2Q30A

Crystal structure of a rmlc-like cupin protein (dde_2303) from desulfovibrio desulfuricans subsp. at 1.94 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
106
structure length
106
Chain Sequence
HMKSHNLLEAVRFDDQRFVMELVHESENFKIVSFTFKAGQELPVHSHNIEGELNIVVLEGEGEFVGDGDAVIPAPRGAVLVAPISTPHGVRAVTDMKVLVTIAPPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_388795.1) from Desulfovibrio desulfuricans G20 at 1.94 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str. g20
molecule tags Unknown function
total genus 17
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q30A01
2BNNA 4IERA 1O5LA 1QY4A 3RPQA 4WVZA 1IPJA 4Q0VA 3OD0A 1RGSA 1YFWA 4HLTA 3R6SA 2IXKA 5I0SA 2VECA 1WGPA 4XF4A 2OYZA 5LRSA 4I0BA 3C3VA 3L2HA 3ACLA 3D0JA 2PA7A 2K9ZA 3ZDSA 3LAGA 4R52A 3SMHA 1CAUA 4D7TA 1Y9QA 1J3RA 4PJYA 1CAVB 4KWJA 5KHHA 2C0ZA 5BUVA 1RL3A 1CAWA 3H50A 1NZCA 1SQ4A 2UY8A 4KWLA 3KGLA 4ZU4A 4IEUA 2UY9A 4META 2BNOA 1DZRA 4KWKA 1EYBA 3EBRA 3CEWA 4FBFA 2IXJA 2P17A 3D82A 4YRDA 4NVPA 4MZUA 1VP6A 2GC0A 2V09A 4Q0SA 4ZU7A 3E6DA 3EO6A 4KL1A 2PYTA 3HT1A 3NKTA 3LOIA 1G6NA 1CAUB 4RD7A 2MNGA 3QOPA 3NSTA 5LEKA 4F7ZA 4XFAA 1X8MA 1NE4A 1ZREA 1H1MA 2OZ6A 5I0UA 2CAVA 5JCTA 1O5UA 5J7MA 2PAKA 2GC3A 4R8HA 4YSFA 4EWEA 1LR5A 2XL9A 4MUVA 1J59A 3BPZA 4A2UA 4QM8A 4I02A 4Q29A 5I8TA 5C8WA 3M3IA 4HVQA 1WA4A 3O14A 2B5HA 5JR7B 2OZJA 1SEFA 1PMIA 4J1WA 3OTFA 3CL1A 3TNQA 3EQEA 3I59B 5F1RA 4IEWA 4HBNA 3JZVA 1XE8A 1ZZ9A 1QXJA 2EA7A 1XRUA 4FAGA 5I8SA 3BB6A 1NYWA 1UPIA 4XETA 1Q43A 4AQ2A 4J1XA 4EWDA 1I5ZA 4UXAA 1Q3EA 1IPKA 1ZZCA 3IDBB 3MYXA 5KBFA 1UD1A 2DCTA 5HI0A 1QXRA 1UCXA 4Q0QA 2VPVA 3KGZA 2FQPA 4I0AA 3LA3A 4IEPA 4N9IA 4D7SA 2ZKLA 1OD5A 5CVRA 3IBMA 1NE6A 2GC2A 4LLOA 3UKVA 1FXZA 2IXLA 4YNIA 4DINB 3NL1A 1JUHA 3U10A 2Q0AA 1CAVA 1CGPA 1ZRDA 4OLLA 1LB2A 3VHRA 5I0TA 3FX3A 4KU8A 3E97A 1GQGA 1ZZ8A 1RUOA 5I91A 1O7FA 1U12A 1UW8A 4X6RB 1YUDA 4IEVA 3KMHA 1DGWA 4YYOA 5T3NA 1ZX5A 2O1QA 4HN0A 1XE7A 3RDIA 4BHPA 1WLTA 4IEOA 1YFUA 1ZRRA 3DKWA 5KHKA 3H7YA 3OGJA 1VJ2A 4HN1A 4HMZA 2E9QA 1OMIA 2PAMA 3CO2A 2EVXA 1OFNA 1RTVA 3GYDA 2KXLA 5CADA 1Y3TA 3FFQA 2QNKA 3NW4A 4E2QA 1H1IA 4MGYE 3I54A 1O3TA 2UYBA 2IXHA 3UKNA 1J58A 5I0RA 3DL3A 4BYYA 1ZZBA 2Q30A 3OF1A 1CAXB 2IC1A 3H8UA 4P9GA 3KCCA 1SFNA 2GU9A 3M70A 5FCCA 2Q1ZB 3WW1A 1HW5A 1ZZ6A 3I59A 3H3ZA 4GULA 2MHFA 3ES1A 4MV2A 1X8EA 2D5HA 5FPZA 4LUKA 2BNMA 2FMYA 4O9GA 4QMAA 4E2GA 4LTAA 4Q0UA 2XGXA 2Z69A 5JSRA 5JSOA 2Y0OA 4H7LA 5KHGA 3ST7A 4Z82A 3U0ZA 5J48A 4X6QB 4XF1A 3ELNA 4IEQA 3CJXA 4QGMA 4IEYA 1CX4A 3FHIB 3B02A 3EHKA 2MPFA 1O3SA 2XKPA 2B8MA 4JTOA 4HVOA 3WW2A 3D0SA 2OPKA 4L11A 2ZCWA 4F8AA 3NVCA 2PHLA 5CU1A 2CAUA 4ORFA 2B9UA 3ETQA 4OFGA 1UIKA 2F4PA 3DV8A 2XHKA 3H1MA 4HSLA 4MX3A 5E1RA 3CF6E 4XF0A 4HZFA 5LEJA 4XFIA 3E5QA 3DN7A 4WBBA 2I45A 2K0GA 5BPXA 5BV6A 4K8FA 1VR3A 1Q5OA 5I8YA 5KHIA 2HJIA 2QDRA 4AVCA 1O4TA 2O8QA 1LKNA 5FLIA 3LZZA 2IXCA 1J3QA 5FDBA 1O3QA 4CYDA 3ROUA 2D5FA 1GQHA 4AVBA 3MZHA 3FJSA 2ATFA 1FT9A 3RYKA 1X82A 4Q0PA 4TLFA 4IEXA 1YWKA 4PIZA 3LWCA 1YLLA 1EY2A 4IEZA 2PHDA 2EAAA 5FLHA 1EP0A 3SCHA 3RYPA 1CAXA 1RC6A 4FT8A 3IWZA 4L2NA 4LEJA 4AVAA 3E5XA 4WZCA 5I93A 1ZRCA 4QX5A 1J3PA 1ZNPA 2GC1A 2QVSB 4JVAA 4MGZE 5D1IA 4B29A 4XEZA 2GH2A 3NJZA 5FQ0A 2ETEA 3GBFA 3SCGA 4BIFA 2N7GA 2BGCA 3H7JA 2CV6A 4QGNA 4IETA 5BY5A 2PQQA 2XLAA 3BU7A 3UKTA 4XF9A 1YFXA 3KSCA 3G7DA 5BXXA 4XFFA 3WW4A 3IIAA 5JAXA 3S0MA 5E16A 2BYVE 2IXIA 5C6CA 1RUNA 3RNSA 4ONUA 4PIXA 3S7IA 4MGKE 5KHJA 4EROA 3TNPB 2D40A 2D93A 2PAEA 4UBHA 1UIJA 4XFHA 3LA2A 4MGIE 3FWEA 4MH0E 2PTMA 2XLFA 3I7DA 3MDPA 4IESA 3FE5A 3HIFA 3H9AA 3IDCB 5FQ0B 2UYAA 1EPZA 3QACA 4Z07A 4QGLA 4QM9A 5FLJA 4AXOA 3U11A 3E6BA 1LRHA 3N4MA 3MPBA 4XFGA 3USSA 1ZRFA 2XL7A 2XLGA 1CAWB 3E6CC 3BCWA 4N9HA 2ET7A 1X7NA 4HVRA 1DGRA 4LULA 4I09A 3SCFA 3H3UA 3H1YA 4XF3A 2Q4SA 2VQAA 5FPXA 3EJKA 3RZZA 4KU7A 4I3PA 1ZVFA 2QCSB 3H1WA 1NXMA 5LRRA 1I6XA 1QWRA 3CLPA 2OA2A 2WFPA 4I2OA 4E2SA 4LA3A 4EWAA 4BH9A 3HQXA 5J3UA 3RYRA 1YFYA 2ET1A 2XKOA 4LUMA 2GZWA 4JTNA 2GAUA 4JV4A 1O3RA 3E5UA 1J1LA 1L3JA 4EV0A 4AQ6A 3ES4A 1DZTA 2BEOA 3SXWA 1TQ5A 3PNAA 1V70A 4PIYA 1FI2A 1OI6A 2WC2A 3PVBB 4HSJA 4O9EA 5JSPA 4LA2A 2H0VA 4XFBA 1ZZ7A 2CGPA 3FZ3A 4FAHA 3SHRA 4I01A 4UBGA 2PFWA 2H6CA 5EFUA 3HT2A 4YARA 3BALA 3WW3A 5K8SA 5AVPA 2H6BA 3S7EA 2HKXA 5EZWA 2QJVA 4QXKA 4ZU5A 3OCPA 3PLQA 4XFCA 1YHFA 1PM7A 3LA7A 2Z2SB
chains in the Genus database with same CATH superfamily
3C7OA 4AI3A 5CB7A 4IERA 1RHI2 2R1DA 5DG1A 3O1MA 4B4RA 3C8XA 1WZXA 3JBG3 1JMUB 2QQJA 3KWVA 3PUSA 4TZDA 2O14A 1CESA 4HLTA 2YGLA 3RJRA 1ZBA3 1WW5A 2IXKA 4Q4V1 1S2EA 2ES3A 1SHWB 4ZKTB 2VBBA 1FPN3 5IYYA 4JGZA 3RI9A 4EN9B 4GXLA 3JD73 1UY2A 2ORXA 2B4KA 3LAGA 2Y0IA 5GLTA 4DIQA 4AFBA 1PZ7A 4LMFA 3WLUA 1YI9A 1XJAA 2I74A 1B35A 5F39A 2YC2A 4OULA 1W0OA 5KHHA 5APAA 2C0ZA 1N47A 1ZA4A 1NA1A 2OVUA 2QKDA 1JHJA 2AREA 4KQ7A 4NMIA 1CAWA 2D6OX 2A6ZA 1NZCA 1SQ4A 1HQWA 3A22A 4WM7A 1R083 3ZX7A 3KGLA 4CCMA 1J1TA 2R062 3KM5A 2YPJA 3O1UA 5FY1A 4NPRA 2FZ1A 4KI5M 3VKNA 1EYBA 2WS93 2Y34A 3P5BA 4AEDB 2ZGTA 4A41A 2A6XA 2IXJA 3W5NA 2GC0A 1W9TA 3JUUA 1QJZA 4XDQA 2FDFA 2WKKA 4XJWA 3ZYBA 3E6DA 4R9CA 5JOZA 1QJY1 4SLIA 2EXHA 4W6WA 1W6PB 4YW3A 3WF1A 2BPA2 2C6SA 5D8AC 5DABA 2V72A 1YEWA 3HT1A 5H9PA 4CEWC 5LK5A 4XXAA 2DTYA 4KGGA 3C7HA 5G04L 2W9XA 1CQ9A 3FN9A 4AEKA 1PO11 4RHV3 1VRH2 4BB3A 2CY6A 1Y7BA 3POWA 3RVHA 3KVAA 4YPJA 4F7ZA 5LEKA 1POV1 3QBQA 2RR13 4AW7A 1RUH2 3QCWA 3OD4A 5J7MA 1BEV2 4EQVA 5GZCA 5GZEA 4WVMA 4R8HA 1F31A 4JDOA 2WQ4A 2JKBA 4IV1B 1JZ7A 3VLBB 2ADEA 4K7JA 4QM8A 3VZMA 4M3CA 4CPBA 3U75A 5FYTA 5AC91 5I8TA 4FI9A 1NZIA 4D94A 4QDSA 5FP7A 3RZMA 4HVQA 1VRBA 1NQDA 5DDJ1 2BVVA 2AZ5A 3PVEA 4N53C 5ANQA 4M4RA 2NLRA 5DZEA 5FZLA 4RR3B 5JR7B 4J1WA 4PI2A 2QDNA 3LEKA 3TNQA 3FBYA 3BUCA 4IEWA 2D6MA 2P3KA 3JZVA 3ZXLA 1BBT2 3V64A 1OC1A 1XE8A 3A21A 4B1LA 3LIGA 2WFF1 2HWD1 1GZWB 4K20A 3LPFA 5F5IA 1QQP2 1W2UA 2OS2A 3TYJA 1M06G 5DZFA 1NYWA 5A7OA 1UPIA 1JYTA 2MEV3 1AUYA 1KD7A 1Q3EA 3O1OA 1QNWA 1AYM2 4GAZA 4LR4A 5KC6A 1A78A 1UD1A 1IG0A 1UCXA 1QDOA 1YNAA 1FNYA 1RUE3 2VPVA 4LQRA 2R16A 1AX1A 1UU5A 1HDKA 1AHSA 1W2TA 2SBAA 4KH9A 4M0HA 4QPYA 4P00B 2YU2A 2BZDA 3ZN5A 3RZJA 4AE2A 5LZ6A 1BMV1 2VG9A 3LB9A 5CVRA 2PN5A 1VIWB 4S2GA 4V2WA 3W20A 3HQRA 3NL1A 5A6XA 1DP0A 1JZ2A 4AGGA 3DEMA 1X9TA 4BU2A 3NAPC 1DYPA 2XQXA 3CQOA 5FJKA 1CGPA 2E32A 4M0NA 4CU9A 3CKHA 1KQRA 2VGDA 2X10A 4Q27A 4DS0A 4KU8A 3RRDA 1LULA 4AR2A 1V6IA 1KEXA 3VBUC 4NRPA 3ZLIA 5IHRA 4LO8A 3RMXA 3BTZA 1RUOA 4RFRB 5ISLA 1WUVA 4X6RB 1JYWA 2AC1A 2ZJCA 5DUWA 1CX1A 3AP5A 5FO9B 4OUMA 2VZOA 4NAMA 2DBIA 1AR82 2J1AA 2CGOA 5CFCB 1DGWA 1OLQA 2WNOA 4YW1A 1LHNA 3IZOA 4FO9A 2O1QA 4QDQA 4YYOA 2FDGA 1LTEA 1D7PM 2D3SA 3K46A 3N9MA 5C71A 1BEV1 1KJRA 4AL9A 4IEOA 3KF5A 1Z7S2 5IT6A 4NIIA 1N3QA 3RWNA 5FY5A 5IVVA 1KS4A 1W8HA 1QU0A 1IS5A 3H7YA 3OGJA 4HN1A 4HMZA 2C26A 1AX2A 1GUIA 2DVDA 3HJRA 4UW5A 2HWC2 4COVA 3OBTA 3QH7A 2EVXA 4Y24A 5CADA 3WZ1A 4D6QA 1JW6A 1OLME 3J9SA 1D4M2 2ZXQA 4MGYE 2IUWA 4CEYC 2IXHA 1A6CA 2XJPA 3LEIA 4QKFA 1ACCA 1RXGA 1UY1A 1PGL1 1RVF3 2XJQA 1TG7A 1GNHA 1QJX1 4HT1T 4IGOA 3GGLA 4NIHA 3POBA 5ACA1 3PJQA 5FO7B 2Q30A 5JWPA 2BGOA 4J6GA 2XJUA 1RUI3 3NJXA 4BLIA 2R042 2J1UA 1RUD1 3A0KA 1RUF3 2PLV3 5DMYA 1RYYA 4XHXA 2IC1A 2Y6HA 3CNAA 3N7LA 3KCCA 4HKOA 1LOFA 3M70A 3HNYM 1I5PA 2Q1ZB 5F2SA 1OVPA 1PVXA 1M4WA 5LATA 5FREA 1BZWA 1JI6A 3I3DA 1W8TA 4MV2A 3CIHA 4S2FA 3T0AA 1RITA 2GMMA 3IMNA 4AFAA 4O9GA 5DQ0A 1U0AA 1RUC3 4MGTA 1G9DA 3AXDA 1OOPB 2XQRA 4OVEA 1FPN1 4MSVA 4DXTA 4H7LA 5KHGA 3U0ZA 3GJBA 3JD71 1ZYBA 5D8AA 2GMPA 3DPRA 1HB3A 2WSVA 2ZHNA 3VKFC 3ELNA 1W9SA 3CJXA 1JZ3A 4QGMA 3VDCA 4CEWA 2VE1A 1LHVA 3FHIB 3POGA 2RDNA 5DN2A 3N35A 3OY8A 2XKPA 3GCXA 1O3SA 1IGOA 3UETA 3T2TA 5FWJA 4JTOA 1VBB3 1CN1A 3NNGA 2HWE3 2VZ3A 3VBFB 1W6NB 5FK7A 2RHPA 4CDWC 2OPKA 1Z78A 2QQUA 1AR81 2ZCWA 4JQTA 2NPIA 2XONA 5IWFA 3NVCA 4QPIA 2PHLA 2WS91 5BNNB 1TMF3 3JB8A 2CAUA 4JHTA 4GWIA 1DQ1A 4N90A 5CKMA 4JKKA 2ZTNA 5FIXA 3RSJA 1W2NA 3DV8A 5I0DA 1F5JA 3PIGA 3RFRA 1H8VA 4WV8A 5E1RA 1D0GA 2XBO3 2YPDA 1D0HA 2J7MA 2X29A 4EZHA 1PK6C 1REDA 4FPKA 4ZXKA 4XF0A 3UK9A 2QQIA 2D98A 4HZFA 1PO21 5LEJA 3AK0A 4XFIA 4YWAA 3T2QA 1JZ5A 1V6MA 3WNMA 2B46X 2I45A 1TNFA 4GZ9A 4C91A 4RHV1 1S55A 4ARXA 5F3EA 5IVYA 2DVBA 2DVGA 1MEC2 2RR11 1V00A 2JDMA 4AVCA 3B01A 1O4TA 1H4HA 1OQDA 2O8QA 2YU1A 1W8OA 4HKLA 4N8MA 2ZMNA 4OI4A 1XU1A 1X9PA 5L9BA 4M3CE 4Y3OA 4IV3A 1DYOA 1WCDJ 2IXCA 4LHLA 2B9VA 1OUXA 3KT7A 3ZXAC 4CYDA 1ONAA 4QB1A 1QOTA 1QJU2 5T5PA 1H9PA 4Y5SA 3IN9A 5LBBA 4P5YA 3OPZA 2A6WA 2VUAA 2XB6C 3ZM8A 1FT9A 2G4IA 5FZ6A 4CDXC 4Q0PA 3VD7A 2VZSA 4JQRA 4RA0A 2W1SA 2ZEWA 3WG2A 4S2DA 1US2A 5DAXA 5LK7B 1ODNA 3WDTA 3NAPA 4GB32 4ZXEA 4AHWA 5JXJA 4YGEA 5LASA 4AG4A 4FT8A 3V56A 5C5TA 4LEJA 2DU0A 5D21A 1EAH3 4KBBA 3QD6A 5IFTA 1VBA3 2EXJA 4BPZA 5LA1A 2WAOA 4JAAA 3WQ0A 4W65A 4CUBA 1AXYA 4A6SA 1EUUA 2BFUS 4QX5A 3SQOA 1J3PA 1Z0HA 1ZNPA 5TSWA 2RVAA 5A6QA 5BNOB 3ZMOA 3MLKA 5IK4A 1F8VA 1YIFA 2RS32 1RUE1 5K7PA 5FYZA 3AMHA 3BIWE 2OQ6A 4MGZE 4AQTA 2VMGA 4H2AA 2A3YA 4RYDA 1AR63 4FSJA 2YROA 1XBFA 2GH2A 3NJZA 2W08A 1R1A2 3HN3A 2ETEA 2GDFA 3ZFGA 3GBFA 5LA0A 3GXUA 1H8TB 4NRMA 5JDBA 4AAPA 1UXXX 1FV2A 2WQZC 4AGRA 5BY5A 2DVFA 3FBMA 3K51A 5FZKA 2JD9A 3BU7A 1G9BA 3VDAA 2RM23 3B3QE 3KSCA 4FVVA 3G7DA 3WW4A 3CJIC 4HKWA 4BXSV 5EJ3A 5JAXA 4EJRA 4CEYA 1FNZA 1LOCA 1QIQA 5C6CA 1RUNA 3PUHA 4PIXA 1DCSA 1F5FA 1PZ8A 4MGKE 4UF0A 4CDQB 1UOFA 4LBQD 5FO8B 5FMDA 5K0UB 3AMMA 1V0AA 2A75A 4YG3A 4UBHA 1W3VA 5F6LB 5CFDA 5H9SA 2F6BA 1Q8SA 2HWF2 5AVAA 2AUYA 1W6MA 2Z4FA 4IXLA 1UQXA 2XVKA 3FWEA 3BPSA 4QXCA 5GKAC 4DY3A 1TME2 3I7DA 3MDPA 4D6RA 3FE5A 3HIFA 3I2JA 2V73A 2RV9A 3IDCB 4UT5A 5ABJB 3K4ZA 5A3NA 1S2BA 4LBJA 1EPZA 3OGRA 5C8CA 1XNKA 5E89A 1UZZA 3BGAA 3I2FA 1AL0G 3PIJA 3PTYA 3WDXA 1K42A 2W1QA 3FMGA 1W2OA 2VTXA 1W28A 5FFOC 4O61A 1ZRFA 4CTEA 4QX3A 3ZXGA 3WNLA 4MXVA 3HD8B 3ZFFB 3A23A 3B93A 4NHMA 2ET7A 5J96B 1X7NA 2HBUA 1MS0A 4KG0A 2VCBA 2Z79A 5FR3A 2Y33A 3JU9A 4H3WA 1DLLA 4GKYA 5FYYA 5FPXA 1YIPA 3EJKA 1RUF1 3RZZA 2PLV1 4KU7A 4Q4W2 4GH4B 3IB3A 1UO9A 1ENXA 2ZX0A 2UU8A 1W6QA 2QCSB 3SEEA 4QX7A 4A44A 3WNXA 3BOPA 2UURA 5HXVA 5BNPA 2WFPA 4N43B 5C9AC 3AYAA 5L7OC 2WNVA 3HPNA 2JEMA 1HXS1 1XSQA 1OD3A 5J3UA 4JDMA 3RYRA 2Q8CA 1PGSA 1OQEA 1FOD2 1XXNA 4KGQA 1Q8QA 4CSWA 1O3RA 3E5UA 3T1MA 5FKBA 3RS6A 2G19A 3S6PA 4OCTA 4GQ7A 1KITA 1E5HA 2RS53 1ULEA 2VW0A 2LALA 3I2DA 3N7KA 3Q8CA 5LBCA 3UESA 3ZIWA 1T6BX 3ES4A 3G6JB 1MS3A 4NWVA 4DXRA 5CISA 3K3NA 1S0EA 5GM0A 2ZHMA 4KNCA 4XPVA 1FI2A 1VBB1 2V4VA 4QHOA 5FZ0A 1ND3C 4ATFA 1ENSA 1W9FA 2HWE1 4JRLA 1C28A 4O9EA 4OZXA 3TEXA 1W0PA 1Y9GA 2W0XA 3R4DB 1T2XA 2Q1MA 3AP9A 4LA2A 1K45A 4NN0A 4CP2A 5KWRA 3PUAA 5LA9A 3T4HB 3ZOIA 3NMBA 4I01A 4UBGA 5F3IA 2H6CA 4C0BA 4YARA 3VDBA 4CP9B 2WJSA 4BQ2A 4DQAA 1R093 5K8SA 5AVPA 2H6BA 3MFCA 4ISQA 2FCTA 4JC1A 5EZWA 5FYBA 2Y6JA 4JGZC 4YGBA 5FP9A 3VZNA 4TLGA 5IVFA 4GIQA 1VBE1 1KGYA 1AX0A 2A5ZA 3RG0A 1YYNA 2AYHA 4XFCA 3U1XA 4F3JA 1B35C 2BNNA 5A7WB 4FOWA 4AEDA 2HBTA 3RPQA 1EV13 1REEA 4LKFA 3RZHA 4WVZA 5FZAA 1IQDC 1NT0A 1XB9A 4Q0VA 2D6NA 1RGSA 1VBC2 4Q4X2 3R6SA 1AR73 1LGCA 1OOPC 1RUJ2 2A1XA 2D44A 1VMHA 1W6PA 1AF9A 1WGPA 4XF4A 2KA3A 5FP3A 5LRSA 1NCRC 1U5IA 3IDEA 2VOVA 3WDVA 3D0JA 2PA7A 3W9AA 3ALQA 4JCKA 3INAA 1VLNA 5FZGA 2YMZA 1UAIA 2EIDA 1S0CA 1H2NA 4DUVA 3B7MA 1J3RA 3IDAA 5FMOS 2FHRA 5BUVA 3IMMA 1LEDA 1CD3G 4I3GA 5KXCA 3H50A 2CDPA 2NZ9A 4L97A 5IUQA 3VBFC 3GHMA 3MIHA 2Q8EA 3I2HA 5FYHA 1YQ6A 1UNBA 3NV1A 4A3XA 1DYKA 4META 5BNNC 3BTYA 4IV1A 3WNKA 1GU3A 3UJQA 1FMD3 4QQPA 5E8AA 1CWPA 2P17A 3D82A 3OSDA 2FDIA 3C7FA 4ZZ8A 4Q4Y3 5FY4A 2FDHA 2DU1A 3D6EA 3LQCA 1EAH1 4Q0SA 2DCKA 2LS6A 3VL9A 1VBA1 5HCBA 5FZMA 2ILMA 1CZVA 1JTZX 4TN7A 2WWSA 1PIV2 4YVWB 5KXBA 1JODA 1GP5A 2TNFA 2VMEA 2VVFA 1VPHA 5CEHA 2GALA 2VOKA 3LOIA 4IE7A 4A45A 2XJTA 1CAUB 4NHLA 4RD7A 4YW7A 3BVCA 4QXBA 1GZWA 3ZVXA 4QPGB 2WDBA 4XFAA 1EUTA 1NE4A 1ZREA 1H1MA 1MQTC 2OZ6A 4N7IA 5CYYA 2ZOEB 5I0UA 2FD8A 5JCTA 5A3TA 4Q4V2 3ACIA 5JMOA 3O1RA 2WO7A 1K5MB 3MGUA 3GCWA 3NWKA 3HAGA 3ZSKA 5E88A 5F9TA 3AMQA 1WMEA 2XL9A 2VNRA 4X8PA 2RM21 4Q29A 4Y1XA 3ZSJA 1CONA 5FZ4A 3ASIA 2DURA 4ATEA 5FYCA 3MBWA 5C8WA 3VDDB 3ZXKA 4HK8A 5JR2A 3ZSMA 4Y1VA 4CCEA 1PMIA 3KT1A 3J7NA 1DFQA 3MEPA 3CL1A 3EQEA 3I59B 4XURA 4E4HA 5F1RA 4GALA 3N9LA 1ZZ9A 4XJZA 1E5IA 1GFF2 4ZZ5A 4PF1A 1ODMA 2EA7A 2GN7A 3M3CA 2J42A 4FTSA 1QJEA 1MVQA 3EB7A 1HQNA 5I8SA 1GP6A 2R30A 5DAVA 2ZGUA 4ASMB 3ILRA 3VZKA 5C3OA 5IVBA 3MW4A 5FZFA 1RMU3 1QJY2 1LOBA 4J1XA 1UYZA 1I5ZA 4XUNA 3IDBB 5BNOC 1QOSA 2ZGQA 1DF0A 4GD4A 4AWDA 3AKTA 4EN6B 2Y26A 2JWPA 2JDAA 4CCDA 4Z2AA 5A33B 1QXRA 2VZTA 4M00A 3ZXEA 1NQJA 4B3NA 5DXDA 1VRH3 3WG1A 1RUG1 2AACA 4P9IA 1PO12 1AYN3 2JDNA 5A1AA 4IEPA 1DQ4A 4N9IA 2ZKLA 4Y1UA 1RUH3 3QLQA 2VM9A 1LAJA 3IAQA 2WZ8A 1D2SA 1OSGA 4LLOA 1WW4A 4QQLA 2IXLA 4YNIA 5A6ZA 3KHBA 3DXTA 2BRTA 4XQ4A 1DGWX 1XU2A 1BYHA 1CAVA 1ZRDA 3HWJA 1LB2A 4FPOB 2VMFA 1O8PA 1NX9A 4W8JA 1H30A 5I0TA 2OIIA 2ARAA 3SH3A 5IATA 4NHKA 1UX6A 3ZXDA 5JZGC 1GQGA 4OQ9A 5I91A 1O7FA 5DDJ2 3IKWA 4CCNA 3EXUA 4QX1A 5A7PA 4AI2A 2QZ2A 2JG9B 3OEBA 4BCUA 1YUDA 4IEVA 3VBOB 1BBT3 3MF6A 5C3SA 3KMHA 2VCAA 1GZ9A 4XABA 5L73A 1WA6X 1CZTA 1ZX5A 2JE8A 3AJZA 1XE7A 2WFF2 2X8KA 3IT8A 2HWD2 3RDIA 3ACHA 2LW8A 2VU9A 1W8ZA 2W1UA 3D4KA 2V5YA 3AL5A 1YFUA 2QZ3A 4ZONA 1J83A 2Y6GA 3RZLA 4MXWB 4JGYB 3M1HA 3N9QA 2RS11 4P14A 3ZYHA 1G9CA 1LHWA 2UWBA 2RS51 1RJ7A 2PAMA 3CO2A 3AC0A 1PVC3 3U78A 4GKXA 3GYDA 3NNLA 1U5XA 1H6XA 4IDZA 2NN8A 3CZUA 5A32B 3NW4A 4E8DA 4E2QA 2VCMA 4GWJA 1LOFC 3ZFFC 3I54A 5GALA 1O3TA 1OOPA 1MZ6A 2DWRA 3WINE 2OQ7A 2NQYA 5I0RA 4XVHA 2VTFA 2ZGMA 1XNDA 2JG8B 2X5IB 3IPVB 1NCRA 4G4FA 4ES9A 3I3MA 1PNGA 2ZHKA 4DXSA 1S0GA 1ZBE3 2XH6A 4BYYA 1PM4A 4ZY9A 1S2KA 1L7RA 4FTEA 4YG0A 3W59A 2LRPA 4TSVA 1CVNA 4QT6A 2YG0A 1R091 4H55A 1JZ6A 3OF1A 4GH4C 4Y20A 1CAXB 3OG2A 1H2LA 1XNCA 4P9GA 3T1LA 4QHZA 1SFNA 3VBFA 3J7HA 1W6NA 3DPRC 5FCCA 3W21A 1HRV1 2AGSA 3LFIA 2A3WA 1KDKA 4GULA 2MHFA 1YRZA 3ME2A 5C33A 1X8EA 2E7TA 5BNNA 1QEXA 1EV11 3LEGA 2BUKA 5A70A 4LUKA 1DQ0A 5JXGA 4LKEA 4FTBA 4QMAA 4UFHA 1S0BA 2P3YA 4E2GA 2YC4A 1AR71 3MPPG 2XGXA 3O5SA 1LESA 2XUMA 4IQPA 5GLWA 1VAVA 3MLLA 2ZX2A 3B5LB 4XUTA 5JI9A 2Y0OA 5JSOA 1Z7S3 1JYXA 4Y5TA 1F9KA 4CPBD 5DPNA 4Y33A 5J48A 2DDUA 4QPIC 2DBNA 2E26A 1XOYA 4K8RB 4XF1A 3ZYPA 5F7UA 4IEQA 2G1MA 2XJRA 2HWC3 3MIEA 4FFFA 3MW2A 1LHOA 1CX4A 2Q1FA 3B02A 3EHKA 5HCFA 2DFCA 1QDCA 3AZWA 3GZAA 3UYJA 1N3PA 2ZZQA 3VBSC 2X53S 3AVRA 3K3OA 4NJ4A 1MQTA 3WV6A 4K1YA 5FWEA 4HVOA 3WW2A 4YZ2A 1CR7A 2VZPA 2D6PA 1OBNA 2OX0A 1PGL2 2J1VA 2AR6A 4F8AA 1QJX2 4XZPA 1IS4A 5ACA2 2B9UA 4Q4Y1 2JIJA 4UOJA 4YZ4A 3WY6A 3GDBA 1Y43B 4OZOA 1JYCA 5C4WB 3BIEA 1RUD2 5FRAA 5G05L 3CF6E 5HCHA 1W8NA 2GSYA 5A80A 3J7LA 4QB6A 4IV3C 4RQPB 1SLBA 4BK4A 1CIYA 3E5QA 3R4UA 4WBBA 3BI3A 4I30A 4PHZA 3HNBM 5JIUA 4FPLA 4P5HA 5F5AA 4CCOA 2K0GA 3DKQA 2WO2A 3NNJA 2WZPP 2W1WA 4LK7A 3UV9A 4K1ZA 4K8FA 5I8YA 4MADA 5A7NA 2QDRA 5CBLA 2ZGPA 4ISRA 3N36A 4R9BA 1FPN2 3LOBA 4M01A 4D8MA 2AEYA 3JD72 1AXZA 2WYSA 2BBVA 5BNOA 5FTTC 4L99A 3OB8A 2E6VA 2VUJA 3LCPA 5T5LA 3V0AB 1J3QA 5FDBA 1NCQB 1URXA 2JDKA 3O1SA 1DZQA 4LIUA 5FYIA 4BMBA 5T52A 4CA9A 2ARXA 2QQOA 4LHSA 3VUOA 2ARBA 1W6OB 2ATFA 2RG4A 1ASJ3 1AR93 1H8TA 4OI0A 1CJDA 4TLFA 1BKZA 5DUVA 3THDA 1IKQA 1YWKA 4XCBA 3H8OA 1L7LA 1W9WA 1EY2A 1YLLA 2PHDA 1YQ2A 3OGVA 3SKVA 4AI8A 5LA2A 2WS92 4IGQA 4Q2FA 4BWOA 4BQ3A 4AGVA 3RYPA 3HR9A 1POV0 2LM3A 4QDRA 1K5JA 5FZ7A 4CXYA 3IWZA 3WF2A 1F2NA 3ZFGC 4AVAA 3KB5A 3NJVA 3RZGA 5FZIA 3URFA 1V6KA 3IAPA 5I93A 1RMU1 2A71A 2VVDA 2ZX1A 4YM0A 4YVWC 3WX5A 5JZGA 2H0BA 4CDQA 2GC1A 1PO22 1XQNA 2CSGA 2QVSB 4JVAA 3OYWB 4PDWC 4AEJA 4C0HA 1AYN1 4RHV2 3ZR6A 1X33A 3T30A 2GNDA 4CDUB 1SDWA 4XEZA 5IAVA 5EXOA 2RR12 2DCYA 2QTWB 4EYUA 4GWMA 1IS6A 3POEA 4BXFA 2N7GA 4P9XA 4R4ZA 3I97A 3AZYA 3WQBA 4YGCA 4QGNA 1F4AA 1S0DA 2PQQA 2ZEXA 1UF2C 2XLAA 5CFDC 1UYYA 4XJUA 3WW1A 3LEMA 4QX8A 5JVVA 5HPOA 1AVBA 4XF9A 3WF3A 1QJU3 1SMVA 3B69A 3AB0A 1UMZA 3VDDC 3TEWA 3ZFFA 2R071 1RIRA 2IXIA 2R32A 5GLVA 3WNPA 4DNYA 4CUCA 2NMOA 3RNSA 4ONUA 5C8CC 3T09A 2EXIA 3CBNA 5J37A 4IE0A 4P9YA 4HL0A 4CCJA 3SITA 3JBG1 5C5UA 2PAEA 1T6GC 5FPLA 4HETA 3TEYA 4GB33 2W47A 1HN0A 1ZBA1 4CE8A 4XTPA 5KR7A 3GZUC 4MGIE 4GH4A 4LBOA 2PHXA 1IQAA 1H9WA 2ZMLA 3KF3A 4WVWA 2RDQA 2P3JA 3LDBA 4Q1PA 1ENRA 1QKQA 1TEIA 2B42B 2MEV2 5GZDA 2FBEA 4FPHA 1CZSA 4HONA 2DCZA 4Z07A 4QGLA 1HQLA 2VMDA 4E8CA 5HV0A 2Y64A 4N43A 4XZUG 1UX7A 1PVC1 2R0HA 2RS33 1GLHA 3FL7A 1XNTA 5FLJA 3I2OA 2IFRA 4AVSA 2IFWA 1RUE2 4MGQA 3ITQA 5DUUA 3N4MA 4UWDA 2OW4A 1DU3D 3GF6A 1R081 3KS7A 4AK3A 4CZSA 4GMP3 3P1IA 2XLGA 1SCRA 1CAWB 4LBKA 3BCWA 1WD4A 2BFUL 3CMGA 4WM7B 4XOGA 2VW2A 5BNPC 1GANA 4Q5OA 1ZBE1 2WNVC 1DGRA 2WZR3 2F17A 1AL23 3H1YA 4YW2A 2E7AA 2YY1A 4XF3A 3OBRA 3BKZA 2KD7A 1K12A 2XG3A 1Y9MA 3FUQA 2EALA 3KZ4C 5EIYB 3OPWA 2GP3A 4PBPA 1LODA 4TXWA 2EICA 3IIIA 4MHRA 5FY0A 3VBSA 5A1FA 4EZ4A 4YFZA 4WM8C 4CP1A 4ZPIA 5IW0A 4B4QA 1UU4A 3H1WA 4UFLA 1JXNA 1WLWA 1I6XA 4JZRA 1QWRA 1ULOA 1BMV2 2NM1A 1SDDB 5EP9A 4AQSA 4QD2A 2OA2A 3VBOC 2ZA9A 3GZTB 4I2OA 2IVJA 4E2SA 4FPEA 3LGRA 4LA3A 3VV1A 4DY5A 4DRRA 4BH9A 1H4GA 5T54A 5IK5A 3CDZB 2Q8DA 3WDYA 3ZKYA 1JZ8A 1H2MA 3V0BB 2XKOA 2P37A 2C4XA 1CPMA 3M4FA 3DYPA 2GAUA 5LY1A 3MW3A 1SG3A 4FXGB 3QH6A 3MFAA 4Y4RA 1W2AX 2CGNA 3HQUA 5M0TA 5FP8A 2BOJA 2JDUA 1J1LA 1BXHA 5A7WA 2NP0A 3BODA 4E4DX 1L3JA 3LIHA 1C3HA 1LECA 4AI0A 4AQ6A 5J98B 2BEOA 1TQ5A 3OGSA 2YBSA 3PNAA 1YC61 2WC2A 1HV0A 3PVBB 1GQPA 2JG8C 2X5IC 4YVSB 3VBHB 2BTVC 4AEDC 1UKGA 2BU9A 3ORJA 2V5DA 1GZCA 2YBKA 4OUSA 3I3BA 3S57A 1UMHA 1IKPA 3HT2A 4JX0A 1HN1A 5FXVA 4D6SA 4NRQA 1JOPA 3WUDA 2HKXA 4ZS2A 1C8M3 4Q4W3 1RUF2 3U4XA 1MS5A 2PLV2 2MEV1 3N9OA 3ZR5A 2Y60A 2D6LX 2P2KA 3PLQA 3J4UH 1YHFA 1PM7A 1DGRN 4U36A 3POFA 4AOCA 4XILA 1QY4A 5JUVA 2XR4A 1IPJA 2J1RA 5FMBA 3GZEA 1YFWA 5EJZB 5B4XA 3I3EA 1HXS2 2PHFA 4NROA 2VECA 1VE0A 3K4DA 4RSUA 3ECQA 4J25A 5A7SA 2E63A 4I0BA 2E51A 2VXRA 3C3VA 3OUHA 3L2HA 4YVWA 4IV1C 3WF4A 3O1PA 3ACLA 2YYOA 3ZDSA 4QWNA 4AEMA 1O4YA 2ZS6B 1CAUA 4FXKB 3SMHA 3VL8A 4D7TA 1Y9QA 4PDWA 4AFDA 5IVJA 2EXKA 1RL3A 3NKGA 4CXXA 3B00A 2UWAA 4RR3C 4KWLA 1VBB2 1W8UA 2YZ4A 3VKLA 4OHZA 1ASJ1 1O4ZA 1AR91 1K5MA 2HWE2 1D2QA 3LSEA 4IEUA 4IE5A 2BNOA 1DZRA 4FFGA 4MG2A 1CIWA 4Q8KA 3EBRA 3JCIA 3CEWA 4FBFA 2DTWA 2ZBJA 2TBVA 4NVPA 2DVAA 4MZUA 1E5RA 4P08A 2V09A 3I2IA 3VDDA 3EO6A 3TN93 2DUQA 3PU3A 1F35A 3JXSA 2YUEA 1OT5A 2ORZA 1VBE2 1UWWA 3P3NA 5FZDA 3OUJA 1U5ZA 4IGPA 4FFIA 3ZPYA 1LOEA 4DUXA 1G6NA 2OT7A 1MVEA 2ZEYA 3W5MA 1H1AA 2P6HA 3POIA 1WMFA 3KQ4B 1VBC3 3PU8A 3J8F3 1PGW1 1X8MA 4JRAA 5FPVA 5FZ9A 3TWIA 3WXPA 1CPNA 2CAVA 4XTMA 5F3GA 4F83A 4YZ1A 4XDPA 1RVF1 1S0JA 1XYOA 4DEVA 4AVVA 3SC7X 1OFSA 2Z42A 1UY0A 1HRI3 4Q1RA 3AZXA 1LR5A 2ZGRA 5A33A 4EWEA 2CDOA 2BW8A 3BPZA 1ALYA 1RUI1 2J22A 2JDZA 3K48A 2ZKNA 1YXWA 2XJSA 5FP4A 4AI1A 3AMPA 1R64A 1SLLA 1H0BA 3AVSA 3M3IA 2WUHA 2OZJA 1W04A 3OTFA 4R4XA 2VUCA 4L8QA 5CFCC 1VB4A 4YM1A 4HBNA 4NPMA 1KS5A 2IWGB 4AFCA 5FMOL 5IVEA 3FLTA 1QXJA 1RUC1 5FZ1A 1HB4A 2ADDA 5E6HA 1W9YA 2R49A 4QHBA 1COV3 2GP5A 2IVIB 1GBGA 3MIBA 1EAH2 5F8PA 3OGGA 4WM8A 1VBA2 3AKPA 2VOWA 1SLTA 4UXAA 2G9GA 1TNRA 5CNAA 4EWDA 1ZZCA 3MYXA 1FYUA 4URAA 4XUPA 2JG9A 3I8TA 3VBOA 4XJ8A 5HI0A 1JOBA 4XE9A 1OA4A 3I2KA 4FQ4A 2VD7A 1BVVA 3BU0A 1H6YA 4I0AA 2VO5A 2ZX4A 3WUCA 3E1F1 3MIGA 4FQZA 3I3QA 1OD5A 4B8EA 1AR62 4Q4V3 3UGFA 3IBMA 4QKDA 4CU8A 2BJSA 4PF5A 2GC2A 5FYVA 5F37A 1FXZA 2DV9A 4TWTA 2WIIB 1SBDA 4JGYA 1US3A 1TMF1 3A0NA 4LO6B 2WZR1 4B4PA 3DF0A 2EIEA 1ND2B 1AL21 2Q0AA 2TEPA 2VQTA 1UZWA 5A32A 4OLLA 2ZX3A 5A6YA 1NG0A 5C70A 1C8NA 1UPSA 2RM22 3H3LA 2XBO1 3FX3A 3NQHA 4LE3A 5DAPA 1VBD3 2RE9A 3AJYA 3M3QA 5FXZA 2GMEA 2RMU3 2EIBA 4URTA 4QQHA 3VD3A 1ZZ8A 3KQRA 2JG8A 2X5IA 3WCSA 4QX2A 1JS9A 4AF9A 5JLVA 4OYUA 4N53B 2YGMA 3FHAA 1XNAA 2ARCA 5CKNA 1VAKA 3TOJA 2E53A 2HH9A 4U2AA 5B2GB 4TYSA 2HWB3 1AJOA 4D3WA 1Q56A 2VVEA 4FCAA 4PLOA 4HN0A 5A1LA 2VNVA 2E31A 1UOBA 2W87A 4BHPA 4UAPA 5IFPA 1E57A 5A3OA 5JMCA 1ZRRA 3DKWA 1QJY3 2VUDA 3ACFA 2VC9A 5FY8A 4DXZA 2YFZA 1V9U3 3MV11 3GBWA 5K4LA 1OMIA 2YDEA 2VBDA 2JB8A 2KXLA 1Y3TA 3FFQA 1PO13 2PXJA 2QNKA 4GJZA 1JBCA 1I3HA 1RUG2 2WN3A 4Z92B 2BBAA 3OPTA 5FUIA 2VCCA 1HV1A 3UKNA 3RZKA 4V1PA 4OI1A 4FFHA 1KRIA 2QBXA 3SISA 5EJ1B 4XQWA 4DPNA 3GM8A 1KJLA 2R6QA 2X09A 4XBLA 1C8M1 2CWMA 4MGSA 1NLSA 5AC93 1UL9A 2W3JA 1SLCA 1GP4A 1SBFA 5FZBA 2GU9A 4RR3A 3SNMA 2J1TA 1HW5A 3LSDA 1ZZ6A 4IL7A 3AL6A 5DDJ3 2HEVF 1JOJA 1NY71 3H3ZA 5A3WA 3VBUB 4BK5A 3KT4A 4PT6A 3WG4A 1RHI3 1YQ8A 4BMEA 5CA6A 3WDWA 2PHTA 3NRUA 2VQ0A 3DYOA 3WD5A 1DGLA 2BNMA 2FMYA 1QJFA 1AR61 3C2UA 3ZYJB 4BZ4A 3OBAA 2EIGA 1MPXA 3H8RA 5JSRA 2FZ2A 4OHVA 3ST7A 4Z82A 2OUJA 5ERLA 4CU6A 4OHXA 1LJ7A 2WWUA 4RQPA 5FYMA 4X6QB 1XNBA 3MO4A 2JE9A 4NHYA 4QKBA 1BK0A 1NUKA 4IEYA 2RS12 1MACA 2RS52 5GLZA 2ZZJA 2MPFA 3FFZA 2LROA 2B8MA 2XWJB 3AKRA 3N9PA 4LBNA 1TE1B 5EPAA 2R063 4COYA 3D0SA 4PQ9A 2W92A 2W46A 4L9BA 4CEYB 3M7AA 1F15A 3VB9A 5SV8A 1V6OA 3APBA 1PMHX 3WP3A 4O7XA 5CU1A 3V0AA 4AVTA 1NCQA 3AFGA 5HCAA 3CZJA 3ETPA 5HXMA 2RJKA 3R4SA 3ETQA 4OFGA 3RWKX 2WBKA 1QHDA 1UIKA 2F4PA 1R092 4JDNA 3VGIA 1UZYA 3H1MA 1RJ8A 4LBQB 4MX3A 4AHXA 4BOWA 1SZBA 1W6OA 1HB2A 2CNAA 2JXAA 1C1FA 2IZWA 2XHNA 3OJBA 5LBEA 4BE3A 4BDVB 1C5HA 1HIXA 1HRV2 5L19A 2WAAA 4AAXA 4FOQA 3DCQA 3FC0A 4R9AA 1ZM1A 3DYMA 3UGGA 3NV4A 2P6CA 1EV12 3HMYA 4BQXA 4HXCA 5BPXA 2XOMA 1SCSA 3J8F1 4C1XA 2WABA 5BV6A 1VR3A 5KXDA 1Q5OA 3ZYFA 5KHIA 2E33A 2HJIA 1AR72 4E4SA 1BEV3 1H8TC 1DQ6A 4K3UA 1OH4A 4ES8A 1LKNA 1OF4A 2L9LA 2DYCA 4BISA 1ZRIA 1HRI1 3Q8EA 3M8LA 1LGNA 3D8CA 4CVUA 1RXFA 5J36A 3ZN6B 3OYWA 4A7YA 2P4EA 3B9IA 4YW4A 2ZHLA 4B7KA 4ET7A 2XMLA 3I4IA 5FZHA 4CDUA 2JKXA 1JZ4A 3KD4A 3ROUA 2D5FA 1GQHA 4AVBA 4WVVA 1GOHA 3MZHA 5IVCA 1IZ3A 3FJSA 4CDQC 4YZ5A 3W58A 4A3ZA 2ZGOA 3RYKA 5K0UC 2CHHA 2ERFA 5HBAA 3PURA 4CDWB 3LWCA 5FLHA 1O59A 1WCUA 1QJX3 2D6KA 2TUNA 3HBZA 4IEZA 5T50A 1OPMA 3JQWA 5T5JA 3USUB 3DGTA 4CCKA 1N1YA 4IUGA 1V6NA 1QQP3 5ABJC 4Q4Y2 1GV9A 1COV1 2WNUB 1RUD3 3E5XA 2GH8A 4NWWA 3WEZA 1PMJX 3ZO0B 1AYM3 3ATGA 4PQQA 2BWAA 5T55A 1PK6B 4D69A 5AFBA 3P3PA 1JU4A 4FPGA 2E7QA 3AZVA 1S1AA 3AYEA 3L2YA 1O8SA 4HPKB 3AZZA 4XACA 5A3LA 5EWSA 3A4UA 1GOGA 4AHZA 2V4AA 4RGAA 3WP5A 2P3IA 2K46A 1UN1A 2YBPA 3FLRA 3OOXA 3LE0A 4MOAA 4CUGA 3H7JA 4CRQA 5JXIA 3TRSB 5IK7A 2J1EA 2BV4A 3PMEA 3UKTA 3WQ1A 4YZ3A 4XHBA 3WDUA 1FATA 2GNMA 1S0IA 1W39A 2CYFA 1SPPB 1VBD1 4B1MA 1OURA 2RMU1 4G9SB 4V2VA 3S0MA 4EN8B 4NAOA 5FY9A 2DUOA 3V65A 4N43C 2XVLA 1W05A 3VZOA 3N7MA 3WR0A 3T2PA 4OQ8A 4CDXB 1AR83 2D40A 2D93A 2BGPA 2HWB1 5BYNA 3SKJE 4XFHA 1Q8PA 2Y6LA 3IM0A 4FOYA 1WBFA 3MHZA 4P9JA 2VULA 2ZACA 3EMRA 4MH0E 2QQKA 1XC6A 1STMA 2VZUA 1VALA 4CUAA 4FOVA 4K6BA 4IESA 3HVDA 3H0OA 5JPMB 2BOIA 4I0WB 2B39A 5FQ0B 2UYAA 1P8JA 3AYDA 1RMU2 1VB2A 1V9U1 1PO23 1IPSA 1LEMA 3LDKA 3Q9OA 4UI9L 4AXOA 2JECA 1C4RA 1N3OA 1JUIA 1ULPA 2KM2A 1LRHA 3E6BA 5FPAA 1D4M3 3MPBA 1KFXL 4QQOA 3V0BA 3USSA 1AYN2 1D4VB 2CWSA 2XL7A 5L9RA 2C1FA 5LY2A 2PHRA 4UFMA 1KXGA 3E6CC 5KC5A 3P6BA 4N9HA 2BERA 5FZOB 4LXLA 1GICA 1O91A 2WSUA 4BM8A 1FMD1 1ND2C 3KCXA 3LPGA 4HVRA 4I09A 5FZEA 3K75B 2HEWF 3H3UA 4LO7A 4W6YA 4DMIA 1A34A 2Q4SA 2R043 3NNMA 1JYVA 3AP4A 1BQPA 1QOOA 1LNSA 1V6LA 3KV9A 4YG6A 4RN5A 2FDKA 3WCRA 2D7FA 4I3PA 5CG9A 4YVSA 4Y26A 1LHUA 2VMHA 3M3EA 2R072 3VBHA 5LRRA 1DIWA 3CJIB 4DRVA 2ZGKA 5FY7A 5GZFA 5JOYA 5K9YA 4ZHNA 1QH6A 1RHI1 5LB6A 2JIGA 4HOOA 4UW6A 5F5QA 5KXEA 1MS1A 1OHFA 1L7QA 2VBPA 3JBG2 1UKRA 2VZVA 2WWJA 1PZ9A 3ZFEB 4LT5A 3VBRB 1ZBA2 2ET1A 2WLQA 3ZSLA 2VXJA 3UJOA 3WNNA 4JTNA 3AP6A 1SLAA 3KV5A 1W8FA 4JV4A 4XMAA 2GNBA 4MHUA 2VOXA 3T0DA 4EV0A 2W68A 3DXUA 3KV4A 4UFKA 4XQDA 5EV7A 1PVC2 1C5IA 1DZTA 3AYCA 3FLPA 5FZ8A 5IJRA 3SXWA 2QQMA 3WP4A 1OI6A 4Y1YA 5EYXA 2R061 1DBNA 1R082 4HSJA 1JH5A 2BQPA 4WZFA 1DHKB 5F2WA 3D5OA 1HJFA 3WG3A 4CCCA 4BQ1A 2H0VA 4XFBA 1ZZ7A 2NYYA 2CGPA 4LO5B 4FAHA 1ZBE2 1KFUL 3PJYA 4K9SA 4KWUA 3SHRA 2W95A 2WRAA 1BHGA 4Q8LA 5EFUA 4Z1VA 3BALA 3MIDA 4AFMA 1UXZA 2D3RA 4GA9A 4NO4A 1AZDA 3RMYA 3POJA 3DECA 4FP2A 2QJVA 4H14A 3O1VA 4QXKA 4ZU5A 4LKSA 4LLFA 2PELA 2VNOA 4RS5B 3PHMA 4Y22B 5DZGA 3JQXA 3NJYA 4P9LA 4LBLA 3LA7A 5K0UA 3ON7A 2W39A 2Z2SB 3O12A 5JXHA 1HLCA 4UW3A 1O5LA 1VRH1 4XC9A 5FAXA 4DOUA 3B9CA 4QPGC 2DCJA 2Q8OA 5H9RA 1C1LA 2WA4A 1MEC3 3ILNA 4XUOA 5C9AB 3OD0A 5L7OB 3S30A 1RUH1 5T5OA 3S5QA 5ABJA 5I0SA 4L0PA 1GYKA 3PL0A 1K5MC 1OPOA 1GMMA 1QNYA 2OYZA 1E5SA 5D2AA 2VW1A 2WZEA 3AKQA 5FXXA 5FPUA 4ZS3A 2K9ZA 1ZA7A 3JB4C 4ITCA 4Y1ZA 1BCXA 1OKQA 2OUHA 2ZPXA 3AXEA 4DFSA 4R52A 1W03A 3ENRA 5FBZA 1YQCA 4PJYA 1CAVB 4KWJA 3M3OA 3X29B 1GWLA 2CL2A 2A3XA 1MR5A 2HYKA 1WKYA 5J1XA 2UY8A 2UWCA 1IS3A 1SFPA 2A6VA 1LOGA 4ZU4A 3NNFA 1ND3B 2UY9A 2O8OA 1AJKA 5L9VA 1BBT1 3U4SA 4KWKA 3VHOA 2A6YA 4ASKA 3R05A 4W50A 4OHYA 5JOXA 4YRDA 5FV3A 1NOVA 1QQP1 2VOTA 4NHXA 1VP6A 2VZ1A 4RFT0 4XIKA 5FBJA 3BTAA 3CHXA 1DQ2A 4ZU7A 2WINB 4IW3A 2PYTA 4KL1A 1LGBA 3PTRB 4PCRA 4SBVA 3U37A 5JOWA 4JGZB 1W3XA 2PHWA 1AYM1 1OKOA 3GJAA 4MYEA 5CIRA 3NKTA 3H8XA 2ENRA 3GALA 1B35B 1MZEA 2C5DA 2MNGA 3QOPA 3L9JT 3NSTA 3WOGA 1NAEA 3WQ7A 2C9KA 1NA1B 1HXS3 1R1A3 4LHNA 2ZMKA 2RJ2A 3BTXA 4HK9A 1O5UA 2PAKA 2GC3A 2ZEZA 2P34A 2D97A 1LU1A 4D0QA 2RJLA 1NCRB 1IHMA 3DUIA 4ARYA 4E4ZA 4OUEA 4YSFA 5FOBB 2K2SA 5IK8A 4MUVA 1J59A 2KR2A 4A2UA 1TVGA 4I02A 4QPWA 5LCWL 1EPWA 1KDMA 2VH9A 3WVJA 4YGDA 2XXZA 3T2OA 1GNZA 2I2SA 4JKLA 4Y20B 1WA4A 1VAMA 3O14A 1WLCA 3J26N 2B5HA 3KV6A 4OI2A 3R0RA 2YC0A 1SEFA 1OXCA 2JG9C 2W2IA 2Z5WA 4LE4A 1ASJ2 1AR92 1ND2A 4QKNA 4XAEA 4CP9A 2WO3A 2HWF3 4XAAA 1XRUA 2W91A 2OPWA 2A73B 2WNUC 4FPCA 3WT3A 1TME3 4C8DA 4FAGA 1Z7S1 1XPWA 1YJKA 1R1ZA 3BB6A 1U5YA 2JDHA 2VY0A 3N9NA 2LTNA 2AEZA 1Q43A 2WT2A 4JGYC 3MI8A 4XETA 4AQ2A 5CAZA 3PUQA 5EQUA 1VBE3 5GJ6A 1IPKA 4N53A 1NLRA 2HWC1 4WVMB 5KBFA 1ULFA 1B09A 2DF7A 3VN4A 2DCTA 1IOAA 2VMIA 4Q0QA 1S4CA 3B94A 3KGZA 1ULDA 2FQPA 4M3CB 1D4M1 1WMDA 3WHUA 3LA3A 1OF3A 4GJYA 4HANA 4D7SA 1RB8G 1PGW2 5DUXA 3MUZ1 2XWBB 1MQTB 3SH4A 1NE6A 2WN2A 3VD9A 4X8NA 2QUOA 3UKVA 2WYFA 4DINB 1RVF2 4EN7B 4K21A 5DG2A 2ID4A 3ZXFA 3KLSA 4DUWA 1JUHA 3ZYIB 3U10A 4AI9A 1MZFA 3ZXJA 3C7GA 4FP3A 2R041 5ANNA 3HBKA 4UW4A 1V6JA 3UT0A 1RUI2 2HEYF 3VHRA 3I49A 3N3HA 4A4AA 3E97A 3RJ2X 2ZABA 2P5BA 1DG6A 2J1SA 1OA3A 1U12A 1UW8A 1UZ0A 1QXPA 1I9RA 4MO3M 5FUNA 1PX3A 3N7JA 3MICA 3D3AA 5T3NA 3UGHA 3M2MA 3ACGA 1RUC2 1LENA 1FOD3 1GWMA 3I2GA 1WLTA 4OMCA 4XCAA 4MLOA 3EYPA 4YM2A 3WNOA 1ENQA 5KHKA 4NIGA 3VBUA 5IAXA 3Q8FA 2JJ6A 1VJ2A 1UYPA 5B4NA 2CU5A 1WMXA 2E9QA 1YI7A 4TTGA 3LFMA 4UFIA 1OFNA 1RTVA 4QPGA 1HX6A 4EE2A 2QE3A 5F32A 1APNA 4PLMA 2JDPA 2RDSA 4DB5A 1H1IA 2QQLA 2UYBA 4OHWA 1BLZA 3KCYA 3K2OA 1J58A 4H7MA 3AP7A 1ULGA 2WL1A 4PBOA 3DL3A 4L92A 3O7OA 4A7KA 3ZKUA 1NKGA 1TMF2 2HLEA 1H2KA 1G7YA 1ZZBA 2WZR2 1AL22 2DUPA 5C4WC 1WCQA 4W6XA 4INDA 1N1TA 1MS8A 2VQUA 5FYSA 3WP6A 1W0NA 4M4PA 4KMQA 1O6UA 4E27A 3H8UA 3LKJA 1UOJA 2XBO2 4LKDA 4RQPC 4COZA 3T4VA 3F95A 1WWYA 3I59A 3MF9A 4YM3A 1WD3A 4LITA 3VD5A 1GWKA 3VHPA 5JZGB 1ST8A 3ES1A 1RINA 2D5HA 4LHKA 1G8WA 4MVTA 2Y6FA 3TAYA 1XYPA 5FPZA 3ZFEC 1DDLA 1MEC1 3HEIA 4Q4X3 3VBRC 4LIVA 3THPA 4LTAA 4Q0UA 4XJAA 5C3QA 1RUJ3 1XYNA 2Z69A 4XXPA 4LBQA 4LORA 4BQYA 4LO4B 1A8DA 1UY4A 4UFJA 1FX5A 1VMJA 4JKMA 2JE7A 1NCQC 4XBQA 2B7YA 3ZYGA 3O1TA 1OH3A 2QFEA 1QJU1 1OLRA 2YFUA 4LPLA 3VZLA 4CCLA 1RUG3 3UL2A 4QQ2A 4NIDA 2WQ8A 3T08A 2WLPA 4G3YC 5GLUA 2Y6KA 5GZGA 2VTXJ 1BJQA 3T0BA 1JYNA 3VD4A 4L11A 3MLJA 1WW7A 3PUIA 3UNPA 2WO1A 4NUBA 4IE4A 2XPJA 3SH5A 2LUWA 4HFSA 5FYUA 4GB31 3ZN6A 4ORFA 2PQSA 4YFWA 3ABZA 4W4ZA 4LJHA 2XUEA 4PI0A 1YO8A 2XHKA 3J7MA 2FDJA 3HNMA 4HSLA 4RS5C 1MZ5A 2DFBA 1C8M2 1SFYA 2O0OA 2WR9A 3AMNA 4NR1A 1PIV3 4E9KA 3HOBA 4HG6B 4QU1A 5D8AB 3DPRB 3MUY1 4XIOA 3DN7A 2RS31 4CDWA 1NY72 3WHTA 1JHNA 5F3CA 4Y5Z0 4CEWB 4KG8A 3Q8BA 4PLNA 2BVBA 5A7QA 3USUA 4CDUC 3NV3A 4NE9A 1GR3A 3OY8B 2WA3A 3OUIA 2WNUA 4GMP1 1R1A1 4ASLA 2ZGLA 4YW6A 3POSA 1W90A 4MXWA 1OA2A 1PK6A 3NO8A 4RGKA 5FJHA 5FLIA 3LZZA 3BOWA 2VZRA 4BIOA 4XYXA 4QPIB 1J84A 2VJXA 2RS13 2WT0A 5FZCA 1O3QA 1Q8VA 4HPKA 2EAKA 3SLIA 2EF6A 2JX9A 3O0XA 5A3PA 2YXSA 2P1BA 5EYYA 1QH7A 3U14A 1UY3A 3ZYRA 4BQWA 3VBSB 4A6OA 1X50A 2D43A 3IPVA 4K40A 3VKMA 1GZTA 2BDRA 4LK6A 2VNGA 4OMDA 1X82A 4IEXA 3T3YA 4PIZA 3K4AA 2XDVA 5F5CA 5JIAA 4S2HA 1F4HA 2EAAA 5SV5A 1EP0A 3U07A 4B7EA 2PMWB 2HWF1 2R1BA 5FZ3A 3SCHA 5HV4A 1CAXA 2G9ZA 1RC6A 1TME1 3ZN4A 3BN6A 4L2NA 4BJ0A 1SPPA 5DAQA 1N1VA 1OUSA 3AX4A 1HJGA 4P9WA 4WZCA 1BVP1 4Y4YA 1JYIA 1GOFA 2RDRA 4XW3A 3TN92 1ZRCA 1A3KA 2W94A 1HRV3 4CDXA 4IV3B 1UYXA 5L36A 2QQWA 2VZQA 2R0FA 5AFEA 1SACA 1NA1C 4LOTA 2ZGNA 1POV3 5D1IA 4B29A 1UU6A 2JENA 1X36A 3C7EA 1WCKA 3J8F2 4WM7C 5J09A 4R9DA 1WCSA 1WW6A 5FQ0A 3AM2A 1JU3A 3SCGA 2YV8A 1MS9A 3AKSA 1PNFA 4Q26A 4BIFA 5BNQA 4YW5A 2BGCA 5LBFA 2CV6A 5FPBA 4IETA 2XJVA 1HRI2 3F2ZA 3AFKA 3NAPB 3BYWA 4KBZA 4C90A 3OEAA 2ZGSA 1YFXA 4Q4W1 3RQ0A 3HN1A 5C3PA 5H9QA 5BXXA 4XFFA 2JB4A 3IIAA 5E16A 2VL4A 2BYVE 1HB1A 2ZAHA 3FHQA 3FUOA 5JPNB 5FZOA 3WSOA 1S0FA 3LDRA 4DEQA 5A3UA 3LD8A 3Q8AA 4QX0A 2ZAAA 3S7IA 4COUA 5KHJA 3GBGA 2F4LA 2FCVA 3TNPB 4QB2A 4EROA 1QMJA 1VMFA 1N1SA 2WNEA 4A7ZA 2AH2A 1TZOA 3ZIXA 5CFCA 2B45X 4IE6A 3MV01 1UIJA 2HYXA 5EHDA 3POYA 2WFF3 1UZVA 2GN3A 2HWD3 1SLIA 5C4WA 5FUPA 1WLDA 1G9AA 3LA2A 1FOD1 1A8MA 2D3PA 3PMSA 2PTMA 2XLFA 4GMP0 2GNTA 5DAWA 1BK1A 1COV2 2C24A 2OXBA 3H9AA 4FPFA 3WF0A 2WT1A 3ZFGB 4CP0A 3CJIA 4XDOA 5FXWA 2VR4A 4AZZA 4NOTA 1OVSA 3QACA 4COWA 1Q8OA 1G9FA 3K77A 4YLZA 5FMCA 4Z8BA 4QM9A 1C57A 3U11A 1IG3A 4BQ4A 5CKQA 2OKXA 3S5AA 3ZFEA 3TB0A 4XFGA 4PDWB 3VBRA 4CU7A 4RGGA 2YHJA 4YVSC 2A7AA 4LBMA 5CG8A 3VBHC 2QQNA 1HKDA 2JDYA 1UOGA 1G86A 3PVOA 3ZPOA 3NV2A 5A3MA 1Y4WA 3MIFA 1I1EA 4UF0B 2Y38A 4C1WA 1YQ5A 4LULA 4AHYA 3SCFA 1REFA 2SLIA 2G9FA 5C7GA 5C3RA 2VQAA 2CTVA 5F6KA 3ZMNA 3PDQA 4N7UA 4Z2WA 5CFDB 4P02B 4BLJA 5FOJB 1W6MB 3GNEA 4LNVA 4JHZA 3TN91 3KHCA 5LW9A 2BWCA 2XVGA 1ZVFA 5JI7A 2YB7A 1VBD2 3THCA 3VZJA 5LWBA 3PVNA 2NMNA 2RMU2 1NXMA 3ZDVA 3ILFA 4A42A 1FV3A 2FMDA 3CLPA 4D7YA 3LF7A 5C8CB 3VKOA 1WBLA 4EWAA 3HQXA 1VBC1 1FAYA 2A70A 1GKBA 2HWB2 2W5FA 4Q4X1 4QXHA 3TEZA 1NLQA 1W99A 1CJPA 1RUJ1 3H42B 4M3CF 3RI8A 1YFYA 4LUMA 4NPLA 1NXD1 3RGBA 2GZWA 2Y8KA 5FKCA 2W52A 4RS5A 4Y22A 4GWNA 1LCLA 4BQ5A 1YCIA 2R7EB 1UMIA 2QQVA 3OBZA 1LOAA 4NIAA 1MS4A 4XJ9A 4BA6A 2X05A 1V9U2 3O0WA 4XMIA 4RL7A 4UYBA 1QGLA 2BP6A 5C9AA 2PHUA 3KVBA 5L7OA 4LOSA 4XBNA 1V70A 2AENA 4PIYA 1AXKA 1XE0A 2JICA 3ZSEA 2VMCA 1OLMA 1W6QB 3THTA 1ULCA 3VHNA 1JN2P 1K3IA 2Q5TA 4FPYA 1DQ5A 1GSLA 2FCUA 5JSPA 3GHNA 3O0VA 3FZ3A 4AYUA 5BNPB 5ACA3 1FMD2 1XSRA 4O65A 2PFWA 4QU2A 2WNVB 3SEPA 4DZGA 1DLCA 1W06A 4DO0A 2I07B 3WW3A 3S7EA 5CZKA 1GNYA 1POQA 1PHMA 1QF3A 4FPJA 5FK8A 4EN0A 1YJLA 2JD4A 1OQ1A 2QQPA 1SBEA 3OCPA 5AC92 4CXWA 1PIV1 3CU7A 2R073 4QAWA 1ND3A 4XUQA 1PX4A 3A7QA 4WM8B 2VAUA 1LU2A 1W8WA 3TBDA 2C9AA
chains in the Genus database with same CATH topology
4AI3A 5CB7A 4IERA 1RHI2 2R1DA 5DG1A 4B4RA 3JBG3 4TZDA 1CESA 4HLTA 2YGLA 3RJRA 1ZBA3 1WW5A 2IXKA 4Q4V1 2ES3A 4ZKTB 1FPN3 4JGZA 3RI9A 4EN9B 4GXLA 3JD73 3LAGA 2Y0IA 5GLTA 4AFBA 1PZ7A 3WLUA 1YI9A 2I74A 1B35A 4OULA 1W0OA 5KHHA 2C0ZA 1N47A 1ZA4A 1NA1A 2OVUA 2QKDA 4KQ7A 2AREA 1CAWA 2D6OX 2A6ZA 1NZCA 1SQ4A 1HQWA 4WM7A 1R083 3ZX7A 3KGLA 1J1TA 2R062 3KM5A 2YPJA 4NPRA 2FZ1A 3VKNA 1EYBA 2WS93 4AEDB 2ZGTA 2A6XA 2IXJA 2GC0A 3JUUA 1QJZA 4XDQA 2WKKA 4XJWA 3E6DA 4R9CA 5JOZA 1QJY1 4SLIA 2EXHA 4W6WA 1W6PB 4YW3A 2BPA2 5D8AC 3HT1A 5H9PA 4CEWC 5LK5A 4XXAA 2DTYA 4KGGA 1CQ9A 4AEKA 1PO11 4RHV3 1VRH2 2CY6A 1Y7BA 3POWA 5LEKA 4F7ZA 1POV1 3QBQA 2RR13 4AW7A 1RUH2 3QCWA 3OD4A 5J7MA 1BEV2 5GZCA 5GZEA 4WVMA 4R8HA 1F31A 4JDOA 2WQ4A 2JKBA 4IV1B 3VLBB 4K7JA 4QM8A 3VZMA 4M3CA 5AC91 5I8TA 4D94A 4HVQA 1NQDA 5DDJ1 2BVVA 2AZ5A 3PVEA 4N53C 5JR7B 4FSJA 2NLRA 5DZEA 4RR3B 4J1WA 2QDNA 3TNQA 3FBYA 4IEWA 2D6MA 2P3KA 3JZVA 3ZXLA 1BBT2 3V64A 1XE8A 2WFF1 2HWD1 1GZWB 4K20A 1QQP2 1W2UA 3TYJA 1M06G 5DZFA 1NYWA 1UPIA 2MEV3 1AUYA 1KD7A 1Q3EA 1QNWA 1AYM2 4LR4A 5KC6A 1A78A 1UD1A 1UCXA 1QDOA 1YNAA 1FNYA 1RUE3 2VPVA 2R16A 1AX1A 1UU5A 1HDKA 1AHSA 2SBAA 4KH9A 4QPYA 4M0HA 3ZN5A 4AE2A 1BMV1 2VG9A 3LB9A 5CVRA 2PN5A 1VIWB 4S2GA 3NL1A 4AGGA 3NAPC 1DYPA 1CGPA 4M0NA 1KQRA 2VGDA 4Q27A 4DS0A 4KU8A 3RRDA 1LULA 1V6IA 3VBUC 4LO8A 3RMXA 1RUOA 1WUVA 4X6RB 2ZJCA 5DUWA 3AP5A 5FO9B 4OUMA 5CFCB 1AR82 2CGOA 1DGWA 1OLQA 4YW1A 1LHNA 4YYOA 4FO9A 2O1QA 1LTEA 2D3SA 1BEV1 1KJRA 4IEOA 1Z7S2 5IT6A 1N3QA 3RWNA 1KS4A 1QU0A 1IS5A 3H7YA 3OGJA 4HN1A 4HMZA 1AX2A 2DVDA 4UW5A 4COVA 2HWC2 3OBTA 3QH7A 2EVXA 4Y24A 5CADA 3WZ1A 1JW6A 3J9SA 1D4M2 4MGYE 4CEYC 2IXHA 1A6CA 2XJPA 1PGL1 1RVF3 2XJQA 1GNHA 1QJX1 4HT1T 5ACA1 3PJQA 5FO7B 2Q30A 5JWPA 4J6GA 2XJUA 1RUI3 4BLIA 2R042 1RUD1 3A0KA 1RUF3 2PLV3 4XHXA 2IC1A 3CNAA 3N7LA 3KCCA 4HKOA 1LOFA 3M70A 2Q1ZB 1PVXA 1M4WA 5FREA 1BZWA 4MV2A 4S2FA 1RITA 2GMMA 3IMNA 4AFAA 4O9GA 1U0AA 1RUC3 1G9DA 3AXDA 1OOPB 4OVEA 1FPN1 4MSVA 4H7LA 5KHGA 3U0ZA 3JD71 1ZYBA 5D8AA 2GMPA 3DPRA 2WSVA 2ZHNA 3VKFC 3ELNA 3CJXA 4QGMA 4CEWA 1LHVA 3FHIB 1O3SA 3N35A 3OY8A 2XKPA 1IGOA 3T2TA 4JTOA 1VBB3 1CN1A 2HWE3 3VBFB 1W6NB 2RHPA 4CDWC 2OPKA 1Z78A 1AR81 2ZCWA 2NPIA 3NVCA 4QPIA 2PHLA 2WS91 5BNNB 1TMF3 3JB8A 2CAUA 1DQ1A 4N90A 2ZTNA 3RSJA 3DV8A 1F5JA 1H8VA 4WV8A 5E1RA 1D0GA 2XBO3 1D0HA 2X29A 1PK6C 1REDA 4FPKA 4ZXKA 4XF0A 3UK9A 2D98A 4HZFA 1PO21 5LEJA 3AK0A 4XFIA 1V6MA 2B46X 2I45A 1TNFA 4C91A 4RHV1 1S55A 2DVBA 2DVGA 1MEC2 2RR11 1V00A 4AVCA 3B01A 1O4TA 1H4HA 1OQDA 2O8QA 4HKLA 2ZMNA 4OI4A 1XU1A 4M3CE 4IV3A 1WCDJ 2IXCA 4LHLA 3KT7A 3ZXAC 4CYDA 1ONAA 1QOTA 1QJU2 5T5PA 1H9PA 3IN9A 3OPZA 2A6WA 2VUAA 2XB6C 1FT9A 2G4IA 4CDXC 4Q0PA 4JQRA 4RA0A 3WG2A 4S2DA 5LK7B 3WDTA 3NAPA 4GB32 4AHWA 4YGEA 4AG4A 4FT8A 3V56A 4LEJA 2DU0A 1EAH3 4KBBA 3QD6A 1VBA3 2EXJA 4BPZA 4JAAA 3WQ0A 4W65A 1AXYA 2BFUS 4QX5A 1J3PA 1Z0HA 1ZNPA 5TSWA 5IK4A 5BNOB 1F8VA 3ZMOA 3MLKA 1YIFA 2RS32 1RUE1 5K7PA 3AMHA 3BIWE 4MGZE 4AQTA 2VMGA 2A3YA 1AR63 2YROA 2GH2A 3NJZA 2W08A 1R1A2 2ETEA 2GDFA 3ZFGA 3GBFA 1H8TB 5JDBA 5BY5A 1FV2A 2WQZC 4AGRA 2DVFA 3FBMA 3K51A 3BU7A 1G9BA 2RM23 3B3QE 3KSCA 4FVVA 3G7DA 3WW4A 3CJIC 4HKWA 5JAXA 5EJ3A 4EJRA 4CEYA 1FNZA 1LOCA 5C6CA 1RUNA 4PIXA 1PZ8A 1F5FA 4MGKE 4CDQB 5FO8B 4LBQD 5K0UB 3AMMA 2A75A 4YG3A 4UBHA 5F6LB 5CFDA 5H9SA 2F6BA 1Q8SA 2HWF2 5AVAA 2AUYA 1W6MA 4IXLA 5GKAC 2XVKA 3FWEA 4DY3A 1TME2 3I7DA 3MDPA 3FE5A 3HIFA 5ABJB 2V73A 3IDCB 1S2BA 4LBJA 1EPZA 5C8CA 1XNKA 5E89A 1UZZA 3PTYA 1AL0G 3WDXA 3FMGA 5FFOC 1ZRFA 4CTEA 3ZXGA 4MXVA 3HD8B 3ZFFB 3B93A 4NHMA 2ET7A 5J96B 1X7NA 1MS0A 4KG0A 2Z79A 3JU9A 4H3WA 1DLLA 4GKYA 5FPXA 1YIPA 3EJKA 1RUF1 3RZZA 2PLV1 4KU7A 4Q4W2 4GH4B 1ENXA 2ZX0A 2UU8A 1W6QA 2QCSB 3WNXA 3BOPA 2UURA 5HXVA 5BNPA 2WFPA 4N43B 5C9AC 3AYAA 5L7OC 2WNVA 2JEMA 1HXS1 5J3UA 4JDMA 3RYRA 1PGSA 1OQEA 1FOD2 1XXNA 4KGQA 1Q8QA 1O3RA 3E5UA 3T1MA 3RS6A 3S6PA 4GQ7A 1KITA 2VW0A 2RS53 1ULEA 2LALA 3I2DA 3N7KA 5JPMB 3ZIWA 3ES4A 3G6JB 1MS3A 4NWVA 5GM0A 1S0EA 2ZHMA 4KNCA 4XPVA 1FI2A 1VBB1 4ATFA 1ND3C 1ENSA 2HWE1 4JRLA 1C28A 4O9EA 4OZXA 1W0PA 2W0XA 3R4DB 2Q1MA 3AP9A 4LA2A 4NN0A 4CP2A 5KWRA 4I01A 4UBGA 4C0BA 2H6CA 4YARA 2WJSA 4DQAA 1R093 5K8SA 5AVPA 2H6BA 3MFCA 4ISQA 4JC1A 5EZWA 4YGBA 4JGZC 4GIQA 1VBE1 3RG0A 1AX0A 2A5ZA 1YYNA 2AYHA 4XFCA 4F3JA 1B35C 2BNNA 4FOWA 4AEDA 3RPQA 1EV13 1REEA 4WVZA 4Q0VA 2D6NA 1RGSA 1VBC2 4Q4X2 3R6SA 1AR73 1LGCA 1OOPC 1RUJ2 2D44A 1W6PA 1AF9A 1WGPA 4XF4A 2KA3A 5LRSA 1NCRC 1U5IA 3IDEA 2VOVA 3WDVA 3D0JA 2PA7A 3W9AA 3ALQA 4JCKA 3INAA 1VLNA 2YMZA 1UAIA 1S0CA 1H2NA 3B7MA 1J3RA 5FMOS 2FHRA 5BUVA 1LEDA 1CD3G 4I3GA 5KXCA 3H50A 2NZ9A 4L97A 5IUQA 3VBFC 3GHMA 3MIHA 4A3XA 3NV1A 1DYKA 4META 5BNNC 4IV1A 3UJQA 1FMD3 4QQPA 5E8AA 2P17A 3D82A 4Q4Y3 2DU1A 3D6EA 1EAH1 4Q0SA 2DCKA 3VL9A 1VBA1 5HCBA 2ILMA 1JTZX 2WWSA 1PIV2 4YVWB 5KXBA 2TNFA 2VVFA 2GALA 2VOKA 3LOIA 2XJTA 1CAUB 4NHLA 4RD7A 1GZWA 3ZVXA 4QPGB 4XFAA 1NE4A 1ZREA 1H1MA 1MQTC 2OZ6A 4N7IA 5I0UA 2ZOEB 5JCTA 4Q4V2 1K5MB 3MGUA 3NWKA 3HAGA 3ZSKA 5E88A 5F9TA 3AMQA 1WMEA 2XL9A 2VNRA 4X8PA 2RM21 4Q29A 4Y1XA 3ZSJA 1CONA 3ASIA 2DURA 4ATEA 5C8WA 3VDDB 3ZXKA 4HK8A 3ZSMA 4Y1VA 1PMIA 3KT1A 1DFQA 3MEPA 3CL1A 3EQEA 3I59B 5F1RA 4GALA 1ZZ9A 4XJZA 1GFF2 2EA7A 2GN7A 3M3CA 4FTSA 1MVQA 1HQNA 5I8SA 2R30A 2ZGUA 4ASMB 3ILRA 3VZKA 3MW4A 1RMU3 1QJY2 1LOBA 4J1XA 1I5ZA 3IDBB 5BNOC 1QOSA 2ZGQA 1DF0A 4AWDA 4EN6B 3AKTA 2Y26A 5A33B 5CFCA 1QXRA 4M00A 3ZXEA 1NQJA 4B3NA 5DXDA 1VRH3 3WG1A 1RUG1 4P9IA 1PO12 1AYN3 4IEPA 1DQ4A 4N9IA 2ZKLA 4Y1UA 1RUH3 3QLQA 1D2SA 1OSGA 4LLOA 1WW4A 4QQLA 2IXLA 4YNIA 4XQ4A 1DGWX 1XU2A 1BYHA 1CAVA 1ZRDA 3HWJA 1LB2A 4FPOB 1H30A 5I0TA 2OIIA 3SH3A 4NHKA 1UX6A 3ZXDA 5JZGC 1GQGA 5I91A 1O7FA 5DDJ2 3IKWA 3EXUA 4AI2A 4BCUA 2QZ2A 2JG9B 1YUDA 4IEVA 3VBOB 1BBT3 3MF6A 3KMHA 1GZ9A 5L73A 1ZX5A 3AJZA 3RDIA 1XE7A 2WFF2 2X8KA 3IT8A 2HWD2 2VU9A 3D4KA 2V5YA 1YFUA 2QZ3A 4MXWB 4JGYB 3M1HA 2RS11 4P14A 1G9CA 1LHWA 2UWBA 2RS51 1RJ7A 2PAMA 3CO2A 1PVC3 4GKXA 3GYDA 5A32B 1U5XA 2NN8A 3NW4A 4E2QA 1LOFC 3ZFFC 3I54A 5GALA 1O3TA 1OOPA 1MZ6A 2DWRA 3WINE 2NQYA 5I0RA 1BMV2 2ZGMA 1XNDA 2JG8B 2X5IB 3IPVB 1NCRA 4G4FA 4ES9A 1PNGA 2ZHKA 1S0GA 1ZBE3 2XH6A 4BYYA 1S2KA 4FTEA 4YG0A 3W59A 4TSVA 1CVNA 4QT6A 1R091 4H55A 3OF1A 4GH4C 4Y20A 1CAXB 1H2LA 1XNCA 4P9GA 3T1LA 1SFNA 3VBFA 1W6NA 3DPRC 5FCCA 1HRV1 2AGSA 2A3WA 1KDKA 4GULA 2MHFA 1YRZA 3ME2A 5C33A 1X8EA 2E7TA 5BNNA 1EV11 2BUKA 4LUKA 1DQ0A 4FTBA 4QMAA 4E2GA 1S0BA 3MPPG 1AR71 3O5SA 2XGXA 4IQPA 1LESA 2XUMA 5GLWA 1VAVA 3MLLA 2ZX2A 3B5LB 5JI9A 5JSOA 2Y0OA 1Z7S3 1F9KA 5J48A 3ZYPA 4QPIC 4XF1A 4IEQA 2XJRA 2HWC3 3MIEA 3MW2A 1LHOA 1CX4A 3B02A 3EHKA 5HCFA 2DFCA 1QDCA 3AZWA 3GZAA 1N3PA 2ZZQA 3VBSC 2X53S 1MQTA 3WV6A 4K1YA 4YZ2A 4HVOA 3WW2A 1CR7A 2D6PA 1PGL2 2AR6A 4F8AA 1QJX2 4XZPA 1IS4A 5ACA2 2B9UA 4Q4Y1 3WY6A 4YZ4A 1Y43B 1JYCA 5C4WB 1RUD2 5FRAA 3CF6E 2GSYA 4IV3C 4RQPB 1SLBA 3E5QA 3R4UA 4WBBA 4I30A 5JIUA 4FPLA 4P5HA 2K0GA 2WZPP 3UV9A 4K1ZA 4K8FA 5I8YA 2QDRA 5CBLA 2ZGPA 4ISRA 3N36A 4R9BA 1FPN2 3LOBA 4M01A 3JD72 1AXZA 2BBVA 5BNOA 5FTTC 4L99A 2E6VA 2VUJA 3LCPA 5T5LA 3V0AB 1J3QA 5FDBA 1NCQB 1URXA 1DZQA 4BMBA 5T52A 2ARXA 3VUOA 2ARBA 1W6OB 2ATFA 1ASJ3 1AR93 1H8TA 4OI0A 1CJDA 4TLFA 1BKZA 5DUVA 1IKQA 1YWKA 4AI8A 1YLLA 1EY2A 2PHDA 2WS92 4BWOA 4Q2FA 4AGVA 3RYPA 3HR9A 1POV0 2LM3A 3IWZA 1F2NA 3ZFGC 4AVAA 3KB5A 3URFA 1V6KA 5I93A 1RMU1 2A71A 2VVDA 2ZX1A 4YM0A 4YVWC 3WX5A 5JZGA 2H0BA 4CDQA 2GC1A 1PO22 1XQNA 2QVSB 4JVAA 4PDWC 3OYWB 4AEJA 4C0HA 1AYN1 4RHV2 1X33A 2GNDA 4CDUB 1SDWA 4XEZA 5EXOA 2RR12 2DCYA 4GWMA 1IS6A 2N7GA 4P9XA 4R4ZA 3AZYA 4YGCA 4QGNA 1S0DA 2PQQA 1UF2C 2XLAA 5CFDC 4XJUA 5JVVA 1AVBA 4XF9A 1QJU3 1SMVA 3B69A 3AB0A 1UMZA 3VDDC 3ZFFA 2R071 1RIRA 2IXIA 2R32A 5GLVA 4DNYA 2NMOA 3RNSA 4ONUA 5C8CC 5J37A 2EXIA 4P9YA 4HL0A 3SITA 3JBG1 2PAEA 1T6GC 4HETA 4GB33 1ZBA1 4XTPA 3GZUC 4MGIE 4GH4A 4LBOA 2PHXA 1IQAA 1H9WA 2ZMLA 4WVWA 2P3JA 4Q1PA 1ENRA 1QKQA 1TEIA 2B42B 2MEV2 5GZDA 2FBEA 4FPHA 2DCZA 4Z07A 4QGLA 1HQLA 4N43A 1PVC1 2R0HA 2RS33 1GLHA 5FLJA 2IFRA 4AVSA 2IFWA 1RUE2 3N4MA 5DUUA 2OW4A 1DU3D 3GF6A 1R081 3KS7A 4AK3A 4CZSA 4GMP3 2XLGA 1SCRA 1CAWB 4LBKA 3BCWA 1WD4A 2BFUL 4WM7B 4XOGA 2VW2A 5BNPC 1GANA 1ZBE1 2WNVC 1DGRA 2WZR3 1AL23 3H1YA 4YW2A 2E7AA 2YY1A 4XF3A 3OBRA 2XG3A 3FUQA 2EALA 3KZ4C 3VBSA 4PBPA 1LODA 4YFZA 4WM8C 4CP1A 4B4QA 1UU4A 3H1WA 1JXNA 1WLWA 1I6XA 1QWRA 2NM1A 4AQSA 4QD2A 2OA2A 3VBOC 2ZA9A 3GZTB 4I2OA 4E2SA 4FPEA 3LGRA 4LA3A 3VV1A 4DY5A 4DRRA 4BH9A 1H4GA 5T54A 5IK5A 3WDYA 1H2MA 3V0BB 2XKOA 2P37A 1CPMA 3M4FA 2GAUA 3MW3A 4FXGB 3QH6A 3MFAA 2CGNA 1J1LA 1BXHA 2NP0A 3BODA 4E4DX 1L3JA 1C3HA 1LECA 4AI0A 4AQ6A 5J98B 2BEOA 1TQ5A 3PNAA 2WC2A 1HV0A 3PVBB 4YVSB 2JG8C 2X5IC 3VBHB 2BTVC 4AEDC 1UKGA 1GZCA 4OUSA 1IKPA 3HT2A 3WUDA 2HKXA 1C8M3 4Q4W3 1RUF2 3U4XA 1MS5A 2PLV2 2MEV1 2D6LX 2P2KA 3PLQA 3J4UH 1YHFA 1PM7A 1DGRN 4U36A 4XILA 1QY4A 1IPJA 1YFWA 1HXS2 2PHFA 2VECA 4RSUA 3ECQA 2E63A 4I0BA 2E51A 2VXRA 3C3VA 3L2HA 4YVWA 4IV1C 3ACLA 2YYOA 3ZDSA 4AEMA 1O4YA 2ZS6B 1CAUA 4FXKB 3SMHA 3VL8A 4D7TA 1Y9QA 4PDWA 4AFDA 2EXKA 1RL3A 3NKGA 3B00A 2UWAA 4RR3C 4KWLA 1VBB2 2YZ4A 3VKLA 4OHZA 1ASJ1 1O4ZA 1AR91 1K5MA 2HWE2 1D2QA 3LSEA 4IEUA 2BNOA 1DZRA 1CIWA 4Q8KA 3EBRA 3JCIA 3CEWA 4FBFA 2DTWA 2ZBJA 2TBVA 4NVPA 2DVAA 4MZUA 2V09A 3VDDA 3EO6A 3TN93 2DUQA 2YUEA 1VBE2 3P3NA 1U5ZA 3ZPYA 1LOEA 1G6NA 1MVEA 1H1AA 1WMFA 1VBC3 3WXPA 3J8F3 1PGW1 1X8MA 4JRAA 3TWIA 1CPNA 2CAVA 4XTMA 4F83A 4YZ1A 1RVF1 1S0JA 1XYOA 4AVVA 1OFSA 2Z42A 1HRI3 4Q1RA 3AZXA 1LR5A 2ZGRA 5A33A 4EWEA 2BW8A 3BPZA 1ALYA 1RUI1 2JDZA 3K48A 2ZKNA 1YXWA 2XJSA 4AI1A 3AMPA 1SLLA 1H0BA 3M3IA 2OZJA 3OTFA 4R4XA 4L8QA 5CFCC 1VB4A 4YM1A 4HBNA 1KS5A 2IWGB 4AFCA 5FMOL 3FLTA 1QXJA 1RUC1 2R49A 4QHBA 1COV3 1GBGA 3MIBA 1EAH2 3OGGA 4WM8A 1VBA2 3AKPA 2VOWA 1SLTA 4UXAA 2G9GA 1TNRA 5CNAA 4EWDA 1ZZCA 3MYXA 1FYUA 2JG9A 3I8TA 3VBOA 4XJ8A 5HI0A 4XE9A 1OA4A 4FQ4A 1BVVA 4I0AA 2ZX4A 3WUCA 3MIGA 4FQZA 1OD5A 4B8EA 1AR62 4Q4V3 3IBMA 4PF5A 2GC2A 1FXZA 2DV9A 4TWTA 2WIIB 1SBDA 4JGYA 1TMF1 3A0NA 4LO6B 2WZR1 4B4PA 3DF0A 1ND2B 1AL21 2Q0AA 2TEPA 5A32A 4OLLA 2ZX3A 1NG0A 1C8NA 1UPSA 2RM22 2XBO1 3FX3A 4LE3A 1VBD3 2RE9A 3AJYA 3M3QA 2GMEA 2RMU3<