2Q2WA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
253
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRNGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 90
structure length 253
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2wA00
2NTJA 4RPGA 1IZ0A 1E3IA 3BA1A 1K89A 3SBOA 3WTBA 3BMQB 1Y9EA 6LDHA 5CDSA 2C2XA 1A9ZA 3AY3A 3ZWVA 3HG7A 4E2WA 1YJ8A 4J7UA 3F1LA 1EQUA 3E9MA 1C14A 4GL4A 1U5CA 3DBVO 2AW5A 4NPCA 4WPGA 1NR1A 4JBIA 2J8ZA 3JQGB 1YOVB 4BO8A 1WPQA 4QT0A 4K9DA 1PJLA 3H9QA 1PTJA 4AJKA 3VDRA 4GI2A 1KVSA 3MJCA 1LI4A 4IMPA 1YB1A 4XR4A 3HB5X 1P31A 5A9RA 1D7OA 1I8TA 3I1JA 2DBZA 1E1NA 4FFNA 4Q3AA 3AU8A 2Q4EA 1HEUA 1U9JA 4N54A 4XGIA 5KNLA 1RKXA 3H2ZA 3SVTA 5BNTA 3EK2A 3HNPA 3Q11A 5EQDA 3Q2KA 5IZCA 1BRMA 1A9YA 3SC4A 3NYWA 3G49A 1PGQA 2I65A 1GEGA 5L4NA 2H1SA 3GZ4A 5ADHA 4XQCA 2PY6A 3AM3A 5EPOA 4WLOA 1LQTA 3LF2A 3MCVA 1PZEA 5DNAA 4BGUA 3UVEA 4FFRA 4B4WA 1MA0A 2J3JA 3I4FA 5EJ2A 4ZICA 2NVBA 4P4NA 4D0SA 3LVFO 2X7HA 4BIIA 3UCXA 1UXKA 1KY4A 1GYRA 4QEDA 5TNXA 3GDGA 2NQTA 1JA9A 2VRCD 4IGFA 3NJ4A 4PG4A 4WCDA 1QYXA 4WLEA 1FDSA 4D41A 4CLRB 5HS4A 4ZRNA 4DLBA 1R0LA 3ANLA 4J0FA 1LLUA 1X15A 2HJRA 5IZ4A 1QYCA 1PGOA 4GVXA 3CZMA 3RFVA 3ZWMA 4CUKA 1C0KA 2GN8A 3ETGA 4MP6A 4NBVA 4O0LA 2NM0A 3G79A 4YT5A 3U9LA 1ZO8A 1DIHA 2P5UA 4URFA 4E5YA 1BVUA 2O50A 4W4TA 4YDRA 5CG1A 3QIVA 1XEAA 4YJGA 4YVFA 4XIJA 4D0RA 3D3WB 1PGPA 1PZHA 1N9GB 3ENNA 3PPIA 3RVDA 4AJEA 3DFUA 3O38A 2Y1EA 2YFQA 4BOYA 2DT5A 4IDCA 2WDZA 2FZWA 3L4BA 2HSDA 1SB9A 3AK4A 4O6VA 2CUKA 4RZIA 4YRDA 1Q1NA 3Q9NA 3K31A 3UXYA 3AI1A 4R9SA 1HF3A 1I0ZA 2Q3EA 1E6EA 3KXDA 4JBHA 4Q9NA 1U3WA 2XOXA 3OBBA 4IDGA 4XJTA 3IC5A 4WOKA 5BNFA 3U4HA 3KHUA 1ZSVA 4CUJA 1EE2A 3O8QA 3OEWA 2AQIA 1XYGA 1U7HA 2JFHA 4BNGA 1WDMA 5IZCC 2BGMA 4RL6A 4OAQA 3DZBA 3GUCA 2X1HA 4RO0A 2DVMA 2PNFA 3VZPA 1CIVA 3LU1A 1B0AA 5L7WA 5GMOA 3NTQA 1DFGA 5ICSA 4K26A 2B4QA 3R1IA 2O7SA 5IXSA 4JQCA 4WKGA 2G76A 2Y68A 1B15A 1VC2A 5L9AA 4RCVA 2C5AA 5HTOA 4XRRA 1GZ4A 5KJEA 4KUHA 1PL8A 3D4NA 2UYYA 1KC1A 5BQFA 4CMCA 3DONA 2HRBA 2XF8A 3NKLA 4TRMA 3HADA 4QSMA 3VKUA 1UP7A 2VOJA 3ZWYA 3M1AA 3GGOA 2ZJ1A 4MIOA 4J1QA 1H93A 4EI2A 4E32A 3WMWA 3ZHZA 1EE9A 1PJSA 3PDJA 1SO8A 1RPNA 2YV1A 4OXKA 1LSUA 3Q3CA 1HL3A 3HB4X 4WASA 1T4DA 5LCXA 5A9TA 2X22A 5MGBA 3OJEA 4GMFA 3OIGA 4DLLA 3VTZA 3WFIA 3JQ8B 4IXWA 3KRTA 3F3SA 1CF2O 1ONPA 1BXZA 3DAGA 4ND4A 4D3FA 3IMFA 3MWEB 3DAPA 1IOLA 1DEHA 3PFFA 3GPDG 3OM9A 1ISGA 4R68A 3FI9A 4M86A 1GU7A 2AXQA 4AJIA 3JYLA 2FPIA 2LDBA 1HT0A 4C7KA 5JLAA 3GK3A 1E5QA 5EIOA 3E8XA 2GDZA 2EW2A 5JO9A 1GDHA 4Y98A 3KSDO 5TF4A 4L9RA 4KQWA 4NIMA 3F9IA 1H0KA 4FC7A 4O5OA 4W9NA 4ZVVA 3D5TA 4BNJA 2Y67A 3AY7A 3MTJA 3G1UA 3OETA 4NQZA 3RFXA 4FW8A 2Q46A 3B70A 1W6UA 2IE0A 1K2WA 3ZNNA 2GASA 4QECA 4D79A 4R16A 1LSJA 1Q7CA 1GPJA 5JE8A 5G0VA 4ND3A 3TWOA 3HE3A 1VKNA 4C4OA 4GX0A 4JP2A 4WOJA 3WYEA 2DTXA 3AU9A 3KO8A 5JMWA 1XWFA 4YJFA 2X58A 3MJ4A 4YJGB 3AWDA 1PS8A 2C54A 2QHXA 3AOEA 3WGTA 4XDZA 3W8FA 1K6JA 2AE1A 4I5FA 1JTVA 3FRJA 4BKQA 4P38A 3D1LA 5T8KA 1RM0A 1DLIA 1LC3A 2I6TA 4BV8A 4XIYA 4CMIA 1O94A 4HFMA 3CH6A 4JIGA 4TVOA 3Q0EA 1X0VA 4CR6A 4ZQEA 1A7AA 3EY4A 3C24A 1A71A 4XYEA 4QFDA 4QO8A 3AUTA 3GNSA 1FF9A 3Q1LA 4GWGA 4TZKA 4F6CA 5I8ZA 1J6UA 5J23A 4J2HA 3O8QB 4EJ6A 2DPHA 2X8LA 5A04A 1EBUA 2V7PA 5JFOA 1LX6A 3ROPA 1JAYA 3RUDA 2D3TA 1G0OA 3X2EA 4EJ0A 2EGHA 4B4OA 3KOUA 4CMKA 8ADHA 2QRLA 1TB4A 1NVGA 1DC4A 4XCVA 2BRUA 4E21A 2IEDA 3DZGA 4MP3A 4ALLA 2HMWA 3M6IA 1RYDA 1XLTA 2FPGA 2YHIA 4JJIA 1Q0HA 4BVAA 2G0TA 4Y8VA 3X2FA 1H94A 3D4PA 3DC2A 4DL9A 3PZRA 4L4XA 2EKPA 3GFGA 5JW6A 5KOIA 1VE9A 3W8EA 1S6YA 2J5QA 3ULKA 4KOAA 3GRKA 4ROSA 4GGOA 3VPGA 1GCOA 1DIRA 1HLDA 1JKIA 1CQIA 2BGLA 4BB5A 3WJAA 2FR0A 2QQ5A 3JQEA 5CG2A 4W9NC 5A3VA 4AJJA 4BO2A 4CPDA 4YT2A 3SEFA 4Z3DA 4PG5A 3V5NA 3U5TA 4MOWA 2AEJA 3ONFA 4GLLA 1U8FO 2HKIA 4EEZA 2A35A 3B1JA 3JQCA 3ZV3A 2FR1A 3E48A 4RVHA 1F0YA 5DDIP 5TQVA 3RAJA 3UH1A 3GY0A 4E31A 4ONEA 2RIRA 4DBZA 2JHGA 2I99A 1H2HA 2D1YA 2NU6A 3NTOA 2CNBA 3B1KA 3AOEC 4UUPA 2I3AA 4CM3A 1Y8RB 3OFSA 4CV3A 1OC2A 4R01A 4BV9A 1GYQA 2HCTA 4XGKA 3ZV4A 9LDTA 1E7RA 3WYBA 5I9LA 3JYQA 4WJZA 1HETA 1NPYA 1PQWA 2Q1SA 4M54A 3WXBA 3ZCXA 2X5KO 4YAIA 1B7GO 4I8XA 4XKJA 5A03A 2PH3A 2JAPA 1ENOA 3G17A 3H5AA 1WVGA 4R54A 1TT5A 1PSDA 4HFJA 3PHHA 4FJ2A 4WCFA 4ZQFA 4U8GA 1EVZA 4J49A 2UV8A 3RASA 1T1RA 1AN9A 2GN9A 3KYCA 3VC7A 1Y5RA 2GRAA 4HFRA 3W1VA 5B12A 1G0NA 6ADHA 2D5AA 2RH8A 3FTNA 3PGXA 4R1SA 3ZH2A 2RAFA 5T67A 3C85A 4NFSA 4RQUA 2ZTVA 3T7EA 2PKQO 1LRLA 4YJFB 1KC3A 4YQZA 4J16A 3KYDA 3AUUA 1DRUA 1ONNA 3GFBA 4IM7A 3L77A 1E7WA 3INTA 2W2KA 4TROA 3U4DA 1R6DA 3RFTA 5F5NA 1UXJA 4Y6RA 3ORFA 4UUNA 4B79A 3ANNA 3IUSA 1ISMA 3DOJA 4YB8A 3TF5A 5ER6A 4CMIB 1LJ8A 1TT7A 3GVXA 4WK6A 3FNGA 3JQ9A 4Y6SA 1UZNA 4G5HA 1MV8A 4B7UA 3I3OA 1FDVA 2NADA 4XQGA 2HRZA 1J49A 1GCUA 4CODB 5U9CA 3K73O 4BKOA 3QVSA 3QWHA 5KCZA 3E82A 4Y9DA 3GVHA 4AJNA 3A4VA 1T2CA 3I9JA 2O48X 1OAAA 5JDIA 2G82A 3KZVA 1SBYA 1VJTA 3MWDB 3JQBA 4PG6A 3B20A 1DJQA 3DHEA 3W6ZA 3BIOA 5DBGA 2YHIB 1HDRA 1WP4A 3DBRA 1ID1A 2CSUA 1JKJA 3BMCA 1PR3A 2Q2VA 4PLVA 1Q7BA 1EZ4A 3PQFA 3QHAA 1NX6A 2OFPA 5G0UA 2NSDA 5BSHA 2ZIZA 3UN1A 3MOIA 4J2OA 1CRWG 5THKA 3L9WA 3MJVA 2VNAA 2VRCA 4I9HA 3ZV6A 2HJSA 2OMEA 1B14A 4RPKA 4WE3A 2QZ9A 3FPCA 4J1SA 4WCFC 2JCXA 3PI7A 1IY8A 1Y1PA 3TZHA 4YRAA 2ZJ0A 1MG5A 4ALKA 4CQLA 3ADPA 3ICPA 3TJRA 1YL5A 1YL7A 5ES3A 4Y67A 3EVTA 3RCBA 3VDQA 1N7GA 4OKNA 3VH3A 2F00A 2B69A 3PJFA 1LSSA 3QJ5A 3ROQA 1DRVA 4PG7A 4IQGA 3GNQA 5G4LA 3QWIA 2BFMA 3RBVA 3VPFA 1QP8A 1I10A 3H9EO 2E48A 4KZPA 3UOGA 5CFZA 3TN7A 1GUYA 2ZQZA 5G4KA 3SC6A 1PX0A 4BQRA 4B4VA 5I7SA 4J4TA 1N1GA 3LLVA 4J7CA 4Q39A 2R6JA 1NQAO 1V8BA 1U2DA 3IP3A 4OOEA 5JMPA 2UDPA 3C7DB 1ULUA 3WX0A 3QW2A 1TT5B 4DWVA 4OQYA 4WCFB 4RVFA 2P4QA 4PGFA 1W8DA 4ZU3A 4OHUA 1I3KA 3GLQA 2C07A 3TZCA 1ORRA 1UJMA 3E18A 1U3VA 2AEMA 1EVIA 3I83A 4KWHA 4XZ3A 1EVJA 1XA0A 1K6IA 2QG4A 5F5LA 5U4QA 3OQBA 3ZNQA 4ITUA 1AGNA 4CLDA 1EUDA 1VL0A 3QV1A 3PJEA 1CYDA 3ST7A 2CDCA 4EW6A 3IKTA 3WBBA 3DAFA 2D4AA 4DPMA 2CF5A 3KYDB 5L95A 3L0DA 3CIFA 3FR7A 3OJ0A 4D7AA 1MUUA 4JJFA 2W2KB 4K28A 3HUDA 4EUEA 1YONA 2HQ1A 4TVBA 2P2SA 2ZCVA 4BNZA 3TNLA 3SJUA 2FN7A 3L4SO 2CVQA 3KVOA 4LRTB 1KIFA 3NDIA 1ML3A 1ZZEA 1SC6A 3DBLA 2NTVA 5G0SA 4Z9YA 4PLYA 5EN4A 1DC3A 4OQZA 1FDWA 3GMSA 3WB9A 2ZB3A 5TS3A 1E7YA 1GL3A 4L74A 4MVJH 1SEVA 3ZU5A 2OBNA 1ZXLA 2VWHA 3UGKA 1M2WA 2Y1FA 1R16A 3M1LA 4RPLA 3PHIA 3BTOA 3H8VA 3U49A 1NAIA 1PJ2A 2JD0A 1K0UA 3ZNOA 1LRJA 1G6KA 2D5CA 1FK8A 3SLGA 4DYDA 1E1MA 4BHTA 2Z1NA 2BHLA 3E9NA 3WWYA 4ALJA 3DBRB 3I9OA 2WYVA 3OIFA 4U6SA 3WFJA 5CHEA 4AJ4A 3LC1O 4BO6A 1U7TA 2HAEA 2Y0CA 3GN1A 4J9VA 4Q3EA 2WMDA 3GT0A 3UF0A 1ZW1A 2FP4A 4HXYA 1U3TA 4FC6A 1TEHA 5F3RA 4YAEA 4P4GA 5G0WA 2PWZA 4A10A 1AXGA 1P45A 3OH8A 4QQRA 5KIAA 1ENZA 2O3QA 2Z5LA 1AXEA 1PGJA 4MINA 4PLTA 2C7GA 3GH3A 3OF2A 3RU9A 1Z75A 3ETDA 1VLLA 3ZDFA 4HNGA 4NBRA 4BNYA 2EF1A 1XSEA 2G17A 3M2TA 5G4KB 1B26A 1N1EA 1VSUA 5TC4A 2PGLA 3GDFA 2O3SA 1SZJG 4BS9A 4ESOA 1AE1A 2A9FA 3JYNA 3U3XA 1AUPA 3OJOA 4W7HA 1HTBA 3C7AA 4I9NA 4B3HA 4M87A 4Z9XA 1KEVA 3JQFA 4M8SA 1HE2A 1CJCA 2OUIA 2OBYA 2PZMA 1H6BA 1N8KA 1P74A 4KWIA 3MEQA 2NLOA 3JYPA 3RSHA 4CL3A 4ZQHA 1M75A 1Z82A 1VJ1A 3BXXA 4Z0PA 4CQLB 4CMEA 1NHWA 4IUYA 3JD3A 1IULA 3ZHYA 4IY1A 1QYWA 1DC5A 2VHVA 3WDSA 3JD4A 1NFQA 1F14A 1KVQA 2VWGA 3H5NA 3IQDB 3IUPA 3WWZA 1P0CA 4PCVA 3PHLA 2EHDA 3WNVA 5L4SA 2DLDA 2QRJA 5T64A 5CP8A 4YTEA 1ZK3A 4X54A 2Q49A 1YJQA 4FBGA 4PFJA 3VH4A 4YBZA 9LDBA 3H5RA 3JQ7A 3TL2A 3IIEA 4M89A 1NVTA 1X14A 4RF5A 4BNHA 4EUHA 3CMCO 3VVCA 4TKMA 4NMHA 4KDFA 1P1HA 1N2SA 1PJBA 1YKFA 3AI2A 3DBLB 3EUWA 3GF4A 3K5PA 1XDWA 4NJMA 3RKUA 4E3ZA 1XKQA 1T26A 3OMLA 4DA9A 3F5QA 1CDOA 1E77A 4IDFA 3KETA 3BHJA 2X0JA 1PZGA 3HHPA 4JN6B 1L7DA 3P2OA 1HZZA 1QYVA 3RU7A 3ZHBA 1XR3A 2X86A 4I5EA 2PR2A 1NAHA 1YH3A 3C8MA 3AUSA 3K2BA 4WEQA 4CUZA 4E33A 2CVZA 3GVPA 5AYVA 2B37A 3TL3A 1LSOA 2EV9A 3AY6A 1U2GA 4BO1A 2OOSA 2WSBA 4GWKA 1UXHA 1BGVA 4R1TA 1NYTA 1PZFA 4JBGA 4HP8A 1ZMOA 2W98A 3OICA 1YL6A 3G3EA 3QVTA 1Y6JA 2X9VA 4AJHA 5F21A 1HDCA 5JXWA 2EIHA 3ENKA 5A3JA 5A9SA 4AL4A 1SB8A 5JYDA 3PIIA 4RF4A 2OP1A 2O23A 4G65A 1X7DA 2DFVA 4RVSA 1W73A 3JQFC 2Y05A 1OFGA 2EXXA 5ILOA 3QLJA 3PLRA 3WSVA 3KV3O 4LSWA 5BNIA 5C5IA 1D8AA 2FSSA 3HQ4O 4CMEC 1GQ2A 5A06A 1JWAB 3KTDA 5K6AA 3ZHXA 1HE5A 3LT1A 4IS3A 3PQEA 3HJAA 4BNFA 3GVIA 4Y6PA 3H4VA 4OGWA 4WLNA 2H9IA 2NTNA 3K9QO 3VPHA 3K6JA 3GDOA 2VNSA 4KUEA 4KDEA 2HK9A 1P9LA 3GUYA 3WOHA 3EMKA 3NDJA 1HE3A 3INRA 4PVCA 1JKFA 2IZ1A 4LRSB 1E6WA 1QXSA 4BL5A 3RD5A 1DIGA 1HDOA 3E03A 2QIOA 3IJRA 4B3IA 2EG9A 1T2DA 4BGVA 3UCFA 1UP4A 2B35A 2YZ7A 2BGKA 2ZCUA 2D8AA 2VZ0A 5DN9A 2JKVA 4WUVA 1O95A 2WEKA 2AG8A 2WTBA 1U3UA 3NV9A 3BMNA 4CQMA 1NR7A 3H2SA 2O3RA 3Q6IA 3WQQA 2BMAA 3BHMA 4L8VA 1R66A 2JCVA 2B5WA 1LEHA 1LLDA 2PD6A 3TSCA 1HKUA 3HN7A 2NWQA 1Z74A 4FGSA 4MPDA 4WLFA 2A4KA 4DMLA 3PGJA 3MZ0A 4O63O 3FHLA 3RQSA 1IPEA 3VZQA 2O2SA 3LQFA 3ZWCA 5MDHA 1DAOA 1JAXA 3OJLA 3QY9A 1LDBA 4EDFA 1BMDA 1ISJA 3ZZNA 5JNLA 5CDTA 2WD7A 3DMYA 2Y1DA 1XCBA 2B0JA 3KB6A 5DCWA 2G5CA 5DBIA 1KS9A 3RUHA 2FY8A 3TZQA 5C7LO 4XWYA 1CQJA 5KWEA 4Z3KA 4BNKA 3JQ7B 2AMFA 4DLAA 1GPDG 1KVRA 2PK3A 3S2IA 4HWKA 3BTVA 4F45A 1WAMA 3C3XA 3NGLA 3RJ5A 3SLKA 4CM9D 3UFXA 2OHXA 3WICA 2H6EA 3FPLA 4NJMB 3BTUA 1RM3A 2B83A 4CV2A 4FJ0A 4RV9A 3ONDA 1PWXA 4IS2A 5A5EA 4FN4A 4E5MA 3KLMX 3GEMA 3BYZA 1E1KA 5TSDA 5LDGA 3JQAA 5GZ3A 2EW8A 1KEWA 4GAEA 5ENDA 4HADA 1MB4A 4M1QA 4JXKA 5IDWA 4CMJA 2RBEA 1WLYA 1I32A 2RHCA 3QVWA 3WMXA 3ZWXA 3RWBA 4BGEA 2Q1WA 1H6CA 2PKRA 5AXCA 4U7WA 2PGDA 1ZCJA 4IDAA 5T6BA 2Y99A 3RC9A 4E5PA 1IZ9A 3PXXA 3LDHA 5CEJA 2W90A 3L4BC 2X0IA 4FOSA 5A9SB 1ZK4A 4MVJF 1QYDA 2W8ZA 4MIEA 3INGA 1R4MA 1XU7A 3PWKA 3D3EA 4HFNA 3VOSA 4UVHA 2VT2A 3U4IA 2VCYA 2O3JA 2C2YA 5CDUA 1PJCA 3KUXA 4FFMA 1B8VA 5TT1A 2GCGA 4NNJA 3N58A 4IQ0A 4IGEA 4E30A 1WMAA 2WYUA 4LISA 3MJSA 3N74A 2PLAA 1NVMB 1CWUA 1EEHA 1HYGA 4K1LA 5FI5A 4D3DA 5COQA 2CY0A 4DC1A 1ZNQO 5KJ6A 3K30A 4YEDA 2HO5A 4UEJA 4YAKA 3LK7A 5KVSA 4ALMA 1UR5A 3S2GA 1JVSA 4PG8A 3W4JA 2Q45A 2VTDA 4L4SA 3VH2A 3RC7A 1C0IA 4BNTA 3OP4A 5L7TA 2ZYDA 1H5QA 1A27A 5KKCA 1DOHA 5A02A 4TRJA 5ENVA 1B3RA 1DJNA 2RHRA 2JFGA 3RROA 3UICA 1TLTA 2J5KA 5KVQA 2GSDA 3VTFA 5AQ1A 1J5PA 1IHYA 1JVBA 4I5DA 1QKIA 3I23A 2FWMX 3BMOA 3DMTA 1RYEA 3BMNB 4CQMB 3FR8A 4E2YA 2PTGA 1OZAA 4A2CA 3PK0A 4INAA 4FFOA 4TZTA 4RPJA 4I9UA 3DBHA 3CTMA 3V1UA 1V0JA 3UUWA 4A73A 3PQDA 3ROMA 5K9ZA 2CZCA 1E1LA 3DHNA 3IS3A 4F6LA 4N7RA 1NQ5A 2DUWA 5JSFA 1LDGA 3PJGA 1DBVO 4A0SA 4YJHA 4IZHA 4XYGA 1XQ6A 1ISHA 3NTRA 4E6PA 4R4JA 1BDMA 4FFLA 3JYOA 4OJNA 4J4HA 1YQDA 3TRIA 3ZU3A 1G1AA 1L7EA 1ZJZA 1IUKA 3TFQA 3ZU4A 4IINA 2JJYA 5IDXA 4KTVE 1LRKA 4GMGA 1NQOA 4LN1A 5FFFA 4BO5A 5F1KA 3W6UA 1E3SA 3P7MA 4MKZA 1U8XX 5AXDA 2JCYA 3I5MA 1DO8A 2DBRA 5I9MA 4E5KA 1VPDA 3F6YA 5AXAA 2NV6A 3JQAB 2Y1OA 2C82A 3E1KA 3GZNA 4Z6KA 1DLJA 4ZD6A 1H6DA 4PLCA 3ZU2A 3TOZA 1R4NA 2YQ4A 3F4LA 2NVUA 2H5LA 2E37A 4BB6A 4BO9A 2PFGA 4EZBA 4F3YA 2Q1TA 1NWCA 3DZHA 4J4BA 2PZKA 4IMRA 5T8KC 4BNNA 3FNHA 4BNVA 1I24A 1WDKA 4KMSA 2X9NA 1UDCA 3QQPA 3RIHA 5GZ1A 4C7JA 1Q7GA 3C1TA 4ZN6A 4BO4A 3PDUA 1R4MB 1WDLA 3S2FA 1CERA 5LC1A 4Q3DA 2WM3A 2BI8A 3QSGA 2WE8A 4GPD1 1R15A 2VQ3A 3GRPA 4N18A 3GQVA 2I5PO 3HWRA 1GEEA 2BELA 3WQSB 2AEFA 4FB5A 3QWBA 1TVEA 2EGGA 1IHXA 2GN4A 3FNEA 4LVUA 2NNLD 4EITA 2DKNA 4M55A 2FZEA 5FYDA 2ZATA 4DTIA 4D3SA 4YQYA 3O9ZA 5KTKA 4GSKA 4GSLA 2VT3A 3U62A 3NAQA 3IKVA 3FTPA 2PH5A 3KYBA 4UEOA 1LA2A 1XU9A 4RDIA 2ZYAA 3JQ6A 3STHA 1F8GA 2YJZA 4DRYA 3LT0A 4FFPA 1XIVA 5FI3A 3G1TA 3WGQA 2YV2A 1EQ2A 1YWGO 3U0BA 5HRUA 1HXHA 5CAEA 1ZFNA 4CQMD 4NFHA 4BNUA 1GYPA 1XG5A 3BMOB 3AOGA 3GNTA 3KM0A 1CETA 4Q3CA 4R9RA 4DIFA 5I8WA 5DCYA 1XQ1A 3EDMA 3PFWO 5L7YA 3T7CA 2ZKLA 3DBHB 5GY7A 4DPKA 3RKRA 3HZZA 3AW9A 5BT9A 1VL6A 2E4AA 5C3MA 1GFSA 1B8UA 4JX8A 2H63A 4UREA 4DBVO 4BNIA 1D3AA 2E82A 5C7IO 3P19A 4OL9A 4RF2A 1BVRA 1C3VA 3A1NA 4RDHA 1LBEA 4YPOA 1VM6A 4LMPA 3WIEA 2GR9A 4MVJA 4YJHB 2P68A 1T2EA 2X5OA 3H9GA 1MFZA 4MVJM 3U4CA 3WGIA 1LLCA 1LNQA 3F47A 1Q0LA 1KY5A 2YDXA 4XB2A 4JK3A 3WS7A 1GZ3A 4S3MA 3PYLA 4LW8A 3VZSA 5BR7A 5IDQA 4BMSA 5JY6A 4P4LA 1ZUD1 1UDBA 3K2EA 1AHHA 3ONEA 1SEPA 4FSHA 2GGSA 4J6FA 5HM8A 4YYZA 1T2AA 3JQAD 2J3HA 3OEYA 5C7OO 4DVJA 4MVJI 1BWSA 5IFLA 1IE3A 3L07A 2J3IA 4NK4A 3GZNB 4NU5A 3UCEA 2I3GA 3PZBA 4QTZA 1JN0A 1PL6A 3MJTA 2QX7A 1QRRA 5AOVA 2GO1A 1YRLA 3NRCA 5AXBA 4BKPA 1R4NB 4DQXA 2NVUB 1JU9A 5DOVA 3OA2A 5B4VA 4YJDA 3D5QA 1IPFA 3WGGA 5LDHA 1I3LA 4XEHA 1VJ0A 4IDDA 2NU9A 1ZJYA 1HDGO 3ZWPA 3DZKA 4PLHA 4U0KA 1J4AA 1UZMA 4AJLA 4KUGA 1GAEO 1FDUA 2BFOA 4ND2A 2IEBA 1P44A 5L53A 3BZUA 3WLEA 4B3JA 2DU8A 3FN4A 1FDTA 1OBFO 2EKLA 2XXJA 3WR5A 1A4IA 1JQBA 3JQ9C 1WXDA 3FNFA 1RM4A 1FJHA 3KYCB 1E3WA 1QORA 4XGNA 2B4TO 1ISFA 1GR0A 1I01A 1P1RA 2YW9A 4IJKA 4N5LA 4TQGA 4YWJA 5HBRA 1H6AA 3K8ZA 1PS0A 4NDNE 2NVWA 3VH1A 1WMBA 2HMTA 3GA0A 3PEFA 1HYEA 3ZN2A 3ZW8A 4E5NA 5JDIC 3JQBC 2GNAA 4IPTA 3TOXA 4EUFA 1EFKA 5C37A 5JC1A 1J0XO 1I3MA 3LSYA 1Y5MA 2VYVA 2ZQYA 1PJQA 5TLSA 4CM6A 3IJPA 1M6WA 5CEFA 2Y1CA 4MDHA 3W4KA 2JD1A 4QFCA 3OHSX 1KVUA 3GHHA 3BMQA 2ZB7A 4BMNA 1XELA 4Z0HO 3WBFA 1MP0A 1VI2A 2CFCA 4W7IA 1GQYA 4XYBA 4CJXA 1VRWA 2VYND 4IJWA 3ADOA 4W99A 3AFMA 3NEPX 1NFRA 4JNKA 2HMSA 4XRGA 4CLXA 1W0CA 4D45A 3Q2IA 1PEDA 4CM9A 3IDSA 1ENPA 4QX6A 4DXHA 4NK5A 1K3TA 1KVTA 4DREA 2E6UX 1TA4A 4H16A 2Q1UA 2IZ0A 3W8DA 2ZK7A 5ITVA 2BI7A 4XR9A 4PVDA 1DRWA 1DC6A 3AUAA 4JGBA 4P22A 3HFGA 2OO5A 2C59A 3MOGA 3DZIA 4ZHSA 4ID9A 2YFHA 3HDJA 2X4GA 4E12A 1Q2XA 5A1TA 1DHTA 3BMCB 1X7HA 2YYYA 1LDMA 1TXGA 3V2HA 1N7HA 3GN2A 2XXBA 2C29D 2ZTLA 4UUMA 2UVDA 4LGVA 4M49A 3PVZA 1D4FA 1E6UA 2AHRA 2VUTA 4II2A 2IZZA 3CE6A 1EMDA 4J1TA 4B7CA 3DTTA 1C0LA 1ZSNA 1HE4A 1YB5A 1GADO 4WNIA 3ZWNA 1EBFA 1JW9B 1BW9A 3OSUA 1P0FA 3WGYA 1GV0A 2NUAA 3IP1A 1ENYA 5ER9A 4MIYA 2I76A 4I5GA 1I3NA 4ZA2A 4U6QA 1O8CA 5ILGA 4XDYA 3S2EA 3DZFA 5HWSA 2C20A 1D1SA 5JCJA 2DAPA 2J6IA 1E7MA 1WZIA 4J0EA 2NACA 4WLVA 3JD0A 3S55A 3K96A 3QRWA 3QWFA 4PLZA 4ZGWA 3P2YA 4YAJA 4PZEA 1MC4A 2BKAA 4CV0A 1SPXA 2Y1GA 4CM7A 5ICMA 1ZEJA 3PIDA 4OO3A 1LDYA 3CZRA 5H83A 2GERA 3WYCA 4H3VA 4FD3A 4DIBA 1ISIA 2JL1A 2X23A 3D3WA 3RC2A 2XAAA 2OGUA 3V1TC 3NDRA 3FWZA 3KLPX 2Q2QA 1ZIDA 4J91A 4K6FA 1E3WB 4R41A 2AA3A 1V3UA 3ROKA 3VHRA 1SOVA 5IN4A 3A9WA 4UAGA 2BFPA 3R3SA 2JAHA 4NR0A 1X7GA 3PYMA 1Y8QA 2TMGA 4TSKA 4AJ2A 2C5EA 5DP2A 1M6HA 1ZK1A 2I67A 1UAYA 4J1NA 3BAZA 5DT9A 5JAMA 3JD1A 4EEXA 4NI5A 5G2OA 4GQAA 2VRBA 3ZWBA 5FEUA 1O89A 2EKQA 3SJ7A 4BNLA 5TJ9A 2GN6A 4HNHA 1HDYA 5CDGA 3DQPA 2DPGA 7MDHA 1C1DA 4ZQBA 3I9NA 4NJOA 5IDYA 4RF3A 2EP7A 2PKQP 3GG2A 3RUFA 4A5OA 1DFHA 4W6ZA 2O4UX 1I36A 4R51A 4RQTA 3NT5A 4J9UE 4AJPA 4DUPA 5L4LA 1VKOA 4UEKA 2YV3A 3T4EA 3WJ7A 2Y0DA 3H3JA 1OC4A 5CPBA 4N5NA 3JV7A 4MVJE 1N92A 3O4RA 2RH4A 3ZGYA 1WZEA 5JY1A 2GPTA 2CMDA 4CV1A 5KKAA 5TJHA 5FF9A 4FGWA 3HDYA 4MVJD 4EGFA 4KQXA 1ADBA 3F5SA 4J43A 3DXFA 3E5MA 3PJDA 4R1UA 4BQPA 1ADFA 4CMHA 2A94A 2DM6A 4F46A 4UULA 2B4RO 2EEZA 2PD3A 3I9MA 3V2GA 3JQ8A 4AJOA 2PA3A 3HDHA 3TQHA 4MVJG 2GZ1A 1M67A 1I2ZA 4UVIA 4OYRA 1I33A 1LC0A 4JROA 3M2PA 4OSPA 4PRKA 4FR5A 3NT4A 4KP7A 2DFDA 1DXYA 4J90A 4EJMA 4WECA 3MJEA 1WNTA 4NH4A 1UZLA 4CM4A 4E0BA 1LXCA 2UUOA 1BW9B 4FS3A 5H81A 3RJ9A 5DCUA 4BO3A 4PN3A 1OOEA 3O03A 2DBVO 1P1JA 3RUAA 4WEOA 2AQHA 4B7XA 3G0OA 1YS4A 3GGPA 2EJVA 4GX2A 4XQ9A 5F1OA 5I9NA 1P1IA 2FHSA 1KBZA 4NU6A 2QRKA 2B36A 2HMUA 4FQ8A 4L73A 3EGOA 4YAGA 4GBJA 2VOEA 3U09A 1BXGA 4BNMA 4YR9A 5IXYA 2CDBA 5TT0A 5ITWA 3PYXA 3QA9A 1QMGA 4RPHA 2HK7A 3IOYA 2OP0A 4GX1A 4CMGA 1IB6A 1Y7TA 4XB1A 3WIDA 3D4OA 3GEGA 4NBWA 3WSWA 1MXFA 4HX5A 1YE3A 1HLPA 2IYOA 5T5QA 1PJ4A 5KJ1A 4GLOA 4CLOA 4A26A 2O2YA 2TMDA 1MGOA 2ZTUA 5CDYA 2O3UA 4K6CA 4OXNA 1NM5A 1T1SA 2CF6A 2YY7A 2Q4BA 1PWZA 4O1MA 1DDOA 1EUCA 1HDZA 1ZEMA 2WJPA 1R37A 4FIZA 2W2LA 3KBOA 1V6AA 4PRLA 4WLUA 5I7VA 1GTMA 3OA0A 3NGXA 1Y8QB 2VYVD 1X13A 4CM1A 4XYLA 3CSDA 3LZ6A 1NFFA 4QXMA 3EZLA 4ZJUA 1OI7A 3OQ1A 2FPPA 1EFLA 1R0KA 1E3JA 2R2GA 1O0SA 1TI7A 2BLLA 2VZ9A 3VPXA 2CDAA 4ND1A 5DBFA 1VSVA 2V6MA 3TFOA 2IXAA 4DYVA 4OXYA 4R5MA 5COAA 1UP6A 3GMDA 1C1DB 3ZWAA 4JP3A 1RWBA 2DBQA 1C0PA 3IL2A 5L3ZA 3L6OO 5EERA 2ILTA 1DFIA 4IXTA 1KYQA 2D2IA 1Z6ZA 4GKVA 4ALNA 5K6AC 1P33A 3ASUA 3C1OA 4B8ZA 2O4CA 1PR9A 1UAGA 2HK8A 1KEPA 4UVGA 1X0XA 3VPSA 1LDNA 3B1FA 4FCCA 8LDHA 1LUAA 4GH5A 3NJ8A 3ZWOA 3EVNA 4D44A 5JPIA 4FJ1A 1UH5A 2GUGA 3TDKA 3I9KA 4R69A 3BHIA 3PWZA 3NUGA 5DOZA 2FOIA 1LLQA 3AM4A 5EMHA 4DPLA 4E2XA 4U0JA 4G2NA 4PZDA 1ARZA 1NBOA 2ZB8A 1PJTA 3I6IA 1GY8A 5CPFA 2P9GA 3KSZO 3TZ6A 5TIIA 1P3DA 1UDAA 4QO7A 4GGPA 4RLHA 2R00A 2GZ3A 2FMUA 4O59O 5L45A 1Y8RA 2UAGA 4MO2A 1ZSYA 3FCOA 4OMUA 4L0QA 4CM4B 3DZJA 3T4XA 1I30A 1QV7A 1EUZA 2X0NA 5JCJD 4RGBA 1ZVMA 1E92A 4H7PA 5BSFA 3NX4A 1YB4A 4I08A 3PP8A 5JAIA 5TGDA 2DTEA 1FXSA 1DSSG 1YBVA 2D59A 2VUUA 3V8BA 4AJ1A 3EYWA 1NXQA 1BXGB 1YO6A 3E9QA 1V9LA 3OECA 5EESA 2IRWA 3EZYA 4XYMA 4I1IA 1SNYA 4PLPA 4UVEA 3GAFA 2WE7A 3L6EA 1F12A 3RUEA 3VAZA 1ZXBA 3LLSA 3IAHA 2VYNA 1X1TA 1M76A 4L75A 4YXFA 2Y66A 3OIDA 1P1KA 4IZIA 4NZ9A 2AG5A 4NG5A 4XQEA 3W4IA 4AFNA 2Y93A 4CLHA 2FRDA 4CLOB 1XGKA 3NT2A 3L9XA 2HU2A 3DR3A 2ET6A 1WWKA 5BSGA 2Q99A 2J5RA 1QR6A 4IIUA 2UUPA 5DULA 5I7EA 1ZMTA 4PIVA 4TRRA 1PGNA 3DOCA 3TPCA 3WTCA 4DC0A 1HRDA 2V6GA 1N5DA 4MVJP 3F4BA 2V6BA 2RCYA 4P8RA 4TWRA 4MKXA 1EDZA 1NNUA 1YDEA 4OSOA 4H15A 4TKLA 3UKOA 2WD7B 4LVCA 3S1LA 1D1TA 4KTTE 2OZPA 4JCOA 3TZKA 5JC8A 3I4CA 4RORA 1CEQA 4JLWA 3EHEA 2AQ8A 1MFPA 3LYLA 1B3BA 4LCEA 1GQQA 4WNCA 2P9EA 2ZTMA 4CM8A 1U5AA 4OM8A 4RLSA 5TRTA 3DB2A 4HBGA 1BG6A 3GGGA 1ZK2A 4GVLA 2R00C 4OIMA 1EK6A 1HYHA 3A28A 4PLWA 3QP9A 1ADGA 5COBA 1T2FA 4OOFA 3ON5A 1ZK0A 4A03A 2VHXA 3DL2A 2HMVA 4YACA 4DGSA 1UXIA 3DEYX 2GD1O 4AVYA 1BSVA 5JS6A 5GZ6A 3HDQA 1MC5A 5HA5A 2V6FA 1O5IA 1PS9A 3AJRA 5AVOA 3GAZA 1T24A 4CMBA 3JD2A 3BTSA 1M66A 1HSOA 3VKVA 3ZWWA 4BGIA 4CLEA 1SCUA 1O9BA 3OJFA 1YGYA 3A14A 4Q3BA 3D0OA 2PGJA 4TRNA 2Y0EA 1U1IA 1EK5A 1U4SA 1YBAA 3SXPA 2Z1MA 4IBOA 1B2LA 3CEAA 5A5FA 4G81A 2WYWA 2YQ5A 1Z45A 4YRBA 1P1FA 4CR8A 2P9CA 2QYTA 2F1KA 5IG2A 1Z73A 3VVBA 3DMTC 2FR8A 1L1FA 2IODA 2GYYA 3H3FA 3GHYA 2IXBA 1A4UA 1UXGA 4RJTA 3EC7A 3RBZA 1I5RA 4D43A 5B4TA 1QLHA 1S7CA 2POQX 3RC1A 4QUKA 4A7PA 4NBTA 4ND5A 1BXKA 4E4YA 3PLNA 4YA6A 2D0IA 2O3TA 5JDCA 4ZRMA 4XA8A 5IN5A 2IYPA 3N7UA 2VN8A 3DFZA 3UW3A 1H9BA 3F46A 1NASA 4DMMA 1LDEA 1A7KA 2AQKA 3RUIA 1K5HA 2NQ8A 1MX3A 4NBUA 2QW8A 1A5ZA 3H6KA 4IDBA 4BO7A 5IF3A 2P91A 2QYSA 2DTDA 3HN2A 2I66A 2Z95A 2JD2A 3WLFA 2NU8A 2W4QA 4Z0TA 1YDWA 5L40A 2J3KA 3DTYA 5HS6A 1E5LA 2FSVA 2X6TA 3RBXA 1K6XA 2CD9A 1EDOA 2YHUA 2W2LD 3ASVA 3B6ZA 4FPXA 3S8MA 2OL4A 4MJLA 2IDZA 3DDNA 3RUCA 1V3VA 2C7VA 2YUTA 1NPTO 5A4DA 1SOWA 1LQUA 4N5MA 3WGOA 1YVEI 1C1XA 3AI3A 1E0DA 4XX0A 4YT4A 4JJGA 3GG9A 4XJSA 3I6QA 3H7AA 3PWSA 1O6ZA 1V35A 4MP8A 1WW8A 4J3FA 4RVUA 1E3LA 2DUUA 4A27A 5JO0A 1HWYA 5U1PA 4W82A 2VHZA 4DIOA 3QVOA 3KEQA 1R0SA 3FSRA 2EJWA 2PV7A 1DHRA 1P77A 3GEDA 1W4ZA 1EVYA 4B4UA 4J7XA 2XPCA 4HV4A 1F17A 1LTHR 4CM8B 1MLDA 4FDAA 2BFAA 3FF4A 4R1NA 5TX7A 5B37A 1H2BA 4HY3A 5I7FA 1Y9AA 1Y81A 3Q9UA 4ILKA 3SX2A 1PJ3A 5T57A 2LDXA 4MKRA 1KETA 3HFSA 1VL8A 2BH9A 4UVDA 4CM5A 3CKYA 3I9LA 4L76A 5K0ZA 5A05A 3ITKA 3LC7O 3F1KA 1BTOA 3E6AA 4PLGA 1A72A 4BO0A 5IAAA 1NPDA 1BHSA 4BNWA 1UUFA 4NFYA 2YDYA 5JDCC 1PQUA 4GX5A 1V3TA 3AFNA 3D64A 4Z9FA 5JCXA 3P5SA 2X5JO 4E13A 4RVGA 2HLPA 3DWFA 1DPGA 1I2BA 3R0IA 4XD2A 4TMFA 1QG6A 1HSZA 2ZB4A 3CPSA 4ZQGA 3JTMA 2VZ8A 5EINA 5KVCA 1T25A 5JYEA 1DAPA 1GV1A 4IJUA 2OXIA 4AICA 3ABIA 3PHGA 1JLLA 2VTEA 4CMAA 5KJFA 1R12A 2X0RA 3VZRA 4CL8A 3COSA 2VWQA 4LSMA 3I52A 1RJWA 4GKBA 4LCJA 7ADHA 1E7SA 3EW7A 4D42A 1NQTA 5B1YA 1B16A 4WGGA 4DQVA 2EERA 3A06A 1E3EA 4EYEA 4CR7A 1YQGA 1PQPA 1F8FA 1PU2A 1MXHA 3L6DA 4YT8A 3WG9A 3LT4A 5H82A 3CINA 4S1VA 2X9GA 3E5RA 2O7QA 3AM5A 1IL0A 1DB3A 1H9AA 3K92A 5IJZA 1Q0QA 3KSUA 1X1EA 4R3NA 3WGZA 1ZBQA 1YQXA 3ZW9A 3V2UA 5FWNA 3PRJA 2A92A 1KERA 5EQFA 5JAQA 2HUNA 5DP1A 1FMCA 2GZ2A 3DO5A 3LF1A 4IQ8A 4L4RA 4LK3A 2PZJA 2GF2A 4Q3NA 5THQA 1Z7EA 1QV6A 3GC6A 1SMKA 3ICCA 3WNQA 3ZI0A 2DQ4A 4UUOA 2WD8A 2Q50A 1YOVA 1ZH8A 3JQGA 1GUFA 1PL7A 2VWPA 2E49A 4PLFA 3D7LA 3H9UA 1IYZA 1ULSA 1PIWA 1ZKMA 2JHFA 1AHIA 1JWBB 2P4HX 2NU7A 4R3WA 5KJCA 1SAYA 2QZZA 1NTOA 3GOHA 4DQUA 1GD1O 2I9PA 3CMMA 4OH1A 1GZ6A 4LMRA 4HUJA 5DZSA 3RI3A 3KEOA 3DOOA 1I2CA 4PZCA 1C1XB 4R5HA 1DIAA 3GVCA 3C7CB 4BKUA 4EBFA 1RM5A 4NHEA 1HZJA 2BF7A 3JQDA 1XHLA 4D46A 3ZNPA 4IDEA 3FD8A 1YBMA 3QVXA 1MG0A 3CXRA 4IIVA 3LC2O 1Z7BA 3FBTA 1GUZA 3PTZA 1QSGA 4II3A 3WGHA 3UHAA 2WWRA 1NWHA 2JFFA 4BKRA 1ONOA 3DHYA 3R6DA 1U4OA 3OQ6A 2GLXA 2PZLA 3LT2A 3QWAA 3FBGA 1DIBA 2C0CA 4RZHA 4U5QA 2CVOA 4BMVA 2PD4A 2VUSA 4OKIA 1F06A 5BSEA 2VHWA 2B5VA 5KVVA 5B4UA 3PHJA 1KOLA 4CLRA 3ETEA 3R3JA 1E7QA 2Q2WA 1HDXA 2DC1A 3O26A 1LU9A 1OMOA 4B8WA 2AE2A 4YCAA 2G1UA 1NP3A 1YXMA 3H9JA 3UAGA 5EL0A 1T4BA 5L51A 5JBIA 2BD0A 3V1YA 3HSKA 3ZV5A 3QE3A 2P5YA 4BNXA 2EWMA 1QLJA 3MTGA 1BDBA 1U28A 2VHYA 3JSAA 4RVDA 1KEUA 3ITDA 1N9GA 1JDJA 4BUCA 5CEEA 4IJVA 3CUKA 3GR6A 4AG3A 2HDHA 5F1PA 2OORA 2EP5A 3EAGA 5JAZA 3H65A 1B8PA 4HKTA 5DF1A 3WQRA 1NHGA 3JCZA 4FOOA 3C1AA 2ZYGA 2SCUA 2V65A 4E2ZA 3FWNA 3ANMA 4ALIA 1ADCA 3GPIA 5G0TA
chains in the Genus database with same CATH superfamily
3V8EA 5FBQB 1G9XA 1E2EA 1IZ0A 3BA1A 1HT2E 2AX4A 4HH0A 1ILWA 3EEQA 2Q4DA 4V0KA 2UXDB 2E85A 1LBQA 6LDHA 2Z2YA 2IS1A 4J6EA 3QX7A 3ZWVA 3OPYB 2WSIA 4E2WA 1UJ6A 2G7ZA 4J7UA 4IG4A 2MJLA 1N2HA 4BECA 5JHHB 3E9MA 2XXAB 9GPBA 5I5EA 1U5CA 1RQPA 2AW5A 2OLEA 3A37A 4NPCA 1AVTA 1QDLB 2WFLA 2C9BA 3BQMB 2W93A 2RHOA 4GOOD 2I6SA 2BEVB 1ATZA 3GJ7A 4A8HA 3SWWA 4Z3OA 1W4RA 3GWGA 4BO8A 3TG2A 1USGA 4K9DA 3DNMA 1J07A 1L5KA 3RRNA 4AJKA 1DQPA 3VDRA 4NXNB 1Q1GA 3P9XA 2AF4C 2C2HA 4UMEA 5KTMA 5KREA 3ZKWB 2W2NA 4IMPA 3NHJA 4JS0A 1GKYA 1OCEA 1PUJA 4TV9F 1YMVA 1D7OA 4IIFA 4Q12A 3I1JA 3K7EA 1EK0A 4FFNA 2NXJA 2CMHA 4ZGGA 4Q3AA 1A1VA 1TOAA 5EWLB 3V7UA 4U00A 3U13A 4R7ZA 1J0EA 2A9RA 1SD2A 3GNLA 5KNLA 1VBMA 2AMLA 3SVTA 1Z38A 4E3WA 1AKMA 1Z39A 1AMNA 2WM2A 3SC4A 2B8JA 1IVYA 5DX0A 1DU4A 1FFBA 1O96A 4P4SB 3A6EA 1AK9A 2CHQA 2H1SA 2I29A 1KDPA 3GEPA 1JT9A 1AKRA 4XQCA 2PY6A 1YCDA 2P7IA 3AM3A 4D4HA 4AYXA 5DNAA 2I7DA 3UJHA 4LRQA 3EPLA 1JH9A 1FRVA 3TSZA 3I92A 2B8NA 2F62A 2IW3A 3M5PA 4OHCA 4FFRA 1E98A 1W48A 1RYBA 4BCDA 4LJKA 3PXAA 5JQGB 5EJ2A 4N41A 2O1EA 2NVBA 1SY7A 3NTVA 4D0SA 1ZH0A 3LVFO 4BIIA 1T5SA 1QR2A 2IYWA 2XEXA 2QR5A 1Q20A 1U2EA 1Z0UA 2PXAA 4MV3A 2PT6A 1JA9A 4PYKA 4QEDA 3NJ4A 4J2TA 5A4KA 2CUNA 1QYXA 2O8FB 3QX3A 5TGTA 4CLRB 1V16B 4ZRNA 4F0JA 2DJIA 3VR6D 4GI7A 3WJ2A 4DM7A 4MB0A 1FEZA 3HBJA 4EK9A 1CNEA 1XZQA 2R8ZA 1AKUA 5BN3A 1EFTA 4N3GA 3T1TA 1QYCA 1GSOA 1PGOA 5EC8A 3CZMA 5EIAA 3ZWMA 1XRMA 1C0KA 4EHDA 2GN8A 1SUCA 3ETGA 4MP6A 5CTJA 5DISB 1T43A 2NM0A 3G79A 4BFSA 2QB5A 1X1CA 3EARA 5A4MS 3SKXA 1T0UA 4YDRA 5B6PA 3B6KA 4PZPA 4HGQA 1XEAA 4RV5A 4ECAA 4XIJA 2R5WA 2PRYA 1LGYA 1ZC3A 1YZNA 1PHPA 3GBPA 1W2GA 2GA9A 3AIMA 1PZHA 3D3WB 3HL0A 1DXHA 5CGZA 4JYMA 1FDIA 1N9GB 5HF5A 1U5BA 3EVEA 1T0JB 3PPIA 3RVDA 5AJWA 5FA8A 3K1JA 2BWJA 3LYAA 3MT9A 4AJEA 4H6VA 3HMQA 4BOYA 4KFCA 1WXIA 3KVRA 1PTJC 2WDZA 4BP8A 2HSDA 4C4PA 3KLOA 3S99A 1QGDA 2COUA 1G8SA 3WV4A 2XNDD 2QMEA 4YY3B 5AVYA 3Q9NA 3QEBZ 1CF9A 2GILA 1AKTA 1HF3A 2PMCA 5LUBA 2ZS9A 3DEJA 4Y2RA 4Q9NA 4RX1A 4PHHA 1B6RA 2XOXA 3OBBA 4IDGA 4ND7A 5BNFA 3GMIA 2WLTA 5KYNA 3PPWA 2V7EA 4WK4B 5ALWA 1T8TA 1EE2A 2ESRA 3K1YA 2R4UA 2OCXA 2R62A 4S0ZA 2JFHA 3FUVA 4M9UA 2EG5A 2YVUA 3PGLA 1L7QA 4QGFA 2IYXA 4OAQA 1W9MA 4XH9B 2X1HA 5H9VA 1L4MA 1QKKA 2J6BA 1TIBA 3A6LA 4HYQA 2DVMA 3VZPA 1CIVA 5L7WA 1B0AA 1VHQA 1FFXA 1K8ZB 1DFGA 3W2TA 2Q4OA 4K26A 2B4QA 3R1IA 4OQFA 3OLCX 1SKQA 4C87A 1ZOOA 4WKGA 4F1KA 4JI8B 2G76A 2XIQA 2Y68A 1W34A 1ZONA 2DHDA 1LVHA 2YV5A 4U6NA 4EA7A 1NY5A 4ZK6A 4KUHA 3B6EA 1QP7A 4K6MA 4HGNA 1M2FA 2UYYA 1KC1A 4V3BA 3DONA 3K71B 1NQUA 5AVWA 2PE5A 2M6KA 4X1YA 4L1KA 3M1AA 1C2TA 1YA6A 2HQOA 1YUNA 4N9QA 4J1QA 2ABWA 3WA6A 4BMYA 3FTCA 4EI2A 4H18A 4FHZA 1PVVA 1XCPA 4NDZA 3WMWA 3WWOA 2GHRA 4E32A 2Z04A 4PQEA 3Q5GA 5BT8A 1HL3A 1KZ9A 2ZR8A 3C8UA 3HB4X 5LCXA 3SBDA 3NWBA 3TTWA 5C8ZA 5CA0F 1Y9DA 1R0BA 4O1IA 3E4CA 1QVRA 2XAUA 4I9FA 3HJCA 4M21A 3UZUA 3W78A 5AW1A 1IVSA 2DFTA 3KRTA 5EYPB 2A6PA 4BEVA 1KMIY 1ONPA 3DVSX 3MCAA 3DHWC 2XQJA 1FLDA 4YCDA 4I50F 2IA5A 1DEHA 3AW8A 5FUXA 3QEMB 4MLDA 4OHWA 3GPDG 5G1PA 5C1OA 1NURA 5IYZB 1GU7A 2NNWB 3PD7A 1DUSA 1G64A 3HBLA 1GKIA 3X1WA 5JLAA 1XQVA 2BTEA 5CBPA 3BUSA 1E5QA 1KBQA 4PV7A 4ZTZB 5AM5A 2JFVA 5KNDD 3ZXIA 4LOHA 4Y98A 5TF4A 3RS2A 2WJ4A 4L9RA 1TGYA 5EFZA 2IIBA 1XNHA 3F9IA 3O93A 4FC7A 4KQWA 4O5OA 2YIJA 4AT1A 2C4TA 2Y67A 3MTJA 1O0CA 1TM2A 3AR6A 3D0KA 3DSRA 2GVZC 2O2IA 3IP5A 4HDNA 4O08A 3T61A 1AQNA 4EG5A 3U37A 4TKVB 4F2WA 4X62B 1WQ1R 3A4IA 2ZITA 3DR5A 2ZSUA 2DECA 4QECA 2JGRA 5FPKA 1Z4OA 7REQA 4RDXA 4FE3A 4D79A 2ZSAA 1G7RA 1Q7CA 2PV0A 1GPJA 3TWOA 3HE3A 3VRHA 4BU1A 1XA4A 1F6WA 2OHFA 3BL8A 1JR4A 3CRVA 3IEUA 4DZTA 1Y37A 3HBMA 1EJBA 1TF7A 2JFYA 3PICA 3F67A 4HH1A 1QQ5A 4JMLA 4Z86A 3IE0A 4C0XA 1IN1A 1PG2A 3W2IA 3UKDA 5IANA 5T4BA 4F9FA 2MYUA 1PS8A 2ZJ3A 1IEWA 1YS9A 5DI3B 3SQOA 3TZBA 1XDGA 3V7YA 4R1LA 2AE1A 4I1YA 2VJYA 4AJ9A 1JTVA 4H7DA 1M2KA 3SOZA 4FX2A 3E27A 1P19A 1EX7A 4BJ3A 4BKQA 2VPIA 3UT0A 5EJ9A 2O8CA 1DLIA 4TV9A 4B87A 4KRXA 4YHBA 1MH9A 3JATA 5EP4A 3R7WA 1KJ8A 3GZJA 2CLDX 4XIYA 1WMDA 5J2TF 1O94A 2WYOA 1NX9A 1QP0A 3QI2A 2JNWA 3H6GA 4TVOA 3P0EA 1R00A 3FW1A 5KU1A 3CX4A 3U5ZB 1OH8A 3OQPA 4MYUA 3FVVA 3M7IA 4COKA 4ARIA 1J0DA 2YJNA 3JASB 1A71A 4XYEA 4QO8A 2WQ6A 4ZO9A 4ISCA 2FPPB 3H97A 3Q1LA 3HA2A 5LNK6 4J2HA 4N3AA 3OJXA 5A04A 4IGIA 1EBUA 1JFLA 1VHLA 1YVUA 1E5XA 1HI9A 3V8RA 5BV8A 4JIMA 1LX6A 2LIPA 1BU8A 3ROPA 3UMYA 3M9WA 4UU7A 5HIJA 2IU3A 9MHTA 1TTQB 3B8HA 2FPKA 4B4OA 1I4WA 1YRQA 1TB4A 2PMBA 2V9ZA 1C8BA 4GF5A 1JEEA 1QRDA 2HMWA 2WUFA 1DKQA 1RYDA 2XTMA 4MP3A 4UFOA 2XWJI 2JFZA 2Z30A 4JJIA 3RPEA 1TLLA 2JIBA 2WUGA 3DLIA 3X2FA 1J2UA 5AI5A 5AJVB 3PZRA 1FP2A 2EKPA 3FFWA 2OZKA 4GW3A 4XM2A 1XUOA 4B80A 2DHEA 3W06A 1ECBA 1RZUA 3EQ7A 4G4SP 5TGZA 3WB0A 4YN3A 2J5QA 1U1DA 1K7EB 2EL7A 2ASEA 2UVPB 2ZI7A 4KOAA 4L9WA 4NMWA 4BRWA 3PC6A 1AQIA 4DMGA 1P7PA 3VPGA 1F1BA 1VIMA 4U2GA 4CKZA 2J9XB 5K8IA 1K0FA 2FR0A 1GZDA 4N8SA 2QQ5A 1P2VA 2P2LA 4PC6A 5TPWA 2AI3A 3KDAA 1CS0B 4ZV9A 3IEXA 1E2FA 4YT2A 3LXUX 1ZGZA 2BMDA 2QMZA 2ZVDA 3AUJB 4HYYA 2GM4A 5B58T 4R0NA 4FKMA 2J6CA 4L4UA 3U5TA 2X6RA 4MOWA 3U7QA 5I7AA 4XPZA 1G4HA 1WTAA 3DAOA 3ONFA 4NZPA 4C1BA 3KB1A 4R98A 3I0MA 4DJDC 3B1JA 1Y3IA 4R05A 1Y7HA 2I6FA 3H9BA 2NW6A 4LY9A 2JH8A 3COWA 4O33A 5DDIP 4DDKA 2PZFA 3CYFA 3RHZA 2OQRA 4L5IA 4P36A 4A8JC 1IY2A 1N78A 4DBZA 2JDIA 2JHGA 1K1EA 5BOVA 2RD2A 3DEZA 2HM7A 2YJTD 5IKEA 2CNBA 1PVDA 3HP1A 4KK3A 2LCIA 3TRFA 4A8TA 1Y8RB 4K9SA 3NZEA 2R68A 3ZY2A 5C1IA 1IN4A 1KQNA 1J8MF 5KHOC 2HCTA 5DM4A 3SYMA 2VAPA 3M9XA 3ADBA 4WCVA 3ROTA 1VMEA 4UNQA 1ZRHA 5I9LA 2A0KA 3JYQA 4MYCA 2BHRA 2Q1SA 3GGJA 2B30A 5KX5B 2X5KO 3BWEA 4X6YA 3PX3A 1SBIA 3LWNA 3G17A 5CTAA 4EDHA 5IBPA 3M6FA 4DC9A 1XALA 2DR2A 5JAUA 3PB3A 3PHHA 4ZQFA 5L3QB 2FMTA 2OKGA 2UZ1A 4URVR 1HQYE 4GZ5A 4R8KA 4DJTA 1EVZA 4DR5B 4EYKA 4Z8XA 2OHIA 2PGOA 1MKYA 1VYVA 2GBFA 3MMSA 4OHKA 4CWAA 3KUCA 4R71A 4EQZA 2PRZA 2W2OA 4H60A 5B12A 1OFIA 3BBPA 6ADHA 3F96A 1VI6A 2BMWA 4R1SA 1S9HA 1EJ0A 1DQSA 3L92A 2JA2A 3IR5A 1SUPA 4HG2A 1I7DA 3KYIB 4NFSA 1RRMA 3A1DA 2LIVA 3T7EA 4A8JB 4YJFB 2BEUA 2BCGY 4J16A 1IBSA 1T6YA 4KPEC 2BRUC 2CUTA 3KHTA 5EXDA 2A1TR 5E2BA 3IDOA 2ZU0C 1BMQA 3EA5A 3L77A 3INTA 2E89A 3K70B 3IR6A 4YMLA 1R6DA 4RIIA 1PUIA 1UXJA 3RU7A 4BU0A 3ORFA 3BEDA 3QVGB 1ISMA 4LZNA 4YB8A 3BCSA 3R9IA 5ER6A 3TF5A 4RHFA 4G0XA 2AJTA 2IZ7A 4NLLA 3EXFA 4NX2A 4WOBA 1WMSA 1CZRA 4CF6A 3CWZA 1TT7A 3PBKA 4ZI7F 3REGA 1B1CA 2CJXA 2PXHA 1GG8A 2JIQA 1T8WA 4N5HX 4Y6SA 2I2XB 5CA0A 1PNTA 5I4CA 1RI1A 1X87A 2WNIA 4AF7A 4QOEA 4ARZA 2L0XA 4KIWA 4BFCA 1FB5A 2IOYA 3R5HA 4IEIA 3H0KA 1J49A 2PFKA 4CODB 2J9YB 4RTLA 4LOAA 3CNLA 2QN7A 3QWHA 4B2LA 4IMJB 4PXSA 3OPNA 3GVHA 4PTLA 3KKZA 3I9JA 4XLZA 3P0JA 2JJQA 1IEVA 2G82A 2HWWA 2XHZA 3D2BA 3MGAA 3A4LA 4HTAA 4I50A 2ZYRA 4UQPA 3ZBTA 1OWLA 1QIIA 3QU2A 1KKMA 4ZVPA 3ZEIA 2KQUA 3IHLA 3D54D 1DJQA 3CF0A 3DHEA 4M1EA 1R3UA 3BIOA 1XTPA 4KK4A 2FPGB 3SC2A 1HDRA 3I4LA 5B2EA 1NSYA 4PINA 2P2YA 2JGFA 4X9XA 1MX9A 1VE3A 3PITA 4PLVA 3VSDA 4ZKDA 1CUVA 3QV2A 1EZ4A 3B85A 4HDOB 3PQFA 3NXSA 4KN5A 1FLAA 1ZVKA 2H7YA 3ETNA 4X8OA 1Q44A 4V0RA 5DMXA 5DYWA 2QP9X 3R0XA 3UN1A 4AP6A 1FRNA 2AC4A 1KSHA 3OZSA 4B3DA 1SUDA 4QSHA 3JU3A 2ETVA 1VI5A 3MJVA 1OH5A 1VIDA 1JHZA 1GNSA 2VNAA 1Y3CE 1B14A 1ZLYA 2OMEA 3S40A 2CVFA 3SC3A 3HJFA 2YVQA 5JU6A 3NUQA 4WERA 1JBKA 3SVLA 1RYZA 3PI7A 4XAQA 1Y80A 1SCUB 1RMYA 2Z3VA 3GH1A 5FV4A 3BSYA 3ICPA 3NPMA 1Y8CA 4QGSA 1XD8A 1YL5A 3BAFA 3TFWA 3M6WA 1YL7A 2QORA 5ES3A 1XTIA 1Y7IA 3HJGA 3VDQA 4CFYA 1AJEA 1E4EB 1NVBA 3QJ5A 3ROQA 1QKJA 2PKYX 3TNJA 1I5EA 4PG7A 2PUVA 1ISRA 3GNQA 3RBVA 3QSYA 4NONA 3MB5A 4NCXA 4OQDA 5JASA 1QP8A 4J0KA 4H59A 3BF8A 3H9EO 2E48A 3ZDZB 2H7CA 1WMEA 2AJDA 3UOGA 2H4FA 3AEXA 4EB8A 2ZQZA 2A9QA 2XUAA 5FWXA 1PX0A 4BQRA 4B4VA 5HRAA 4J4TA 5J2TA 3RRZA 1O03A 1GZ5A 2GCPA 2WILA 4G4JA 2GJ4A 3LLVA 2D54A 4BZQA 1GARA 4L15A 1OZGA 2R6JA 1SCJA 1U9IC 2BFDA 2YHBA 4OOEA 4YAWA 5M04A 4GOLD 5JMPA 2O8DA 4KQIA 3MSCA 3FSEA 4HH3C 3WX0A 4B3CA 3TW0A 4DRZA 1C9NA 1TT5B 2GCOB 3BL5A 3G6KA 4OQYA 3TR0A 3SG0A 1CTQA 1Z6PA 2P4QA 4ZU3A 3LOUA 4ZYWA 1E2MA 1OE0A 2C07A 1ORRA 2QIPA 5FR2A 3VFDA 4Z7JA 1PT7A 1U3VA 1E8NA 2FGKA 3I83A 4IOJA 4KWHA 1XA0A 4N40A 5F5LA 1KP9A 1RJ9B 3D2LA 4P84A 5IBRA 4NCBA 3CUYA 5FBKA 4MDYA 1AGNA 4QGHA 1EUDA 3EQ8A 1PQYA 1D8TA 3PJEA 4ACBA 4EB3A 1CYDA 2F1RA 4G8BA 1KI7A 4EW6A 1BOFA 1SXHA 1NJFA 1XXHA 3AEUA 5EKTA 5TVKA 4UZFA 4P33A 2PHZA 2CF5A 1T1EA 3KYDB 1DAGA 3NHLA 4B5KA 2H7VA 2RHTA 2ZRGA 3OMWA 4IKOA 4ENTA 4FDVA 1FMFA 3A6PC 4RQBA 3IQWA 4JJFA 4K28A 1UBEA 2CEKA 3HUDA 3N5CA 1P4GA 1XN1A 4EHFA 3RABA 1KTIA 1MOPA 3LVBA 3G2IA 3TNLA 2YCLA 4OSEA 3T0IA 4B48A 1J0AA 1OXXK 3B6IA 5JAHA 5K8CA 2XUGA 3L4SO 2CVQA 1JG2A 3V6MA 3CCBA 2EZTA 1ML3A 3HSSA 1SC6A 3DBLA 4BQSA 1QJ4A 3HBAA 1KDYA 1SQFA 4HQ6A 3ZE0B 1XTJA 4RXMA 4CZ2A 3IE1A 2R7LA 3B5EA 4NESA 2ZB3A 1XN4A 3HLYA 1RYYA 1IHPA 4FGJA 3C3EA 1OI2A 4QDKA 2X2OA 4A1OA 1SXPA 1SEVA 3L05A 2OBNA 4WINA 5TVGA 3MB8A 3P1JA 2V8BA 5FCDA 1LWNA 4B73A 3QF4A 2SKDA 1ZG3A 2ZUUA 2ZIVB 5D1HA 3M1LA 2HEGA 1QS0B 3PHIA 2PMFA 3BFVA 3R23A 4RPLA 5AHRA 1C9EA 1I1OA 1NAIA 1UBCA 4M0FA 3ZNOA 3ZCQA 4F5WA 5ITZB 1SVLA 4FMCF 4TTQA 1X9HA 1OWNA 4MJ3A 1E1MA 1V95A 3IJ5A 1NW9B 3QG5A 1E2QA 3R5KA 2Z1NA 4HPXB 2BHLA 4UBMA 1WB9A 4EA9A 2MSKA 3ETHA 3P0IA 4IF4A 2O5CA 3KIPA 3QKIA 2WYVA 2JIDA 1L4UA 3I6BA 5E6RB 4XB6B 1NLUA 3WFJA 4M9SA 1W52X 3LC1O 3BWYA 2X40A 1KR2A 4UU0A 2Q5OA 5AKXA 3ZW7A 1QK3A 3GN1A 4IWXA 5C1BA 2VPQA 5BN5A 1I0LA 1BYUA 2Q21A 5EJEA 3NBQA 2C4WA 4NNPA 4FZ3A 1UIMA 1Y48E 2NSJA 2FP4A 2PZ8A 2QSZA 4WA7A 1JFVA 3IPXA 1NQWA 1MVNA 3QH4A 4FC6A 4MW6A 3VMMA 4ZV4A 4YAEA 5EEGA 3BE6A 1M54A 1M5TA 2A30A 3CWQA 4HUQA 1RTTA 5EOVA 3S7ZA 1AXGA 4QE3A 2IYFA 5DE3A 2AOTB 3TLAA 2ETXA 3OO0A 5J43A 3OH8A 4QQRA 2YYSA 4N0DA 1U7PA 2WWIA 3L41A 4X90A 3KQUA 4QQFA 2BHTA 2QD5A 2X2EA 3CVXA 2JDID 3TSYA 1PGJA 3RU9A 3Q8LA 3NMUF 2XHEA 1N0HA 3PF8A 1MVLA 1YC2A 3ETDA 1T6XA 5E4JA 4HNGA 3HCNA 4BNYA 3C3DA 3GP3A 3TW8B 1C29B 1G41A 2EF1A 3DNPA 3IDAA 3UK6A 3HXLA 3I58A 4PC2A 1XHEA 5G4KB 2BP7A 4YFVA 2PT9A 4MJ7A 3F71A 2PGLA 4ESOA 2A9FA 5CH5A 4D8TA 3IXLA 1I4OA 3MBKA 3OTHA 4ZI7A 4ER7A 4DV4B 2IQIA 4Z9XA 1RNLA 2H7XA 2X8BA 3EFBA 3G88A 2XUQA 4XASA 4QYSA 5EMMA 1CFZA 4MWDA 1CJCA 2LR0A 2QWXA 3LNCA 4KWIA 3MEQA 4FMDB 3GUVA 3P2KA 3L6CA 1M2VB 1USWA 1M75A 4OCZA 2JAQA 3BXXA 4BQEA 1L9KA 4CTNA 1CYEA 3EUEA 2H9YA 2Y1LA 3JD3A 3SSNA 1FVHA 4E22A 1DC5A 4HLCA 2XD9A 4P86A 5AKIA 2IDJA 4KN6A 1WPRA 3W3ZB 1ND5A 1V9CA 2L18A 3AILA 4TS1A 2MYNA 1NVFA 3KT0A 4DJAA 1ZWLA 2IBSA 1OXMA 3AVPA 1ABFA 1TCVA 3I2GA 4R54A 3LHIA 3PHLA 1E4VA 3PEUA 3VKFA 3WNVA 4F6RB 2DLDA 2GTHA 4Y2PA 2RH9B 3HCAA 3UEOA 4WX2B 5T64A 5K8UA 1GU0A 2PXXA 3TBFA 1ZK3A 4PSVA 1J90A 3HVJA 4X54A 4F21A 3QKSB 2PS0A 4FBGA 1L8XA 1TCBA 4G86A 4PX2A 4UHJA 1WXXA 3U7IA 3OMXA 4XFJA 3JR3A 2Y3IA 1D2HA 2C92A 1MCZA 1ZM9A 4FR2A 1DC8A 1JP7A 2Q2NA 9LDBA 2A57A 4EG0A 4UXJA 3TL2A 1EM6A 4EO4A 4M89A 1SVIA 2IGTA 3AJAA 3ZI4A 2W58A 4BZXA 1J5XA 4F1JA 4CCAA 4CDNA 1T5DX 3RKUA 4NJMA 4XPIB 3STYA 1XKQA 3B3FA 1BS2A 1QGAA 4PZ0A 1T26A 1KARA 4TYWA 1PK8A 1UKEA 1FTWA 2J32A 1CDOA 3DB1A 2MYPA 4HQKA 4IDFA 2Z43A 5AM1A 3VJKA 4L9SA 4M0PA 2OZEA 3HHPA 2FZLA 2QD1A 4D3XA 3ICQB 4B3SB 1HZZA 2CBGA 1RPJA 5JSYA 4ZALA 3ZHBA 3MMXA 1XR3A 1FW8A 2OZLA 3PXCX 1XAHA 4I5EA 1YH3A 4WEQA 3WDMA 1TJ5A 1KAHA 1A5SB 1W87A 2LP4Y 3WLRA 4AKSA 5J3JA 1T9KA 4KYIB 1UBNA 1S3FA 4UMVA 1U2GA 3FFTA 2FUKA 1SVKA 1EI9A 1DRKA 2OOSA 2WSBA 2OD2A 5ALJA 4QEKA 5EZSA 1Z6AA 1IAQA 1YCFA 1PTKA 3U9SA 1WSBA 3R9WA 1S02A 1IQRA 1W46A 2AZDA 3MPOA 4JBGA 2W98A 1RYMA 4OBBA 1YL6A 4BFVA 3SIWA 1SZDA 3QVTA 2JJ2D 2HD4A 4X3CA 3UQZA 3M1IA 3AVVA 5A3JA 4E94A 1SVUA 2EFDB 3PIIA 4RF4A 3N8GA 2P30A 2OP1A 1X8XA 3EFOB 4G65A 1MO2A 3KL2A 5GJWC 3R5XA 4LPSA 1P7VA 5EWJB 1AF7A 3MWKA 1AHNA 2WU3A 4ZV7A 3ZGZA 2W6NA 2XUZA 3ASZA 2W37A 2W43A 3PLRA 3QLJA 4HDRA 2RSLA 4LK2A 2CNNA 2FDCA 1NC1A 4O2BB 2CXUA 4ZARA 2WKWA 3FVQA 2WUVA 1IBCA 1KL7A 4LSWA 4S12A 4EKIA 1TZJA 3HQ4O 4QNNA 1GQ2A 1JWAB 3KTDA 6REQB 3A1VA 4ZEWA 1SUAA 2HPVA 1HE5A 3DE1X 4RH3A 5ENZA 2BE9A 1QGOA 2GLTA 1DI0A 4WLNA 2NX2A 5EKXA 4LRXA 2NTNA 2B0CA 3QMPA 3WS7A 3RNLA 1A9PA 4KDEA 3C16C 4EUSA 3F7OA 4IYRA 1JR6A 1EQAA 3NDJA 1CB7A 1D2CA 2B9VA 1XMPA 1O9GA 1X1SA 1C5KA 2DLNA 1B93A 2OO3A 3INRA 3NHSA 3O7WA 5F3WB 3EULA 3I9FA 1E6WA 1PEYA 1GQRA 3K0CA 4F9EA 3ZD6A 2Q28A 1C41A 1UWCA 4QUGA 1RCTE 2OGSA 3BE5A 3N2LA 4LFCB 2X0EA 4KR6A 4JB3A 1DV1A 2H2GA 3V4ZA 2CMKA 1UK8A 2DR3A 4AZVA 1JEYB 1UP4A 4JB0A 3RF6A 1XWIA 4S1WA 5E8RA 2EDAA 3ZHVA 1UWKA 2A0UA 3MOSA 3P2MA 5HIKA 5TS2A 4F38A 2JKVA 3ROGA 4WUVA 1M9NA 2K5UA 1U3UA 3FDIA 4P7JA 5JWOA 3RF7A 3H2SA 5KNCH 2KBFA 4LXXA 3Q6IA 4DCCA 5DGXA 3AC0A 2WUEA 3U19A 1T2NA 1WSAA 2XRMA 3BHMA 5ICCA 1KDRA 3BGWA 3U4QB 3IPYA 4OA5A 2PD6A 2WU8A 4FGSA 1P3JA 2WHRA 2V54A 3HKEB 2JI4A 4BVGA 4N7BA 5CA1F 3QEKA 4J29A 2CXSA 2GD2A 2GK4A 1JAXA 4MKIA 1BMDA 4GYJA 4XIFA 3EA4A 5KYUA 1EM8A 2HDWA 1B0ZA 4BMPB 5CDTA 4F72A 1RHKA 1XNQB 1XCBA 2B0JA 2D2FA 4O3FA 4C4YA 2G5CA 3RUHA 1CNMA 2JRLA 3NGMA 3O5AA 4Z3KA 2XWBF 4G8CA 2RI0A 2AMFA 1G59A 1YZUA 2IYAA 2ZYWX 4L02A 2VLBA 3C3XA 3TLCA 4CL2A 4EY5A 3NGLA 3BQ9A 4CM9D 3OE5A 3UFXA 1N7JA 1IVNA 2OHXA 5FBVB 2H4HA 2H1IA 1V11A 2B83A 2H29A 1LBSA 4OGKA 2DY0A 3ILYA 2OBFA 2QMYA 1IJEA 3S2YA 4PBTA 4F5YA 3I9V6 1ABBA 1N5KA 3KLMX 4DCMA 2A9VA 4LZLA 3FWHA 3TPZA 5TSDA 1E1KA 1RYNA 1TD1A 2CXNA 2JGKA 5CXXA 2EW8A 1KEWA 1DRJA 3GYGA 2B1IA 1J97A 2X14A 5ENDA 3REQA 1MB4A 1U90A 3NNNA 2VT6A 3CT4A 3T7SA 2ZRIA 2XNHA 3R4VA 3ZHRA 4CMJA 4E1AA 3BC1A 4G4IA 4Z53A 3ZWXA 4QZVA 4QUDA 2IY7A 2ZJYA 3PFHA 5AXCA 3SIPA 4U7WA 4B6EA 3LW7A 4NYMQ 2Y99A 2YCBA 3MGCA 4JC0A 3LDHA 4KW7A 3LKDA 2QRPA 5CEJA 3LHKA 4X84A 1MD9A 4FOSA 1II8A 4DE5A 3MYYA 4GR4A 2IPNA 4KBGA 5AKKA 5B2FA 4JJEA 4NEQA 1U8ZA 5IVHA 5GV7A 3TIVA 3R7DA 1XU7A 4AY4A 4U7HA 1YE8A 3VSBA 1HA3A 1UPTA 3L01A 3N7TA 1BH2A 2EWWA 2QZSA 2WVAA 4UVHA 3EA0A 5H59A 2VCYA 5E2IA 2GPYA 4Q1FA 2AS0A 4FFMA 3WNBA 4ZCMA 5HP4A 1B8VA 4JJZA 4P81A 3VJRA 2OFWA 4JB8A 3R09A 4ZHQF 4E30A 5EIHA 3H1TA 2WYUA 5EE3A 2PSFA 1TM5E 3MJSA 4C21A 4CKXA 4CIYA 1R4ZA 2PUDA 2B9EA 2PLAA 3BOSA 1NVMB 1VA5A 1RP7A 4R0MA 1E4OA 5K8VA 2G63A 5BVHA 4GM0A 5KJ6A 3X3HA 3QUAA 4W1QA 4LV6A 4YAKA 2FV8A 2OESA 5KVSA 4XOIA 2R47A 1NP6A 5LU9A 3DWIA 1FFSA 5B36A 2FN3A 2Q45A 3PXUA 4M9QA 4WFIA 2BR5A 1RFGE 4DOMA 1AMOA 1EGQA 1K8YB 3GLRA 5L7TA 3VA7A 3ND5A 1A8QA 1J70A 5ALZA 1A27A 1LPBB 4RK7A 4TRJA 1DJNA 2VT7A 5D51S 4MR7A 5EE1A 1C7QA 2O07A 5CB8A 4D4GA 1RBYA 1OTHA 1T6BY 3VTFA 2PYDA 5HKAA 1G16A 3IESA 1JVBA 4BAGA 1AX9A 3B9QA 4HRXA 4I5DA 1J7JA 4K6HA 1THZA 4IH9A 3LKBA 4W1RA 2AR7A 1RYEA 3BMNB 4D9FA 1QG4A 4E2YA 3GCZA 4QBKA 4MDFA 1FXWF 5AT1A 2AKAB 2G88A 4FFOA 4TZTA 1DXQA 4RPJA 2DG2A 1M1YA 2FWIA 3CTMA 3MTAA 2WM9B 2QE7A 2OLJA 2FX3A 5AK6A 5K9ZA 2NO6A 3AF3A 4KCGA 3HRHA 1NSFA 3PC8A 2QE6A 3X2SA 1FFAA 4JL8A 1GNTA 3EVGA 3PDIB 4F6LA 4ER5A 2BV3A 4N7RA 2VDKB 1SHLA 2H00A 2W71A 2DUWA 5JSFA 4YS6A 1IJBA 4M22A 3AESB 1V7PC 1ZCZA 1CNFA 4YJHA 1C1HA 1JIVA 4JLSA 3GZTB 4MEJA 2PBFA 3ZGLA 1J2JA 5EJIA 3UFBA 1ZU4A 2BMVA 5TY0A 3VHLB 3C3YA 1V1RB 5FX2A 1J25A 4FHEA 1BDMA 4HVCA 1Y6RA 3VTAA 4J4HA 1YZTA 4I3FA 1Z35A 1YQDA 1DKMA 2XWSA 3A3NA 1G1AA 1B4DA 1CRLA 1QG0A 1OLSA 1XMXA 3NBXX 3IAUA 3ZJ5A 4C6TB 1IUKA 3HU2A 4IXMA 4NZZA 4IO1A 1W96A 4U4AA 3ZU4A 1IMJA 3O8RA 3H11A 3EZ6A 5IDXA 4KTVE 1SRRA 4GMGA 5IMBA 1XRRA 5IBQA 1GKUB 5D6OA 4D80A 1KQGA 1X8LA 4R8MA 4X1IA 1U8XX 2CL5A 2WHEA 4NPHA 2OXTA 3NUZA 4PYLA 4F4HA 2JS7A 3F6YA 3O94A 3RB8A 4Y2QA 3GLIA 2P65A 3L0BA 2ILVA 3IOMA 1NATA 3SLRA 5HDBB 4PLCA 3KQOA 1AIPA 3TOZA 3LUAA 1CX9B 4ZEXA 4BB6A 2E37A 4O2AF 2BI4A 4EX6A 3AETB 1U8TA 3WWCA 5BOSB 4J4BA 4PAQA 2BGUA 2FU5C 5ISMA 1Y5IA 1VHJA 2ZR7A 1XDSA 3GLTA 1GT6A 4Q9IA 5H02A 1SBQA 2WYHA 3FNHA 4GDMA 3SS8A 1I24A 4Q4AB 4U2DA 4J3NA 1Y1KE 2JLRA 2WJWA 4C14A 4DM4A 1OI4A 3ZIUA 4C7JA 4FSXA 4V0ME 1C7EA 1Q7GA 1WE2A 2VF2A 4ZN6A 2P40A 1WDLA 3S2FA 1QBKC 2R11A 2B82A 4EG7A 4MSUA 2G40A 4G6ZA 3TOCA 2WM3A 1PAUA 1WXEA 1I5OA 1ZHHA 2WE8A 4BLQA 2PUWA 2GPBA 2XZDA 2XUJA 4N18A 3GQVA 2CDNA 4G8JA 2EFEB 1PG0A 2I5PO 3WQSB 1I1QB 4RELA 4FB5A 4A6DA 5JZOA 3JAMA 1X1AA 4N3CA 3NASA 2DKNA 3NTXA 2JVJA 5CM2Z 2C8JA 3EZFA 1BN6A 4BX2A 5CA1A 2LW7A 3KCNA 2FQYA 2XQKA 1TYZA 3OTWA 4ZP1A 1USIA 2N9UA 3O9ZA 4GSLA 2JASA 4RW0A 4X63A 5DNCA 3U62A 3NAQA 2PKEA 4HN2A 1JNXX 4XFKA 5TV2A 3G8CA 4C3ZA 5ULLA 3OZRA 4C0AC 3N6XA 3OCWA 3T5DA 1EX9A 4XVHA 4RKRA 2LCFA 3IVMA 4C5AA 3JQ6A 1K8QA 4G0MA 3DCJA 3SFVA 3STHA 1I7NA 1V1JA 3FNIA 4DRYA 2YXBA 3C3KA 4FFPA 4WCFA 4ZCSA 4BZPA 1V37A 2MSLA 1KQPA 2XKJE 2YV2A 4K9MA 4QOSA 4CIBA 1YWGO 1F5SA 3U0BA 3ZDEA 4TMYA 3K20A 1RLMA 1WPGA 4LE1A 1HXHA 4O4LF 1W30A 4E4RA 2GPNA 2GCIA 3VNVA 1R2QA 1DTEA 4KX5A 1RQ7A 3DEFA 4M0LA 1D6MA 3B9RA 1Z33A 3IKMB 2UZ4A 3LLMA 2Q27A 4Z1MA 4BV2A 3V1LA 3AOGA 1SCIA 1UC5B 3C5EA 4R9RA 5K51A 1KDVA 3T9DA 3PE4A 5M5BA 3G9TA 4L2IA 1LW6E 1XQ1A 3ILSA 4FOLA 3VYVA 3PFWO 4N48A 2G9QA 5BW6B 2P90A 3VBEA 2ZKLA 4XUDA 5GY7A 4KPYA 3L93A 2IY8A 1AUQA 3Q0TA 1FC0A 4HPJB 1ZVQA 3MAJA 1QGED 1U1CA 3IT1A 2JCSA 2R97A 2GZSA 1ECGA 1KF0A 3DUFA 4DBVO 5CXUA 1JR3E 4NCIA 2ATVA 4OL9A 3UT6A 1Z56C 2EX4A 1TYAE 1Z22A 3A1NA 3FH0A 3IIIA 4RDHA 3BSFA 4IYJA 4BASA 2X1VA 2PUGA 1VM6A 3UBTA 1Z8HA 3ADKA 3EHDA 5EUBA 2Z2ZA 1Z5OA 2KS6A 1NJ1A 3U4CA 4G1BA 3KPYA 4R2KA 3E70C 1F2TA 3VR5D 3HU3A 4QLBA 2LBPA 1P3Y1 3BJEA 3D8UA 2FN4A 2G25A 4RD3A 2FEWB 1U0LA 3KJEA 1KY5A 1D4AA 2OMKA 5I9BA 4XB2A 5D5HA 1EWYA 4LW8A 2CZGA 1WPXA 2SKCA 3JAWB 3VZSA 1NVWQ 1X7XA 2PUCA 1JLRA 2OC4A 3TH5A 4EA6A 2ZPAA 2IUEA 5JY6A 4ZHQA 1H65A 4CI0B 1UDBA 4CHTA 2GXUA 4V0QA 2BMJA 1YVDA 2V4ZA 2ZBUA 1G5PA 1SEPA 2YS6A 2GGSA 2VP4A 3R4CA 1R6UA 4FSHA 4LI3X 5D85A 3WRYA 3RBAA 4AECA 1FFHA 3ENZA 3L04A 3OEYA 1D1QA 4ZMRA 5C7OO 3LUKA 3HWSA 5H80A 1JQJC 1UMBB 1KI3A 5JCOA 4G97A 4NENA 5DM2A 1WZNA 1GNLA 5JFGA 3S1SA 1ORHA 1A8PA 3GZNB 3UCEA 3RYCB 4Y0AA 3G6WA 2QN1A 4OHYA 1JN0A 1QRRA 5AXBA 4E5DA 1GQOA 3Q7TA 2NVUB 1ULAA 2BM1A 2HNKA 5DOVA 2PAAA 1G1MA 2GKSA 3JZFA 3LLCA 2WQ7A 4KC0A 4HVAA 5IAEA 1KK3A 4QA9A 1XWWA 1G6Q1 3PC7A 2HU5A 1VJ0A 3R20A 4FNAA 4ISBA 2NU9A 3IO5A 4P3NA 4WXHA 1YNOA 2O2CA 4C4ZA 521PA 4FFBB 4KJZA 3KOXA 4JUDX 2QRHA 2XITA 4G1MB 3H2YA 4AJLA 4KUGA 3IUBA 4FOTA 5L53A 2DU8A 1DBWA 2OSVA 4N7JA 5F1YA 4X44A 1LV7A 1X2EA 2EKLA 1FXWA 3J7TA 2GBPA 2RIPA 1OXVA 3DVAB 5CLHA 3AP3A 3K2IA 4WDRA 2VK2A 5HIMA 2PO7A 3VU9A 4I66A 5CNIA 3QFHA 1E3WA 4WADA 2Q3BA 3IQIX 4M76B 1JF8A 2A58A 4EH1A 3SYLA 2CV0A 4IJKA 4TQGA 2AFIA 1E9SA 1GKLA 3R5JA 4N5LA 1KPHA 4Q4LA 1QQTA 4GXRA 4XM0A 1HG1A 1KP3A 4S0XA 3ZDQA 4D25A 5F5XA 1E9FA 2E4VA 4MPPA 3JQBC 4IPTA 1PEKE 2AK2A 3SSAA 1SIOA 3QELA 4EUFA 1RRGA 5LIPA 4C0QC 2CJFA 4ZEMA 5JC1A 3F6SA 2VYVA 4KWTA 3TR5A 3KLBA 3OZAA 3ZHUA 3W2FA 5TLSA 5FWYB 2WINI 4RA6A 3IJPA 4WY8A 2A3NA 5LB2A 4MCAA 3T38A 4QFCA 1W76A 2I7XA 2HWYA 3A3PA 3ZY3A 3BJMA 1W85B 4ZEVA 1XPRA 2PTHA 2J9FA 1RACA 3O47A 1Q2UA 4RA9A 4Z0HO 1KJJA 1UPUA 2ERCA 3QPUA 2QTMA 2XZTA 2G07A 1VI2A 2CFCA 4W7IA 1KE1A 1GQYA 2C8KA 1VRWA 2VYND 5C32A 1I2MA 3EODA 5JH7F 1V5IA 3HO6A 3NEPX 4Y1RB 3Q8WA 1SA0A 4JNKA 4XLTA 3SYRA 5KQLA 4WRRA 1IUOA 3PD1A 5CT9A 4HAYA 4KLAA 1E18A 5K01A 3D2CA 3LUPA 5FI0B 1E62A 1KEZA 4NK5A 5HJ2A 4OAOA 1QAQA 4X97A 5EJ8A 1IXKA 1F4LA 4H16A 2QE7D 2ZAGA 2CN1A 1W7AA 1APBA 1G20E 5A7GA 4TQAA 2PSDA 4B3MB 2JLXA 1G17A 2W6IA 2YWGA 4AP9A 2BM8A 2OCDA 4O2AA 1IXYA 4EHKA 1WHSA 4CEHA 3SD7A 3WYDA 4R2IA 1WBJB 2AFVA 2G80A 1VRCA 2XMDA 3K6KA 3VNBA 4ZHSA 4OX9Y 1RKQA 1YHZA 2YFHA 2HL6