2Q2WA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
253
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRNGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
total genus 90
structure length 253
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2wA00
3PIIA 4AL4A 1OC4A 2J5RA 2GNAA 3DEYX 1DC4A 5COQA 3RC2A 2B4RO 3FPLA 1U5CA 3WICA 4FPXA 2P68A 4M54A 4PFJA 3PZRA 3GFBA 4PLVA 4RZIA 1UAYA 3DMYA 3QWAA 3JQ7A 3E9MA 4GPD1 4XCVA 1MV8A 5TJHA 3I4CA 1P1KA 3UCFA 4IBOA 4IPTA 5TNXA 3F5SA 3U5TA 3PYMA 3W6ZA 2YQ4A 1ADBA 2VTDA 5TC4A 3GZNB 2LDXA 1UUFA 1V3UA 1LDBA 4ESOA 5IJZA 3GVHA 1U2GA 5AXAA 2DAPA 1E7WA 5JYEA 2FR0A 1GPDG 3VDRA 2VYND 3IP3A 1E3SA 3QP9A 1D3AA 3E18A 3HDQA 2DT5A 3PHJA 4PLCA 4W7IA 5JO0A 5JY1A 1I01A 4OO3A 4RV9A 2P5UA 1FXSA 1PZGA 4D43A 1IZ0A 2JJYA 4CLEA 4E3ZA 2E4AA 4IS2A 3QV1A 1L1FA 3WNVA 2DPGA 1KY4A 4GX1A 3UXYA 3PPIA 3WFJA 2P9EA 4NNJA 4E32A 4AJOA 5CDUA 4NR0A 1ULSA 1ENPA 1RJWA 2HK8A 3TZHA 4II3A 4ALJA 1N7HA 2OUIA 5U9CA 1HDGO 4OXKA 4DBZA 4K26A 1NFQA 2NU7A 4XDYA 3RUHA 1YBVA 3MZ0A 4HWKA 3ZU2A 4R1NA 1DO8A 1O0SA 3I83A 3QE3A 3SJ7A 1UDAA 1XDWA 5KJ1A 1SOWA 2G82A 1UXGA 1B2LA 4NK5A 4BHTA 4EDFA 4YT8A 4NG5A 3OBBA 1GCOA 3IP1A 4KWHA 4GVXA 2GN8A 2NADA 2YW9A 1PZHA 5ITWA 3GR6A 2PD3A 1SCUA 1E7SA 3IS3A 7MDHA 1QYVA 4BKQA 3GDOA 4N54A 1SZJG 4L73A 2I6TA 1DOHA 3MWEB 3DTYA 4LSWA 1VLLA 2Q1TA 1BXGB 2PLAA 1S7CA 3OSUA 4OM8A 2AHRA 5G0SA 3RVDA 1GEEA 3EC7A 4OXYA 1PIWA 3ZW8A 4S3MA 3JQCA 2VQ3A 4PVDA 4UVDA 4A7PA 2PZLA 3ROQA 5EPOA 1LJ8A 3UN1A 4A27A 4YWJA 3RAJA 2BFOA 4BKPA 1EBUA 1A9ZA 1Y1PA 3VH1A 2OXIA 2ZK7A 4CR8A 4KDEA 3E5MA 1P3DA 3VPFA 3W1VA 4DPLA 1KS9A 3H9UA 5AXCA 4M1QA 3VC7A 5EINA 5IDXA 3SJUA 3H9QA 5U4QA 4CL8A 2RH4A 3IAHA 3C1AA 3LDHA 1F8FA 1YDEA 4ITUA 3FNGA 3SEFA 3I9MA 5L4SA 2EW8A 1C3VA 2J5QA 4RJTA 1K89A 4RZHA 5CAEA 2DBRA 4DGSA 4B8ZA 4XQEA 2Q45A 5I8WA 1C0IA 1EZ4A 3WFIA 3QJ5A 2HCTA 3AI1A 2X58A 3H2SA 3K73O 5A9TA 1VSVA 2Q4BA 4GQAA 4BNWA 5A9RA 4YJHA 2CDCA 4ZQHA 1H9AA 4R51A 1WPQA 2UUPA 3KEOA 4K6FA 3E9QA 3OIFA 4XIJA 4WLFA 3QWFA 1PS0A 5U1PA 3Q3CA 4TVBA 5IXSA 3PVZA 1CETA 1Y8QB 2LDBA 3L77A 4EGFA 1HZJA 1P74A 1H6DA 2EERA 2EIHA 2OL4A 3ZNNA 3D3WB 4Z9FA 5C7IO 1I36A 5KVQA 1LQUA 3INGA 1JVSA 2FOIA 3RI3A 3ZNQA 1HE5A 2FWMX 4IDCA 1ADGA 2O3QA 4A03A 4CMEC 2ZATA 1HLPA 2GDZA 1GAEO 4NDNE 5JMPA 5H81A 3UFXA 5L53A 1HYEA 4J7XA 4GKVA 2I3GA 1HLDA 1O94A 2J3IA 4KDFA 5K0ZA 1NHGA 4B3JA 1HE2A 3D4OA 4XGKA 1P0FA 1ZFNA 2NVUB 4BO7A 2W2LD 1U7TA 4IINA 1GV0A 4TWRA 4CM8B 3CMMA 5GZ3A 2XAAA 3BMQB 2ZYGA 1MG0A 1PJLA 4L75A 1BVRA 1NVTA 3DO5A 3AM3A 3N58A 2NV6A 3ANLA 5K6AA 5KIAA 4F6CA 1BWSA 2H9IA 3C85A 3ITKA 1EQ2A 1YDWA 3PYXA 1XCBA 2BMAA 3JQ9A 1Z82A 1N2SA 2VWPA 2CVZA 1YJ8A 2ZTMA 4GX5A 4YJGB 4XYBA 2D1YA 1GYPA 1WDMA 3O26A 1LRLA 3BXXA 3PQFA 3BIOA 4BS9A 4CQMB 5IAAA 4Y8VA 1DIHA 1R15A 1T1SA 1KVTA 1Y8RA 2Q2QA 4K28A 4CLOA 3NT5A 2NLOA 4BGIA 2Y1EA 2YJZA 5HA5A 5A04A 5IDQA 3ZNOA 4O6VA 3RUFA 3Q9UA 2VRCA 1PWXA 3NJ4A 2ET6A 1Y5MA 3VDQA 2FY8A 2YHUA 1ZIDA 2DPHA 3EMKA 2VWHA 4I5GA 2O23A 4NZ9A 4A5OA 2JHGA 3F5QA 1P1FA 3RROA 2PKQO 3JQ7B 4RLHA 5KVSA 3C7CB 3BTUA 3DAPA 3HE3A 1KEWA 4CMCA 4UVHA 1Y9EA 3OM9A 4UULA 2QRKA 4EJMA 1VSUA 1NQAO 2P2SA 4J4HA 5G4KA 3E5RA 2CVQA 2OZPA 1ONPA 5DP2A 2C5EA 3QQPA 2Q4EA 3H65A 2GZ1A 3GQVA 4CM4B 5JS6A 5HBRA 1NQOA 2O50A 3W4KA 5K9ZA 2J8ZA 4JX8A 4MVJH 1GL3A 4Z0HO 3EVTA 1IULA 2V6GA 4P4NA 1PL8A 4E12A 3NX4A 1GUFA 2EJVA 2VYVA 4D42A 3AI2A 4RVSA 3EDMA 4F3YA 1UDBA 4IDDA 4GSKA 3JQAA 5JMWA 1DFIA 4PRLA 4RDIA 4J16A 4DUPA 1QG6A 1T4DA 3HFSA 4ND2A 1B26A 2Y99A 3DR3A 5TQVA 4PZCA 2AQ8A 3B1FA 2IRWA 2GD1O 4CR6A 4JP2A 4X54A 2W2KB 1IB6A 4IY1A 4BKUA 2O3RA 2VOJA 5I7SA 3WJAA 4Q9NA 1GZ4A 1YWGO 2ZTUA 4GX2A 3WDSA 1BXGA 2OHXA 3F1KA 2HRZA 1ZK4A 4XQCA 3DBVO 3ROMA 4DLLA 4F46A 3K2EA 2O4UX 3LZ6A 4DMLA 2I65A 3Q6IA 3FPCA 3CZRA 3GMSA 4GSLA 3ZW9A 1K6IA 3ZDFA 1PTJA 3KUXA 1G0NA 1MFPA 2A4KA 5THKA 1WXDA 4E5YA 4WOKA 2RHCA 3DHYA 2NACA 1YL5A 2FN7A 3JD3A 2GASA 3L9XA 3ONDA 4FFMA 4Z0PA 1T25A 4NI5A 5JAMA 2FR8A 4FIZA 5FF9A 3MWDB 1A9YA 4B3IA 2R6JA 3CSDA 4YRAA 1NAHA 1CQIA 3GG2A 2EV9A 3HQ4O 1HETA 3S2GA 2O4CA 3DAFA 3OQBA 2WD7B 5F21A 4NJMA 3TL2A 3AK4A 3HDYA 2VTEA 3DFZA 2HLPA 4TQGA 1WZIA 1X7DA 4HFMA 1IHXA 4NMHA 3D3WA 4BQRA 1SOVA 3ONEA 4IUYA 4N5LA 4BNGA 3IOYA 1FDUA 3FI9A 4MDHA 4BO2A 1P1RA 4W82A 4JK3A 2QX7A 4GLOA 4YVFA 4AICA 4HNGA 4L0QA 1NFFA 3ZGYA 5FI3A 1YL7A 4J4TA 4GH5A 3RU9A 3ADPA 3TL3A 4FW8A 3ZWXA 4C4OA 1WDKA 5L45A 4CM8A 1DJNA 4BMSA 4N18A 3CPSA 4M87A 4EYEA 3NYWA 3OMLA 4CV0A 4YACA 1NM5A 2YFQA 1MG5A 1UXJA 1RM5A 2Y67A 4GLLA 3HB4X 1E3WA 2VHYA 1PR9A 5DP1A 3JQGA 5ER6A 1AHIA 3GDFA 1HEUA 1IY8A 1IHYA 3JQ6A 3AY7A 3WSWA 4RPGA 4P8RA 4Q3AA 1XG5A 1QXSA 2DBVO 3D0OA 2C5AA 1I3MA 4NU6A 3TZQA 4HP8A 3OFSA 4HY3A 1EVJA 1ORRA 4GKBA 4YXFA 3CTMA 1QP8A 1ENOA 3C7DB 4CM3A 4WCFA 2BF7A 5A03A 1MC5A 4B4UA 1GR0A 2IEBA 2IZ0A 2NVWA 1NWCA 1YE3A 4RGBA 4XRGA 1RM4A 1VM6A 3AU9A 4W9NC 5BSGA 3VH4A 3I5MA 3F4LA 4TRRA 3X2EA 5G0UA 5JW6A 3DC2A 1HWYA 1DC3A 3HADA 3O8QB 2HJSA 1ZK0A 2D4AA 4L8VA 3C1OA 3WYCA 4Y6PA 5L40A 3QHAA 3FNFA 5DOVA 2VNSA 1Z45A 1JWBB 3AUTA 1PR3A 2EGHA 3W4IA 3C1TA 2Y1OA 4FQ8A 1BG6A 3DBLB 1EFKA 3CIFA 1U5AA 1O95A 4XQ9A 2NU6A 3NT4A 3OJEA 3FR7A 5IZ4A 1GCUA 4IJKA 4BOYA 2VN8A 4ZD6A 5BNIA 1ZBQA 3KETA 1DIGA 2O3SA 5DF1A 1YQXA 5L95A 4W6ZA 1UZNA 3PYLA 5EQDA 3D5QA 4DMMA 5KCZA 1NX6A 3M6IA 3SLKA 4XQGA 2AG8A 1MLDA 2O48X 4LGVA 1NTOA 4I5DA 3JTMA 2XXBA 2E37A 1LI4A 1U9JA 1YQDA 3CUKA 4BO3A 3I23A 4A2CA 1PGQA 4RPKA 3ZV3A 3ZV6A 1XEAA 1XYGA 1ZK3A 4BNVA 2AQIA 3ZNPA 4JGBA 5TJ9A 1B16A 3RJ9A 3G3EA 1GV1A 4GWGA 4HFJA 1J4AA 3D64A 1O9BA 4B79A 1T2EA 3GPDG 3QLJA 5GY7A 3NDRA 5TT1A 1AN9A 3U4DA 3L6OO 5DNAA 3GF4A 2HK9A 4IZHA 1LBEA 4XYLA 4MKXA 3OJFA 1F06A 4YJFB 2FZEA 3GLQA 2FRDA 2D59A 4ILKA 4OSPA 4LW8A 4QEDA 4J1NA 5ILOA 1KC1A 2Y68A 3BTVA 3TN7A 3WX0A 1SPXA 3K8ZA 4R5HA 2TMGA 1YBMA 1YB4A 4J9VA 2B83A 4JBGA 2Y05A 4YJHB 5DBIA 5COAA 1JU9A 3UVEA 1I8TA 1T2CA 1ZK2A 1C0LA 2BI7A 3H6KA 3MOIA 3QIVA 5A3VA 3WS7A 1DFGA 1PU2A 4D44A 1FK8A 1TXGA 4YJGA 2H6EA 2NVUA 4BV9A 1GQQA 1UP6A 1U8FO 4N7RA 1KVQA 4N5MA 2R00C 3QVXA 3C7AA 1L7DA 5L9AA 4TSKA 2DTDA 5BSHA 4B4VA 3AW9A 2D0IA 4B7XA 5JSFA 1HXHA 4NFYA 5JCJA 2YFHA 4Q3NA 5CDGA 4BNXA 3MEQA 2JL1A 4CL3A 1NQTA 1X1EA 4IMRA 5DN9A 2X0NA 1E6EA 2E48A 1KVSA 3GPIA 2NU8A 5J23A 3EAGA 4OJNA 3A1NA 2ZTLA 3TZCA 2GO1A 2YV3A 1H94A 1E5QA 4J0FA 2RH8A 1PGPA 2VWQA 1K0UA 5HWSA 2I9PA 3ZN2A 2OGUA 3HWRA 1XQ1A 3ASUA 1C1DA 5JYDA 1HE4A 4ZN6A 3ZWCA 3D7LA 5IG2A 2YDYA 5EESA 5A05A 4IJVA 4MIOA 2GR9A 1U3TA 3F47A 3JYNA 4TRJA 1HL3A 2Q50A 4G65A 3E6AA 4IDGA 3OJOA 4BKOA 3EVNA 4ID9A 2G76A 4EITA 4UUOA 1E6WA 1R66A 4TRMA 4MVJI 3QRWA 1E1KA 3HN2A 1D1TA 5C37A 2C82A 4URFA 3ZHZA 3P5SA 9LDBA 2GYYA 3KBOA 1UDCA 5KJCA 2PY6A 1M2WA 1R6DA 3GRKA 3V2GA 2Z95A 5ILGA 3JYLA 3ORFA 3JQAB 4R5MA 1K3TA 4C7JA 3AUAA 5EN4A 1NBOA 3K2BA 5G4KB 3KV3O 5L4LA 1DRVA 4IDFA 1GD1O 2GZ2A 3O38A 4ZA2A 4IIVA 3DL2A 4MKZA 4RCVA 5JPIA 3A06A 1NPDA 1GADO 3QWHA 2HAEA 4ZRMA 1NQ5A 3ULKA 1Q0LA 5ENDA 2J3KA 3MOGA 4DC0A 1PJ2A 1E1MA 2OBNA 3FR8A 1QYXA 1DEHA 4CMGA 1DLIA 1NPYA 2IDZA 1BW9B 5T57A 3A14A 4IJWA 3TFOA 4CV3A 1GUZA 4CMBA 2VHWA 1ISGA 1HDXA 4JLWA 5T67A 1CF2O 1X7GA 2XF8A 2BFPA 1PX0A 3R0IA 3STHA 4JN6B 4CMIB 3PRJA 4A0SA 3AJRA 5AVOA 3BMNB 1KIFA 2PV7A 4BNNA 4E2WA 4CLRB 4FS3A 3KHUA 1I0ZA 1BSVA 1HDRA 5JC1A 4B4OA 3WBFA 1JW9B 1U3VA 4Y9DA 1V3VA 1G6KA 1X13A 4IS3A 3Q11A 2P4QA 5AXBA 2HQ1A 4YYZA 4OHUA 3H9GA 5CFZA 2DFDA 2JFFA 3E03A 1YS4A 1BDBA 2BGLA 5ES3A 4XJSA 1ARZA 1W4ZA 4WEQA 3AU8A 1FJHA 4CMHA 3H3JA 4CUJA 1RYEA 2QRLA 4AJ1A 3WG9A 2B35A 3JQFC 4FDAA 4FFPA 1MFZA 1LDEA 3RIHA 1ZEJA 1FMCA 3WQSB 2YDXA 3SXPA 5JDCA 1E92A 4HXYA 1EE2A 4NPCA 3D4NA 2PH3A 3RUAA 3AOEA 4YAIA 1XSEA 3UAGA 2HKIA 3HJAA 3JQ8B 3KSZO 4DIBA 1P77A 4KOAA 4WJZA 3ZHYA 3ZWMA 2Q2WA 4H15A 4KUGA 4QTZA 1ZSVA 4YDRA 2W2KA 3TNLA 4ZHSA 3LU1A 1E0DA 1HZZA 3R3JA 4DLBA 4R4JA 4YB8A 3BA1A 5DULA 1M6WA 4ND1A 4E5KA 4BO8A 4CLOB 3DZJA 3PWZA 4HX5A 2FR1A 5FEUA 3P7MA 1V9LA 3DZHA 2W8ZA 3CKYA 1EFLA 4OGWA 1M75A 1RKXA 1UZLA 3GGPA 3VPHA 1W0CA 2C2XA 4I5EA 2PKRA 3T7CA 4ND4A 1T2AA 4E4YA 3OICA 4AJHA 4PG5A 2Q99A 3IIEA 3TWOA 1C1XB 1LU9A 3DOOA 3FNEA 1I3KA 2AXQA 2EHDA 4J1QA 4R54A 3ETGA 2A35A 1TVEA 4PGFA 4AJPA 4E31A 4I8XA 3DB2A 4DYVA 4CM9A 1TB4A 5C3MA 1HF3A 4MJLA 3T4XA 1XGKA 1DFHA 3U4HA 1A72A 4QT0A 2F1KA 4J49A 3RUEA 3L4SO 4D41A 1GQYA 3S55A 3Q9NA 2DBZA 7ADHA 1Q7GA 4YA6A 1IL0A 1M6HA 4DVJA 1GZ3A 3JQGB 4GL4A 1DHTA 3F6YA 3HDHA 1NP3A 2BI8A 4QSMA 3DTTA 1A4IA 1W8DA 4OH1A 4TRNA 2CD9A 2FP4A 1FDSA 2FZWA 3I9JA 3K9QO 3NRCA 4U5QA 2D2IA 1IZ9A 1H5QA 2I99A 2O3JA 4D46A 2JFGA 5B37A 2EW2A 1U3UA 1D8AA 2PNFA 2WTBA 1YB5A 3DZKA 2ZQZA 3ABIA 4R16A 1GDHA 1K6XA 4WOJA 1E7QA 1ZH8A 3RWBA 3HZZA 2B69A 1SBYA 3IKTA 3PZBA 2OOSA 4MP3A 2UVDA 4PZEA 1EUDA 3JYPA 2CDAA 4IM7A 4J6FA 2VT3A 4ROSA 1V8BA 2IEDA 4JBHA 2RIRA 2RBEA 3DBRA 3KO8A 1N92A 2CVOA 1NVGA 1NR1A 2W90A 3NEPX 3ICCA 2A92A 2HDHA 3PWKA 3R3SA 3D5TA 3GA0A 4XZ3A 4KUEA 4ND3A 3P2YA 2CUKA 2NTNA 4WKGA 4OMUA 3WSVA 4WCFB 2I66A 1H2HA 1LDGA 5TLSA 1R4NB 5DT9A 3GVIA 5L7YA 1ZEMA 1JQBA 4RPLA 4WCDA 4Z9YA 4NBRA 2P5YA 4OKIA 4LISA 3OA0A 1LDMA 4XYEA 4G81A 5KKCA 2OP0A 4W9NA 5JCJD 1E3EA 1LC3A 1MP0A 2DTEA 2GPTA 2Y1CA 4KMSA 3GG9A 3VAZA 1CRWG 1D1SA 2PGJA 4FFLA 2X6TA 5JC8A 4JXKA 3TDKA 4OSOA 2EWMA 4UUMA 1KETA 2CFCA 1Q2XA 4E30A 2X22A 1EUZA 2GRAA 2C07A 1DJQA 1UP7A 3UCXA 2DLDA 5JFOA 3TFQA 1Y7TA 2QHXA 2WD7A 3DZGA 5LC1A 4CPDA 1HDOA 4IDAA 3UICA 2GSDA 4Y67A 1Q7BA 1V6AA 3H5RA 2E82A 2JHFA 1GYRA 4XR9A 2Y1DA 2X9VA 4QQRA 5I8ZA 1EDOA 2QQ5A 3DBHB 1NFRA 1MX3A 4KQWA 4NJOA 3H9JA 2B5VA 1B3RA 4LVCA 5KOIA 1JN0A 1R0KA 2JD0A 1OOEA 3OEYA 4ZVVA 5A5FA 1NVMB 3WQRA 4ZQBA 4CM6A 1E7RA 3VKUA 4KTVE 2E49A 4FOOA 4CMEA 2J3JA 1VKNA 1ZSNA 3GNTA 3HUDA 1ISJA 4PG4A 1EK5A 4FC6A 3V8BA 2Z1NA 3GNSA 4FOSA 2O3UA 3I3OA 1QYCA 1DSSG 4FJ2A 5A02A 2PWZA 2PTGA 1BXKA 4WLUA 4XGIA 1HRDA 3KOUA 3LT0A 3RFTA 4D7AA 2Y0DA 1VPDA 2FMUA 1N1GA 4IGFA 2GN4A 3MJ4A 1HTBA 2C54A 1I24A 1N9GA 2BFAA 4RLSA 2ILTA 3FWNA 3MJVA 4UUPA 3WLFA 3V2HA 1F12A 3VHRA 4I9UA 4YPOA 3PXXA 1W73A 2PR2A 4R9RA 5IN5A 1E7YA 4DQUA 3OQ6A 1Q7CA 5IN4A 3SVTA 1T1RA 3GC6A 3PQEA 1J49A 1ENZA 2DKNA 2O7SA 3NV9A 1PJQA 3PEFA 4WE3A 4ALNA 1C1XA 4AJNA 1PWZA 2EP5A 3PLRA 4PLWA 4LVUA 4R1TA 3ETDA 4M55A 3VH3A 1E7MA 5F1PA 4UEKA 4JNKA 4UVEA 2BHLA 4NH4A 3B1KA 5IZCC 5JDIA 4ZQGA 3Q2KA 4G2NA 2EKPA 4AG3A 5DOZA 1LC0A 5H82A 1NWHA 4E5PA 5JCXA 3S2FA 4UVGA 2VCYA 3SC4A 3TRIA 2X5OA 1YB1A 1I3LA 1LQTA 2X0IA 1HE3A 4MVJA 3NAQA 4AJJA 1PJ3A 4S1VA 1WW8A 1W6UA 3I6QA 1NR7A 2DBQA 3K30A 3QWBA 1M76A 1FF9A 1U28A 1R4MA 3JQDA 3OIGA 3RJ5A 3KYBA 3WGYA 1R16A 2ZB7A 1QMGA 3AFNA 1TI7A 4QXMA 3NTOA 4AJIA 3DBHA 2VYVD 2EKLA 4L4RA 3GVXA 1GPJA 3IKVA 5EIOA 1PQUA 3DWFA 1EVZA 1U8XX 1LXCA 3RFXA 1D7OA 1RWBA 2DUWA 1NXQA 2V6MA 1T2DA 2IZZA 4RO0A 1HDZA 1Y6JA 3WGHA 4EUEA 2GUGA 2Q1UA 1YL6A 4HADA 4RVFA 3BMOB 4CM9D 1QYDA 1ZMOA 3GNQA 2YUTA 3KYCA 3H7AA 3D1LA 3F9IA 4R9SA 3VZSA 5BR7A 4M89A 3VTZA 3N74A 5KTKA 2QG4A 2Q3EA 3QVSA 1LRKA 4J1SA 3L4BC 2NQ8A 3VTFA 1WLYA 4BNJA 4YRBA 4PRKA 1B8PA 4GMGA 4Y6SA 3ZH2A 3KLPX 1GTMA 3QVTA 4GWKA 4R01A 2NU9A 3FF4A 1JDJA 2BELA 4OOFA 3WGQA 3H8VA 1B7GO 2IE0A 2X9GA 1HKUA 2F00A 1PSDA 2Z5LA 3AWDA 1TA4A 1PS8A 2I76A 1CYDA 1H6BA 1RYDA 3H2ZA 4MP8A 3WMXA 3QW2A 3WYEA 3IL2A 2EJWA 1PJ4A 4ZRNA 1EDZA 3RFVA 3WLEA 2AG5A 4MVJM 2IYOA 4DIFA 1TEHA 4HUJA 3AI3A 2BLLA 5HTOA 2X4GA 1FDVA 5CDSA 5CEJA 2XXJA 2IYPA 3DZFA 4PN3A 3KTDA 3PIDA 4YJFA 2ZJ1A 3ANNA 1ML3A 3RUDA 2G5CA 3ITDA 3LT1A 2X1HA 3Q0EA 2H63A 3IQDB 3FNHA 3GGOA 1BGVA 3I9LA 2C2YA 3DONA 3B70A 3SC6A 4RDHA 1QRRA 3VOSA 2BFMA 3PTZA 4XYMA 5DCYA 6LDHA 1J6UA 1C14A 3BMQA 3KVOA 5A9SB 2AEMA 1DRUA 1XWFA 5LDGA 4BNHA 1HYGA 5KVCA 1UXKA 5LDHA 3RBVA 1FDWA 4O63O 4FFRA 1ONOA 1DAOA 5CG2A 2VHVA 3ANMA 3GEMA 5DBGA 2OORA 3L6DA 4TZTA 4YRDA 3AUSA 4OQZA 3E9NA 3GHYA 5ENVA 4BNFA 1DIRA 4OKNA 1ISFA 1H2BA 8ADHA 3PP8A 4B8WA 5L7WA 3PJFA 3HFGA 1GYQA 3DFUA 5CEEA 2D3TA 4JROA 3VZRA 3Q1LA 2B4QA 4CLHA 3OA2A 4LRSB 5JDCC 4OOEA 3V2UA 3WOHA 1B0AA 3ZU5A 1WAMA 3RC7A 3W6UA 4XYGA 1T24A 3ZU3A 3TPCA 3U49A 4JJFA 1I32A 3KXDA 1ZNQO 3HHPA 4II2A 1LLDA 1R37A 1ENYA 3RU7A 1YBAA 1H6AA 4CJXA 3U0BA 1E3LA 2C7VA 4PZDA 1Q0HA 2AA3A 1DXYA 2OO5A 1DC5A 3BMCB 4CV2A 4J9UE 4B4WA 1C0PA 4R41A 3ZWNA 1O8CA 5DDIP 2HMUA 2Y0EA 2VUTA 1AUPA 1E5LA 1GEGA 4F45A 5AQ1A 3QY9A 4JJIA 2WDZA 4DYDA 1VRWA 4L74A 2EEZA 4BO4A 1XQ6A 3L4BA 4N5NA 3K92A 4LK3A 3QWIA 5G2OA 2JD2A 3EUWA 1Q1NA 1GY8A 1SB8A 2AE2A 2DM6A 3OHSX 4UVIA 3G79A 4D45A 1EBFA 4RVDA 1A5ZA 5CP8A 4O1MA 3INTA 1LRJA 4IQ8A 1U3WA 2C20A 4I1IA 5HM8A 3I9OA 2CMDA 3WBBA 4MKRA 5F3RA 2DVMA 1UJMA 3HSKA 3ZWOA 1UZMA 2OFPA 3EZLA 1LSUA 2H5LA 4CODB 5IXYA 1LDNA 1GUYA 2OMEA 1LUAA 3GHHA 3ZU4A 4EUFA 4RL6A 1PZFA 1P44A 1XHLA 2CZCA 4DQVA 5THQA 3DQPA 5I9NA 1AXGA 1EMDA 4CR7A 4W4TA 5B1YA 3IMFA 3RQSA 5B4VA 1DHRA 3OP4A 4YCAA 1Z75A 3JV7A 3BZUA 2SCUA 1DRWA 1F8GA 2FPIA 3PHLA 5HRUA 2JAHA 3VPSA 1QLJA 1NNUA 1E6UA 3CE6A 2QYSA 4INAA 3ZZNA 3F1LA 1P33A 1SB9A 1WMBA 4J7UA 2AEFA 5L3ZA 2GN6A 1VL0A 3DOJA 5B4UA 4Y6RA 3GZ4A 1JA9A 4DL9A 1X7HA 5T8KC 3M2PA 3OJLA 4RF4A 5DZSA 4WECA 1E3WB 3GZNA 1LX6A 4K1LA 4DREA 1ADCA 1GFSA 3GH3A 3M1AA 4GGPA 4NFHA 4CLRA 5L7TA 2WYWA 3WMWA 3U4IA 3UUWA 4ZICA 2ZTVA 2PD6A 3JQBC 1UXHA 3KEQA 2O7QA 3KSDO 3JYQA 4MP6A 2HSDA 1H9BA 4ZQFA 5I7VA 4CM1A 3GDGA 4FFOA 2VHXA 3U09A 5C7OO 1Y9AA 4LMRA 1V3TA 3R1IA 3WTCA 4M49A 4PLFA 1YGYA 1TT5B 3S1LA 5FI5A 4EJ0A 1AE1A 3B6ZA 4FGSA 5B12A 4BNKA 3D4PA 1MXFA 2VYNA 4EW6A 5CPFA 1OC2A 4Z6KA 4PLGA 5TRTA 5EL0A 3ICPA 2IXBA 4B7UA 4BO9A 4AJ4A 4DA9A 1SEVA 4RVGA 4E0BA 5JLAA 4RVHA 4IQGA 3VZPA 3G0OA 4FGWA 1KOLA 2CDBA 3GUCA 3QVWA 4AJ2A 1YQGA 4WPGA 1A71A 5A5EA 3I52A 4J3FA 4RQTA 1F0YA 5BNFA 2QZ9A 3H4VA 1E77A 3MTJA 1ISIA 1I2ZA 4ZU3A 3C8MA 4U0JA 4L4SA 4J2OA 3RUCA 2BGKA 2NUAA 3CMCO 4UUNA 4IXTA 2E6UX 3EZYA 3M2TA 4MVJG 5ADHA 3ZWWA 1XLTA 2QW8A 2DFVA 3RKRA 5JY6A 2FPGA 3GFGA 5T6BA 5BQFA 1YH3A 3FTPA 2DTXA 5KNLA 1LSOA 3ZWYA 5TGDA 4ZJUA 1SAYA 5JNLA 3H9EO 1U4SA 3FTNA 4NBWA 4DQXA 4NFSA 4J43A 4J4BA 2C0CA 5A9SA 2Y1GA 3JYOA 1H6CA 1QV6A 4GAEA 5JO9A 1QKIA 5T5QA 4D3DA 4NBVA 1BDMA 1RM0A 1A27A 2PGDA 3KYDB 4WLNA 2PA3A 3IJPA 3T7EA 3GN1A 3LVFO 4XX0A 3GVPA 4BNYA 4ALIA 1N1EA 4R1UA 1ZKMA 4NBUA 2YHIB 3UF0A 3PJGA 4JJGA 4XD2A 4LMPA 4E6PA 4DPKA 3EYWA 1LSJA 3WGGA 3ROKA 5C5IA 2DUUA 4BNZA 1A4UA 5TT0A 4GGOA 3ZHXA 3LSYA 4YEDA 3EY4A 2DU8A 4IDEA 5KJFA 3LC2O 4W99A 3U9LA 4IMPA 1MC4A 3DBLA 2ZJ0A 5JDIC 4DXHA 1P9LA 4R69A 5I7FA 3DBRB 4A10A 1P1HA 3JQFA 5MDHA 1G0OA 3K96A 5T8KA 4QFDA 2B0JA 3KSUA 3LC1O 5BNTA 4FBGA 4CQMA 1UH5A 2FHSA 4D3SA 4FN4A 3DAGA 4ALKA 3RC1A 1ZUD1 2RCYA 3AOEC 1IE3A 1KBZA 2JCVA 1BVUA 3RD5A 4AJEA 2I67A 4DTIA 5AOVA 3T4EA 1MA0A 4GX0A 2WM3A 4J0EA 3ZWBA 1WP4A 3FRJA 4ALMA 4A26A 5T64A 4P22A 1E3IA 5TF4A 4D3FA 4L4XA 5BSEA 4XEHA 2ZYAA 1OFGA 5CPBA 1M66A 3UOGA 3BHMA 2V7PA 3E82A 3ENKA 4L9RA 1XKQA 1KERA 2X9NA 3UCEA 4IGEA 4O0LA 4NK4A 3BYZA 3ZV4A 1B8VA 2A9FA 1QYWA 3ENNA 4W7HA 4BO5A 3O8QA 4OQYA 1I2CA 4NBTA 5F5NA 3D3EA 3PI7A 4YT2A 1WWKA 3FD8A 4PVCA 3RKUA 4QX6A 1SEPA 4MPDA 1PGNA 1MUUA 2BH9A 3TQHA 2Q1SA 4OIMA 2O2YA 4UREA 4WLEA 1PGOA 2ZCVA 1PGJA 4JIGA 2WEKA 4QO7A 2P4HX 2DQ4A 3O4RA 1EVIA 3TSCA 1HSZA 3WYBA 3JD0A 1OAAA 3JD1A 3VPXA 3UW3A 5A06A 1BMDA 3DZBA 4BIIA 4DIOA 1GZ6A 3EHEA 3BHIA 3NTRA 2YYYA 3WNQA 3RCBA 3UH1A 4U0KA 3X2FA 4CQLB 1IPFA 1I10A 1XA0A 3WIDA 4EUHA 3JQ9C 3JQAD 3DXFA 2PFGA 5A3JA 1ISHA 4TKLA 1YKFA 5GMOA 3LT2A 4RQUA 5EMHA 4GBJA 1X14A 3V5NA 4XR4A 3TZKA 1QORA 5IDWA 2WE8A 4BNIA 3PQDA 5CDYA 1TT7A 4FJ1A 5BSFA 4IDBA 3KRTA 4BB6A 3PHHA 1DLJA 2X86A 2BD0A 2AQHA 5JAQA 2VZ9A 5JAZA 2C59A 2EG9A 1WVGA 4BKRA 1YXMA 4XA8A 4H3VA 3S2EA 3PJDA 2JCXA 4LN1A 3CINA 2G1UA 1P0CA 3IC5A 3G17A 1VJ1A 3Q2IA 4CM7A 2Q49A 3RSHA 3NUGA 5KVVA 2HO5A 1D4FA 4HBGA 4E2XA 4HV4A 1B14A 4HFNA 3DHEA 5JBIA 3WQQA 2YQ5A 2QYTA 3COSA 4MVJF 1O5IA 3JCZA 1BHSA 4MVJP 2POQX 2QRJA 1LTHR 5I7EA 4KQXA 4U6SA 4LRTB 4NJMB 3VVCA 5F5LA 4XB1A 2NQTA 1JWAB 4GMFA 2NNLD 2HMVA 1FDTA 1P1IA 4WK6A 4J91A 1X15A 4O5OA 4G5HA 3OEWA 3A4VA 3OIDA 4R1SA 5EERA 5DBFA 5IDYA 1O6ZA 2ZB8A 4YT5A 3W8FA 4RPJA 4XB2A 5AYVA 3BTSA 3U3XA 3CEAA 3AM5A 3NKLA 4MIYA 4E5MA 3K5PA 3L07A 2Z1MA 3B20A 4PCVA 1XU9A 1SNYA 2I3AA 2HJRA 1NAIA 4Q3DA 1Z73A 3F3SA 3PHIA 3CZMA 1BTOA 1EQUA 3BMNA 3DHNA 1JVBA 4MVJE 2EGGA 4E2YA 3RBXA 1YJQA 2Y0CA 1KVRA 3SBOA 3LC7O 4H16A 4BO0A 4BQPA 1TT5A 1DIAA 3WGZA 1LA2A 1Z74A 1K2WA 3BMOA 1C1DB 1X0VA 3PFWO 5GZ6A 3NJ8A 3VH2A 4F6LA 3EGOA 3P2OA 1T26A 1ZMTA 4D0RA 4Q3BA 3GOHA 1VI2A 2CSUA 5FYDA 4CV1A 4GI2A 1VL6A 1P31A 1JAYA 4L76A 1G1AA 3GAZA 3SX2A 3G49A 4DLAA 3N7UA 3H5AA 4P4LA 4B7CA 2D5CA 1VKOA 4RF5A 1B3BA 2R00A 3MJEA 1CDOA 4HFRA 2VNAA 4U7WA 4WEOA 8LDHA 1KEPA 1CERA 3KB6A 3AOGA 2H1SA 5C7LO 4BMVA 4R3WA 4I9HA 5TS3A 4AJLA 4Z3KA 1Q0QA 2QIOA 3FSRA 3LQFA 2UDPA 3UHAA 2EF1A 1DB3A 3KYCB 2NTJA 4FCCA 5CDTA 4Q3CA 3V1YA 1RPNA 2OBYA 1ZVMA 3EK2A 5CHEA 2Q1WA 3UGKA 3HN7A 3AY3A 3V1TC 1DBVO 4C7KA 2TMDA 2J3HA 3GMDA 3WIEA 2BKAA 3GUYA 5EJ2A 1HYHA 3IJRA 2GN9A 2IODA 1B8UA 3K6JA 4WUVA 1YVEI 4E33A 3VZQA 3U4CA 1PJTA 5DCWA 3GGGA 4J1TA 3U62A 3F46A 3NDJA 2UYYA 3AFMA 2X0JA 4XJTA 4Z0TA 3PWSA 4YAJA 1DAPA 1WZEA 2CF6A 5TSDA 3B1JA 3I1JA 3VVBA 2ZYDA 3FBTA 4FFNA 2VT2A 4E2ZA 1ZCJA 2G0TA 1X0XA 2PZJA 1XR3A 1VJTA 3NT2A 4UEJA 4BGVA 4NHEA 2UUOA 1JAXA 4YTEA 4CMAA 1KYQA 5F1OA 2IZ1A 4RVUA 1YRLA 2PGLA 2HK7A 1LLQA 2FSVA 2X8LA 4BO1A 5L4NA 3GY0A 1Z7EA 3AM4A 1A7AA 1N5DA 3LK7A 5BT9A 2HU2A 4E21A 1ZSYA 3OJ0A 2Q46A 1ID1A 2CF5A 4I08A 3FN4A 1ISMA 3DMTA 4YBZA 4BNUA 3LLSA 4Q3EA 1PJSA 4CMIA 1HDCA 3ASVA 1DC6A 1UAGA 1Y8QA 1IYZA 4RORA 1CWUA 1CJCA 4ZGWA 4KTTE 4YAKA 4H7PA 3TJRA 5AXDA 2W2LA 4DC1A 2AQKA 1XELA 4LCEA 1BW9A 2FPPA 2YZ7A 4BGEA 1H93A 2ZB4A 3PDUA 2VUSA 3LF2A 1SC6A 2Y1FA 1YO6A 1T2FA 1PJCA 3H5NA 3KM0A 2W98A 4KUHA 2HMWA 2JFHA 3QVOA 5IZCA 2AE1A 5G0WA 1V35A 2P9CA 1F17A 4KZPA 4EZBA 3GEGA 4PG6A 1VJ0A 3C24A 4JCOA 4YR9A 1KEUA 2C7GA 3LT4A 1ONNA 4LCJA 4DPMA 3K31A 2RAFA 4DWVA 1KEVA 1S6YA 2AW5A 3S8MA 2X0RA 4YJDA 4FD3A 1NYTA 3V1UA 4UAGA 1N7GA 1HSOA 2XPCA 1BXZA 2YV1A 5CEFA 3JQ8A 3JSAA 3KZVA 4EEZA 3SLGA 3CXRA 4WLOA 4OL9A 1Y8RB 5LCXA 1YOVA 4R3NA 4XWYA 3PHGA 4EJ6A 3TF5A 5A1TA 1KY5A 2AEJA 1AHHA 1IOLA 1K6JA 2YHIA 1R4MB 3LF1A 1JKIA 1U4OA 4CUKA 1ZW1A 1E3JA 2GZ3A 2B36A 4MO2A 1QV7A 3MJTA 3ONFA 6ADHA 1U1IA 1LNQA 3H3FA 3DMTC 1ADFA 3FCOA 4WGGA 1UR5A 1EEHA 1JKJA 4MINA 1Y81A 2EKQA 4KP7A 1I30A 3I6IA 2A94A 4PIVA 3ZCXA 2HRBA 3GN2A 3JQBA 5G4LA 3G1UA 3HNPA 1R0SA 3WGTA 4BO6A 4E13A 1HDYA 1OZAA 4IIUA 4AVYA 4YAEA 4A73A 3ON5A 1QLHA 4Y98A 2HMTA 4DRYA 1SMKA 5F1KA 3RUIA 4BV8A 1BRMA 1Z6ZA 3WJ7A 5HS4A 1ZK1A 2R2GA 3F4BA 3EW7A 4NQZA 1ZZEA 4U6QA 4UEOA 3O9ZA 1M67A 2Q2VA 3O03A 4FB5A 4DBVO 1VL8A 4IQ0A 2VHZA 1ZO8A 2YY7A 4IZIA 4MVJD 3PGXA 4TROA 4JBIA 3TOXA 4CLXA 2CY0A 4D0SA 2Y66A 3WWZA 1CEQA 2X5KO 3E48A 1V0JA 3GT0A 1Y5RA 2IXAA 3WTBA 1KC3A 2JKVA 5B4TA 3FBGA 3I9NA 4B3HA 1UXIA 3I4FA 2ZB3A 1PJBA 5I9LA 4BB5A 3ETEA 1XIVA 4HNHA 2VZ0A 1MGOA 1OBFO 2ZIZA 3W8EA 5ICSA 4PLTA 4WASA 3RBZA 2O2SA 2C29D 3RC9A 1MXHA 2B37A 2PZMA 3RASA 1AGNA 3OH8A 5GZ1A 1LEHA 3GRPA 3MJCA 4ND5A 1CQJA 2XOXA 2UV8A 3LLVA 3L6EA 1SO8A 3NGXA 4ONEA 2NVBA 1OI7A 4XDZA 2JD1A 1J5PA 3TZ6A 3I9KA 4AJKA 3FHLA 4P4GA 4CLDA 1RM3A 2GCGA 4M86A 4CMJA 1GU7A 1ZJZA 3ZWAA 3E8XA 1B15A 3DOCA 3HB5X 3NTQA 5JAIA 2P91A 2CNBA 1QSGA 3G1TA 2P9GA 2WYUA 3JD2A 4NIMA 1EE9A 4EEXA 2PKQP 3OQ1A 3UKOA 1EK6A 1PQWA 2AMFA 2QZZA 1MB4A 5ITVA 1X1TA 2JCYA 2VZ8A 3S2IA 2VOEA 4WNCA 1I2BA 2V6BA 1NPTO 2UAGA 4XGNA 5ICMA 4WLVA 1LLCA 2GERA 4P38A 3ZWVA 3QA9A 5K6AC 4PLHA 1AXEA 4XRRA 3ZWPA 1E1LA 1PL6A 2GF2A 3IUSA 4K6CA 4R68A 5H83A 4U8GA 4GVLA 5A4DA 1WMAA 1GQ2A 4CQLA 2ZKLA 1DPGA 3PJEA 2V65A 2EXXA 4TVOA 3PK0A 1TLTA 4LSMA 4QO8A 2X23A 2B5WA 3OECA 4I9NA 4YQYA 2WJPA 2WWRA 5ER9A 3BAZA 3HG7A 3IDSA 3R6DA 4BL5A 1I33A 3ST7A 1NASA 5MGBA 3MJSA 4JQCA 1R4NA 3LYLA 1ZXBA 3JD4A 1C0KA 1J0XO 5I9MA 4EBFA 3VKVA 1JTVA 2WYVA 5FFFA 4RF3A 5G0TA 4MOWA 2WSBA 4RF2A 5IFLA 5TIIA 3P19A 2VUUA 3W8DA 4PG7A 2NM0A 1U2DA 2VRCD 1A7KA 2HMSA 3ROPA 4O59O 3KYDA 3E1KA 3WXBA 1E1NA 1JLLA 2VWGA 4Z3DA 3NDIA 1DIBA 1LDYA 2EP7A 1I3NA 3ADOA 5CG1A 1P1JA 2NTVA 2X7HA 1Z7BA 1YONA 1QR6A 4PLPA 1EUCA 4PLZA 4QUKA 2YV2A 4PG8A 4QFCA 4XIYA 3WGIA 2WD8A 3INRA 4KWIA 4IJUA 3ZHBA 4M8SA 2GLXA 1T4BA 1PS9A 3VPGA 4AFNA 3CH6A 1EVYA 5JXWA 2ZQYA 2PZKA 4YQZA 1LSSA 5KJEA 4YAGA 1PEDA 4BUCA 3W4JA 1I5RA 1VE9A 1DDOA 4BNMA 3A9WA 1PL7A 4FJ0A 3GVCA 5KJ6A 4Z9XA 5KWEA 1LLUA 2BGMA 4CM5A 1IUKA 3L9WA 3AY6A 4J90A 1R12A 3MTGA 3DDNA 2PH5A 4OAQA 1YOVB 4CUZA 3MCVA 2VRBA 3PGJA 4K9DA 4BVAA 4CM4A 4YT4A 2W4QA 3WGOA 3OETA 3KLMX 2J6IA 5DCUA 1PQPA 1N8KA 4FC7A 9LDTA 2WE7A 4FSHA 3HDJA 4BGUA 2ZCUA 2DC1A 2D5AA 3WB9A 1R0LA 5G0VA 2PD4A 3QSGA 2O3TA 3WWYA 2B4TO 4JP3A 2I5PO 2HUNA 3C3XA 1UP4A 3BHJA 3DZIA 2JAPA 2NSDA 4PLYA 4FR5A 1NHWA 5COBA 4XKJA 4OXNA 4ZQEA 4D79A 5IF3A 1IPEA 2Y93A 5TX7A 2OP1A 4CMKA 4BMNA 3OF2A 3NGLA 3TOZA 4J7CA 2RHRA 3JQEA 1JKFA 1H0KA 4ALLA 4I5FA 2X5JO 1O89A 1P45A 1CIVA 1WDLA 1PZEA 2FSSA 5KKAA 3ZI0A 4WCFC 4BNLA 5HS6A 3WR5A 2NWQA 2WMDA 4J2HA 4OYRA 4TKMA 3PFFA 3BMCA 4TMFA 1L7EA 1XU7A 3IUPA 3FWZA 4RPHA 3BTOA 5L51A 2BRUA 3AUUA 3M1LA 3GEDA 4WNIA 1N9GB 1VC2A 1F14A 1K5HA 1HT0A 4TZKA 2GGSA 1ZJYA 4EI2A 1WNTA 3PDJA 1U7HA 1KVUA 2V6FA 4HKTA 3GK3A 4NU5A 5FWNA 2J5KA 4MIEA 3A28A 4QECA 4CQMD 4IXWA 2D8AA 1ZXLA 3L0DA 4E5NA 5JE8A 4BNTA 2G17A 3ZV5A 5EQFA 1OMOA 2PK3A 3GAFA 1ULUA 3PLNA 4Q39A
chains in the Genus database with same CATH superfamily
3PIIA 3TMAA 2VATA 3QE2A 4IO0A 3O95A 4UM7A 3VGJA 5COQA 2XCOA 5EFZA 3RC2A 4WGFA 3ZXXA 3CW9A 2IPOA 1U5CA 2J9FA 2PMCA 4C2TA 2P79A 4IOLA 1XZFA 4DUZB 2RI0A 4YRKA 5IMBA 3IR7A 3GFBA 4K3UA 3HKBB 3U17A 4CDMA 3C15C 3L0PA 4GPD1 5TJHA 1MV8A 1DZ3A 2WAXA 3UCFA 4DRZA 3GDHA 5ITSA 1A77A 5JQGA 4HAVA 5A5VA 3AR7A 3QVUA 4ETMA 3SIRA 4DARA 1QONA 3GJTA 1KH2A 4O25A 2YQ4A 1QIKA 3GROA 1FLDA 2YHAA 3T9CA 1M6EX 4CKXA 4XPZA 5ADUS 3AVVA 1E7WA 2W48A 3LYUA 5JH7B 1PYGA 4I3FA 1CNFA 1MTOA 1W85B 2VYND 3BEOA 4B09A 2H5EA 2IYYA 3E18A 2P77A 1S8FA 5JO0A 2M2IA 1I01A 1SUIA 3PD7A 4JOCA 4W8GA 4IIJA 2YVQA 1FL9A 1LQ2A 2ZIAA 2OT3B 4YP1A 1KE2A 5K99A 3H17A 4D9EA 5G1OA 4CLEA 4FHGA 2E4AA 2ZWIA 4IS2A 5LOVA 3DPSA 3WNVA 3GJ4A 4ZYTA 2UZ4A 4MIKA 1OFUX 1KY4A 3UXYA 1XNGA 2WUGA 3WMGA 4DXAA 1W5FA 4QGHA 1PAUA 2C5LA 2YWDA 3FW1A 3GLHE 5JATA 2LPMA 4AT1A 2CVHA 2BE9A 4FQ7A 2QP9X 3IQXA 5ANRB 2BEVB 1FUEA 3H4TA 1GAXA 2I54A 2EKBA 3M5WA 4B6QA 3NWEA 4DSUA 4JJ7A 5FUQA 3IAFA 4LNUA 4UBMA 1PP4A 2P5SA 1ZH6A 3LGXA 2OUIA 4RAQA 3TLBA 4ALJA 3DBOB 1AKRA 1U0LA 4L50A 3CTPA 3ET4A 1K6MA 4NDAA 4XDYA 2PRSA 2Z2IA 2XMZA 3QUSA 2CLSA 1TJ3A 3KV1A 4WWHA 4WSOA 1N1MA 1L3BA 4R1NA 1OBOA 4X1IB 4KVGA 4QJIA 4EPRA 3OOSA 4KBYA 1XMOB 4GD3Q 2VBFA 2XEXA 4EDFA 4YT8A 3TOCA 2HHJA 1RWKA 1UQUA 5BWNA 1ZVVA 1L5HB 2IYXA 3DCJA 1PZHA 3GR6A 3QFRA 1QRUA 3IQHX 3BCSA 4NECA 3RS2A 4BATA 7MDHA 3ICVA 4CIYA 5KNBH 1Y34E 3L7JA 5IC5A 4L73A 3WP1B 1FB5A 1QYIA 2EWWA 4ZOQI 4GI7A 1AX9A 2BJVA 3D9QX 2WIKA 4V2UA 4Z4IA 1BXGB 2BI4A 1S7CA 3EVBA 3OSUA 3CISA 4UC0A 2O8BB 3TS1A 2VEOA 2QP3A 1JEYA 5G0SA 2QQ0A 2QVLA 1BJKA 1W0JA 3EF3A 5L8VA 3EC7A 4RUKA 2EATA 4Z4CA 3CGGA 3N6XA 4KGXA 4QLAA 1P75A 2DULA 3ZW8A 2NPFA 2FLKA 3HV0A 4H1UA 2VQ3A 2DWUA 1S3IA 4CFYA 4A7PA 2FK8A 5JSHA 5KB3A 2WNIA 4A27A 4BKPA 2R8YA 1A9ZA 1IDN1 4NMMA 1HFJA 3K4HA 4BFWA 2ZK7A 4YMVA 3HLKA 4EHHA 1TYAE 5ECDA 4KDEA 1EFRD 3VPFA 1C9DB 3OUTA 4EKIA 2GDJA 3WLIA 2XBLA 1BE1A 1U5BB 4NXMB 2B1QA 2J0UB 2FSHA 3AHCA 3K1AB 4G0PA 4X3PA 5EINA 3G68A 4XW2A 5U4QA 4CL8A 4KACA 2XGSA 1E59A 1IG0A 2XX3A 3IAHA 3OMXA 5CX1A 1KOLA 3IOEA 1T0PA 5BW4A 3FNGA 2QI9F 3SEFA 3EXHA 3K2QA 2EW8A 1C3VA 4HR7A 1M1ZA 2GXUA 2RJNA 4ARUA 2C92A 1LW7A 4DGSA 3R23A 4XQEA 2H7XA 3G0GA 5TQ0A 4NWIA 1C0IA 1XCMA 4M7RA 3S4YA 4GZLA 5IAOA 2DBYA 4EB6B 1SIBE 4FBMA 1W44A 3H2SA 5CD1A 5D51S 4MUJA 5A9RA 1ZR2A 3EMVA 4YJHA 3OG9A 3KPWA 1DUIA 4G01B 9ABPA 1EUYA 5CXQA 4LJRA 1IY9A 4QFMA 1Y7IA 1YS6A 3OIFA 4XIJA 5U1PA 2Q5JA 1EX1A 1RIIA 2GHQA 4TVBA 5IXSA 2ZI5A 1CETA 1Y8QB 3DDWA 2ZRBA 3KQHA 2EERA 3TQIA 2EIHA 2OL4A 3ZNNA 4EY8A 2WQ7A 4F3TA 4Z9FA 2WV7A 3EIUA 3KG2A 2HDNB 1HYBA 1YAJA 4KYVA 5KVQA 3SNHA 3AP3A 3UK0A 2QPAA 2FDCA 3DT9A 2E9SA 2GNOA 1XWIA 2PANA 3ZDXB 4OI1A 2FWMX 2XY4A 1RYZA 1OXMA 3AFHA 4ARZB 4RK1A 2E4WA 1G8SA 3QNWA 1CVLA 1KI4A 3DUFB 4JL6A 4JYBA 2ZATA 1HLPA 5L53A 1SN7A 4M7PA 4GGMX 1HYEA 4Q05A 4GKVA 1Q7TA 3U4AA 2IXFA 3FVVA 3H11B 3ZD7A 4OGKA 1ZFNA 1RNLA 2GCPA 2NVUB 5HE8A 5D85A 3FIUA 3CC8A 4CM8B 1IVSA 3CMMA 4AWBA 2ZYGA 1S2NA 4NCBA 4LXYA 2ZR8A 4ENTA 3DO5A 3AM3A 3N58A 4Y2VA 2F59A 2NV6A 3H13A 4OTZA 5KIAA 2YX1A 4FFVA 1XTTA 1XCGB 1L4MA 1A04A 2H9IA 1E2LA 3V2IA 3AFIA 1YDWA 5BRJA 5GADl 3AIIA 3NHBA 5A3SA 4OGFA 2RHDA 4NU0A 4QPJC 4H6VA 1WCIA 2GZHA 4Z3OA 1AKWA 2ZTMA 3KZCA 4CQMB 1WDMA 1CLEA 2JEZA 3BIOA 2GTIA 4Y8VA 1R15A 5ALTA 2ZSBA 1KVTA 2Q2QA 4JENA 1STOA 3AVQA 3SI7A 3TI7A 2WZCA 2PS0A 3NT5A 4BGIA 2GPNA 4FYVA 4PPFA 5TXGA 3T3NA 5MGNA 1Q3TA 2Z09A 3U6BA 3A3PA 4IIJB 1AZTA 5BW6B 2BEUB 1PWXA 4MV7A 3VDQA 5E0KB 3PCRB 1BDJA 4FD2A 4G4IA 5LIPA 2C1EA 1JXOA 3QHPA 1ZIDA 2DPHA 1ZINA 1HPLA 1Z0FA 1G20A 2JB9A 1JB9A 3IUQA 4EG4A 5BSWA 4JT9A 3TRFA 1KY2A 1LV8A 3PFNA 1VP9A 3PICA 4KRYA 5J59A 1AQJA 3FJOA 2PKQO 2IYZA 1LNSA 1TZCA 3RU2A 4YCCA 5TDHA 3LPDA 4NAVA 2FUG1 2VNKA 3C7CB 5A4IS 1BVYF 3E4DA 2IPNA 4O5AA 3LT5A 5IM4A 4RM3A 3G6WA 1QVWA 3SICE 1M0TA 2CB0A 3RHFA 5GGYA 1T9AA 1KEWA 4F2PA 4Q7EA 2RGCA 2J4DA 4YCDA 5K45A 3P4XA 2QRKA 1E6LA 3VR5D 1ADJA 4AIIA 2P2SA 4DDMA 1H2ZA 5H0IA 1G2IA 2ODEA 3L5KA 2CVQA 1AOXA 1S2GA 2OZPA 3F8TA 4ES6A 3B9QA 3KSRA 2OD7A 1CQZA 4HB0A 4F8YA 3IA2A 4IFBA 1UEJA 3FVTA 5DP2A 2DR0A 1AGXA 1W0JD 3BUSA 3IBGA 4IW3B 3GQVA 2G06A 1IHPA 5HMMA 4CM4B 5JS6A 4DZTA 1RLIA 3OCUA 4P98A 2R68A 4UHDA 4JX8A 3VPDA 4ZAGA 1T3LA 3N2YA 4BVGA 2OYCA 4ZCTA 1VXRA 1OBHA 2JNWA 3VRHA 4CKBB 3EDCA 4KJZA 1A76A 4B2YA 2IEAA 3MS2A 2EJVA 3GI1A 4ZYYA 4GXQA 1ZGCA 4D42A 4MI9A 4B75A 4KQKA 3STUA 1JZTA 2QN6A 4LY9A 2DWPA 4PFQA 4HWRA 2QTBA 4GSKA 3JQAA 3GLFB 2OM6A 3NVDA 5C8YA 3SOZA 5JMWA 3IIKA 3SS7X 2W9XA 1T4DA 2DZDA 1B26A 3K2IA 1DAFA 1R74A 5DW0A 2C9ZA 4PZCA 4XVUA 4R31A 1NJ6A 2C3UA 2AQ8A 3FKJA 3GNLA 2DWCA 4BFUA 3T99A 1YZVA 3TSAA 3UXEA 4DQDA 2DH6A 2OHFA 4YP0A 1L5FA 3T3DA 4X54A 2Y1XA 3QF7A 3EJWA 3ZBUA 4WBNA 1B4DA 4MS4A 4BKUA 2J3EA 4LHXA 4H4EA 2O5RA 1UZUA 1GARA 1BWRA 2J07A 2ORVA 2RGUA 2Z4RA 1JAHA 1ACJA 4GX2A 2CVFA 1SZPA 1OYYA 1JLMA 2ZBUA 1L5ZA 1ZK4A 1GITA 1GL6A 2HRZA 4QODA 3DBVO 1R6AA 1R0BA 2L0XA 3QVKA 4XQCA 2YH2A 4DLLA 5JD5A 1RQLA 1KQ3A 1ESEA 2W6OA 1CEEA 3REQB 2WTEA 3GMSA 5BN3B 2WJYA 1MABB 2H7CA 3HVUA 4BGDA 2AWOA 5BV1A 1G41A 1M74A 5M34A 3R9XB 2IHTA 3K71B 2ODPA 1Y1QA 1D6SA 4ZVNA 3ZHCA 3KUXA 1GKYA 1MFPA 1OTHA 1GP2A 2ISCA 2Q9UA 1IEVA 2ZBPA 3IQFA 3K8YA 5FWXA 4LF8B 1P7YA 2Y76A 2PS1A 6PFKA 2FN7A 3L9XA 4H1VA 4KIUA 4QLBA 5BN4A 1T25A 5JAMA 2FR8A 4FIZA 2V96A 2RBKA 2BAGA 2XQFA 4YRAA 3KZ1E 4ZI5A 4X1KA 1E8MA 3QKIA 3IV7A 2EV9A 4IH9A 2Z43A 3SS9X 3S2GA 1P39A 3LLUA 2E4YA 3G88A 2WD7B 1Z2DA 1JBKA 3TL2A 5CFRA 1QS0A 1ES9A 2WM2A 3O74A 4TQGA 4FBLA 4ZEVA 2I4LA 4HFMA 3ZUPA 3SHTA 3V8EA 1H2AS 5ICGA 4RXTA 4KO3S 3QVVA 1C3OA 1MDFA 4US0R 4NMHA 1E1RD 4DJAA 4N5LA 2WTNA 5FV7A 4BO2A 3PITA 3ZBTA 4TL7A 3D2LA 3JALA 4MUFA 3RC3A 2BUBA 2QX7A 2QT9A 2RGAA 4GLOA 4KFRA 4CEJB 4HUTA 1AO3A 2OFWA 4IHAA 1U98A 5I9IA 4PV7A 3TJZA 3C5CA 2H7VA 2J31A 2ODWA 2YNMC 4GH5A 3AVWA 2KQUA 3RU9A 1EFUA 2MR5A 3ZWXA 3OFND 4GNKA 2Q4OA 1PHPA 3BX1A 2H00A 1E3TA 4RK4A 4MGKR 4YP5A 3THRA 1DI0A 3S40A 1OH8A 2YC4C 3ND8A 5CFNA 4BBJA 3CPSA 4M87A 2J4FA 2AUNA 4AF6A 2PVSA 2RARA 2O2GA 4OQDA 1NM5A 5C18A 1EDEA 1JHMA 1UXJA 1RM5A 5KPJA 5K1ZA 5BR8B 4Q7LA 4TSFD 1ZICA 5FOSA 4ZTBA 1C7QA 1RYYA 4FW9A 4TSFA 4JI0B 3D3KA 2ZE5A 3AY7A 2RSLA 3CSSA 4LUCA 2RAPA 1EDBA 1X8LA 4QUGA 4P8RA 3F0TA 1KAEA 2A14A 1P4JA 1FTNA 3D3QA 1IPHA 1NE7A 2C5AA 1ECGA 5HF6A 3DDUA 4BB0A 4HP8A 1EVJA 1ORRA 5F5XA 3TLZA 3ZZMA 2IF2A 3CTMA 1WJGA 3C7DB 4A5SA 4CIAA 2C77A 2BF7A 3EZGA 3C8ZA 4BKMA 4F9FA 3LOQA 4LG1A 1ODTC 4FT2A 1JECA 1PT7A 4IVRA 4ZAWA 4AF7A 4QXOA 1FUUA 1ORVA 2PRJA 1O94D 1DU4A 2ZUWA 1NWCA 1BFKA 1BO6A 3WAGA 4W9NC 3I5MA 3F4LA 3X2EA 5LA6A 5G0UA 3WIBA 3DC2A 2PEZA 1DC3A 3NUZA 2F43A 4C7BA 4EGCB 1MQ8B 3TX6A 5L40A 4L8VA 2Q1YA 3C1OA 4BZZA 4Y6PA 1AO0A 3GT4A 5C1OA 2ATIA 5AVYA 2ZCJA 5DOVA 2XJ9A 4WXRA 5AW5A 1LI7A 4B45A 2H0AA 3NWOA 1PR3A 3FFXA 1A7JA 1XRLA 2EGHA 4ENUA 4JEHA 1ZL0A 3F3MA 4QGFA 4RY0A 3C1TA 2Y1OA 5H70A 5ELXA 1NVKA 3UJBA 1EFKA 3CIFA 3SGLA 3CH5A 1FFHA 4TV9A 4KRFA 3T7RA 1URPA 4QA9A 2NU6A 1PEKE 3OOHA 1J21A 1ZOPA 1DAGA 4KLZA 5TEVA 1ZM9A 1Z68A 3GRVA 2VJQA 3JATA 3KAKA 2E89A 3HA3A 2CLLB 3TJMA 2AUMA 1T0JB 2Q8PA 4QO7A 1ZY2A 1WQ4A 1JKMA 4MHOA 1QHHA 2F43B 4DMMA 1T13A 1EYZA 2ZWVA 1XD9A 4Q9AA 4PQFA 2FPKA 4V0QA 1TK3A 1KQFA 1MOPA 3ILHA 1KXJA 1Z13A 2P5TB 1YVUA 3GFVA 3C3EA 4OP3A 5F12A 1CTQA 5DH9A 1I5EA 1VDZA 4YH1A 2KB0A 4A2CA 5JZVA 2DFNA 3DJFA 1QRDA 2AQIA 2GA9A 4I6GA 4YGYA 3EEYA 4BNVA 1U2EA 3ZNPA 2UVPA 2P9HA 1OWPA 2G6TA 4QFBA 3VNBA 2VL7A 1B16A 2GOYA 2JLZA 2JVKA 4R9NA 5BOSA 4GWGA 2BM9A 1S2DA 2R96A 2XYGA 4HFJA 1V7PC 1ILEA 3D64A 3K09C 4LC1A 1T2EA 4LWPA 5T4HA 3I92A 1YR1A 4TT3A 2WSYB 5TT1A 3SK0A 3RSGA 4RIFA 4RIIA 2C7BA 1TMYA 2Z0MA 1S2LA 3A05A 1KA9H 2HIGA 3S5JA 1LBEA 1NM5C 2QJTA 4HATA 4MKXA 3NI2A 3VKFA 4PN7A 4ZCMA 4Y0VA 4BFXA 4H77A 4JODA 4K0RA 1GNTA 3SYTA 4NCJA 1A8SA 5BVGA 2O8BA 3EASA 3QLTA 2FNAA 2QVGA 4TL6A 4CKWA 4XUGB 1X8JA 3O4JA 1M3SA 4QEDA 4OHZA 3KNZA 2RK6A 1MX5A 2IELA 4FYXA 3BTVA 4W5HA 2HCJB 3OZRA 3UV3A 3CKLA 3TN7A 5JLJA 4DF3A 2BM8A 5ITZA 5LOVF 4HAOA 1V4VA 5BYJA 1LCIA 1XAHA 3OO0A 2HGSA 3R3VA 4RKQA 2EX1A 5HK8A 1M34B 3KVRA 1TM2A 2RBGA 3DOEA 5DBIA 4HLUC 4KVFA 3TSWA 2E4ZA 2BI7A 4MEAA 3QIVA 3WS7A 5A3VA 1UJ2A 1TXGA 2EFGA 2B7LA 2H6EA 5FPHA 4L4ZA 1GQQA 2P62A 3CLKA 2XHEA 3A6LA 3GW8A 4N7RA 1U8EA 1KVQA 1WDTA 1JG1A 4N5MA 2GN0A 5AW0A 4GDMA 2FSFA 3C7AA 1AG9A 1AK1A 2QAGB 4JQOA 3PNBA 5ALDA 1G5QA 1R6UA 2PUTA 2HF8A 3TLCA 2VKTA 2PX2A 3HCEA 4B7XA 4NTZA 1HXHA 2XIQA 3DF9A 1XTQA 4MWGA 3V3KA 3ZDRA 4AZSA 4MHTA 3I0NA 4HDMA 5JCJA 5IH3A 3PT5A 3AIMA 2WKWA 2AN4A 2FOLA 3E9CA 2VPXA 5C34B 2Z3WA 4XVCA 1EHCA 3DMRA 1W5EA 4CKYA 3RVJA 2BZ1A 1E6EA 1V8FA 3GJSA 2B82A 2E48A 2QU8A 3AP1A 2NU8A 5KZMB 2LD4A 4NC9A 3A1NA 4OAPA 1L1EA 1PVDA 3L1UA 1RQ2A 1H94A 1XCLA 3QHQA 2Q5IA 3SFZA 2VAWA 1QZZA 1RRCA 5IT0A 4V0SA 1W4CA 2PWPA 3FPBA 1SBIA 2XZDA 4ZRDA 3MJDA 1DZIA 4NCIA 3SX4A 1T5SA 3WLAA 1WXIA 2QGNA 5T4FA 3ZXYA 2NPOA 3ZJ4A 5AM2A 1FVOA 2UYOA 3RAEC 4XWOA 4WA7A 1TEZA 2Z6UA 1RTTA 3H0EA 3BBPA 5IG2A 2WF7A 5EESA 4ILEA 3CUTA 2N75A 3B2EA 4IJVA 4HX9A 1KR2A 3ASYA 4F6RB 3WZMA 1HL3A 2NG1A 2Q50A 3D7MA 2DGDA 3QKTA 3EWIA 1SPBS 4I7EA 1QTIA 3KEMA 2X0FA 3AEQA 4N47A 5JI2E 1VCOA 2PMWB 1IC6A 4KXYA 3MUNA 1RCUA 1SXGA 1QAQA 1ZYUA 2ZDGA 5I7WA 2W2MA 1OB5A 4GFDA 1OXUA 5FUWA 2BFBB 3MELA 5E4JA 2GN2A 4X00A 1T3TA 2WR8A 5ESWA 2AD1A 1XTVA 2OESA 3DMFA 3ZVNA 2GYYA 2IEIA 4QRHA 2CE7A 3IP9A 1RAHA 1V1RB 3V2GA 3KZXA 1GR1A 2LVBA 4KWEA 3JQAB 4RMGA 1G291 3GLFA 2A1UA 1K3TA 4C7JA 3EC2A 2APJA 3JY6A 3AUAA 2WOOA 3L43A 3ID6C 1ZC4A 4NSNA 5HKAA 2BV3A 2N46A 1JEQB 4C4SA 2P40A 1L5KA 4DKXA 3GARA 2KLHA 3X44A 3SSNA 2XRZA 1DRVA 3NBKA 4HGYA 1EFCA 1GGFA 1OAOC 2EBWA 3O38A 4LBZA 3AEQB 3NOOA 4QQKA 4C1BA 3HVRA 1EUQA 1Q0SA 3DL2A 4RCVA 1Z8DA 4BC0A 4KHPB 2QMUA 5JPIA 3A06A 4AG5A 4BVEA 1HNZB 4ZOLA 5GWXA 4XGQA 1V37A 2X77A 4ZRMA 2CJFA 1T3HA 4QXQA 4Y2RA 3FOFC 3FGOA 2NVOA 2CNWD 1PJ2A 1E1MA 1LK5A 1QYXA 4WFKA 4CMGA 1A2KC 1BW9B 1YGPA 2FPPB 2HN9A 5LM3A 1QIIA 3UY4A 4XB6B 1PD1A 1YI0A 3T3EA 1DQSA 2OORC 2ZJ4A 3MRVA 3DV0A 3ZG6A 5BWLA 5EJ6A 4QAJA 2VHWA 3QELA 1ISGA 2QUIA 1HDXA 3C8DA 1XD2A 2IS2A 1X7GA 2XF8A 3H1PA 3LVQE 5E4FA 5AW4A 3R0IA 4MW5A 1J0DA 1E4EB 3CN7A 2A3NA 3DOFA 4A0SA 1OI3A 2Z9DA 4OD0A 5AVOA 3BMNB 3OQIB 3OVMA 3C70A 2PV7A 5HUJA 1NW4A 4DG9A 1ZJWA 1EQAA 1FNDA 1I0ZA 3MPUA 1VE5A 2CLEB 3WBFA 1JW9B 1US8B 2DLCX 3EY9A 2L18A 3AUXA 4IUDS 1S2IA 3FLEA 2QVYX 3TTTA 3SXUB 1YRYE 3BQNB 3R9WA 2ZAYA 4OK5A 4YIHA 3EPRA 4Q12A 3T12A 3E1GA 2IOYA 2JFFA 3DLTA 3N86A 5FBKA 3RC8A 4XJSA 1KZHA 1Z4PX 2XTJA 4DLSA 5KOYA 3VU9B 1WZ2A 2UZ1A 3SQXA 5DGCA 2XI4A 4NYJQ 3IPLA 1CFZA 2ZIXA 2I9KA 1UC9A 2GJ8A 1BMFA 3V55A 2ZI3A 1ORTA 2HK6A 2JHAA 2JFUA 1TW2A 1JHQA 2YRWA 3FYCA 4M1OA 1LWNA 1PW7A 2HWYA 4AJ9A 1W49A 4M83A 3VO8A 3WQSB 2FW6A 2V45A 4BX3A 1JHYA 5TB5A 1NQWA 4O0MA 3RTBA 1YJCA 2PJZA 3D4NA 4JC8A 2PH3A 5CLHA 5EP3A 3AOEA 1SVWA 2P9YA 3OOYA 3UAGA 1IQ0A 1W5AA 2OBBA 3O4VA 4HDRA 4AULA 3KSZO 1U1EA 221PA 2P1RA 2R8EA 3JQ8B 2ZSJA 4DIBA 4KOAA 4WJZA 3ZWMA 1NV8A 3FZEA 4C1NA 4DS3A 2I2AA 2W6CX 5KX5A 2A0FA 2JFBA 1ZSVA 4QTZA 4UBNA 2FF5A 4DCSA 4A15A 4PGAA 1X9HA 2OXTA 4ZHSA 4G9GA 5G53C 2V4ZA 4EHAA 1TCAA 4DLBA 2BDTA 4D9NA 1HT2E 1XXHB 4D5GA 4YB8A 5DFAA 4G1BA 5DULA 4ZVSA 2VG8A 5SYMA 4CLOB 5JVDA 3DZJA 2YYSA 3DTVB 4DJ5X 3HCWA 2OLKA 4IEIA 4S05A 3NP7A 3TQQA 4LHVA 2A0UA 2IS1A 3TXXA 4MQUA 5HDQA 5AJYA 2I2XB 1IN1A 3HB9A 1E89A 2WFMA 1OWNA 4NZMA 3QOFA 4AQYB 4OHCA 3JATB 4QICA 4OGWA 1KZ1A 1RKXA 2Q28A 4MGHA 2R1VB 4Q4LA 5B58C 4I5EA 3T7CA 5IX8A 4AJHA 4PG5A 3TWOA 4CIBA 1UANA 3H05A 3O92A 1WQ1R 2EHDA 1XVTA 1JIKA 2B6NA 5DHFA 1ZBDA 3ELBA 4PGFA 4K03A 5FTMA 4EY6A 4WZAA 4E31A 4I8XA 4US2R 2OWEA 3Q8LA 1TB4A 1Z38A 4MPTA 4X8LA 3ZE9A 5CCBA 3AJ9A 3AR4A 5K09A 1XGKA 3EIQA 4CCSA 1Z29A 2G4VA 1A72A 2OLJA 4QT0A 2HSEA 3KJNA 3RO7A 1CKEA 4J49A 5FO0A 3OM1A 4CCYA 3TG8A 1RJGA 2PZGA 3V9AA 1GQYA 1TDJA 4IUBS 3PF9A 3Q9NA 4NRDA 5AVVA 2DBZA 1P7ZA 2WVGA 1R64A 2OOKA 3OKAA 4YA6A 4YDSA 3K32A 5ALKA 3B5JA 4XDGA 3L4EA 1QHIA 3MM4A 3SLRA 1IZZA 3PDIB 1U0EA 3B13B 4GL4A 3Q5DA 4A8JA 1DHTA 1AKNA 3Q0IA 3K20A 3L82B 2D1SA 1P81A 4OH1A 2A84A 4P3YA 1JEDA 2CD9A 5AOCA 2FP4A 4QRDA 4UHCA 2I99A 2OXCA 3FDIA 3FTCA 3WLHA 5AFSA 3A7EA 1SU7A 1ZAYA 1ECJA 1YRWA 4EKGA 5LA6B 4S35A 2ES4A 4K0KB 1VJDA 3MCTA 4JUCA 3AP2A 1U3UA 1D8AA 2EEPA 2WTBA 1YB5A 4HBZA 2ZQZA 1NJ2A 3ABIA 4M1MA 2WWXA 1YKGA 4QPDA 4C6TA 4CTMA 4DWOA 5LMUB 2ZANA 3CUSA 4K87A 3PS9A 2ORWA 2DB3A 2RH5A 1CEYA 2Q41A 2ID7A 4DUYB 3W2GA 1AS2A 1RW4A 1ZRMA 3VI3B 1UQRA 1II0A 4IH1A 4ZYXA 5BUCA 1MV5A 4D9GA 1T5LA 2UVDA 4B34A 1XLWA 2JIPA 1F5SA 4JKYA 3H1BA 1T4GA 1OPXA 4ROSA 5ADWA 5B7NA 3I39X 5BQXA 5C8YF 4JBHA 3DVAB 3LOPA 4M0DA 4OGLA 1LNZA 3R8CA 1HFEL 5ESDA 3LXMA 4P81A 4ZXPA 1E20A 4HVLA 2VA9A 3OPVA 1Z26A 3B51X 1NVGA 2CHEA 2W90A 3FPFA 3WLNA 4C4PA 3A4MA 1YR7A 2QX9A 5AJWA 1PN3A 4YUZA 5I8PA 1C29B 2Y8EA 1SUEA 1HY3A 4KUEA 4ENRA 4MYCA 1XDSA 4DLXA 2I66A 4N5DA 4MUHA 5KNCD 3VA7A 2A5LA 4GEGA 4ASUA 3GGJA 4A8HA 1MOZA 1UM9A 3G89A 1UKZA 3UB4A 4ZU1X 1JQBA 3BH7A 4RPLA 1DP4A 2BHRA 3ZHTA 4Z9YA 3EFHA 3LXRA 4XYEA 2W6ZA 4D9FA 2B4AA 2GN1A 3LDAA 3TE7A 5JCJD 4LTNA 4MO9A 1R9GA 2DTEA 2Y1CA 2G63A 1Z4NA 2PGJA 2ZWMA 5FWAA 1BX3A 2IXTA 3B6MA 5JC8A 3KTAB 3TDKA 4TMZA 1K68A 5FOVA 4URXR 1DEOA 4BWGA 2R1TA 2UXCB 4UUMA 2VJPA 3U4QB 1KMHA 4RQAA 2ZJ5A 2IUTA 1Q2XA 5IMSA 1VHDA 4QOSA 5TPZD 821PA 1YZGA 2ZYTX 1C8LA 1EUZA 1Y1LA 5K3FB 3K0BA 2I6XA 3PFIA 4P3XA 2H4JA 1T91A 2BDEA 1UP7A 2FWPA 3NALA 5EHGA 3DE1X 4CPDA 1L4EA 1YZTA 4IDAA 3NU1A 4IG4A 2WYIA 4HJRA 1DWQA 4NONA 2QL7A 1SHTX 2CNLA 2UZ1B 5ICEA 5L3QA 1DBQA 1M2FA 1MZVA 3VHQA 5FUVA 4MZDA 1D9XA 4K9SA 2V0CA 4XR9A 4ZVPA 5LYJF 4M9SA 3WLQA 1MN6A 3UV7A 4QQRA 5I8ZA 1DRJA 2ZJ6A 2P0EA 2R6GA 1NFRA 3JASB 3PF8A 4IGAA 4IIBA 4PBSA 3W3ZB 3L41A 4FMCB 1W85A 4WZBE 4F1JA 2IUSA 5C4MA 4HCJA 4LVCA 1H4SA 1JN0A 1MJFA 2XECA 3WWEA 3IEMA 2PUAA 3C4VA 4Z5XA 1EM8B 4J76A 1E9AA 1MMFB 1DRKA 1E2EA 4ZPJA 4O2BA 4ZQBA 3KAJA 1E5TA 1E7RA 3VKUA 3WQRA 4KTVE 2Z8YA 2R1ZA 3BIWA 1DKQA 1JR4A 3MIIA 1KH1A 2E49A 3O2NA 4M0KA 5NULA 4ZI7B 2CL7X 3FRIA 5JAHA 3OQNA 1VHLA 2F4VB 3TRHA 3GOQA 5IP5A 1ISJA 3NNSA 4P5EA 3DE7X 3WGNA 2Z1NA 4EF6A 3LXXA 1H2XA 1UPBA 2OE2A 2BKVA 3BERA 3IV6A 3RBAA 3P0JA 2AF4C 3G02A 1KXZA 3IT2A 2ZSUA 4RVNA 5E2AA 3RVBA 2RJOA 5A02A 1P4GA 4WLUA 3E5HA 4XGIA 3UNXA 2FSIA 2XE7A 3NDPA 1B23P 1XEXB 1XZIA 5GJWC 5TQJA 3ZHSA 3D8RA 3RFTA 2IGTA 1B6GA 2A9KA 1N2BA 4R1OA 4FEYA 1N1GA 3AXTA 1NKVA 4IGFA 2EVWX 3MJ4A 1DTWA 1DCTA 1NYQA 2C54A 4NOJA 3UWPA 1NBWB 3PTAA 2AH5A 3NVMB 5IEJA 3GJ7A 1U7DA 2CL0X 4LYJA 4BNDB 2QRPA 2WUEA 3IUEA 4HGZA 4R9RA 4B3DA 4ICIA 4JXZA 3AYXB 2VJNA 2D5BA 2BZGA 3OQ6A 4EI9A 4V2IA 2CCKA 4XWKA 1GUAA 5HFNA 3EPHA 1J49A 5EMJA 4DJEC 3KB1A 3TCKA 1YR9A 5REQA 2H0QA 3GJZA 1PWZA 1E64A 3PLRA 4HGNA 4LVUA 3UMBA 1P73A 2IHBA 2WWYA 1UQTA 2CDRA 3ETDA 3ORHA 1NG9A 2W93A 3ZGXA 1QPBA 1IRIA 1RVDA 1ISSA 2H2GA 2WJAA 5JDIA 5SZKB 3B3AA 1U90A 3Q2KA 1YBFA 2F7SA 2C95A 1G8HA 3SSOA 5JCXA 3S2FA 3QMWA 4UVGA 3SC4A 3JWGA 1DTWB 3PNYA 3WRXA 3ZD9A 5JTUA 4TMWA 5LYJB 1JV2B 3VZDA 4MVYA 4L7QA 4U6NA 1ZW6A 4C6HA 2VDWA 4PNPA 1QH0A 1SD1A 4X64B 1QIGA 5F64A 3QUQA 4HDSA 5FORA 2JAWA 4AJJA 5I7UA 3JPWA 1DARA 1NR7A 4YV0A 3UEOA 2UUBB 1NXPA 1FF9A 2HTEA 5FHQA 1ONBA 4DEVA 4Y9UA 3AFNA 1U0RA 2OCDA 1P0PA 1CXZA 5FBWB 4ZZIA 1KTVA 4L4RA 4RL4A 5HNKA 3P32A 1U0JA 4ZU6X 2BBOA 3GRZA 3IKVA 3PTLA 3F6EX 4BZWA 4N7MA 1LXCA 1V9SA 2HA6A 2YICA 4BLUA 2DUWA 4M9ZA 4ERXA 4ECEA 3CWQA 1B8OA 1T2DA 2EJBA 5JCZA 4O4IB 4YFYA 4JMLA 2FN8A 2O2HA 4KE7A 4M3NA 3DKVA 4MWZA 2JHPA 1YL6A 2JRCA 2XA9A 3SWWA 3CZPA 2BTQB 3UOWA 3BMOB 4NEQA 1NW3A 1QYDA 1ZMOA 2V0NA 4AYWA 5IU6A 4MI3A 2WT4A 1AKQA 4H59A 1MZPA 4DG5A 3D1LA 4PC2A 5AKIA 3S70A 1XRMA 2ECQA 2MIIA 2DWOA 1ORIA 2QG4A 2X4DA 3AKEA 4O4JB 4LQDA 5EFOA 2Q7XA 1L8AA 1WLYA 4M8LA 1VIMA 2WQZA 4WZBB 1N4AA 4PRKA 3VYRB 1VQ1A 1T1IA 1HQYE 1OLXB 2NU9A 3D81A 5B30A 5MFPA 3T5TA 1JDJA 3CA8A 3AETB 1II8B 2JI9A 3K5HA 5SICE 3A2KA 3EGDB 3HXLA 1NN0A 2RGRA 3VSCA 1NNEA 2F00A 3MD9A 3VX4A 3AWDA 4MGYR 7REQA 3EXAA 4UMVA 1JA0A 4HMQA 1CYDA 1V4BA 3H2ZA 3ER8A 3WMXA 1WLSA 2QS9A 1AUXA 4P54A 2I2CA 3MCWA 4LJ9A 4MV6A 4DCJA 3FOEC 2D0OB 1EDZA 1K7CA 3RK4A 2AG5A 3M5PA 3WLEA 2IYOA 3VFDA 4CIWA 1TEHA 2UUAB 4KEAA 4LOIA 4QUAA 2X4GA 1Y3HA 2VJOA 4KI0A 3PGVA 1JJVA 1Z35A 1FMLA 4PPYA 1IVNA 4WHMA 5EKSA 1P2BA 4BTEA 4Z7NB 2G5CA 5A1JA 1Y5NA 3F67A 3LT1A 5AK6A 3F8SA 2WU4A 4G5XA 3R6TA 4PPQA 5ALIA 4RTNA 3L8MA 1GG8A 3FNHA 3HBFA 3KLBA 2C2YA 2J33A 4PY2A 2B1IA 1MJHA 4YCNA 3HWSA 1H2RS 5KWIA 1GPWB 2BFMA 1AVTA 6LDHA 1J6UA 1KYTA 1EUDB 2XW6A 2I2FA 3RQIA 1FLNA 4EFMA 2FAXA 1XWFA 2WMNB 5EZ5A 1HYGA 1KY3A 3LX4A 1UXKA 2JLWA 4EDHA 1Z4LA 3DWGA 3N75A 4ZANA 1YBHA 1JRLA 1J42A 3DOUA 1IJEA 1ONOA 3NHFA 4Y1EA 1T43A 1JLRA 2VDUE 5HMLA 4CKEA 8OHMA 2F64A 3GEMA 1R3DA 4AURA 1IMOA 3PXBA 1SCBA 1FQWA 2W43A 4P4TA 2UZ3A 3E2PA 2B30A 2HZ7A 4ER6A 1L7PA 1FP7A 2PLRA 5IWCA 4HEQA 3F6PA 2H2IA 3P0EA 4X8OA 3ANYB 5DLDA 5CW1A 5TGZA 5JDCC 3MGBA 4NZOA 5A5DA 2B8EA 3K4QA 3QI7A 1WAMA 5AR1A 1HNNA 4LKRA 3W6UA 2NSHA 4XYGA 2XHZA 1L3IA 3SMVA 1M1YA 3TPCA 2XOEA 3LHIA 1I32A 3ZU3A 3ZZ0A 3LBHA 5F73A 2GPSA 2HYDA 4LHSA 2B4YA 1ZNQO 1RXCA 2R7NA 3AF5A 1LLDA 1OGYA 1SFRA 1W34A 1N2CB 3CT4A 4II2A 4EFLA 2JLXA 1Y9ZA 1A8PA 3I2KA 1D2HA 1NW8A 5KREA 4O8ZA 4R2XA 1MIOA 3TRDA 4ZVOA 4AMGA 1E3LA 5GJVC 5EHNA 3BMCB 2AA3A 2OO5A 4QUBA 4G86A 4R9UC 2QQFA 3L7OA 4WZ6A 4R1LA 1F4VA 2ABWA 4R41A 3WRWA 1O8CA 3PGA1 3ZK9A 4EPVA 1QPGA 2XGJA 3UUEA 1NRWA 2C57A 5AQ1A 5C35A 3CWCA 3P52A 3EQ7A 3U3MA 3G8AA 5E7IA 2MHCA 5F76A 4DYDA 2JK1A 4MRPA 4GP7A 3OPYA 1VRWA 4HNTA 3UMMA 2XTMA 3V7YA 2EEZA 4B7AA 4EHLA 1XQ6A 2PS3A 3IJEB 3K92A 4F4CA 3QWIA 5G2OA 2JD2A 3EEOA 1GY8A 2AE2A 2XMGA 1JT2A 2DM6A 4UUQA 4PQEA 4XDHA 1PNTA 4FX5A 2QTAA 3JZFA 4D45A 1A1VA 3W5UA 4EW3A 5AIBA 1T4CA 1AKEA 4O1MA 2JLCA 2ZLBA 2HXYA 2XSZD 1N5MA 4I1IA 4QIHA 1KK2A 4AB1A 2WUFA 1W96A 2DVMA 1UJMA 1O0BA 4C06A 4X7RA 4HJXA 4DLWA 1A9QA 4LPSA 4BVKA 2OFPA 3O8DA 5F4BA 3LPNA 4A1OA 3W6PA 3ADBA 1Q1AA 5IXYA 4Q03A 4RMIA 1GUYA 1VMIA 2WFLA 3WK6A 2ZRHA 2KJQA 3OM8A 3HU5A 3NAGA 2QPLA 2B8JA 4TVSA 1EK2A 1RI3A 4NZZA 1WD5A 5H1YA 2C04A 3KQUA 2CZCA 2PPVA 4AMYA 1D2GA 5JJIA 1D0IA 1Z0SA 1EZZA 1P9OA 5AVQA 4AKTA 4C43A 2MU1A 3OTHA 4M1YA 1T15A 1XOIA 2E87A 5CNMA 3M33A 1DHRA 2WJ3A 4P7GA 2RD2A 2C1ZA 1R6VA 4TLEA 3GLHB 1PUJA 4CKBA 2PL9A 1A9SA 1KO5A 2I1LA 2J9YB 3JV7A 3A1EA 1KP3A 2ILVA 1M1UA 4K88A 4LZZA 2SCUA 3CE9A 4NAHA 4QAQA 3I5YA 1BZYA 1VG1A 2FPIA 3O5AA 3UXMA 3G1WA 2PRZA 4PZUA 5ARDA 2W4MA 3RIXA 2QE7A 1Z3IX 3VPSA 1QLJA 3EXIA 3CQ9A 5AKXA 3WL8A 5JSUA 1DG9A 4S1OA 4RKEA 2VS1A 5BPHA 2ODBA 4Y6QA 3DMNA 4INAA 1KMIY 4RZ2A 1SCJA 3ZK8A 5LOVB 4TTPA 3QVLA 4R84A 1N2XA 3R5TA 4RIEA 5GVRA 3UMGA 1KRHA 1QOQB 2AEFA 2IUYA 3W9UA 4EGAA 1VL0A 3HVKA 1L3CA 1RI4A 1KAOA 4G23A 3LA6A 3KKQA 3ZJVA 2KE5A 3CO5A 4GPAA 1N8TA 2D1QA 3IDFA 3OZ7A 3U2QA 3OJLA 4RF4A 2PYIA 5BWOA 3B9BA 4WECA 1U99A 1ULTA 4DREA 4JLOA 2WMYA 4GGPA 5JS1A 2IT1A 3I8OA 5L7TA 5G1PA 5LQKA 2WYWA 3LBYA 5HRCA 3QFHA 3KS9A 1PBNA 1CF9A 1PFYA 2XVXA 3A6ZA 1JG7A 4H17A 3GJ5A 1E1QD 5AICA 3UUWA 4YUYA 3LHSA 2B7BA 4WKOA 3FPEA 1WUKS 4KQIA 4M0MA 3UC9A 2O5VA 3NBQA 4UDNA 3AUKA 1RWOA 1W0KA 3GDGA 2P4UA 3V32A 3JWPA 3FMVA 3PUWA 2QTHA 1MEJA 1ZIOA 2AMLA 1Y9AA 3DT8A 1T2VA 1O87A 4JVNA 4MLPA 1OX5A 3RVNA 2H2FA 3UENA 5LU9A 5K3FA 1YGYA 2EFYA 1EGAA 1II9A 3CLRC 4GBMA 4RXUA 4X9XA 3T4UA 4H27A 3P27A 4QKQA 1VLVA 1AE1A 2Z8ZA 4WV3A 1CVRA 4M53A 1GFIA 1MXFA 2C3YA 3B1VA 5CPFA 4CTNA 3PUIA 1OC2A 4Y18A 4GYKA 3TIXB 4A8JC 4K9OA 2ENUA 4N49A 4BVLA