 5CDYA 2EGHA 4GSLA 4CM4A 3UXYA 5CEEA 3DZIA 1DHTA 4O1MA 2YHUA 3S2IA 2ET6A 4FPXA 1HZJA 1UZNA 4FQ8A 1XCBA 1PGOA 5L7YA 5JDCA 1EE9A 5L4NA 1WMBA 2EJWA 1PJ2A 3COSA 4JK3A 3MOIA 2X22A 1I36A 5AOVA 4RVSA 2ZYGA 3WLFA 3KOUA 2NWQA 4B3HA 3VTZA 4PLYA 4K28A 1I32A 4WOJA 2GF2A 2DM6A 3PLRA 1JKFA 4MVJH 5IXYA 1T2EA 1OC4A 2PZKA 3C3XA 3U4IA 4PG7A 3WXBA 1O89A 1LRKA 2BI7A 1R4MA 3TDKA 4CLEA 2BFAA 5T8KC 2NTJA 3DFZA 3DZGA 4IS3A 2PGJA 3WGOA 1RYDA 3AJRA 2VYVA 4DYDA 3ZNNA 1T2CA 3OA0A 3GEGA 3JQ9C 1NPTO 2ZK7A 4ZD6A 1XR3A 3K2BA 3LC2O 1FJHA 3LT2A 1ISHA 4KP7A 3DOOA 2J3JA 2O3SA 4E2WA 1GL3A 2P5YA 3VH4A 4TZKA 1B3BA 2O7SA 2B4QA 1ENOA 4TRNA 5DP1A 4Z9YA 3ONFA 4J49A 1JW9B 4A26A 2X0JA 3AOEC 4LRTB 2RH4A 5CG2A 2DLDA 3ZNQA 3LLVA 3BMCA 1ZKMA 4WNIA 1PJSA 2X23A 1E7YA 3W4IA 3ZI0A 3RBVA 3WICA 1YL6A 4UUMA 2Y1FA 1EK5A 3IC5A 2QX7A 2D2IA 2O3QA 4NMHA 5FFFA 2R00A 3NDIA 2HK8A 2ZATA 2HMVA 2G76A 5B37A 1R15A 4EEZA 4PG8A 3OA2A 4GLOA 2D0IA 2VYVD 4R68A 1SNYA 4FDAA 3WJAA 3C1TA 4Z3DA 2DKNA 2W2KB 4B7CA 5A5EA 5JAZA 4NJOA 4DMMA 4CLOA 1U8FO 1P0CA 2Y0EA 3TN7A 2AQ8A 1XIVA 3AUSA 4IGFA 4GX5A 4HKTA 1EQ2A 3GZNA 3ENKA 5C3MA 1HYHA 1KVQA 2CDAA 4PVDA 3GVPA 4W6ZA 4E2XA 5JDIA 4PLFA 1DBVO 1AUPA 4LN1A 1PJQA 3I4CA 4E12A 1NNUA 2VHXA 2WDZA 4M49A 4OXYA 3RU9A 3T4EA 2I5PO 1TEHA 2VWPA 3ANMA 3D4PA 3KRTA 3OQ6A 1CIVA 1WMAA 2EKPA 1U4OA 2OP1A 4ESOA 4KWIA 3E82A 3TNLA 1PQWA 3SC4A 3I1JA 1UXHA 2QRKA 3W6ZA 4AJPA 5KTKA 2D59A 3GHYA 1VI2A 3JD0A 3FWNA 1ISMA 5A04A 3GN1A 1BWSA 1TT7A 3F4LA 5T8KA 1I10A 3F1LA 4DLLA 3ZW9A 2VYNA 3BA1A 3IJPA 3QA9A 1EK6A 1GV1A 4R1TA 4XGKA 2WTBA 3DL2A 4CMEC 1DHRA 4PFJA 1LLUA 4RPGA 2UVDA 5KVVA 4RVFA 4AJHA 1YGYA 1R4MB 1KEUA 2PKQP 2YY7A 2ZJ0A 3ZZNA 5L7TA 2PKRA 4KMSA 2AA3A 1H0KA 3QV1A 1KVSA 5IZCC 2Y66A 1P77A 1I3MA 1IULA 1E7QA 3KZVA 3EDMA 1PJ4A 4D3FA 4L4SA 3WBFA 5IDXA 1CQIA 4CPDA 3GK3A 3IKVA 1O94A 4GX2A 2PTGA 1DC3A 5A9SA 1NVGA 1SMKA 2C54A 2H9IA 2SCUA 3V1UA 3DHNA 3K8ZA 1QORA 4GBJA 4YDRA 3H9UA 4YT8A 3BMNB 1VJ1A 4ZQEA 3IDSA 4IJUA 3V1YA 1NFQA 3FR7A 3WB9A 2O2YA 5BT9A 4CM4B 3AOGA 1LUAA 2X0IA 4J1TA 4QSMA 4XYBA 5TJHA 3OP4A 4CV1A 1UJMA 3LLSA 5A03A 4BMSA 2VHWA 1JN0A 1K2WA 4N5LA 2W2LD 4J7XA 5GZ6A 1X14A 3IS3A 4FJ0A 4TWRA 3VKUA 3T7CA 1C0PA 2PNFA 3ETEA 2P5UA 1KBZA 5HRUA 2I99A 4J43A 3H6KA 2W98A 5MDHA 4MVJG 1FDTA 4WGGA 4MDHA 3C8MA 2DQ4A 4HX5A 3ZWWA 3CIFA 4GSKA 4IDDA 3ZU3A 1BXZA 1NPYA 3RJ5A 5CFZA 4DMLA 3DBVO 4FJ2A 3UKOA 4B4OA 1Q7GA 5L9AA 2ZTLA 1Q0HA 1O9BA 2NU6A 4Q3CA 3VPFA 4R1SA 3JD3A 4XYLA 4J9UE 2D8AA 3ICCA 4CLXA 4PIVA 4J1SA 5JBIA 1VPDA 4D3DA 1VE9A 2G82A 4QEDA 1ZO8A 3CTMA 3CSDA 3L6OO 4JJGA 4BOYA 1EBFA 4JQCA 3PJDA 1PJ3A 3QRWA 4I5DA 3VZRA 2O48X 3PJGA 4C4OA 4MKXA 3SBOA 4D0SA 1HZZA 2HU2A 3L4BC 3P19A 2UUPA 2I65A 1V3VA 2J8ZA 3KBOA 1W73A 2D4AA 3DBHA 1ONNA 4CMEA 4JBIA 3HB5X 3KM0A 4NU6A 5FWNA 1IPEA 1V3TA 1HDZA 3VAZA 1K6IA 2X5KO 1XGKA 2PH5A 4WLVA 4CUKA 3KSUA 1AHIA 4F6CA 3DQPA 1XG5A 2WEKA 2G17A 5DP2A 4YJFA 2X0RA 4R3WA 1HF3A 4NFHA 1XLTA 1EZ4A 4IZIA 2FY8A 2C20A 4YT2A 4HWKA 2J3KA 2DTEA 4FW8A 1BXGA 2CF6A 1YDWA 2O3UA 4WCFC 1FXSA 1I33A 4DQUA 4QXMA 2O3JA 3RIHA 3VZPA 1JAYA 2QZ9A 3V2HA 3LT0A 1LSOA 3JQDA 2HRBA 3LVFO 1LNQA 3JQCA 2CZCA 4R01A 4IJKA 3VH3A 1K89A 4HADA 1JVBA 4XD2A 5TJ9A 3RQSA 1N2SA 2FN7A 3D64A 3H2SA 1B3RA 2DPHA 4IXWA 4BL5A 5ICSA 3ITKA 1WDMA 3DBRB 4R9SA 1HDXA 2CUKA 3CUKA 2B37A 1UP6A 3NDRA 3PFFA 5KWEA 1U2GA 1HKUA 4CUJA 1T1SA 1GY8A 4NFSA 1YO6A 5ES3A 1BDBA 4I5FA 1DLIA 3WGQA 4FD3A 4BKQA 1A4UA 3ZWBA 4XRGA 3QVWA 4DQXA 3V8BA 1C14A 6LDHA 2R00C 3JQ7A 3U9LA 1HDOA 5TIIA 4J9VA 1SO8A 4EUFA 3D1LA 5IN5A 4D41A 5JY1A 3JCZA 2GYYA 4YJDA 1X7HA 1PQUA 4CM1A 4YRDA 3HJAA 4HXYA 4UVEA 4YWJA 3ZGYA 4E0BA 1UZLA 2AHRA 4Z9FA 3H2ZA 4S1VA 2PWZA 3ZH2A 1F17A 4JP2A 1N92A 3TOZA 2P68A 1Q0QA 3QSGA 4GMGA 3INTA 3IP1A 1SEVA 4UUNA 4J4BA 5G0TA 4YACA 2NVUB 1JKIA 3UH1A 4BO3A 1F12A 4BNFA 3IL2A 2JKVA 1XU7A 3ZWVA 1R4NA 2YQ5A 4RPHA 1GD1O 1DXYA 1YS4A 2XAAA 5JY6A 3WIDA 4M55A 3W8DA 3Q9UA 5DBFA 4D79A 1X7GA 5U1PA 1QYVA 3A14A 4Q9NA 3K6JA 3ON5A 5G4KB 3WSWA 4TKMA 1HDYA 4DIOA 2WWRA 4AVYA 1E3LA 5THKA 4R54A 2PD3A 3DZHA 2O4CA 1I30A 2A92A 4A03A 1VKNA 2VZ8A 1J5PA 4UULA 2AQHA 5KJ1A 4UVIA 5BNTA 5JDCC 1E5LA 2Q4EA 3PTZA 5F5NA 5L95A 2ZJ1A 1K0UA 4LCJA 5TT1A 4RF2A 3GPIA 4O6VA 1ONOA 1NVTA 4BNYA 1DFHA 4O0LA 4OQZA 7MDHA 1UZMA 3LT4A 4NFYA 3GFBA 1GQYA 4ZN6A 2HSDA 4DREA 3H5RA 1UUFA 2NADA 1QP8A 4WLFA 3C24A 2UYYA 3DZKA 4J1NA 4FR5A 3GOHA 5T5QA 3LZ6A 3WGZA 4KOAA 1QYWA 4WLOA 9LDBA 4IQ8A 1CETA 4LMRA 3KEOA 5I7SA 2BGLA 2R2GA 2DAPA 4JBHA 2JCVA 3PYLA 5DCWA 4Z9XA 2Q2WA 5AVOA 3H7AA 1H5QA 2PV7A 3G1UA 2VT3A 4B79A 1FF9A 3H3JA 4DUPA 3WS7A 1PWZA 3A1NA 3ASVA 3GVHA 4J90A 3RC7A 2A94A 1KS9A 4FFPA 2PLAA 5DN9A 1PGQA 2Q99A 2Y1EA 3DONA 3ROKA 2H63A 3FWZA 1I8TA 3KYDB 3Q3CA 4RF5A 3WDSA 4ALIA 4J91A 2AG5A 4J2HA 4XR4A 4FFRA 3PQEA 1DIAA 4KDFA 3DZJA 3ZV5A 1PR9A 2FP4A 5T64A 4HFNA 1K3TA 1EVJA 2V7PA 2YV1A 1QXSA 4CM8B 4D0RA 5BSHA 1LLDA 1YBAA 1PEDA 1BXKA 1UDBA 2JHGA 3NDJA 3FTNA 3KO8A 3HE3A 4NK5A 3DAPA 4GKVA 3Q9NA 4ZQFA 3ZDFA 2CY0A 1IUKA 3KSDO 4W9NA 2C29D 4MVJI 4BNGA 2H1SA 3GVIA 5L4LA 5L45A 3I52A 3D3EA 3AUTA 3NV9A 3RFVA 1HXHA 4ND3A 4PZEA 5EL0A 2PA3A 3DHEA 2FR1A 2JAPA 1ZMTA 4CL8A 1FDUA 1ZSNA 2GUGA 4BNJA 5IJZA 3H4VA 4XDZA 4CMJA 2DTXA 3HB4X 4C7KA 4YJHB 1OMOA 3PGJA 2Q1UA 3Q1LA 1NHGA 3N58A 4CMGA 1P9LA 4KQXA 4OAQA 1HETA 2OMEA 2HKIA 5AQ1A 3WFIA 3O26A 2DBRA 4MKZA 4XWYA 4EDFA 4B3JA 5AXCA 3OBBA 3MJTA 2I6TA 4Y6RA 3X2FA 2RHCA 1AHHA 1PJBA 1O95A 3GN2A 3HFGA 4L8VA 1E1LA 1HLDA 1LLCA 3KB6A 3RUIA 3STHA 1ID1A 3VZQA 4TSKA 1J49A 1E1NA 4UEOA 1C0IA 1ZFNA 3AFNA 4DWVA 4E5MA 3WQSB 2BKAA 3DOCA 1WZEA 1ZXLA 3ENNA 5A06A 2YJZA 2DBQA 5J23A 2VTEA 2EW2A 3WGYA 2AEMA 4TKLA 5ER9A 3UUWA 3PFWO 1EUCA 3RSHA 2G1UA 2ZYDA 1CJCA 1ENYA 2PH3A 3E5MA 1E3WA 4URFA 5B4UA 2NVBA 1LDYA 3MJVA 2IEBA 2X1HA 1RM0A 4NH4A 4TMFA 3FBGA 3LF2A 4NBTA 4E2YA 1Z73A 4PRKA 2WE7A 2Y1CA 4YJHA 2GR9A 1A4IA 4Q3AA 1RPNA 2ZYAA 4RCVA 3K31A 2E82A 5DDIP 5CDUA 3BIOA 1P1JA 3L6DA 2GZ1A 2FOIA 1ZEMA 4KTVE 3JD2A 4KUGA 2I3AA 5A4DA 1WVGA 1NP3A 4D3SA 1E6UA 3EVTA 3M1LA 3ZNPA 3DEYX 4WLUA 5DCUA 4GLLA 5A3JA 4XGNA 2LDXA 4RLSA 4BS9A 5C7LO 1R16A 1PSDA 3VZSA 3UCXA 4EITA 1UXJA 3GMDA 1UDAA 4ND2A 4HY3A 5G0UA 1R0KA 4E30A 1OBFO 3TJRA 3B6ZA 4O63O 3EC7A 4BMNA 5B1YA 4KUEA 3SLGA 1EVZA 2GERA 4E5YA 1LXCA 1M67A 3LC1O 3MTGA 3F47A 4JP3A 2CFCA 2IEDA 1L1FA 3GA0A 3OSUA 3L77A 5I7FA 1MFPA 3JD1A 5JC8A 4DXHA 1ZK4A 4HFMA 5B12A 1NAHA 1KEVA 1ONPA 3JQGA 1D1TA 3WWYA 4BKOA 1SB9A 4GWKA 3MWEB 4IQ0A 2YDYA 3UOGA 5U9CA 3B1KA 3WX0A 3F46A 3O8QA 4RPJA 3VHRA 4BIIA 1H2BA 3WNVA 3TZHA 2H5LA 4AJOA 4TZTA 5I7EA 2JFGA 5DBGA 4EBFA 4RJTA 1NYTA 3I5MA 3QIVA 5K9ZA 3NJ8A 2NTNA 2EKQA 3U09A 4U7WA 2PY6A 3SEFA 4PGFA 4E5KA 1V35A 1YE3A 1I2BA 2HMSA 4OQYA 3RC9A 4PLWA 4WK6A 4U8GA 2VOJA 3U3XA 1P1RA 2NQ8A 1YB1A 2PZJA 1N1EA 1PGPA 1S6YA 4NIMA 4PZDA 4CMIB 1KIFA 4CM5A 1P44A 2IODA 3E18A 1ZEJA 4UEJA 4C7JA 4W99A 1TB4A 4XX0A 2Y0CA 5B4TA 1P45A 3FNEA
chains in the Genus database with same CATH superfamily
2WTAA 3WGGA 4E09A 1GQFA 1QB7A 2JA1A 2EP5A 1MNAA 2AE1A 4FMBB 1ZJ4A 4MP8A 3DL4A 1SXHA 5A05A 2OXEA 2YY5A 1WOYA 4I1IA 4V0KA 2PMWB 5CGZA 4AO7A 4HCJA 4CM3A 1SG9A 1TVKB 3WRYC 4PYKA 5AVUA 5EJ7A 1UPUA 3A3OA 3D6TB 3IQHX 4RVUA 4EW6A 2IUEA 2IHJA 4TYNA 4B3SB 1G7SA 2W6ZA 3A2NA 3ET5A 3I92A 5ESDA 1B0ZA 2ZB8A 4QAQA 3E7XA 5CUQA 5AM3A 3NGLA 5A5GA 4F3TA 3B9BA 2EG5A 1YASA 3NYRA 4ND5A 1DINA 4AN1A 1JFLA 1LEHA 2FSFA 1QV7A 3T1OA 4J7AA 1SJ9A 2GEFA 4DUGD 1PZEA 2PD4A 1J8DA 3DKKA 3TPCA 5AXAA 2LTAA 4LYEA 1XMIA 4MMXB 3KSMA 5AW1A 4FDLA 5I4CA 3AHFA 3NHAA 1KEWA 1V11B 3OUZA 1AKUA 4IIUA 4JIGA 3RS8A 3LDHA 2XYHA 1T2DA 3V4LA 5TE9A 3FX2A 3EFEA 4LVNA 5JD3A 1F38A 3IJ5A 4CM4A 4DLBA 4KOEC 4ITVA 4AZ3A 2ACKA 1DAFA 2JJMA 3AF5A 1NVVR 2V5AA 2ZRNA 1O58A 4BQRA 3U49A 3V4FA 2QORA 5J58A 1LH0A 1JKXA 1PTJA 2GN4A 4MQ5A 4C03A 2KX7A 3PQ8A 1YAJA 3KVRA 5TR9A 1XO1A 4XD7D 1FJXA 2XBMA 2P0AA 1HC7A 5IKOA 3EK2A 1XVVA 4L9AA 2VRCD 4L4RA 5C1PA 5JYEA 5A02A 1CUFA 3GJ3A 3H2KA 5GAJA 1JRLA 4E31A 4IF4A 4IDNA 5DU2A 4G4IA 1CZKA 1NQ5A 4MUXA 3D8TA 3FPLA 3FZGA 2QUKA 2ZKLA 4Q9HA 4CU2A 4CEJB 2IS1A 4ICIA 1D4FA 3IKTA 2NXCA 3PHJA 4NBUA 2I1QA 1N6PA 3SS7X 2V97A 1ATIA 2YJTD 2XCTB 5JNLA 3FCCA 5E2AA 1DIBA 3AY3A 3I8SA 1SKAA 4IDGA 3B9QA 4UUPA 2OCAA 4D80A 1WCV1 3S1SA 3DQQA 1KDPA 1LSJA 2JASA 4O1IA 3T9DA 2PO7A 5AJXA 1NBOA 1Q2UA 5JVDF 3QELB 1NFFA 5H70A 2HMYB 1RXYA 4UATA 2VUTA 1VHLA 1QV9A 4PSKA 4XVHA 3AUYA 3H19A 4M7PA 3NBZC 1GNSA 4LQLA 5T6MA 1UKCA 2QQ5A 1ZH8A 3AJ9A 4DGQA 3EX7C 1N78A 2JBHA 4D7AA 2FPGA 2HJSA 1FY2A 3A1WA 3K0EA 5I9LA 4RCZA 4JI4B 3GRFA 2OCIA 5CB4B 1XKQA 4P38A 4EUEA 3KPVA 2BGKA 4I19A 5LOVA 1OXKB 1IONA 3DQZA 3ET4A 2QU7A 1J33A 1IY0A 2N75A 5K03A 2VZLA 4I6EA 3DPUA 4QUBA 2JI6A 3OFJA 3KQKA 1E4YA 3LW8A 4HN2A 5I7VA 5JZBA 3S8YA 3ESYA 4CQMD 3A9TA 3KJIA 3L7LA 2GETA 3K16A 3B52X 3BJEA 3DPIA 3KYCA 4IQGA 2MOKA 4H7PA 2XNKA 5CHEA 4OHVA 2MR6A 5BYBA 2VTKA 1MCZA 4RLFA 4EUKA 1HYEA 2J1LA 3DBHB 4PNEA 4G0VA 3K9BA 4GMHA 1SD5A 1VPLA 3HFSA 4R0NA 5CP8A 1Q14A 4OHBA 4GZ3A 4KN5A 2C7GA 2JGIA 1LQTA 3GRPA 4YRZA 5CG1A 1ABFA 4QOGA 1RHMA 5F51A 4FEAA 4DJTA 4BVEA 1YI1A 1SU4A 1GSIA 2V6GA 3I53A 3WLOA 4HLQB 5LZ5A 1RKUA 3OTWA 4RANA 4UM9B 1B16A 3EZXA 3M6FA 5EQFA 3TBHA 3DF9A 1V6CA 4D5GA 1FW8A 3ADPA 7REQB 4UARA 2A9VA 4D9BA 4ZU1X 3T7IA 1I6KA 2VK1A 3A10A 4OFWA 2VF2A 2V1XA 4R7GA 4RPIA 5CA0A 3RJZA 4DTIA 4DCNA 2VPZA 1TF7A 3E3LA 3V4SA 4CQMA 4NCHA 3SC2A 3GDGA 4PM4A 1J5EB 1CQJA 1J1UA 4CEHA 1JLLA 1RE0A 1ADBA 1ZYUA 5PNTA 2LDBA 3A2KA 5EE9A 4B76A 4BO9A 2J9RA 1M7GA 1AXGA 4Z2YA 1PW5A 3OM9A 1Z4JA 3IIKA 3QP9A 1G6KA 4PPQA 4GXNA 4TQUS 3T3MB 1WXFA 2VPQA 3PFNA 3UKJA 3V8VA 3J80A 1K97A 3GJSA 4OV6B 2AOVA 4GGOA 4XOUA 3ZE6A 3PEFA 4JA0A 5AVSA 1SKQA 2EP8A 1HFJA 1W4ZA 3PGVA 1FX0A 5JS1A 2HUNA 4H4CA 5C8YB 1SBNE 3P5SA 4BQPA 1XOIA 4FR2A 1ESDA 1S3GA 1SVIA 3WV4A 4MVJD 1QFYA 2PZMA 1NM5C 4NYMR 4UM9D 2TECE 4YNBA 5T57A 1CVRA 1KKLA 3HMQA 4KO4S 1U9IA 4QNNA 2IZ5A 2XT6A 3ZDCA 4R3UC 4WMLA 3KPUA 4H15A 4XPIA 1XEWX 3TL3A 1OWNA 4KFUA 2B78A 1Z33A 1J20A 1Y8QA 1JG4A 2W4QA 2Z58A 4F5ZA 1XRMA 1A2KC 2XWPA 4PLPA 4TL7A 5LNK6 3LXMA 3IV9A 4FM9A 2ZJ6A 3IURA 4EH1A 1RM3A 2O2CA 2LNDA 3AF3A 3H9GA 3NVAA 1RKXA 5A6SB 5JCOC 1Y7TA 3H4MA 3CB4A 4ONEA 4WKGA 4ZZ0A 2BF7A 3NC0C 3AW9A 3C3BA 2AR7A 4PQFA 3TLGB 1I6LA 2OQRA 3VC3A 2AC7A 2FVYA 5L51A 1NVWQ 1I7LA 4JBXA 2GZRA 2ZQYA 3CJQA 3LDUA 3A9RA 2IDMA 1C2TA 2H59A 2WUEA 1HT1E 4HYYA 3EPKA 4GZLA 1X74A 3H9CA 4UFPA 4K3UA 2R1TA 4KREA 1GCAA 4OL0A 1THGA 1KAHA 3ADKA 2C07A 3MUFA 5U4XA 2YOHA 3VNBA 2CL7X 4DIMA 2B1JA 5C4IA 4DB4A 2G8LA 2NO4A 4UU1A 2KYRA 1IPFA 1IBRA 5BW4A 5CB4F 2AQIA 2LP4Y 2OG2A 2W6OA 4PG4A 5D85A 2JPDA 3DO6A 3MSCA 2WQ7A 5K2MA 3KYCB 1DDIA 1YU9A 2GZ3A 4R7ZA 2D0PB 3PVCA 1CUCA 1C1XA 2I4TA 2P9JA 2XB6A 2ZT7A 3QVTA 4NYJR 1VBFA 4P53A 4PC2A 4XIJA 4NWIA 5FX2A 5HOEA 1J4AA 2GWRA 4ZZ1A 3KOMA 3VX4A 1JIVA 2GBGA 1U0HC 1I0ZA 2P9CA 3E2MA 4IJVA 4TYQA 1TKCA 1LDBA 1X92A 4MPTA 3QYJA 4JOSA 1NBWB 6Q21A 4IMIB 4OXKA 3T9EA 4ID3A 4P32A 4BO1A 1COZA 4IDHA 4FBMA 3L9WA 3L4KA 1ECFA 3GO4A 4ZOLF 5FLEX 1A9SA 1XB2A 4D9NA 5HBRA 4PAGA 3KZ1E 3GUYA 3K0CA 3OURA 1ACLA 3HVJA 4LRXA 4O5AA 1Y7IA 2BUAA 4JV5B 2XKJE 4C4AA 1VG1A 1ZCAA 2XYVA 1F0YA 3EFOB 4XEUA 4OJMX 4EI2A 4XVUA 1HY3A 3NTVA 1YCGA 4L4XA 2GZAA 1TM1E 1LLFA 4LFCB 4MJ3A 3CVOA 1E94E 1G64A 3L84A 5E6RA 1R10A 2Y2VA 1W44A 2GEVA 3AX6A 3TSOA 3EEQA 3BTOA 1DBSA 3VDQA 5HR5A 4YCMA 3TB6A 1WUIS 2I9KA 4X97A 1CRPA 3DLTA 1ACMA 1L6RA 2PGLA 2WFAA 3TD9A 1CUSA 2NO6A 4LJ6A 4LZZA 2PU7A 4MPJA 2ONYA 3OOSA 1GTL1 2GD2A 1PYDA 4OO3A 2I29A 2YJ5A 4FFDA 4M46A 4P3YA 2I33A 4PX3A 3NYWA 3CNQS 3PWSA 2WUFA 5FULA 1K63A 4LKRA 4DGSA 1P6UA 5EZSA 4IZ6A 4EOGA 3BD6A 2DXIA 1VA5A 3KD2A 4KYUA 2BEKA 1T1GA 1UMBB 2QM8A 3WSVA 5JIBA 4IVRA 3WNQA 4WCDA 3SMVA 2RCNA 4IZHA 3K9FC 1KEPA 1R9GA 1Z4OA 5LPNA 3LQFA 1K7CA 3FF1A 4KQ6A 4M53A 1KOLA 4ZOCA 4DQVA 5KAPA 4RVDA 1AQJA 5IJWA 3OTHA 2YRFA 2XUAA 2BC9A 2B1QA 2OBFA 4M0CA 4EUHA 4AF6A 3KKEA 1R8XA 1VP3A 3EXHA 4PY2A 1QU3A 2XADA 3WHLA 1AS2A 4CR7A 4EKEA 2WMOB 3VDMA 2ZRDA 1E2FA 5KWSA 4D02A 4JQSA 2JGEA 2FR8C 1TEXA 2ES4A 2GPAA 1YRHA 2WF8A 3RUCA 4P3PA 3WXBA 1X7XA 2XUGA 1NXPA 2I67A 3BX1A 3NRCA 4AJEA 4ARZB 4CMIA 5IZCA 5K4GA 3OAAD 3T3HA 2XQFA 4R2MA 4KN6A 4E88A 2IZZA 3QOWA 4DHEA 4JEUA 3FN4A 3OZBA 1ZCJA 2ILVA 2NN3C 1JQKA 1H2EA 1PJTA 1GPDG 4G0XA 4B2LA 3ZD7A 3JV7A 3C3WA 4EP1A 3NASA 3CPEA 1ITZA 1G5FA 1NQOA 4WCVA 2H3EA 2Q3DA 2NTVA 3G2MA 4Q3LA 3VR6D 3CT4A 4B35A 3ZCVA 1UOEA 2CNOA 2OC9A 4KIJA 3HCDA 3QNWA 4MIEA 4EW1A 3O4FA 3CVJA 1QRSA 2I3GA 1EB8A 4KQWA 3P0EA 3FYDA 4EG8A 4PAQA 3PFHA 1QHXA 4GGMX 4JS0A 3MT8A 4MW9A 4B6PA 4EFKA 2QMEA 2BFDA 5HM6A 2O0KA 2ERCA 1K6EA 3EZ2A 4LVCA 2WU1A 4RDHA 4D4KA 5BNZA 5K8TA 1KQGA 4ALMA 5SYAA 2WM2A 2Q1SA 5LFAA 1E60A 2BHRA 3VR2A 3KSZO 5BSFA 2NO0A 1EK0A 3N75A 5KVSA 1J70A 3OX1A 4DNPA 4X64B 1Z0AA 3LSYA 4A2CA 2CV0A 3J7AC 2MDTA 1WVIA 2YZ2A 2OWDA 6ADHA 1SZPA 4YA6A 2AK2A 3UATA 4IKPA 1A7KA 1NJFA 1Y63A 3I42A 4YCLA 1D6JA 3OCCA 3WKAA 3UEOA 4Z9BA 4RENA 2RGCA 3C3DA 4FGKA 2QTVB 4A16A 2BGNA 3E35A 4RNDB 1GNTA 4JLOA 4KXFB 1KSFX 3V8NA 2R0QC 3OJ0A 2HH9A 2O0JA 4H7IA 4KW7A 3OUTA 3LPDA 4C76A 5DYGA 2VSFA 3AFIA 3BGWA 2BFCB 1RCTE 2JLQA 4CDNA 3LD9A 1F8XA 2MT9A 3LCCA 1X0VA 3OX4A 4HP8A 4YS6A 3NHWA 1POWA 4FHGA 2H48A 1NN3A 2EWMA 3OT5A 3O8QB 2AW5A 4OHPA 4YJGB 3N6XA 3SXUB 3VU9B 3QY9A 2CLEB 1V8FA 3MWEA 5D3MA 3I23A 3RU3A 3RVKA 4GYJA 3WQRA 2OBXA 2NUPA 1UJ4A 4RQUA 2Q2QA 2QTAA 3CH6A 3C1UA 4ER7A 5CVCA 4DANA 4PZZA 2IPAB 4REQA 2VC2B 3PUIA 3DKIA 4GPAA 4K9LA 4JLDA 4FE3A 2N47A 4EF4A 1V2GA 2QI9C 1ADGA 1TX4B 3WNZA 1TT5A 1L7AA 1X1SA 2YCLA 1JQ3A 1NVBA 1PDWA 1ZVJA 4I4TB 5JC1A 2EYQA 3DXZA 5F2NA 2DBVO 3ZE0B 2QX6A 3PC8C 4QL3A 2OBLA 5BSKA 2CDBA 4RVHA 5KJEA 1S7CA 3JAKA 1H2WA 4HQ6A 4N54A 1NR5A 1KO4A 4FFMA 3WGVA 3ACDA 2XZPA 4BLTA 5J2UB 4DR2B 1VJCA 2A59A 3GJXC 1MGPA 4M1QA 5HE9A 3RANA 1QNLA 4JB8A 1GA6A 2BEUA 4W8HA 2RD2A 3CVYA 3MD0A 2PS9A 4BLUA 4ZDWA 2EERA 2VWQA 5JDIC 3JQ6A 3U5TA 3FHCB 1VFNA 1R64A 2MJLA 4Y2VA 5FFMA 4BNLA 1BG6A 4E5UA 5FBVB 2R7LA 1QGUA 3HVHA 3RFXA 3T5DA 1HWYA 1ZD9A 2H65A 1EMDA 4AKHA 3CIOA 3KB8A 1D7AA 3M9LA 2IZ6A 1K4YA 1LBEA 4C14A 4CT0A 4UMVA 1NE2A 3EHEA 4EB3A 3MJCA 4BJ1A 1MJHA 5FI1B 1W5SA 1UAYA 1E0KA 3GW8A 3OHSX 1X2EA 5KINB 1SOVA 3NC4A 4HGQA 3FYTA 4QULA 4F5DA 4F1WA 2IX9A 4X8MA 1OBOA 1VLQA 3T9AA 2J5RA 1J5XA 4OI1A 4B81A 3EQZA 2QAGC 1L7DA 1ETHA 3ZLVA 4AWXA 5EQTA 4B87A 3PX7A 5B1EA 1KFBB 3CX3A 1B73A 1HQCA 1UBUS 2J5XA 4OQDA 1ZY2A 5TARA 1YQWA 2H31A 5I7RA 1MP0A 1UZUA 4ERXA 4US1R 1V6AA 4WZBA 1MABA 1RKBA 3U61B 1RJFA 3IT1A 3WFJA 4V3BA 4D43A 1JI3A 3EQ8A 4ZVQA 3ILXA 1Y4UA 2YJ4A 5ADUS 4B3DA 3VISA 4ZYLA 1JE1A 4IJ5A 4HD8A 4W8GA 3QMPA 4Q1VA 5AHKA 1CVLA 2TMGA 1XDDA 3SZMA 3LHKA 1HA3A 2JLXA 2RGYA 1RABA 3EBPA 4DJEC 1V25A 1G3UA 2Q50A 1D6NA 1YDEA 2RGNA 2R62A 3I9MA 4KBYA 2B3TA 4AZ0B 1E9BA 4DT1B 3ILYA 5TT0A 2WU4A 2ZRJA 4P4GA 4DLTA 3JTMA 4NESA 5LBUA 5JAMA 1SKYB 4L76A 5LKAA 4GX1A 2BP7B 3HI6A 2DCUA 1E9DA 1WS6A 4CODB 4TLDA 2HGSA 1G4AE 3GFOA 3GDFA 3KL2A 4NI5A 4NV3A 4PTLA 4G5OA 1AMOA 5IRCD 3K71B 3ZGZA 4RXUA 3RK1A 1QAOA 3FFBA 3VR5H 2YZMA 5K0TA 8ATCA 2JZOA 1F2TB 1XDUA 2AG8A 2REQB 2EXXA 2WRZA 1MX1A 3G0DA 1KRWA 1A8PA 4OHRA 6REQB 1ZPDA 3OE5A 4L73A 3F90A 5KSOA 3KEFA 5ER6A 3H5WA 4FOSA 1E4VA 1XV5A 3NVDA 5AKZA 4G84A 1IBMB 4XEHA 1DLJA 1R5JA 2ATEA 2WZQA 1M9NA 4OH1A 4OK3A 4G2NA 4R1OA 1ULTA 4C21A 2G1PA 1S2DA 1SEPA 2Z30A 3OJEA 3IXQA 1A69A 2VDQB 3P5BA 4B7ZA 1DOHA 1PNQA 3QKSA 1T10A 1T3GA 2AFHB 3Q1KA 1WEHA 4IFIA 4CBVA 1FJGB 1IIRA 1BC5A 2NTEA 2QIPA 1MAAA 4IOMA 3UB2A 1EDZA 4YBZA 5ES4B 1FU7A 5CA0F 4LBYA 2NVOA 4QUHA 5AI5A 3TZLA 3F67A 1Q57A 1UC4B 1RYNA 3LWDA 4RJ2A 5C7YA 1ZLYA 3G6WA 4I0WB 2IV3A 2IXGA 1ZVVA 1RM4A 2C4WA 1SUDA 4E5DA 4O08A 4XUDA 3LUPA 4BFCA 3GD5A 2A0UA 4DL9A 4Y30A 1YE8A 1C9DB 1H42A 2J0UB 2C4KA 2H8KA 4G9GA 4URHA 4DABA 1H3FA 1QM5A 1ZIDA 5TV2A 1ZUNB 2QENA 1WUJS 5HQ3A 3KKKA 2R79A 2VFAA 3DEIA 1MO6A 5BSRA 5IKXA 5AD1A 2QW8A 3V32A 2WAAA 2ZUSA 3AEQA 4OL9A 2TRSB 2OOSA 1JHDA 4BASA 1E7SA 3IKJA 1Y1PA 1YZVA 2F7SA 1ZNXA 3JYLA 2R86A 1W5AA 3EARA 2DFPA 2ZSJA 3CF0A 4WASA 2XXJA 1T4GA 3CF2A 3QPAA 5B3LA 3IR5A 1C8BA 2VUSA 3OJOA 1Y48E 4OAOA 1R6TA 2PRZA 2G1KA 1HE4A 3PJFA 5FBWB 3VJLA 3WMFA 4ZI7A 1EH5A 3BXPA 2QUAA 3MPUA 4D98A 3OCZA 3ER8A 4D9MA 3QVGA 1EX6A 1R3DA 3PYMA 1M34A 4KDCA 4W7HA 1SURA 3VKVA 2IE0A 2G63A 5EI5A 3PEWA 3F6BX 2RH5A 3IVAA 1CZLA 1A96A 3QWBA 4FW9A 4PU0A 1OYVA 1CK4A 2B4TO 3GB9A 4PBTA 3CUEF 5KDOA 2NNLD 3UW1A 3NANA 4F45A 3WLKX 2VATA 2ZYWX 1DX6A 4L5CA 1ZD8A 3AVTA 2G0AA 3BRWA 1B7GO 4X3CA 2DECA 3QTTA 2QUBA 4OLJA 2ZPTX 3Q11A 1TAQA 3B20A 3OC0A 1C8VB 3M6IA 1LSSA 1OLUA 2B8WA 3EGVA 2W71A 3ZD9A 5JSUA 1R3UA 3EUWA 2OZLA 4OHFA 4OFZA 2BELA 5K6RA 3UJNA 4LF7B 5SZJA 4AICA 1E3QA 4JYCA 2D7JA 4LJ4A 5D5QA 1DEHA 2JGFA 3CH5A 5BOVA 2RHMA 4JX8A 2HRRA 4JBYA 1C3LA 5LP6A 3BJIC 3F4KA 1L7OA 1O5IA 3GMSA 1N5KA 4I5GA 4Z4EA 1QU2A 1Z25A 3E0QA 2GEBA 2X41A 4CWAA 1V8ZA 1I94B 3R0ZA 4DJAA 2ZOSA 3BFKA 2JFWA 3DAYA 3TFQA 1QH1A 1D2EA 1JTVA 4AYTA 5FOWA 2YH2A 3GLUA 1U7TA 3BRWD 4WINA 4KQJA 4OXRA 3FPSA 4DV0B 1E5QA 2JVJA 1LDMA 2UUOA 3OZAA 2PH1A 1NHWA 1Q7TA 5FPYA 2GA8A 4EEKA 1WMSA 3OG9A 3EFOA 5HBGA 2X5JO 4O4JA 4U7GA 1JR6A 4M37A 2MIIA 3AU8A 4ES6A 2IBTA 2CVOA 2X0NA 3MFYA 4C3VA 3O7MA 4K1LA 3T1VA 4UVGA 3T5BA 4C6TA 1J1ZA 2O8VA 3IHWA 4ZDKA 2CW5A 3AP2A 1WDLA 4Z9AA 1T6YA 2H54A 4KPFC 2O2EA 3ENZA 4ARUA 1O9GA 1UP7A 1LI5A 2P9ZA 1BTOA 3HUFA 3R3VA 4H6VA 4MCAA 3ER6A 1GGKA 3TW6A 3ZDYB 3NIBA 4HDOB 5BURA 1QF7A 2CEAA 3ANNA 3IMFA 4TS9A 4W9NC 4G8BA 1PI3A 2IEYA 3IT0A 1RWBA 1XA3A 4HDRA 4PG6A 4WI1A 1KZ7B 1WSWA 1ZUHA 2Y1WA 4LKOA 1Y7LA 3KSRA 2FWAA 2FZEA 2WAXA 5JPIA 5CDGA 2RHOA 1O94C 4OXNA 4URVR 3RSZA 5B6JA 2XWSA 3FVVA 4KR0A 4ZGWA 4LJ7A 1C3OB 2PMDA 1C1YA 3MC1A 2Z9DA 1G2QA 3HVIA 4YMTA 5FFNA 1MO4A 1YJQA 3X1YA 2FPPB 1HSZA 2TMDA 5EWLA 5EYPB 3TIFA 4B0OA 1S2IA 5TMPA 1P2DA 2D1YA 4QQRA 4YREA 3SSNA 3BJZA 3GLVA 4HQFA 2FN9A 5LP6C 4MYDA 3T6KA 1GPBA 4CU5A 1FUEA 1XZAA 1YUNA 3DW3X 4RTMA 2YW2A 4G1CA 4FYXA 1QOQB 1R00A 1VL6A 5CW2A 3KL4A 3LBHA 1Z7BA 4PZ9A 3IJRA 2HBQA 2WWFA 4II7A 4NCIA 3REQB 5ALFA 1NNI1 2EZUA 2OQIA 3EQ7A 3ABOB 3VPHA 3IE0A 2ADMA 5IDYA 1I24A 1L4BA 4S24A 1ZJ6A 3BMXA 3S2YA 2VRBA 4XM2A 5D51S 3T7RA 4MKGA 4NPCA 5CJPA 5T3UA 4BUJA 4BCBA 1NTOA 3F9IA 1ULHA 5K7SA 5DBEX 1X7ZB 3D6MA 2FZGA 3UHAA 2JC3A 4MZXA 4GHWA 3S2EA 2CVPA 1OAOA 1VPWA 1CERA 1GKUB 1UFQA 2IZOA 3HEAA 3DD5A 5H4GA 1HT0A 3RS0A 4UNNA 5JSHA 3TVTA 4F8EA 5MN6A 2XUPA 3ADBA 1GTMA 2OV6A 2IYZA 4HLUA 3UT6A 4ALNA 1NQWA 5K0GA 3TIGA 4S0XA 4DC0A 2ALJA 4YFYA 4MICA 4CTJA 1KC3A 4MHTA 4EPWA 5DK6A 2H1CA 1RHQA 3KVOA 4CEIA 1KDTA 2ZW9A 3AM1A 5AKHA 1ADCA 4BQNA 3LO8A 1L4LA 2WIAA 3GNSA 1NZJA 1Y98A 1WETA 5C8YA 1CY8A 1H5UA 1NT4A 3RC1A 1H2XA 2Q46A 1ZW1A 4H7HA 4KIGA 4DEXA 5AKLA 2FVXA 4DBLE 1RBQA 2I54A 3AUJB 4DLKA 1SB8A 2Z2JA 3IVCA 1F2DA 3ADOA 3C39A 3KC2A 4N0DA 2JL1A 3PX3A 1NSYA 1DIHA 1LVHA 1QK3A 3KWLA 3WWOA 1SHLA 3IAFA 3IV7A 5BPHA 4L50A 3LRTA 2J6CA 1A76A 2C82A 3I9LA 1B4DA 2IU4A 4JWKA 3WLPA 4COKA 2HYIC 5AK6A 5A9SB 2CXQA 1JNXX 2EYUA 5IG2A 1CNEA 1WQ3A 3M1YA 3TRJA 2GHIA 1UBNA 5KUTA 3GRKA 1H8HD 4UASA 4R6XA 2CJPA 5JO9A 4JP1A 4GOND 4QDKA 3CWQA 3CEAA 4ZVTA 2DT5A 1JDNA 2V7XA 3AR2A 2A3NA 3Q5EA 3R0QA 4C2TA 1ULZA 3IODA 1LRJA 2V7GA 5BN4A 2AUTA 2I87A 5FV4A 1EFKA 1RYYA 2POCA 3TAHA 4O2AF 4DR1B 3OJLA 1H93A 1XD9A 3T38A 2F1OA 1NV9A 3ZR4B 3ZY4A 3KPJA 2VO1A 3DDSA 3ZHRA 1AKVA 3CVWA 3F5FA 4W1PA 2JJQA 5E9JA 5EKUA 1JU4A 1I7NA 3BWYA 3RHFA 4RD6A 1YJCA 2FZLA 4ROSA 1FA9A 4WA7A 4XSVA 4GOKA 3WK4A 1IRIA 4F97A 2NT3A 4ABTA 1SIBE 1U0EA 5IJZA 1A9ZA 1Q15A 1JT9A 3QVSA 3P9CA 4HXGA 1KVRA 3M3HA 4CNBA 3OU6A 1NT2A 1TI7A 5FA6A 3UICA 3K70B 1QFZA 3EZLA 2X8JB 4L8LA 2RG7A 2GM4A 3CNNA 3H42B 3HZZA 1RZUA 1RNLA 3MWYW 5EUBA 4ZU6X 4HLNA 5ALSA 3AHGA 4PS1A 1V6SA 2C0PA 5CYOA 5KS2A 5IM4A 4PSUA 4EBBA 3DXYA 5CB4A 1QS0A 1GEEA 2NM0A 1XXLA 1NBHA 3GFTA 4IDAA 3K70C 3C7CB 1I2CA 2I78A 2P5SA 3FNHA 4YCNA 1SR8A 1OA0A 1CF4A 1WW3A 1AS3A 4M8SA 3HXMA 2VCEA 1GAWA 4ANFA 2OEPA 1N2OA 1XU9A 3JWIA 5ENVA 1Z6XA 5EUQB 3W5DA 1A1VA 1L5OA 3NIFB 2EQAA 1H9AA 2PUHA 2WUDA 3RS9A 3ZDEA 2EATA 1U1FA 3E4CA 1U7WA 1CUGA 5EWMA 1AV6A 5L3SA 4D0GA 4BO4A 4F85A 1F8FA 4DQKA 5E3IA 5REQA 2IKQA 3F5SA 2C3PA 4CLOB 4A0SA 2RIRA 1B8NA 3GJ6A 4RY0A 4DM3A 1GILA 3MLEA 2NU8A 5MN5A 2AZ4A 1HNWB 1EGQA 4LW8A 3ZDZB 1QLJA 2JBAA 4L4UA 3RUEA 5F52A 4DV2B 3WFZA 2GS9A 4FB5A 4JJFA 4RZUA 4C22A 4D5EA 3KXLA 1Q0SA 4XIIA 3UHOA 6GPBA 1CJUC 3PRHA 1Q95A 1Z0KA 4UXIA 5D1HA 3ZDQA 3CH4B 4UBKA 1QONA 3AF1A 3D8HA 5B1SA 2FSVC 4XM0A 5ALLA 5M5BA 2E2WA 1J09A 5EEGA 4EJ6A 2JD0A 4OQQA 3AWDA 3QX7A 4H7JA 1AH2A 1IQRA 3MTBA 2VQ3A 3TYXA 3KWFA 4UAJA 4AZ3B 1U90A 3LPNA 3K15A 3MAJA 4CTKA 1SCBA 2J3DA 4QVIA 3MS2A 5TQ0B 2FRDA 1D1PA 3ENVA 1RQLA 2ZIFA 4OP3A 2JHFA 1OQAA 4M0DA 4D57A 2YYSA 4M54A 1QQTA 2FKNA 5AW7A 4HXEB 1XE3A 1XZNA 2EBUA 4DDHA 3U1VA 1B23P 3Q7QA 4WNCA 1T9DA 2JW5A 1XTIA 3CNLA 3Q5DA 5JXJA 1FDOA 2GXSA 4TWJA 2WD7A 2FW9A 1YZ3A 4MWGA 1VTKA 3PHBE 1FNBA 1GLVA 1NR7A 3NALA 1J90A 1X1CA 3H87A 3CEPB 4PLZA 4YT5A 5K8VA 2C61A 1E1QD 3ND5A 3UWOA 5HZKA 1LDGA 1KHTA 2Q3MA 1J7JA 3DWFA 2GAJA 3D6JA 4WDQA 3T7SA 5JFGA 4UCFA 1OIXA 1HYQA 4MW7A 4BN5A 1K8YB 2R6ZA 4NCBA 3DNFA 3VR4A 2FUEA 3BMCB 3NETA 4GVXA 3IALA 4L2IB 5A5FA 5ITZB 5TQVA 4A5SA 4QGSA 2P9BA 3H8VA 2DFVA 2WZDA 2GYVA 3BCSA 3LMKA 4NZ9A 4ZCLA 4UNRA 5KTYA 3KJGA 3H3XA 2P2DA 1DKUA 4TV8A 1OTXA 3QHPA 2NV2B 2A9RA 4LWQA 4UTOA 5GWXA 4DSOA 4AJJA 5JS8A 5LD2B 1YA6A 5HIKA 4U63A 3IMKA 4XX0B 3NEPX 3FXAA 4TKZA 2VTVA 3AVUA 2BMAA 5IKEA 1ND5A 5HTKA 5EGNA 3VOAA 3BXXA 3EEBA 4OPMA 4XYMA 1N34B 3AIMA 4FGLA 2PGDA 3FNGA 3WB2A 3ZWKA 1M1ZA 1DCMA 3GLQA 3IQFA 3CLUC 3TSWA 2M9MA 3SBXA 4OLFA 3PNLA 3NM5A 1ZNQO 1HFWA 2J67A 1ESNA 4FK8A 2ATCA 2AOUB 4NU5A 3NX4A 3G02A 3TLJA 2ZBQA 2ZU0C 3VUFA 4KQ9A 4AG3A 5T6BA 4AL4A 1NONA 1AHNA 2VNJA 4UZSA 4QE3A 3K53A 1YI8A 1OHHD 3LYAA 3FBTA 2WMDA 1C9MA 1MEJA 1SK9A 5G40A 1Q1NA 3VHQA 3O94A 4YV0A 5IULC 1VKOA 2ZJ4A 3DVLA 3PHIA 5LCXA 3N9IA 4YAEA 3K0AB 3AKCA 2H6EA 4LTMA 2OK7A 3GEMA 1MB4A 1J0BA 4CIAA 5IUNC 4KEAA 1SIUA 3P32A 5DI3A 3VOSA 5K3FB 1K4MA 2NV6A 1DTWA 4MUGA 4Q18A 16PKA 2Q6OA 4E3ZA 1H6AA 2PCJA 2M6LA 3FI9A 3K1JA 3LOPA 3OPVA 3LP8A 1ZSVA 2H4FA 1T6XA 1EYZA 1K5GA 3NHUA 3PD7A 5C2JB 3FMIA 2OBNA 3N6RA 5ALQA 1ZOPA 2FKAA 2BWJA 2IS2A 1QV6A 1JKJB 2X58A 2O20A 2GQ0A 1BU5A 4BGVA 1FXWA 1H1LB 3IPRA 2EW8A 5KVAA 1J0XO 1FDIA 4FU0A 4NS4A 4Q5IA 2QTHA 4K6CA 2A5JA 1TNDA 3M6LA 3D02A 2P7HA 5F9HA 3KLMX 4WBNA 3E9NA 1M34E 3A3YA 1I3LA 3FAKA 2F8MA 3T3EA 1FFYA 4R5HA 3L7IA 2JCGA 3P2KA 4K9OA 2LW7A 3CNEA 2O54A 1R0XA 4DILA 5JZVA 2Y1DA 4LAFA 2GJ4A 3RI3A 4PSCA 1IVSA 1W36C 1IZ0A 1US8A 2HN9A 1GU1A 2P6PA 4M98A 4KYTA 4RAQA 1ONSA 2VSNA 3GLTA 3N28A 5EERA 4B40A 1VHTA 3ABRB 1R6UA 3DUWA 2G77B 1L5MA 4EYGA 1HORA 4MQ6A 2PQ0A 1FYFA 3AI2A 1GNQA 3G9QA 1YBVA 2UXBB 4J2OA 3MINB 3O47A 4LHVA 4Q6BA 4FOPA 3A0RB 1C30B 1EVLA 3ZWYA 2W43A 3GFFA 4KXVA 1GEGA 4IEIA 1SIOA 4G1EB 4X54A 2Q5HA 1FFGA 4R1UA 4MPPA 2VQEB 2AI2A 3SXJA 3Q7PA 5GMOA 2JJ2A 1BX0A 1JSLA 3H9EO 3K9NA 3Q15C 1PUIA 3E9QA 1UXIA 4GG1A 4PFSA 4S1PA 4XIFA 1X1TA 4TMKA 5EIAA 2F9MA 3TECE 4OQMA 3FDFA 4QDUA 1Z2PX 4IQ4A 3HLTA 3E8SA 3PIIA 1N3BA 1CQZA 2WNHA 3BGOS 5CDTA 4WEQA 4D74A 3JALB 5E7QA 1GZ5A 1EJ0A 1GTG1 1XQWA 3BMOB 5FKJA 5IABA 1KO5A 4BRSA 4G3XA 1JZQA 4YRBA 4N7RA 2I2DA 3EGDB 3CUTA 5LYYA 2E1PA 2BPOA 3W6PA 2HADA 5G41A 1HR0B 3NHLA 1N5LA 4EJSB 3BEOA 5ALWA 3S29A 3HH8A 1TAGA 4YRFA 4MI6A 3WYEA 1QP4A 5KO2A 4JB3A 5JFOA 1A5ZA 2Z1MA 2WILA 4F6LA 4CTNA 2QM3A 5A5DA 5JS2A 4XVCA 1E3JA 2PLFA 1M2HA 3WLSA 2O0HA 4MQLA 2XCIA 4BN4A 2QYSA 3HU3A 2WVAA 4Q6WA 4DW8A 1SBYA 1ZRSA 2DJIA 1HQDA 1HT3A 2I80A 2JJ2D 1HOTA 2NQTA 2O2IA 1Y8RA 3DEHA 3E3AA 4OTZA 1SUAA 3ZWPA 1BOOA 4U2GA 1XTRA 1KJIA 2WHPB 3SR3A 1YU6A 4EPTA 2IHZA 1K7EB 1S7GA 2ZXEA 3NLLA 4TLCA 1FFXB 1C3VA 3M70A 5LP6B 4JI2B 4TTIA 1M76A 1NI4B 4MLDA 1EXDA 4Q47A 2GCEA 4RSGA 4RM2A 5E1DA 1PF7E 1NJ2A 4W82A 2O59A 2J5QA 3AUAA 1GTRA 4HTFA 1HMPA 4MZDA 5FWDA 4EEXA 1PYOA 4WESB 3TQHA 1SHUX 3EZ7A 1KO1A 3JQ8B 4KR9A 4KMRA 3A9VA 1VDZA 5F2OA 3LL7A 3OTGA 3S81A 1YR3A 4QEKA 1FRNA 4OREX 3BCRA 1U98A 2XRYA 3DEAA 4Q4AB 1XFDA 3CCCA 2QRUA 3DAHA 3GVXA 3OKCA 2CLLB 4RC9A 3RAJA 1T2NA 3BMQB 4FNOA 4KXXA 2XLCA 5AKGA 3IIIA 2ANCA 2VHYA 2OECA 1DO8A 4HT3B 3D3WA 3GARA 4NCNA 3UAVA 3UK1A 1IOWA 3IUPA 2AZDA 2JGMA 3WK7A 4ZTZB 4L5IA 5FPHA 2BSQA 3OCUA 3MFQA 1FPQA 1NUHA 3NGXA 3HZHA 4S35A 2F1KA 2GVDC 3WKEA 3H7IA 4C4ZA 4BX3A 2GK3A 3WZ2A 4ZT4A 4R69A 4OB7A 3E2PA 2R85A 2XXBA 2NXJA 1YXMA 2XQJA 2IXDA 3BRSA 2ROQA 4A8PA 3LX8A 3NS7A 4EY4A 4DBVO 2FPKA 5A4MS 3ZHOA 1W4RA 2OKGA 1A72A 1Z74A 2BF4A 2HF8A 1DFGA 3I28A 3MN1A 4I3FA 4IJWA 3LUKA 3RC8A 4B0PA 2PYIA 4AD8A 1WSBA 3PXAA 1XTBA 3DCYA 3IB3A 3UA3A 1I4LD 4MWZA 1J2RA 4WQMA 1QQAA 3SSOA 1XPRA 5FTKA 2GGSA 3C5VA 5KYWB 4V1CA 1SVOA 1TZMA 3P96A 5ENZA 4LY6A 9LDBA 5ICGA 3DKRA 3EC1A 2JLVA 4CLRA 2EG9A 1WXXA 4UTXA 4Y8VA 3EXIA 3T8YA 4TRRA 1KI9A 1P9OA 3U3RA 3RWBA 3VMMA 3W8FA 1T5SA 2BJWA 3IP9A 3WHIA 1WBBA 3R6DA 2DBYA 3PIDA 4FI3C 4NCXA 4QTUB 2WJVA 2POQX 4RYLA 5CITA 1JYSA 1QGZA 4IIHA 1EVQA 4EG0A 3K3PA 4FMPA 4RMIA 4U02A 3U4DA 3N53A 4IOJA 2XZLA 4TTPA 2J4DA 4U7HA 1BXRB 4N5MA 1QH8A 5DHFA 4HNGA 1W88A 2IV7A 3ROFA 2CNBA 1W1IA 4EB6A 4QUGA 3O2QB 1HI9A 3KVVA 2PWBA 1GUZA 3RFCA 1OT5A 4CCYB 4EI9A 2EEZA 1DU4A 4FCCA 4YAIA 3EAQA 4D4JA 1OFTA 3QLUA 1VB3A 3NT4A 4J0JA 5CCDA 3V4PB 5B2EA 1KZ4A 3T3OA 5I9NA 4D9KA 3PT9A 3K4HA 2H7YA 2P8SA 2ZGVA 1YZFA 4TXJA 4GUAA 1DEKA 2VNSA 1KDVA 2X8AA 4HF7A 2CLMB 3SHVA 2F3RA 3WK8A 2JFYA 2P2LA 2Z2XA 1G8HA 2E4XA 1UKYA 4M89A 2D7DA 1OFGA 3D7KA 4Z7QB 1E2KA 3WWZA 4ZPXA 1H6CA 1E1DA 4Q4HB 4MQMA 4RMHA 2JAUA 1NUSA 2HNKA 4WW0A 1EP9A 4AYXA 1MU0A 3R5XA 4A7PA 1B0PA 1LU9A 3K1AB 3ZGXA 2J9YB 4XCVA 3QW4B 5DLYA 1OBHA 4J2TA 1M5RA 1JMYA 2YV4A 3R7WA 1T9KA 1JH8A 1OFUA 5FP0A 3E9DA 1LTHR 1OW3B 3IE1A 3EUEA 2IELA 2L69A 3A3KA 4CLDA 1TF5A 2C59A 4LX8A 1N3YA 2YUTA 4MYTA 1CZHA 2WJWA 2B5WA 3KWJA 1WB6A 3RK0A 3OMWA 1SRQA 2B4YA 3E8XA 5HILA 3EH1A 3TZQA 4MUNA 5E38A 4KQFA 3D3WB 3R0XA 1ZUD1 5FUVA 3MEQA 3SYTA 5E8JA 4IDFA 4DAEA 5KWVA 4BYMA 1TO6A 1DAPA 3E48A 3MERA 3AM5A 3DLCA 1J2EA 1GPMA 3AV0B 2CL5A 3BHJA 2D2EA 3GUCA 5DOVA 3MMXA 3CX6A 1JEYA 4XD7A 3R0IA 1VL1A 1NP7A 2CVQA 3EMKA 2P5TB 5EFOA 4PWZA 2VRCA 1X9HA 3DE4X 1IBCA 4WESA 1G2PA 5KIAA 2IYTA 1XRQA 3LLUA 4MW5A 4GFDA 4G4SO 2JIMA 3GJ7A 1GZ6A 1BCRB 2C9CA 2B5VA 3AO0B 3CEMA 1P7YA 3FFTA 4JVLA 2K5UA 3KKLA 4GS5A 4MKHA 1PN3A 4BNHA 4OUKX 5ILQA 3M89A 4YR9A 3HDJA 3HJBA 4B46A 1VLJA 3WL3A 1AA9A 2PT9A 2X5OA 3W34A 2V58A 2I9PA 3BJRA 3O6VA