2Q30A

Crystal structure of a rmlc-like cupin protein (dde_2303) from desulfovibrio desulfuricans subsp. at 1.94 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
106
structure length
106
Chain Sequence
HMKSHNLLEAVRFDDQRFVMELVHESENFKIVSFTFKAGQELPVHSHNIEGELNIVVLEGEGEFVGDGDAVIPAPRGAVLVAPISTPHGVRAVTDMKVLVTIAPPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein (YP_388795.1) from Desulfovibrio desulfuricans G20 at 1.94 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str. g20
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 17
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q30A01
4QM8A 5J3UA 1O3TA 3DL3A 4I0AA 5LEJA 1CX4A 3MPBA 4XFBA 2D5HA 1LR5A 4MX3A 1Y3TA 4B29A 2IXJA 5LRRA 4IEOA 1CGPA 1ZRFA 3B02A 2IXKA 4LUMA 2Q0AA 2Q30A 3FE5A 2C0ZA 2PQQA 4IESA 2O1QA 3M70A 2OZ6A 4ZU5A 4AQ2A 3USSA 3EBRA 3RPQA 1YWKA 3CLPA 3LAGA 4LA2A 1DZTA 1YUDA 2VQAA 3PVBB 4QGNA 3ES1A 4K8FA 2IXHA 3EHKA 4JV4A 5BXXA 1NE6A 2XKOA 1Q43A 4IEXA 4UXAA 5KHKA 5J7MA 3O14A 3U0ZA 3DKWA 3RYPA 4MGKE 2UYAA 3E6DA 2F4PA 4MGZE 3OCPA 4X6QB 5KHIA 1O3SA 2QCSB 4Q29A 5I0SA 3CO2A 3OGJA 2EVXA 4QX5A 5CVRA 3GYDA 2GU9A 1ZRDA 4WBBA 3N4MA 3RNSA 2PAKA 2QNKA 1NYWA 1WLTA 2GH2A 2MPFA 3HQXA 1I5ZA 1O4TA 4HN1A 2MNGA 3NL1A 3TNQA 4LTAA 5JSRA 3ELNA 4AVAA 2UY8A 1CAWA 4KU7A 4JTNA 2FQPA 3G7DA 3MYXA 3PLQA 1J3RA 3SMHA 1ZRCA 1XE7A 3IIAA 4UBHA 3LA3A 1X8EA 1ZNPA 4IERA 5EZWA 5I0TA 3KGLA 2OA2A 1O3RA 4N9IA 2PA7A 5FDBA 2UYBA 4PIZA 5J48A 3SHRA 3UKVA 1UW8A 4IEPA 3ACLA 4MH0E 4QGMA 1SEFA 4XF4A 4Z07A 2QVSB 4Q0VA 1EP0A 2OZJA 5I8TA 2PHDA 4J1WA 4FAHA 2ATFA 3H8UA 1QXJA 4UBGA 4L2NA 2IXLA 4XETA 1J1LA 5F1RA 1SQ4A 1OD5A 1ZVFA 3H7JA 3CEWA 1ZRRA 4I02A 4XEZA 2GC3A 2UY9A 3DN7A 1RL3A 3NJZA 2E9QA 2H6BA 4BYYA 2XGXA 3I59B 3UKNA 4XF0A 4Q0SA 5CADA 3S0MA 3HT2A 1ZZBA 2ET1A 4HSLA 4MUVA 1YFYA 5BV6A 4O9GA 3QACA 4XFAA 4AQ6A 4QXKA 1NZCA 2KXLA 5D1IA 5FLIA 4XFIA 5E16A 1O5LA 1RC6A 3OD0A 3BU7A 3FX3A 3LOIA 4QMAA 4HVQA 3EJKA 3HIFA 3TNPB 3KCCA 5HI0A 2P17A 2XLFA 4A2UA 3H7YA 1O5UA 3NKTA 2BNNA 2K0GA 4WVZA 2ET7A 4EV0A 4HZFA 1IPKA 4YNIA 2VPVA 1YFXA 1J58A 5T3NA 3ES4A 5JR7B 1GQGA 1Q3EA 2MHFA 4P9GA 5I93A 3KMHA 4OFGA 4PIYA 4ZU7A 3PNAA 4EWDA 1LKNA 4JVAA 3S7EA 1O7FA 2BEOA 3DV8A 3WW1A 3BALA 3EO6A 3D82A 1FT9A 4QM9A 2I45A 4FBFA 5AVPA 1J3QA 4KWLA 3U11A 1RUOA 1X7NA 5KHHA 3ZDSA 5KHJA 2DCTA 2GC0A 1YLLA 2GC2A 1UIKA 3IDCB 3H3ZA 5KBFA 5I0UA 5I8SA 4LUKA 2XL7A 3H3UA 5BPXA 4MV2A 1VJ2A 4AVBA 4IEUA 3CL1A 4NVPA 4QGLA 3L2HA 2PHLA 3SXWA 4I0BA 1ZZ8A 5LEKA 3LZZA 1UPIA 1YFUA 1PMIA 3GBFA 4I3PA 1RGSA 5LRSA 5FLJA 1NE4A 5JCTA 4AXOA 5EFUA 1CAXB 2ZKLA 3BCWA 2OYZA 4IEWA 4D7SA 2QJVA 4N9HA 2B8MA 3E97A 3EQEA 3I59A 5BY5A 3H1WA 1DZRA 1OFNA 2OPKA 3CF6E 4META 1DGWA 3E5XA 4I09A 5K8SA 3OTFA 4DINB 5JAXA 2K9ZA 1Y9QA 2H6CA 3ST7A 4MZUA 2PFWA 4Q0PA 1OMIA 3H50A 4L11A 4LA3A 3M3IA 5I8YA 2PAMA 3BB6A 5FPZA 4LEJA 4EWAA 1WGPA 2IC1A 2GC1A 4Z82A 1J59A 4XF9A 2Z69A 1ZZCA 4WZCA 5FCCA 1U12A 3CJXA 2CV6A 2PYTA 4YRDA 4EWEA 2HKXA 1X82A 4ORFA 5FLHA 5I91A 1I6XA 3WW3A 3FZ3A 3LA2A 3IDBB 5CU1A 1QWRA 3OF1A 1V70A 3UKTA 5C8WA 1G6NA 3C3VA 1UD1A 4IETA 4MGIE 4XFHA 3NSTA 3IWZA 2XL9A 4R8HA 4BHPA 4PJYA 5JSPA 5JSOA 4JTOA 2D93A 3FFQA 4HBNA 4IEYA 2HJIA 1H1IA 3SCHA 1SFNA 4MGYE 3RYKA 2CAUA 3LWCA 1O3QA 3MZHA 4E2QA 4HN0A 4BH9A 4KU8A 1ZZ7A 4IEQA 4LULA 4OLLA 3E5UA 2FMYA 3E6CC 3LA7A 1CAVA 4XFCA 3KGZA 3BPZA 1FI2A 2Y0OA 1Q5OA 3I7DA 2N7GA 3H1YA 2XKPA 1CAWB 4Q0QA 2GAUA 4H7LA 4BIFA 1QY4A 2IXCA 4EROA 4YARA 2D40A 1UCXA 3U10A 5KHGA 4KWJA 2CAVA 1VR3A 2XLAA 3R6SA 2PTMA 4I2OA 4HVRA 1GQHA 4YYOA 1OI6A 2CGPA 1RTVA 2IXIA 4E2SA 4HSJA 3I54A 2BNMA 3NVCA 1PM7A 1IPJA 1ZZ9A 4XFGA 4IEZA 3S7IA 1DGRA 2QDRA 1RUNA 4ZU4A 2H0VA 4R52A 1VP6A 3JZVA 1ZREA 4XFFA 3KSCA 3FWEA 4FAGA 1WA4A 2Q1ZB 5E1RA 2BYVE 2BNOA 1UIJA 4F8AA 2V09A 3WW2A 3ROUA 3D0JA 2VECA 4CYDA 3E6BA 4KL1A 4RD7A 3RYRA 4X6RB 3VHRA 5C6CA 1QXRA 3RZZA 2XHKA 2B9UA 4PIXA 4YSFA 2Z2SB 2EA7A 4GULA 1LB2A 2D5FA 1X8MA 1ZX5A 3SCGA 2XLGA 3SCFA 3E5QA 3HT1A 1FXZA 4D7TA 4FT8A 3ETQA 1NXMA 4KWKA 4AVCA 3NW4A 4LLOA 1EYBA 3H9AA 2EAAA 2ZCWA 3MDPA 3H1MA 3FJSA 2GZWA 2WFPA 2BGCA 1CAVB 1JUHA 4F7ZA 1H1MA 1LRHA 4ONUA 1J3PA 1CAUB 3FHIB 1CAUA 4HVOA 1ZZ6A 4TLFA 2Q4SA 4IEVA 4XF1A 2PAEA 2ETEA 1TQ5A 3WW4A 3D0SA 4XF3A 5I0RA 1CAXA 5FPXA 1EY2A 1L3JA 3IBMA 2WC2A 4HMZA 4J1XA 1YFWA 1XE8A 4E2GA 1XRUA 2B5HA 5FQ0B 1EPZA 4I01A 4HLTA 5FQ0A 3QOPA 5BUVA 4Q0UA 4O9EA 3RDIA 1HW5A 2O8QA 1YHFA
chains in the Genus database with same CATH superfamily
3ZOIA 4NPRA 1RUC1 2HWE1 4PF5A 4CTEA 4I0AA 4FFFA 3MPBA 4N53C 4XFBA 4MX3A 2LW8A 1Y3TA 2XBO3 2IXJA 1NOVA 1PO12 2VTFA 1WD4A 3VBHB 3B02A 1GU3A 1HB1A 3JBG2 4ASMB 4IV1A 4IESA 1R092 2OS2A 3V65A 2O1QA 4NPLA 2DURA 4Q4X2 1X33A 4ZU5A 3UT0A 4AQ2A 3ZYPA 1A8DA 1LJ7A 3USSA 5LWBA 1RMU2 2RMU1 2W91A 5H9QA 1WCSA 1YWKA 5C3OA 1DZTA 2J7MA 2YPDA 1RJ7A 1YUDA 2YFZA 4GMP1 5A32B 2Y6JA 1PO21 3PVBB 4QGNA 1HDKA 5DPNA 3ZSEA 2E26A 2YMZA 3CIHA 4XXAA 1TVGA 1NE6A 1KDMA 1UZWA 2VZPA 4MGSA 4Q1PA 2XKOA 1C8M2 5GLWA 4ASLA 2XJVA 3ITQA 4UYBA 5KHKA 1FYUA 2O0OA 4J25A 4CDWC 1AR62 4AAPA 2CGNA 4B1LA 3U0ZA 3DKWA 4ZZ8A 1SBDA 2VCCA 2WR9A 2BJSA 1KJLA 2EIBA 1MQTB 2D6MA 2ADEA 2UYAA 2WQ8A 4KGQA 1MS5A 2F4PA 5C70A 5GZEA 3WF4A 2WBKA 2VUCA 1GKBA 4Q29A 5I0SA 2E31A 4D0QA 3DYOA 2LRPA 2VZ1A 3NJXA 1N3QA 2VZVA 3OGJA 4QX5A 5IVYA 3WLUA 3U07A 1AL0G 1S0GA 3GYDA 2GU9A 2EXHA 1PGL2 1CIWA 4GB33 3RNSA 2PAKA 3BTXA 5CFDC 1WLTA 3HBZA 1VBC2 2VQTA 3KV9A 4MXVA 1I5ZA 2XWJB 4EN7B 3BVCA 4DMIA 3CJIA 1BBT2 5ACA2 3NO8A 4Q2FA 4AEJA 5FY5A 2GP5A 5HV0A 3O1RA 4QQHA 3ELNA 3JCIA 2E7TA 1RUH3 3MV11 3VBSB 1V0AA 2VMGA 3HN1A 5LW9A 1AYM2 5T5LA 1FX5A 1KS5A 1RXFA 5FP4A 1AR92 2RM22 3G7DA 4FFIA 4COZA 2DUQA 3PLQA 1XE7A 3IIAA 4K20A 3ZXGA 4UBHA 4BQ2A 4AEMA 5FYHA 2D6OX 5A80A 4CCMA 5FPUA 2A6YA 1K5MB 2ZGSA 1W6OA 4LKDA 4DQAA 1W90A 1UKRA 3PJQA 1QH6A 5L19A 4MH0E 4CEWC 2WFF2 4E4SA 3TBDA 4CRQA 3VLBB 2W0XA 1IG3A 5BNPB 1ENSA 5EP9A 1TNFA 3IM0A 3GF6A 2OX0A 4JKMA 1N1VA 1ZRIA 3PU8A 2WNVC 4XOGA 5DDJ2 5FYMA 4D7YA 5AC92 2VMFA 1MS0A 3HEIA 2PHDA 2P3KA 2FDFA 2QBXA 2O14A 4PDWB 4UBGA 1GQPA 4LBOA 4Y1ZA 1F4HA 3I49A 1RUE2 4J6GA 3KV5A 1AHSA 3A21A 4L8QA 4AGGA 2HYKA 1V6IA 3S6PA 1DQ6A 1IS3A 1BLZA 2D3PA 4DNYA 1SQ4A 2QQIA 3KCYA 1AVBA 1CQ9A 1W3XA 1YC61 2A7AA 1VRH2 3C7FA 3H3LA 1AX1A 4I02A 4QB6A 4XEZA 4RGKA 3NV1A 1ND2B 3RZGA 2B7YA 3DN7A 3MIGA 1WBLA 1RL3A 3BUCA 1F15A 1R081 4H7MA 3UKNA 2BU9A 1TMF3 2V73A 3LEIA 5CADA 4WM8C 1AJKA 3VV1A 3QLQA 5FJHA 4Y1VA 1RUE3 1ZM1A 5EJZB 1MS3A 3HQUA 4MLOA 2WZR1 3AZXA 4CCDA 3DF0A 4YLZA 3KS7A 5F3IA 2VZUA 4Y22B 1MEC2 3HPNA 4K40A 5D1IA 2W1UA 4R9CA 4YVWA 5C71A 1C8NA 2ZHNA 4YM0A 5A33A 2J1EA 3VZKA 1HRI1 2XG3A 4LO7A 5A7QA 3OD0A 3OY8A 5GLZA 3DYMA 1W2TA 3LF7A 3FX3A 3LOIA 4XJZA 1UN1A 2RV9A 3A22A 3AL6A 5EPAA 4UW3A 3TNPB 3ZO0B 4FTBA 2WYFA 1MACA 1HX6A 3HJRA 1NXD1 2RS11 2VU9A 1EUUA 3NKTA 3OYWA 4BXFA 1BEV3 2WFF3 4IGQA 1DHKB 1LODA 1VAVA 2ET7A 2QTWB 2WIIB 1CX1A 4RS5C 1JOPA 4B4PA 4LORA 1YI7A 4IE5A 2DV9A 5FMBA 2EXKA 4RGGA 3ZYHA 4DRRA 2DF7A 4E27A 3ZFEC 1RUJ1 4BQWA 2GALA 5KXBA 5FWJA 2XR4A 2JE8A 2SBAA 4YZ4A 2ZHKA 1HB3A 3RS6A 1LULA 3IAQA 4GH4A 3VB9A 3HAGA 4ZY9A 4XPVA 4BWOA 2RM23 2EXIA 1QQP2 3BKZA 2A3WA 2WAOA 4L99A 2BWAA 2W46A 5A7NA 5IFTA 4Y5SA 1NZIA 4IL7A 2K2SA 4OHYA 1KEXA 1RUF3 5EQUA 3RWKX 3EO6A 4P00B 5DZEA 3VL9A 1DU3D 1TMF1 4AF9A 4DIQA 1ULGA 3A0NA 3V0AA 3OBZA 4AL9A 5C4WA 3U11A 3WHTA 1RUOA 3R4DB 1YRZA 4R9AA 4YGDA 1QXPA 2ORXA 5KHHA 3VKFC 2W39A 2ZACA 5A3WA 4CEYA 2VUDA 1ACCA 1UOFA 2FCTA 3A4UA 4OUMA 1PO11 3GGLA 2OPWA 2VE1A 1GZCA 3IZOA 3FN9A 3NNGA 2WS91 5T54A 5FZLA 4CU7A 2JG9B 3BTYA 1QJU1 2JIGA 3H3UA 5HXMA 1US3A 2P2KA 4UF0A 1VJ2A 1GWMA 2P1BA 3B00A 3ACFA 1JU4A 2R042 2J1RA 1JTZX 1YEWA 1UY1A 4NVPA 4QGLA 4WM7A 1UOGA 4CP9A 4YFZA 3BTZA 1QJX2 3MBWA 4PDWA 1MZEA 4Q4W3 1OURA 4K9SA 4BB3A 5GZCA 3IAPA 2PHLA 5JXHA 4NHLA 2BQPA 2NZ9A 2XVKA 2B46X 3WINE 4LHSA 1G9AA 5T52A 3K75B 1QNYA 1WA6X 4Y33A 1V00A 3RMXA 5LRSA 2W92A 2ZPXA 5DQ0A 4BCUA 3THTA 2HWE3 2NLRA 4AXOA 1S4CA 5FZOB 1V9U2 2ZOEB 3AVRA 2WNUB 1M06G 2CSGA 4IEWA 1WCDJ 3VZNA 1V6LA 3POGA 1UXZA 2Y6KA 3E97A 3EQEA 3PTYA 3H1WA 3ZX7A 2W2IA 2WO3A 4IQPA 2WA3A 1QKQA 2OPKA 4JQRA 3VKOA 5KWRA 4META 1DGWA 2VBPA 3E5XA 2ZGPA 3FHAA 5DZGA 3M3QA 5JAXA 1N3OA 4V2WA 4WM8A 4FO9A 3ST7A 4L9BA 4IDZA 4FSJA 1MEC3 2PFWA 4Q0PA 5GALA 3N9OA 2XVGA 3H50A 3O7OA 4DEVA 2RR13 3POBA 4RFRB 5D21A 5H9PA 5EHDA 3ZN6B 5FPZA 2NMOA 1IGOA 1SLCA 3WQ0A 4AI1A 3I97A 2EAKA 1VMFA 3NRUA 4NWVA 2X29A 4XBNA 3SKVA 2VW0A 1H0BA 2HWC3 2E7AA 1UOBA 1W6PA 2VUAA 3J7LA 4XABA 4Z82A 3KCXA 5FCCA 1VBD3 4M00A 2PYTA 1Y9MA 4EWEA 1WLCA 3IPVB 2P3IA 2JDUA 3AMMA 3WCSA 1I6XA 1Q8SA 3FZ3A 2EIDA 4WV8A 3ZYBA 3N3HA 3VBOB 1AR73 4IETA 4AEDB 2HWF3 4XFHA 4BHPA 5JSPA 3DUIA 2TNFA 4PJYA 4NIIA 5HCHA 4AVTA 4H55A 1W2UA 3AKPA 1DYPA 2QFEA 1GNZA 3JB8A 1JS9A 5FZAA 1UPSA 2ZMNA 3SCHA 2RDRA 3M3EA 2J1UA 4JC1A 4BIOA 3O1MA 1O91A 3ZFFC 1Z7S1 2IVJA 4CEYB 1HN0A 2F6BA 4MVTA 3TB0A 1ONAA 2XUEA 3NJVA 1ENRA 2A70A 4AW7A 5GLUA 1RYYA 1PGSA 2RG4A 1ZZ7A 4FPKA 4FTEA 4NIHA 3N35A 4N43A 5IK5A 4XE9A 3OEBA 3WDWA 1YJLA 3LA7A 4OI4A 1QOTA 4COUA 1OQ1A 1UZ0A 3KGZA 4YG0A 4L92A 1FI2A 4V2VA 3MIEA 5B4NA 2YUEA 3I7DA 2HWC1 2N7GA 1Y43B 4AVSA 5A33B 4BIFA 5FREA 5CFDB 2YZ4A 1QY4A 1CWPA 3KT7A 2XOMA 4K8RB 1AR82 2R0FA 2PLV2 4RHV2 4YARA 3LB9A 3S57A 3U10A 1MR5A 4GD4A 4GKXA 4Q4W1 4AFCA 1F9KA 2QE3A 3WUDA 4Y1UA 5SV8A 3MFAA 3ZR6A 5JZGB 1VR3A 1L7LA 3KF5A 5JOYA 1Q8VA 3ZKUA 1RUC2 2JE9A 2GSYA 2VOWA 1JYCA 2ZGQA 1HKDA 3AB0A 2ZGMA 2ZMLA 2VNRA 3VBUB 1OUXA 4NHYA 3CKHA 1A3KA 2CNAA 2QQUA 3AMNA 1GQHA 1Z0HA 5FZ8A 5C4WC 3IPVA 1XNKA 2Y0IA 4K7JA 1LESA 2VCMA 1YO8A 4FFHA 1W9TA 2YC2A 1W8NA 2BNMA 5L7OA 2SLIA 2XJTA 1PM7A 2A5ZA 5CNAA 2FMDA 5DXDA 5L7OB 1MZ6A 1TE1B 4ZS3A 4Y4RA 3T0AA 3AM2A 2HBTA 1A6CA 4XFGA 4IEZA 5A6XA 5B2GB 3DGTA 1RUNA 1LOAA 4YZ1A 5BNNA 4FOQA 3UJQA 4XFFA 1A34A 1C8M1 3VDBA 2JENA 4LT5A 1E5SA 4CDWB 1JMUB 2GMMA 2UWAA 2Q1FA 3JQWA 4AVVA 4FQZA 2VL4A 3FMGA 2BYVE 1RUG2 5LA9A 5FMOS 5ISLA 1D4VB 3WF0A 4FP2A 4JGYA 5A1LA 4A3XA 4CYDA 3T09A 3E6BA 5JWPA 4RD7A 3W9AA 3RYRA 3M7AA 2ZGLA 2G9FA 2YU1A 1REEA 4YWAA 1ENQA 1W0PA 4P02B 5JOWA 4HKLA 5ABJC 4S2GA 4E4ZA 1U5IA 1SCRA 4YVSA 3UGGA 2XHKA 2XJQA 4QPIB 4CVUA 4LKSA 4NHKA 1QIQA 2RS52 2JDZA 3L2YA 1GZWB 3NV4A 4K1ZA 2D5FA 4JRAA 3K3NA 4HOOA 1ZX5A 2WNEA 1YNAA 3HT1A 1FXZA 4JGZB 1QJX1 3PMEA 4QQLA 2CYFA 4JGZA 1AX0A 3GZTB 1LHNA 4UFLA 5CA6A 2WNUA 5A7PA 2DUOA 2BFUL 3U78A 4OQ9A 3RFRA 4PBPA 4N43B 4U36A 4BOWA 5C3QA 2VCAA 3W5MA 1DQ5A 4XDPA 4XBLA 1W8WA 1HRV3 3H1MA 2GZWA 4XCAA 4XXPA 3VBRB 1V9U1 5F37A 3VBUC 1S2BA 1H1MA 4D6SA 1AUYA 1LOBA 4RS5B 5JXJA 1FPN3 2BUKA 1L7RA 2A71A 3I3BA 1XNTA 5C33A 3QH6A 1CAUA 5FZ3A 1MS1A 4XJ8A 2WS93 4NHMA 1NQDA 1COV1 1PMJX 1W04A 2Q4SA 3N9LA 4IV3B 4XF1A 5EIYB 3I2HA 5KXCA 2ETEA 1UKGA 2Z5WA 1OPMA 1KS4A 1YQ5A 2RS31 1SFPA 2DTYA 4XF3A 3B7MA 1JW6A 2WSVA 1CAXA 2R071 4CCLA 1JZ8A 3TEZA 1GNYA 2WC2A 4AE2A 5DDJ1 5AC91 2C24A 1OVSA 4E2GA 1E5RA 1W6PB 4PT6A 4EJRA 1Q8OA 1URXA 5FPLA 3SITA 5FQ0A 4GH4B 1PZ7A 4O9EA 3RDIA 4C8DA 2O8QA 1UZZA 2VG9A 4XZPA 3ZXDA 2VOTA 4RFT0 1RHI3 4QB1A 3OUHA 2ZX3A 2QUOA 1X50A 4GB31 1OLRA 5FZDA 5FZBA 3T4VA 3N7MA 2WWSA 3DL3A 4NR1A 3J7HA 1XU2A 4B8EA 4M4RA 1MZ5A 3T30A 1XNCA 2D5HA 2JDPA 4QKNA 1LR5A 2ZMKA 5K0UA 3ZFFA 5DMYA 3ZN6A 4W4ZA 4IEOA 4CXYA 3UESA 1CN1A 1O6UA 3QBQA 1G9DA 1WW5A 4AR2A 4LUMA 2Q0AA 2ZEWA 2Q30A 3MUY1 4RR3A 2PQQA 4QPIC 4JDOA 3AYEA 1BVVA 2OZ6A 1N1YA 4GA9A 3EB7A 1G9BA 1LGBA 2ERFA 1VBE1 3A0KA 2PLV3 3PTRB 4RHV3 1OH3A 4EE2A 3NMBA 2JDHA 3BIWE 1LOFC 2DBNA 3MLJA 5E89A 3F2ZA 4LXLA 4K8FA 1NCQA 2WT0A 4JV4A 4BPZA 3CZUA 4CU8A 1GP5A 4M3CF 5J36A 2HWB1 1Z7S2 3VBRA 3KT4A 4UXAA 3F95A 3KM5A 5J1XA 1GV9A 3BOWA 3ZM8A 4EZ4A 4QXBA 2GNTA 4QU1A 3RYPA 5FY4A 4S2HA 1RUJ2 2D6LX 2EXJA 1ENXA 1O3SA 2DVFA 3K4ZA 2V4AA 4KBZA 2QCSB 2X53S 1TEIA 2Z79A 4UW5A 4AHZA 4XAEA 2ZEXA 4OVEA 4FPJA 4QDQA 2YV8A 1W8UA 2VZQA 4FXKB 5JUVA 3JD73 4ARXA 1E5IA 5CVRA 5FYIA 5HXVA 4QDSA 3TOJA 2WNOA 3POJA 1RUF1 3C7EA 3N4MA 1NYWA 2R1BA 1YXWA 1PX3A 2YGLA 3AMQA 3KZ4C 4BLJA 2GH2A 1OQDA 4P08A 1O4TA 1F4AA 4M4PA 4YW7A 2Q1MA 2KD7A 2PHUA 2GNBA 3TEWA 5JSRA 4AVAA 2UU8A 2UY8A 4XBQA 1CAWA 3BPSA 1H8VA 4CDXB 1XOYA 2ID4A 5GKAC 4AFAA 1G9FA 3MYXA 4DXZA 2JG9C 4ZXKA 1WUVA 1JYNA 1J3RA 4HANA 3POIA 1ULDA 5F3GA 5A6ZA 4CEWB 2OXBA 1ZNPA 5H9SA 2XHNA 3J26N 5EZWA 5FUPA 4YZ2A 5I0TA 1EPWA 2OA2A 2R041 3B69A 4N9IA 1COV3 4ITCA 4PIZA 1V6OA 5DAPA 3VKNA 3ZSJA 1POQA 1H8TA 4OZXA 2X09A 3H8RA 2BGOA 1PGL1 2VAUA 1FNYA 1SG3A 5KR7A 4QGMA 1SEFA 4Z07A 1AXYA 2EF6A 3BGAA 1QOOA 3S30A 3FFZA 4Q0VA 3WY6A 1SACA 4RYDA 2OZJA 5F9TA 2ARBA 2HWF2 5HCFA 3HVDA 5J09A 5FY7A 1W39A 1AYM1 4EN9B 3AZVA 2XXZA 1OLME 2C9AA 1AR91 3N9QA 4L2NA 2IXLA 1S55A 3INAA 4NO4A 4XETA 2FDHA 2K46A 5KXEA 2VMHA 4HKOA 2J22A 5A7WA 1CJPA 1S0BA 5F1RA 4CDQC 1ZVFA 3U4SA 1WLDA 2GH8A 1ZRRA 1BKZA 2D44A 4CZSA 1UOJA 1R1ZA 1NAEA 5E8AA 5BNOB 3GZEA 1YYNA 5F2WA 3WD5A 1LEMA 1U5ZA 1WMEA 2VOXA 2XGXA 3B9CA 3I59B 3ILNA 4XF0A 4DB5A 3HT2A 3ZYGA 2B45X 1UMHA 1UYXA 2D7FA 4HSLA 2IZWA 4OUEA 1UU6A 4DXTA 5CKNA 4NMIA 5JI7A 1FV3A 3L9JT 4QXKA 2IUWA 3RZKA 1BBT3 5ACA3 1ULPA 3AZYA 4EN8B 4NRPA 1BMV1 1YQCA 2AGSA 3I2OA 2CDPA 3LOBA 1RC6A 2WO2A 3N7LA 1FATA 3WF3A 5A3MA 3R4SA 3VD5A 3W20A 4HVQA 3HIFA 4X8PA 3NAPA 3UNPA 5LK7B 3G6JB 2P3JA 3VKLA 3H7YA 1O5UA 2FDKA 2K0GA 3HMYA 4HG6B 2J42A 5ANNA 1HIXA 3LEMA 1IPKA 2XH6A 3MIBA 4G4FA 4YNIA 1US2A 2VPVA 1TME2 1YFXA 1COV2 4PQ9A 4D6QA 5F3CA 4A6OA 2VOKA 1XPWA 2XBO1 5JR7B 3MF9A 3V64A 5DAXA 5AVAA 5G05L 2W1WA 3MIFA 3UETA 3WOGA 2GNDA 3WG2A 5FZ1A 4CP2A 1RITA 1QJEA 1G8WA 5FXWA 3VN4A 5I93A 3VZMA 1XU1A 2CHHA 3KMHA 4MOAA 4UI9L 1S0CA 5CISA 4ZU7A 5IK4A 2ORZA 2V5YA 1W6NB 4LE4A 4JVAA 1O7FA 1POV1 2DBIA 4AHXA 4QAWA 4S2FA 3DPRB 3VDDA 3VDCA 4ARYA 1QJY1 2ZGUA 2XONA 4AI8A 2XVLA 2NYYA 4KWLA 3KVAA 3P3NA 5A7WB 3PUQA 5FRAA 4C0HA 1W6OB 1FPN1 4GB32 3ZDSA 1QDOA 2R16A 4GWJA 4XILA 2DCTA 1T2XA 4B7KA 2FDJA 5IHRA 3RZJA 3ZYFA 3SLIA 2R061 4C91A 4PI0A 1UIKA 1IKQA 2BERA 4MHRA 5FBZA 5I0UA 3FBMA 5JPNB 5I8SA 2J1AA 1STMA 1OLQA 4X8NA 3O1VA 4BQYA 4DUXA 5T50A 5BPXA 3K48A 1H2MA 2P37A 1AYN3 5C8CA 4R9DA 1VB4A 4YW6A 1DQ0A 1MQTC 2A1XA 5FO7B 1UX6A 1PMHX 4C1WA 3UJOA 1UYPA 3IDAA 5K0UB 2YBSA 5CFCA 1A8MA 4K1YA 3SXWA 5FKCA 4FPLA 1I5PA 4QKBA 4W8JA 1K42A 3PMSA 4ZZ5A 3WDVA 4I0BA 1W0NA 1ZZ8A 1MS4A 4XAAA 5LEKA 3AJZA 3MI8A 1TZOA 3WHUA 2V4VA 3AL5A 2FHRA 3GBFA 4A7ZA 3WQ7A 5LASA 5CFCC 4TSVA 1UY2A 1ND2A 5EFUA 4FPGA 1RUI2 1ULCA 3MPPG 1VMHA 4B3NA 4N90A 4Y26A 2OYZA 2XMLA 3P6BA 4D7SA 2QJVA 3NV2A 5FYUA 5SV5A 2B8MA 1OUSA 2JKXA 3AX4A 4GWNA 3O1TA 3I59A 1BEV2 2PHWA 1H6XA 2LALA 1UO9A 4QDRA 3O0WA 2WS92 3USUA 2DVDA 3CF6E 1PVC2 3JBG3 3LGRA 3QCWA 3USUB 4NIGA 2OUHA 1HJFA 1J1TA 3OTFA 2A73B 1DQ1A 2K9ZA 2ZEYA 2QKDA 1VAMA 1NCRA 2H6CA 3Q8AA 2CU5A 3BYWA 4XCBA 5IUQA 5JIUA 1H6YA 2WN3A 2D3RA 1VLNA 5LY1A 3K51A 2OT7A 3D6EA 1ZBE3 1LCLA 1DGRN 4AI9A 5KXDA 5CZKA 4LA3A 5F5QA 5FWEA 3WNKA 4FTSA 2EALA 5I8YA 3BB6A 3CNAA 4ZXEA 4QX0A 3AP6A 4DO0A 4CA9A 1GICA 5FOBB 4LEJA 2ZX1A 4IW3A 3AFGA 1OKOA 4CDUA 1K5MA 2WZPP 3TN91 3KLSA 2IC1A 2GC1A 2D6KA 4QPYA 4COVA 3WDTA 4F3JA 3QD6A 5LZ6A 4WZCA 4DUVA 5IT6A 3LDKA 4LLFA 3B01A 3THCA 5GZGA 5F5IA 4YRDA 3M1HA 2ZAAA 3J8F3 1ZYBA 2HKXA 1AYM3 5FZGA 5FLHA 5LA0A 1FOD2 5JI9A 3WW3A 3LA2A 3WDXA 5F5AA 4GWIA 4LKEA 3DXTA 1JN2P 1QWRA 1GANA 2CL2A 1V70A 3IKWA 1S0FA 3OF1A 5D2AA 3UKTA 3KV6A 2Y33A 4EQVA 3NSTA 3IWZA 3ZFFB 2PXJA 2YFUA 2D93A 1QJZA 4HBNA 4IEYA 2VZRA 3AZWA 5FAXA 5AFBA 5CKQA 4BA6A 3TAYA 4E4DX 3V0AB 2JJ6A 1H1IA 4W6WA 1C1FA 1WW7A 4RR3B 3T4HB 2A3YA 2CAUA 3AMHA 3WNOA 2BP6A 3LFMA 4E2QA 1NA1A 2QQJA 2IFWA 3POYA 4HN0A 4KU8A 5I0DA 2JD4A 1GOFA 3LFIA 1YQ8A 3E5UA 2JECA 1HXS3 3VZLA 3K3OA 2FMYA 3N9PA 5A32A 3E6CC 2RS33 1XSRA 3NNMA 4FFGA 1XNDA 1ZBA1 4P14A 2G9ZA 4JRLA 4LIUA 3SISA 3EYPA 3IMNA 4BU2A 3J7NA 1UMIA 1NKGA 4H3WA 3I2KA 2DCKA 2XJSA 1UMZA 1OF3A 1ND3B 2YY1A 3AK0A 1DGWX 2BZDA 2XJUA 3JXSA 4B1MA 2IVIB 3MLLA 1N1TA 3NAPB 4EROA 2VTXJ 2DVGA 1PZ9A 2VNGA 4GMP3 4CP0A 4XYXA 4KWJA 4Z2WA 1NLSA 4TXWA 2GN3A 2CAVA 2XLAA 4HFSA 3R6SA 3OEAA 1DYKA 2PTMA 4N53B 2WQ4A 1JYIA 4P9IA 3ZYRA 3WP6A 2WSUA 4Q4V3 5C5TA 2C1FA 3T08A 1BHGA 2HWD3 2YBKA 5E6HA 3P3PA 2JDNA 3KD4A 3TWIA 1WLWA 1SLLA 2HBUA 5BYNA 4WM8B 5A6YA 4HSJA 5IAXA 3V0BA 3LIHA 3B93A 3J7MA 3UGFA 2ARCA 5IWFA 1XB9A 1VBE3 1VBE2 2DYCA 2VD7A 1QH7A 1UAIA 3J9SA 5IK7A 4FCAA 4FPCA 3I3EA 3SEEA 4QPIA 4G3YC 3S7IA 2UWBA 1DGRA 5ERLA 4LO4B 4ZU4A 3VD7A 1FMD3 1VP6A 3IMMA 1HXS1 2XJRA 1LHVA 4UWDA 5JZGA 4GMP0 4YFWA 5FMCA 5IVJA 3NV3A 1M4WA 1WCUA 2ZGNA 3KSCA 2VW1A 2RMU2 3ZMNA 2P6HA 1PIV2 2VM9A 3OG2A 4FAGA 3RVHA 1UXXX 5E1RA 2YGMA 4K6BA 1GMMA 4Q4X3 1VBA3 3K2OA 2R073 1CONA 3D0JA 3GZAA 3QH7A 3ZSKA 4XJAA 3KV4A 3NWKA 3FUQA 2PHTA 2ZTNA 1AR83 3ZFEB 1FPN2 4RQPA 5K7PA 4WM7B 1IOAA 5LATA 5CKMA 5FZEA 3OGRA 3T1MA 1W8OA 4ATFA 5C6CA 1I9RA 5KC6A 1HRV2 1EAH2 1KITA 1JOBA 1W8ZA 2YG0A 3OD4A 1HN1A 2Y6HA 4PF1A 4UT5A 4XTPA 1G86A 4YGCA 3C7OA 3RRDA 4CPBD 2J1TA 2FCUA 3OPZA 4MYEA 2EA7A 1LB2A 5DUVA 1GSLA 3LSDA 5FY8A 3SCGA 2GNMA 1RUH1 1AL23 4RA0A 2VMEA 2VXJA 3VGIA 2E63A 2WZR3 4JDNA 4LBQB 1NXMA 1POV3 3VD9A 4CP1A 2O8OA 1VRBA 3ZKYA 5BNOA 4QU2A 3M2MA 3VBUA 4LLOA 1DBNA 4AFMA 1W6QB 1RUG1 1DZQA 1ZA4A 3H9AA 4QB2A 2OKXA 4I0WB 3C7HA 1W2NA 5BNNC 2EAAA 2VQUA 3RI9A 3HBKA 2FBEA 3MDPA 5FZ9A 5FP9A 2G9GA 2JDYA 2BGCA 2FZ1A 1RUI1 1CAVB 1JUHA 4F7ZA 1H2LA 1KGYA 2W1QA 4ONUA 2AUYA 1J3PA 4Y20B 3Q8BA 3FHIB 1R64A 1E57A 2FCVA 1JZ4A 4HVOA 3BN6A 4Q5OA 4DRVA 1F35A 4TYSA 1WMXA 5FPVA 3O12A 1ULEA 4HK9A 3DYPA 2VQ0A 4O61A 1O8SA 3ZN5A 2F4LA 2PAEA 5JMCA 3O5SA 1NT0A 2RMU3 2VO5A 3LPFA 5FPXA 5I0RA 1EY2A 2WNVA 1VBD2 4J1XA 4XQ4A 1XE8A 4JHZA 2W47A 3KWVA 3HNBM 2HWF1 4DS0A 4AZZA 2DVBA 4QHZA 3MW3A 4YW1A 5FQ0B 2Q8OA 5J98B 5LBBA 4NJ4A 2E33A 4R4ZA 4IGPA 5BUVA 2YC4A 3D5OA 3ZXKA 4LMFA 3ZPOA 5L73A 1HW5A 3I2JA 1ASJ2 4ZS2A 5IK8A 1YHFA 2Z4FA 3VL8A 4MHUA 2X5IB 4LK6A 3CQOA 4QM8A 1KFUL 1W6NA 5DZFA 3CBNA 2ILMA 2R32A 5GZFA 3TN92 3ZIWA 1O3TA 2NP0A 1NY71 3N7JA 5LEJA 4KWUA 1CX4A 1F5FA 4CDQA 2HWD2 4XHBA 4B29A 3N9NA 3S5QA 1C28A 1RUE1 4QQOA 4ISQA 3I2DA 5FY1A 3VBHA 1UF2C 1XNBA 3FLPA 3FE5A 2CWMA 2WO1A 1HQLA 3H42B 4LOSA 2R072 2HEWF 4GZ9A 5FPAA 2XDVA 2WLPA 1JZ6A 3RZLA 3VBSC 5LCWL 5CYYA 1JH5A 3IIIA 4BM8A 2TEPA 3SQOA 1BMV2 2D3SA 3EBRA 3IN9A 3PVOA 3LAGA 1F5JA 2ENRA 3GHMA 2Y34A 3CMGA 3ACIA 2WINB 1QU0A 1SPPB 1W9YA 2YDEA 1FMD2 4HT1T 5FMOL 1V6MA 5BXXA 2VTXA 1Q43A 1LOCA 1MPXA 4IEXA 5A70A 1PHMA 1K5MC 3I3MA 4LIVA 3O14A 3ENRA 4QPWA 2WWJA 3WSOA 2JDKA 2W08A 1OBNA 1RVF1 3WUCA 4DUWA 3AYAA 4YW2A 4BJ0A 2VMDA 4NPMA 4LJHA 5H9RA 2R1DA 3BTAA 2QQOA 1ND3A 2WDBA 1QF3A 3ASIA 1H2KA 3E6DA 1XYOA 2JICA 2ZS6B 4OHXA 4LE3A 5FUIA 4C1XA 4COWA 5KHIA 4X6QB 4W6YA 1AR71 3CO2A 5ABJA 3E1F1 2GP3A 2NM1A 4PLMA 3VHOA 2JB8A 4CCJA 3ON7A 4FPEA 4Q4V2 2EVXA 1LHUA 1IPSA 4FPYA 1R1A1 3GCXA 5JIAA 1WCKA 4ATEA 5C7GA 3HNMA 1H8TB 3ZLIA 5FZMA 2Q8CA 4QX7A 1BVP1 1SLTA 3VDAA 3VBHC 4QPGC 2AENA 2MPFA 3HQXA 4P9XA 4LBJA 4M0NA 5BNPA 5CG8A 1DCSA 2MNGA 4NROA 2X8KA 4A7YA 3C7GA 1ND2C 4LTAA 3V56A 1POV0 1VIWB 1RB8G 3AZZA 4JTNA 2R062 1JZ7A 2VOVA 2VR4A 3J8F2 1VPHA 1QQP3 1C3HA 1GNHA 2DUPA 5JXGA 1TMF2 1OC1A 2VC9A 5IVFA 1ZRCA 5LY2A 2HEYF 3LA3A 1IKPA 1X8EA 5FZ4A 2XB6C 2WRAA 3O1OA 3KGLA 1DGLA 1DLCA 1VRH3 3WDYA 1AXKA 2PA7A 5FDBA 3O1SA 1O3RA 4O7XA 5LA2A 5J48A 3RZMA 5IYYA 3MIDA 3SHRA 3ZXJA 4FXGB 4NIDA 5JZGC 5FMDA 1NUKA 1XYPA 2ZZJA 3ACLA 3EMRA 3GXUA 5FO8B 2RJ2A 3AFKA 3ZN4A 3HR9A 1DP0A 3DCQA 1Q8PA 2RR11 2P6CA 2QVSB 3JD71 4MSVA 1NG0A 3MW4A 3AYCA 3T2QA 1W06A 3U37A 3Q8CA 3OUIA 4LKFA 4CXWA 5I8TA 2NPIA 2WABA 4J1WA 1MS8A 4FAHA 3H8UA 4PLNA 4W65A 1QXJA 5B4XA 3B94A 4CUBA 1WW6A 2G4IA 1BEV1 1T6GC 5IVVA 1UY3A 5TSWA 1FOD3 3GDBA 1PVXA 5M0TA 3DXUA 4IXLA 3C2UA 3ECQA 3AXDA 3JBG1 5GLVA 1XE0A 1KQRA 5FZIA 1OD5A 3JQXA 4JX0A 1Z78A 4IGOA 2UY9A 1XQNA 1W9WA 3SH3A 4B4RA 3PUAA 3LDBA 2D6PA 3N9MA 5FPBA 4KH9A 2C9KA 2BPA2 3POFA 4GALA 1C57A 2ZGOA 3WX5A 2ET1A 1YFYA 5IAVA 5BV6A 1RUH2 4O9GA 2BRTA 3LE0A 3QACA 5A1AA 3KQ4B 4AQ6A 1A78A 3DECA 2ZHLA 2VUJA 5JVVA 2EIEA 1C4RA 1NZCA 3SEPA 2BGPA 4AI0A 4PCRA 1XSQA 4XFIA 3BIEA 2VBDA 5JOZA 4W6XA 1JOJA 3BU7A 4DPNA 1OT5A 4JAAA 4KI5M 2MEV2 4XURA 5DAQA 4MADA 3KCCA 5HI0A 2P17A 2Q5TA 3ZYIB 2QQNA 4M01A 4N7IA 4WVZA 4CDUB 3HOBA 4DY3A 5FOJB 4BQ3A 1H9PA 1VBB1 3PVEA 4YW3A 2JDMA 1J58A 3WNLA 4EZHA 2X10A 1GWKA 5ANQA 1Q3EA 2W9XA 3AP5A 2C5DA 1OH4A 1TG7A 1YIPA 1VBC1 2MHFA 4LBMA 4P5HA 1UQXA 4P9GA 4LBKA 2E53A 3T2TA 4XIKA 4AWDA 1W0OA 2A6XA 4OFGA 4PIYA 2W95A 1E5HA 1CPNA 1S1AA 4DEQA 1C8M3 4LHNA 3PNAA 1H30A 4A6SA 4EWDA 1D4M1 1LKNA 1JI6A 1LHOA 2Q8EA 5A3UA 3WW1A 2R6QA 4QX3A 4ASKA 1FT9A 3K46A 4QM9A 2WQZC 5FP8A 3ZSMA 4CXXA 4FOYA 4LHLA 5IVEA 4IV3C 1RJ8A 5A3NA 2BWCA 3K77A 3EXUA 3D3AA 1NY72 1LEDA 2CY6A 2GC0A 3PIGA 1YLLA 3GNEA 5F39A 4BQ4A 4AFBA 4AI2A 3GCWA 3PUHA 4MO3M 1TME1 3FUOA 5FYSA 3BOPA 3H3ZA 2WFF1 4H2AA 5FZFA 1GBGA 2XBO2 3LIGA 3T3YA 2XL7A 3ZXAC 2Y38A 2AEYA 4UF0B 3AMPA 4PQQA 4XACA 3CU7A 4AVBA 4F83A 5FR3A 2LTNA 3N7KA 1RUJ3 3CL1A 4RQPB 4DZGA 1W8HA 4RL7A 5C9AA 4RS5A 5L36A 1ASJ3 3L2HA 5CEHA 3M3CA 1X36A 5FYBA 1KFXL 1PO23 1RHI1 3T2PA 2BVBA 5FYVA 1NQJA 2BBAA 1BZWA 4OYUA 1U5YA 3ILRA 1UPIA 1D2QA 3FHQA 2WAAA 4YVSC 4I3PA 5FJKA 2YHJA 2VY0A 1NE4A 3D4KA 3OYWB 5JCTA 1CZTA 1H1AA 2D97A 2DCYA 2ZKLA 3AXEA 2VZOA 3JB4C 3LKJA 3BCWA 4IE6A 5L7OC 2RJKA 2CTVA 3I3DA 4D3WA 3CZJA 3M3OA 3OGGA 1K5JA 3AP9A 4BDVB 3ZIXA 1OFNA 2BOJA 4XDOA 4NN0A 4YM3A 1KDKA 1UWWA 3R4UA 3RJ2X 5FYZA 2EICA 4I09A 4OI2A 4O65A 3CJIB 5IW0A 4Y3OA 4FPFA 4S2DA 4GKYA 4DINB 1PO13 4CE8A 2FD8A 1XC6A 4GQ7A 4HPKA 4TLGA 4UW4A 4YM2A 4XZUG 4MZUA 4OCTA 4SLIA 1PIV1 3VBFC 2HLEA 5BNQA 1OMIA 2HWB3 3UGHA 4L11A 1V6JA 1VBA1 4E4HA 1W8TA 4JGYC 3AKRA 4BQ1A 4ET7A 2PAMA 1R083 3IT8A 2QQKA 2XQXA 2JDAA 1NX9A 3SC7X 1MS9A 1C5HA 1WGPA 1PNFA 2ZAHA 3AP7A 5FK8A 1HRV1 1EAH1 4YG6A 1J59A 1GZTA 1FV2A 1S2EA 4XF9A 5HPOA 1ZZCA 2A6WA 5LB6A 3RZHA 1AF9A 2D43A 1AR93 4BK5A 1N1SA 2CWSA 1PX4A 1OLMA 5I91A 4XHXA 3OBTA 4XUOA 1SPPA 4U2AA 2VJXA 3IDBB 4QHBA 1KD7A 4M0HA 4NHXA 4M3CA 1H2NA 1WWYA 5T5JA 3RJRA 1G6NA 1WMFA 1QEXA 1UD1A 4MGIE 4RR3C 4R8HA 4E8CA 1VBC3 1BK0A 5DDJ3 5DAVA 5A6QA 5AC93 4CDQB 3ATGA 3A23A 2JD9A 3URFA 5BNNB 5C4WB 3KF3A 3OUJA 4XMIA 3MIHA 2HJIA 3MV01 1UYZA 1WW4A 3JD72 1D4M3 1P8JA 3PUSA 4IV1B 2A6VA 4LBQD 4MGYE 5BNOC 1L7QA 4FI9A 3DEMA 1IG0A 2WT1A 2YU2A 4IUGA 1LGNA 1O3QA 3MZHA 1PZ8A 4CUGA 4AK3A 4BH9A 3OGVA 4LULA 2DU0A 1JYXA 2ZEZA 2FDGA 4WVVA 1W28A 1SMVA 1QJU2 1GOHA 3H0OA 4CPBA 1K12A 1RUD2 1ND3C 2W5FA 3KT1A 4LITA 5DUWA 2FDIA 1APNA 3BODA 1CAVA 4XFCA 5FO9B 1Z7S3 1EUTA 3ORJA 5APAA 3BPZA 2VZ3A 4ES8A 2E7QA 5FXXA 5J37A 1J84A 2BW8A 2Y0OA 3I2FA 4Q8LA 4JCKA 2NN8A 1EAH3 2DTWA 2ZJCA 3H1YA 3ME2A 4NOTA 4Q0QA 4YW4A 3WZ1A 5A3PA 2GAUA 2GN7A 4H7LA 2PQSA 4GAZA 1RINA 4D94A 1UCXA 2EIGA 5KHGA 5CIRA 1ASJ1 1SDDB 3WNPA 5FZ0A 2B9VA 3LEKA 5JMOA 1LGCA 2XJPA 3APBA 3ZSLA 1WMDA 1XNAA 2RHPA 1D7PM 4GWMA 5FYYA 5C9AC 4CDWA 5BNPC 3VBOC 4Q1RA 4AEDC 4I2OA 1W6QA 2IWGB 1HQNA 3Q9OA 1RIRA 2A6ZA 1GP4A 3TYJA 4QXHA 1OOPB 2PMWB 4YYOA 1OI6A 4OZOA 2CGPA 3MO4A 1N47A 1LENA 2IXIA 3I8TA 1D0GA 2ARXA 4E2SA 1CR7A 2XUMA 3VD3A 3ZFEA 3MLKA 2Y6FA 2PHFA 5L9RA 2W1SA 1F8VA 4UFJA 2WNUC 3C8XA 1QJU3 2RJLA 1ZZ9A 4XC9A 3THPA 1BYHA 4XUNA 4NE9A 5GZDA 1MVEA 3WP5A 5K9YA 3JU9A 3JZVA 4DOUA 1ZREA 1Y9GA 2LROA 1BQPA 4YM1A 1D4M2 5EYYA 2C4XA 1CVNA 1RVF2 3Q8FA 3FWEA 2XPJA 1JXNA 2Q1ZB 3B9IA 1OOPA 2V09A 2BV4A 3FC0A 3VHPA 2VMIA 2WYSA 3ACGA 1TNRA 4KL1A 5FY9A 4CCEA 3IB3A 1AR72 1XBFA 1DF0A 1VMJA 4JQTA 3V0BB 1OPOA 1EV12 4M3CB 4X6RB 1JYVA 3RSJA 2R49A 4OUSA 4RN5A 4Q4V1 4N7UA 2DVAA 2F17A 4ES9A 1R1A2 2LUWA 2FZ2A 1IS4A 4AFDA 5CFCB 5FZ7A 3PURA 2GDFA 1GUIA 2VULA 2Z2SB 3GBWA 3VD4A 5FBJA 1JYWA 4COYA 4FPHA 3LD8A 1YQ6A 4PDWC 1HXS2 2DFCA 4UOJA 2XLGA 5K4LA 4YG3A 1VE0A 3E5QA 3DPRC 5A3LA 5ABJB 1DG6A 3T2OA 1BJQA 1YCIA 5F8PA 1PGW1 1SBEA 4FT8A 4TWTA 4AVCA 3WP4A 1ZBE1 3MUZ1 1AJOA 1UL9A 3NW4A 1GFF2 2AC1A 4RGAA 1HV0A 4OHVA 3UL2A 5F5CA 4XVHA 3GHNA 4CUCA 3PIJA 1JBCA 1S0DA 1YJKA 1C1LA 1UU4A 4Y24A 2ZBJA 1CZSA 3MF6A 3VBFA 3FJSA 2WFPA 4CDUC 4HPKB 3H8OA 1IZ3A 4QQ2A 1D0HA 5FP7A 1CAUB 3WG1A 3ZVXA 4CEYC 4QX1A 1LNSA 2JXAA 3FLTA 3I2GA 5FZ6A 1UY0A 3LPGA 1BXHA 5EWSA 4TLFA 2PN5A 4IEVA 4CCKA 4D8MA 1LOFA 5LBCA 1AR81 1TQ5A 1RVF3 2PLV1 2VZSA 4RHV1 3WR0A 3IBMA 1V9U3 2A3XA 4A42A 4HMZA 3OBRA 1QJFA 4BZ4A 1YFWA 4L97A 1SCSA 2D98A 2W68A 4OI1A 1W9SA 2X5IC 4WZFA 4KMQA 5EXOA 2B5HA 3U14A 4OHWA 3VUOA 1EPZA 4I01A 4BQXA 4HLTA 5CAZA 2W87A 1ULOA 4GXLA 1PO22 4Q0UA 4LPLA 1CIYA 4FPOB 3WXPA 2Q8DA 2YBPA 3X29B 5C3RA 4FQ4A 1OA3A 3U4XA 2B4KA 3AYDA 2CGOA 4FOVA 1OF4A 5JXIA 1IQDC 1OHFA 1JODA 1JHNA 3CHXA 2LS6A 4M3CE 1OSGA 5IVCA 5LRRA 1ZRFA 1CGPA 2IXKA 2VNVA 4ISRA 1PVC3 2GMEA 3I4IA 3U1XA 4D6RA 1RUC3 1X9TA 2C0ZA 3NKGA 3T0BA 4DXRA 2ES3A 3M70A 5A3TA 2VBBA 3WEZA 2XQRA 1UZYA 4OMCA 1PIV3 4XUTA 2DCJA 4YZ5A 3WG3A 3U75A 4B4QA 3RPQA 3CLPA 3KQRA 4YZ3A 4LA2A 1PK6A 1JU3A 4TZDA 1HLCA 5FXVA 2JX9A 2VQAA 3ES1A 3MICA 2IXHA 3ALQA 3B5LB 2ZHMA 3EHKA 3OBAA 2R30A 4H14A 4OULA 4ZPIA 4Q26A 5IFPA 5FZCA 1W2AX 4W50A 2Y6LA 5FXZA 5J7MA 1QOSA 2UWCA 1O8PA 4JHTA 4Y22A 5JOXA 5FYCA 3THDA 2W94A 4YPJA 2OIIA 1GZWA 1GP6A 2JG8A 2RM21 4MGKE 2B42B 2JWPA 2R043 2HWD1 2J1VA 2V72A 4R4XA 3ZFGB 2RS51 2Y6GA 3OCPA 4MGZE 3WNNA 4CCOA 3OY8B 1KRIA 4GH4C 5FV3A 4QKFA 1IS5A 4NRMA 1ODNA 4HL0A 3WDUA 2RVAA 5IVBA 5CG9A 2WJSA 4Q4Y3 4E9KA 4XJWA 4LK7A 4LR4A 2R7EB 1PM4A 4CUAA 3WCRA 4A44A 2ARAA 2KR2A 4LO8A 3N36A 4P9JA 4EN6B 1HV1A 1W99A 3GALA 2ZGKA 1ZRDA 3T0DA 4WBBA 2QNKA 4UW6A 2JKBA 3MHZA 3PU3A 4XIOA 1LAJA 1GOGA 4RSUA 4DXSA 1DIWA 4HN1A 4Y1XA 3NL1A 1I3HA 3GJBA 3W21A 3TNQA 2E32A 1HB4A 1SDWA 4Y20A 5DABA 5AFEA 4JGZC 1ALYA 1NA1C 4KU7A 2FQPA 1AZDA 1BK1A 3PL0A 4N43C 4UFHA 3SMHA 1S0IA 5L9BA 4IERA 1X9PA 4I30A 1H4GA 4LHKA 2UYBA 4YVWC 1WBFA 5JPMB 3BU0A 2P34A 3K4AA 2QQLA 4MGQA 1R082 3OPWA 3UKVA 1UW8A 4IEPA 2VH9A 4XJUA 1PK6B 4WM7C 5D8AC 4XF4A 2VVDA 3CDZB 4JKLA 1S0EA 3POWA 3RQ0A 3O1UA 4CCNA 2WKKA 2WO7A 2AH2A 3ZXEA 2VMCA 1EP0A 1SLAA 4Q4Y1 3WF2A 5CB7A 5G04L 3WT3A 4CCCA 1JUIA 2UURA 4NIAA 2ATFA 5F6LB 5F3EA 3VBOA 4AEDA 2NQYA 1GR3A 1B35B 5EJ1B 5A7SA 4OHZA 3DPRA 3RMYA 3VDDB 1DYOA 1DLLA 1SLIA 5CFDA 2B39A 1OA4A 5GM0A 1YIFA 4WVMB 1J1LA 4LQRA 4QKDA 4SBVA 1EV11 3H7JA 4PBOA 5EJ3A 3CEWA 5FZOA 2HWE2 2GC3A 1GYKA 1CD3G 3NJZA 4QHOA 2PHRA 4QXCA 1V6KA 2E9QA 2H6BA 1OXCA 4BYYA 2DCZA 5FFOC 4JGYB 4EN0A 4Q0SA 3S0MA 3I3QA 3TRSB 1J83A 1ZZBA 2DWRA 4UAPA 3FL7A 1UY4A 1W3VA 4MUVA 3BI3A 1QJX3 4URTA 2RR12 4XFAA 4KG8A 4Q4X1 2HWB2 1PGW2 3Q8EA 2KXLA 5C9AB 1AYN2 1ST8A 1ZBE2 3KB5A 5FLIA 2BVVA 5E16A 4MXWB 1HQWA 2OQ6A 1B09A 1O5LA 4MXWA 4Y5Z0 3ZFGA 1OD3A 5FIXA 1VBB3 4QMAA 3T1LA 3WV6A 2Y60A 3EJKA 5T5OA 3POSA 1CPMA 3ACHA 4IE4A 2YB7A 2XLFA 3WQ1A 4A2UA 2BNNA 1KJRA 1G9CA 2TBVA 4EV0A 3NNJA 4HZFA 3SKJE 1UNBA 1S0JA 1GLHA 4N53A 4TN7A 1AX2A 1QMJA 4ZONA 1REDA 4XUQA 2RDSA 5T3NA 4DFSA 3ES4A 2H0BA 3WNMA 1GQGA 1RUF2 2JE7A 2AR6A 2LM3A 5C5UA 4FOWA 1LTEA 1QNWA 4BMEA 2BOIA 1WCQA 3OSDA 3VKMA 1O4YA 3NNFA 2R063 1T6BX 3VHNA 4K21A 4KNCA 4NAOA 4XQWA 3S7EA 4Y4YA 2BEOA 4IV3A 1F31A 3DV8A 4OMDA 2Y8KA 1B35A 5FYTA 4AHYA 3BALA 4JZRA 3D82A 1ZBA3 1TME3 5DAWA 2MEV1 2HYXA 2I45A 4AEKA 1YI9A 1F2NA 1J3QA 5AVPA 4FBFA 2RDNA 2YROA 4LBLA 2V5DA 1RUD1 4GJZA 3OB8A 2WWUA 3NJYA 4IE7A 1B35C 1W8FA 2I2SA 1X7NA 4LOTA 4HETA 4KGGA 3VDDC 4XUPA 4AYUA 5JDBA 5KHJA 2ZX4A 4PLOA 5HV4A 1RXGA 1NCQC 4KBBA 2RDQA 2GC2A 4RQPC 4KQ7A 1SLBA 1FAYA 1UZVA 1VBB2 3IDCB 3VBRC 2DU1A 1WKYA 5KBFA 4LUKA 3TEXA 5T55A 4L0PA 4EYUA 4ZHNA 3M8LA 3GJAA 3AKSA 4MV2A 1CJDA 3WP3A 1C5IA 1W03A 1ZBA2 4IEUA 4FVVA 2W52A 4A3ZA 4AQSA 1AXZA 5HCAA 2ZX2A 1VB2A 2A75A 2JIJA 4CP9B 1AL21 2D6NA 3GM8A 4I3GA 1JZ3A 2QZ2A 3S5AA 2ZXQA 2HH9A 2VVEA 2IFRA 2OW4A 2KA3A 5LBEA 3WVJA 4Z8BA 4JKKA 1OOPC 4QD2A 3LZZA 3VZJA 1YFUA 1PMIA 2ADDA 3AJYA 5D8AA 1RGSA 2ZABA 5FLJA 2DFBA 1QDCA 4P9LA 1CAXB 2WNVB 1MVQA 4NUBA 4Z1VA 4LNVA 2R0HA 4V1PA 4QPGA 1RMU3 3O0VA 4N9HA 4QPGB 4XQDA 5EYXA 1CESA 3WNXA 2RE9A 2ZGRA 3H8XA 2JG9A 5BY5A 1DZRA 2BBVA 3ILFA 2GMPA 1REFA 1HB2A 3FLRA 1QGLA 2OUJA 2AZ5A 2ZA9A 3M4FA 3POEA 5K8SA 2MEV3 1DFQA 1Y9QA 2YC0A 1VRH1 3OGSA 1LU2A 4P9WA 4BISA 1SBFA 5A7OA 3VBSA 5L9VA 4G9SB 4CDXA 4UFIA 5JLVA 2JG8B 2QDNA 5FY0A 4OQ8A 1RHI2 3M3IA 5FTTC 4CU9A 2ZKNA 2TUNA 5F7UA 3D8CA 1LOGA 2WZR2 3P1IA 4EWAA 2PELA 4BK4A 1MEC1 3TEYA 1DQ2A 4AGVA 4BXSV 2QQWA 2KM2A 1SFYA 3P5BA 3MW2A 1PNGA 1HRI2 5FZHA 1LECA 2P3YA 2Z69A 2Z42A 1IHMA 1U12A 2C6SA 2RS53 3OOXA 4N8MA 3CJXA 4C90A 2CV6A 2CDOA 5LA1A 2L9LA 5DUUA 1JHJA 3VZOA 1SZBA 1O4ZA 1X82A 4ORFA 3ZYJB 1R1A3 3AP4A 1NCRB 5DN2A 4AAXA 3LCPA 1H8TC 1NCQB 2AACA 2QQMA 1UU5A 1N3PA 5F32A 3ZR5A 1R091 5CU1A 1DDLA 2G1MA 2HEVF 3PUIA 1EV13 5C8WA 3C3VA 3R05A 4IV1C 3W5NA 1OA2A 1RMU1 2XL9A 4HONA 5JSOA 4JTOA 3FFQA 1QHDA 1VBA2 2WZ8A 3A7QA 4OI0A 1QJY2 3W58A 4WVMA 1U0AA 5F6KA 4MGTA 5DG1A 1SFNA 2WZEA 4MG2A 1FNZA 3RYKA 1QQP1 2VZTA 2ZX0A 4Q4Y2 2ZZQA 4XW3A 2XWBB 4A7KA 3LWCA 5GLTA 3WF1A 3JUUA 5HBAA 1AR61 4UFKA 2E51A 4LBQA 3ZDVA 2VNOA 3PJYA 3ZFGC 4IEQA 4OLLA 1OFSA 3WG4A 1SHWB 4GIQA 5DUXA 5A1FA 4NAMA 3LQCA 1CZVA 1LHWA 4XTMA 4R9BA 5C8CB 3KHBA 3AKQA 4PHZA 4BLIA 2JEMA 2QZ3A 5J3UA 5LBFA 1XJAA 3HD8B 2PHXA 4FP3A 3AKTA 4DY5A 4GJYA 4IE0A 4BE3A 1Q5OA 2YXSA 4AHWA 1JZ5A 2XKPA 1CAWB 1ZA7A 4Q8KA 3MFCA 3RG0A 1ODMA 1MQTA 3OPTA 1JZ2A 2IXCA 2NMNA 2J1SA 1YQ2A 4NWWA 4URAA 2D40A 4LBNA 4A41A 5J96B 2I74A 1VBD1 1BCXA 2JG8C 1BBT1 1H4HA 1U5XA 5ACA1 5JR2A 2DDUA 2X05A 4C0BA 1R093 1AYN1 1NA1B 1Q56A 4QX8A 3GBGA 3WQBA 3LEGA 1NLQA 3OJBA 2E6VA 1G7YA 5IATA 1O59A 4TTGA 2WUHA 4AI3A 2AREA 1DQ4A 1GWLA 4HVRA 2W3JA 1W6MA 2VCBA 3UK9A 4QWNA 4B7EA 1PVC1 3LSEA 3DKQA 1NLRA 1LOEA 1RTVA 2BFUS 2WLQA 4INDA 4YVWB 3MGUA 2VXRA 3ZXFA 4XMAA 2ZGTA 3I54A 3ZMOA 1RUD3 3NVCA 3LDRA 3I2IA 4Z2AA 1AR63 4ZKTB 1XYNA 1IPJA 4YGBA 3RWNA 1NCRC 1IS6A 3FBYA 2WT2A 5FUNA 3UYJA 2QDRA 3KHCA 2I07B 1OVPA 2WA4A 2H0VA 4R52A 4CDXC 3K4DA 2YPJA 1VAKA 3ZPYA 5C3SA 1Q8QA 1MZFA 4P5YA 3SNMA 5LK5A 1OQEA 3MEPA 3B3QE 4P9YA 1WA4A 2OVUA 3HQRA 3ABZA 1QJY3 4PI2A 4XDQA 5GJ6A 4Q27A 4HXCA 2BNOA 1UIJA 5F2SA 4A45A 4F8AA 5FKBA 4LO5B 2AEZA 4Y1YA 3WW2A 3ROUA 1W9FA 4CSWA 2VECA 3O0XA 3RGBA 1FMD1 3NAPC 4QQPA 1FOD1 3PHMA 2BTVC 3ETPA 5E88A 5IJRA 3O1PA 2JB4A 3J4UH 4E8DA 2RS13 5CBLA 2WN2A 3VHRA 4JDMA 3HWJA 4BQ5A 1LU1A 1QXRA 1S2KA 2BDRA 5T5PA 4AG4A 4D69A 3RZZA 3ZXLA 1WD3A 4YVSB 2B9UA 2OQ7A 4PIXA 3TN93 3AVSA 1Y4WA 1KXGA 2P5BA 4YSFA 5C8CC 5FP3A 4GULA 2RS32 1HJGA 1I1EA 1X8MA 4WVWA 5C3PA 3PVNA 4Z92B 4KG0A 3SCFA 1IQAA 3HN3A 4LO6B 3IDEA 4YGEA 1AL22 5FZKA 4D7TA 3PDQA 3KVBA 3ETQA 4UFMA 4KWKA 3SH5A 5HCBA 3GZUC 4A4AA 2QQPA 3CJIC 1XXNA 4NRQA 1EYBA 2AYHA 1Y7BA 4HKWA 2ZCWA 3R0RA 1JYTA 2YYOA 3VBFB 2RS12 5DG2A 1LRHA 4K3UA 4QT6A 4YW5A 2VVFA 4BMBA 2VGDA 3J8F1 1ZZ6A 4AQTA 5KC5A 1OKQA 1PK6C 5D8AB 1RUG3 2C26A 4XJ9A 2Y26A 1K45A 3NNLA 3WW4A 1V6NA 2WL1A 3D0SA 2VW2A 1WZXA 2Y64A 3HNYM 4Y5TA 4AOCA 4AGRA 1W2OA 5EV7A 4CEWA 1L3JA 1UYYA 1RUI3 1HRI3 2G19A 1W05A 4HK8A 5FK7A 4CU6A 2HWC2 2P4EA 1UX7A 1XRUA 5A3OA 3UV9A 3RI8A 1VALA 3SH4A 1D2SA 3AC0A 3QOPA 1H9WA 1W6MB 2QQVA 3NQHA 4QX2A 1GZ9A 4Q4W2 1ULFA 5K0UC 1K3IA 2X5IA 3W59A
chains in the Genus database with same CATH topology
4NPRA 1RUC1 2HWE1 4PF5A 4CTEA 4I0AA 4N53C 3MPBA 4XFBA 4MX3A 1Y3TA 2XBO3 2IXJA 1NOVA 1PO12 1WD4A 3VBHB 3B02A 3JBG2 4ASMB 4IV1A 4IESA 1R092 3V65A 2O1QA 2DURA 4Q4X2 1X33A 4ZU5A 4AQ2A 3ZYPA 1A8DA 1LJ7A 3USSA 1RMU2 2RMU1 5H9QA 1WCSA 1YWKA 1DZTA 4GMP1 1RJ7A 1YUDA 5A32B 3ZSEA 3PVBB 1PO21 4QGNA 1HDKA 2YMZA 4XXAA 1NE6A 1KDMA 4ASLA 4Q1PA 2XKOA 1C8M2 5GLWA 2XJVA 5KHKA 1FYUA 2O0OA 4CDWC 1AR62 2CGNA 3U0ZA 3DKWA 1SBDA 4KGQA 2D6MA 1KJLA 2UYAA 1MQTB 1MS5A 2F4PA 5GZEA 1GKBA 4Q29A 5I0SA 3OGJA 3WLUA 1N3QA 4QX5A 3U07A 1AL0G 1S0GA 3GYDA 2GU9A 2EXHA 1PGL2 1CIWA 4GB33 3RNSA 2PAKA 5CFDC 1WLTA 3HBZA 1VBC2 4MXVA 1I5ZA 2XWJB 4EN7B 4DMIA 3CJIA 1BBT2 5ACA2 3NO8A 4Q2FA 4AEJA 4QQHA 3ELNA 3JCIA 2E7TA 1RUH3 3VBSB 2VMGA 3HN1A 1AYM2 5T5LA 1FX5A 1KS5A 4COZA 1AR92 2RM22 3G7DA 2DUQA 3PLQA 1XE7A 3IIAA 4K20A 3ZXGA 4UBHA 4AEMA 2D6OX 2A6YA 1K5MB 2ZGSA 1W6OA 4DQAA 1UKRA 3PJQA 1QH6A 5L19A 4MH0E 4CEWC 2WFF2 4E4SA 3TBDA 4CRQA 3VLBB 2W0XA 5BNPB 1ENSA 1TNFA 3IM0A 3GF6A 1N1VA 2WNVC 4XOGA 5DDJ2 5AC92 4D7YA 1MS0A 2PHDA 2P3KA 4PDWB 4UBGA 4LBOA 4Y1ZA 1RUE2 4J6GA 1AHSA 4AGGA 4L8QA 2HYKA 1V6IA 3S6PA 1DQ6A 1IS3A 4DNYA 2D3PA 1SQ4A 3KCYA 1AVBA 1CQ9A 2A7AA 4I02A 1VRH2 4XEZA 1AX1A 3NV1A 1ND2B 2B7YA 3DN7A 3MIGA 1WBLA 1RL3A 1R081 4H7MA 3UKNA 1TMF3 2V73A 5CADA 4WM8C 1AJKA 3VV1A 3QLQA 4Y1VA 1RUE3 1ZM1A 1MS3A 4MLOA 2WZR1 3AZXA 3DF0A 4YLZA 3KS7A 4Y22B 1MEC2 4K40A 5D1IA 4YVWA 4R9CA 1C8NA 2ZHNA 4YM0A 5A33A 3VZKA 1HRI1 2XG3A 4LO7A 3OD0A 3OY8A 5GLZA 4XJZA 3FX3A 3LOIA 3ZO0B 1UN1A 4UW3A 3TNPB 4FTBA 1MACA 1HX6A 3OYWA 1NXD1 2RS11 2VU9A 3NKTA 1BEV3 2WFF3 1DHKB 1LODA 1VAVA 2ET7A 2WIIB 4RS5C 4B4PA 1YI7A 2DV9A 2EXKA 4RGGA 4DRRA 2DF7A 4E27A 3ZFEC 1RUJ1 5KXBA 2GALA 2SBAA 4YZ4A 2ZHKA 3RS6A 1LULA 4GH4A 3HAGA 4XPVA 4BWOA 2RM23 2EXIA 1QQP2 2A3WA 4L99A 2BWAA 4IL7A 2K2SA 4OHYA 1RUF3 3EO6A 5DZEA 3VL9A 1DU3D 1TMF1 4AF9A 1ULGA 3A0NA 3V0AA 5C4WA 3U11A 3WHTA 1RUOA 3R4DB 1YRZA 4R9AA 4YGDA 1QXPA 5KHHA 3VKFC 2W39A 2ZACA 4CEYA 3A4UA 4OUMA 1PO11 5T54A 1GZCA 2WS91 2JG9B 1QJU1 3H3UA 2P2KA 1VJ2A 3B00A 2R042 4NVPA 1JTZX 4QGLA 4WM7A 4YFZA 1QJX2 4PDWA 1MZEA 4Q4W3 5GZCA 4K9SA 2PHLA 4NHLA 2NZ9A 2BQPA 2XVKA 2B46X 3WINE 1G9AA 5T52A 1QNYA 1V00A 3RMXA 5LRSA 2ZPXA 4BCUA 3THTA 2HWE3 2NLRA 4AXOA 1V9U2 2ZOEB 2WNUB 1M06G 4IEWA 1WCDJ 3VZNA 1V6LA 3E97A 3EQEA 3PTYA 3H1WA 3ZX7A 4IQPA 2WA3A 1QKQA 2OPKA 4JQRA 3VKOA 5KWRA 4META 1DGWA 3E5XA 2ZGPA 5DZGA 3M3QA 5JAXA 1N3OA 4WM8A 4FO9A 3ST7A 4L9BA 4FSJA 1MEC3 2PFWA 4Q0PA 5GALA 2XVGA 3H50A 3O7OA 2RR13 5H9PA 3ZN6B 5FPZA 2NMOA 1IGOA 1SLCA 3WQ0A 4AI1A 2EAKA 4NWVA 2X29A 4XBNA 2VW0A 1H0BA 2HWC3 2E7AA 2VUAA 1W6PA 4Z82A 3KCXA 5FCCA 1VBD3 4M00A 2PYTA 4EWEA 1WLCA 3IPVB 2P3IA 3AMMA 3WCSA 1I6XA 1Q8SA 3FZ3A 4WV8A 3N3HA 3VBOB 1AR73 4IETA 4AEDB 2HWF3 4XFHA 4BHPA 5JSPA 3DUIA 2TNFA 4PJYA 4AVTA 4H55A 1W2UA 3AKPA 1DYPA 2QFEA 1GNZA 3JB8A 1UPSA 2ZMNA 3SCHA 3M3EA 4JC1A 4BIOA 1O91A 3ZFFC 1Z7S1 4CEYB 2F6BA 4MVTA 3TB0A 1ONAA 4AW7A 1ENRA 2A70A 5GLUA 1PGSA 1ZZ7A 4FPKA 4FTEA 3N35A 4N43A 5IK5A 4XE9A 3WDWA 1YJLA 3LA7A 4OI4A 1QOTA 4COUA 1OQ1A 3KGZA 4YG0A 4L92A 1FI2A 3MIEA 2YUEA 3I7DA 2HWC1 2N7GA 1Y43B 4AVSA 5A33B 4BIFA 5FREA 5CFDB 2YZ4A 1QY4A 3KT7A 1AR82 2R0FA 2PLV2 4RHV2 4YARA 3LB9A 3U10A 1MR5A 4GKXA 4Q4W1 4AFCA 1F9KA 2QE3A 3WUDA 4Y1UA 5SV8A 3MFAA 5JZGB 1VR3A 5JOYA 1Q8VA 1RUC2 2JE9A 2GSYA 2VOWA 1JYCA 2ZGQA 1HKDA 3AB0A 2ZGMA 2ZMLA 2VNRA 3VBUB 1A3KA 2CNAA 3AMNA 1GQHA 1Z0HA 5C4WC 3IPVA 1XNKA 2Y0IA 4K7JA 1LESA 1YO8A 5L7OA 2BNMA 2SLIA 2XJTA 1PM7A 2A5ZA 5CNAA 2FMDA 5DXDA 5L7OB 1MZ6A 1TE1B 3AM2A 1A6CA 4XFGA 4IEZA 5B2GB 3DGTA 1RUNA 1LOAA 4YZ1A 5BNNA 4FOQA 3UJQA 4XFFA 1C8M1 2JENA 4LT5A 4CDWB 2GMMA 2UWAA 3JQWA 4AVVA 4FQZA 3FMGA 2BYVE 1RUG2 5FMOS 1D4VB 4FP2A 4JGYA 4A3XA 4CYDA 3E6BA 5JWPA 4RD7A 3W9AA 3RYRA 3M7AA 2ZGLA 2G9FA 1REEA 1ENQA 1W0PA 5JOWA 4HKLA 4S2GA 4E4ZA 1U5IA 1SCRA 4YVSA 2XHKA 2XJQA 4QPIB 4NHKA 2RS52 2JDZA 3L2YA 1GZWB 3NV4A 4K1ZA 2D5FA 4JRAA 1ZX5A 2WNEA 1YNAA 3HT1A 1FXZA 4JGZB 1QJX1 3PMEA 4QQLA 2CYFA 4JGZA 1AX0A 3GZTB 1LHNA 5CA6A 2WNUA 2DUOA 2BFUL 4PBPA 4N43B 4U36A 4BOWA 1DQ5A 4XBLA 1HRV3 3H1MA 2GZWA 4XXPA 3VBRB 1V9U1 3VBUC 1S2BA 1H1MA 1LOBA 1AUYA 4RS5B 1FPN3 2BUKA 2A71A 5C33A 3QH6A 1CAUA 1MS1A 4XJ8A 2WS93 4NHMA 1NQDA 1COV1 2Q4SA 4IV3B 5KXCA 4XF1A 2ETEA 1UKGA 2Z5WA 1OPMA 1KS4A 2RS31 4XF3A 2DTYA 3B7MA 1JW6A 2WSVA 1CAXA 2R071 2WC2A 4AE2A 5DDJ1 5AC91 4E2GA 1W6PB 4EJRA 1Q8OA 1URXA 3SITA 5FQ0A 4GH4B 1PZ7A 4O9EA 3RDIA 2O8QA 2VG9A 1UZZA 4XZPA 3ZXDA 4RFT0 1RHI3 2ZX3A 2QUOA 1X50A 4GB31 1OLRA 5J3UA 3N7MA 2WWSA 3DL3A 4NR1A 4B8EA 1XU2A 1MZ5A 1XNCA 2D5HA 5K0UA 1LR5A 2ZMKA 3ZFFA 3ZN6A 4IEOA 1G9DA 1CN1A 3QBQA 1WW5A 4LUMA 2Q0AA 2Q30A 4RR3A 2PQQA 4QPIC 4JDOA 3AYEA 1BVVA 2OZ6A 1N1YA 4GA9A 1G9BA 1LGBA 2ERFA 1VBE1 3A0KA 2PLV3 4RHV3 3BIWE 1LOFC 3MLJA 5E89A 4K8FA 1NCQA 2WT0A 4JV4A 4BPZA 5J36A 4M3CF 2HWB1 1Z7S2 3VBRA 3KT4A 4UXAA 3KM5A 1GV9A 3BOWA 2GNTA 3RYPA 4S2HA 1RUJ2 2D6LX 2EXJA 1ENXA 1O3SA 2DVFA 2QCSB 2X53S 1TEIA 2Z79A 4UW5A 4AHZA 4OVEA 4FPJA 2YV8A 4FXKB 3JD73 5CVRA 5HXVA 3TOJA 3N4MA 1RUF1 1NYWA 2R1BA 1YXWA 2YGLA 3KZ4C 3AMQA 4BLJA 2GH2A 1OQDA 1O4TA 2Q1MA 2PHUA 2GNBA 5JSRA 4AVAA 2UU8A 2UY8A 4XBQA 1CAWA 1H8VA 4CDXB 5GKAC 4AFAA 1G9FA 3MYXA 4DXZA 2JG9C 4ZXKA 1WUVA 1J3RA 4HANA 1ULDA 4CEWB 1ZNPA 5H9SA 3J26N 5EZWA 4YZ2A 5I0TA 1EPWA 2OA2A 2R041 3B69A 4N9IA 1COV3 4ITCA 4PIZA 1V6OA 3VKNA 3ZSJA 1H8TA 4OZXA 1PGL1 1FNYA 4QGMA 1SEFA 4Z07A 1AXYA 2EF6A 1QOOA 3S30A 3FFZA 4Q0VA 3WY6A 1SACA 2OZJA 5F9TA 2ARBA 2HWF2 5HCFA 5J09A 1W39A 1AYM1 4EN9B 3AZVA 2C9AA 1AR91 4L2NA 2IXLA 1S55A 3INAA 4NO4A 4XETA 5KXEA 2VMHA 4HKOA 1CJPA 1S0BA 5F1RA 4CDQC 1ZVFA 1WLDA 2GH8A 1ZRRA 1BKZA 2D44A 4CZSA 1R1ZA 5E8AA 5BNOB 1YYNA 3WD5A 1LEMA 1U5ZA 1WMEA 2VOXA 2XGXA 3B9CA 3I59B 3ILNA 4XF0A 4DB5A 3HT2A 3ZYGA 2B45X 2D7FA 4HSLA 2IZWA 1UU6A 5JI7A 1FV3A 3L9JT 4QXKA 1BBT3 5ACA3 3AZYA 4EN8B 1BMV1 2AGSA 3LOBA 1RC6A 3N7LA 1FATA 5A3MA 3R4SA 4HVQA 3HIFA 4X8PA 3NAPA 5LK7B 3G6JB 2P3JA 3VKLA 3H7YA 1O5UA 2K0GA 3HMYA 1HIXA 1IPKA 2XH6A 3MIBA 4G4FA 4YNIA 2VPVA 1TME2 1YFXA 1COV2 4PQ9A 2VOKA 2XBO1 5JR7B 3V64A 3MF9A 5AVAA 3MIFA 3WOGA 2GNDA 3WG2A 4CP2A 1RITA 1G8WA 3VN4A 5I93A 3VZMA 1XU1A 3KMHA 1S0CA 5IK4A 4ZU7A 2V5YA 1W6NB 4LE4A 4JVAA 1O7FA 1POV1 4AHXA 4S2FA 3DPRB 3VDDA 1QJY1 2ZGUA 4AI8A 2XVLA 2NYYA 4KWLA 3P3NA 4C0HA 5FRAA 1W6OB 1FPN1 4GB32 3ZDSA 1QDOA 2R16A 4XILA 2DCTA 4B7KA 3SLIA 2R061 4C91A 1UIKA 1IKQA 5FBZA 5I0UA 3FBMA 5JPNB 5I8SA 1OLQA 4X8NA 5T50A 5BPXA 3K48A 1H2MA 2P37A 1AYN3 5C8CA 4R9DA 1VB4A 1DQ0A 1MQTC 5FO7B 1UX6A 4C1WA 3UJOA 5K0UB 5CFCA 1A8MA 4K1YA 3SXWA 4FPLA 3PMSA 3WDVA 4I0BA 1ZZ8A 1MS4A 5LEKA 3AJZA 3MI8A 3WHUA 2FHRA 3GBFA 4A7ZA 3WQ7A 5CFCC 4TSVA 1ND2A 5EFUA 4FPGA 1RUI2 1ULCA 3MPPG 4B3NA 4N90A 4Y26A 2OYZA 4D7SA 2QJVA 3NV2A 5SV5A 2B8MA 3AX4A 4GWNA 3I59A 1BEV2 2PHWA 2LALA 3O0WA 2WS92 3USUA 2DVDA 3CF6E 1PVC2 3JBG3 3LGRA 3QCWA 3USUB 2OUHA 1J1TA 3OTFA 2A73B 1DQ1A 2K9ZA 4YW3A 2QKDA 1VAMA 1NCRA 2H6CA 5JIUA 5IUQA 2D3RA 1VLNA 3K51A 3D6EA 1ZBE3 1LCLA 1DGRN 5KXDA 5F5QA 4LA3A 4FTSA 2EALA 5I8YA 3BB6A 3CNAA 3AP6A 1GICA 5FOBB 4LEJA 2ZX1A 3AFGA 4CDUA 1K5MA 2WZPP 3TN91 3KLSA 2IC1A 2GC1A 2D6KA 4QPYA 4COVA 3WDTA 4F3JA 3QD6A 4WZCA 5IT6A 4LLFA 3B01A 5GZGA 4YRDA 3M1HA 2ZAAA 3J8F3 1ZYBA 2HKXA 1AYM3 5FLHA 1FOD2 5JI9A 3WW3A 3LA2A 3WDXA 3IKWA 1JN2P 1QWRA 1GANA 2CL2A 1V70A 3OF1A 1S0FA 3UKTA 3NSTA 3IWZA 3ZFFB 2D93A 1QJZA 4HBNA 4IEYA 3AZWA 5FAXA 5AFBA 4BA6A 3TAYA 4E4DX 3V0AB 2JJ6A 1H1IA 4W6WA 1C1FA 1WW7A 4RR3B 2A3YA 2CAUA 3AMHA 4E2QA 1NA1A 2IFWA 3POYA 4HN0A 4KU8A 2JD4A 5A32A 3E5UA 2JECA 1HXS3 3VZLA 2FMYA 3E6CC 2RS33 1XNDA 1ZBA1 4P14A 4JRLA 3SISA 3IMNA 4H3WA 2DCKA 2XJSA 1UMZA 1ND3B 2YY1A 3AK0A 1DGWX 2XJUA 3MLLA 1N1TA 3NAPB 4EROA 2VNGA 2DVGA 1PZ9A 4GMP3 4CP0A 4XYXA 4KWJA 4Z2WA 1NLSA 2GN3A 2CAVA 2XLAA 4HFSA 3R6SA 1DYKA 2PTMA 4N53B 2WQ4A 1JYIA 4P9IA 3ZYRA 3WP6A 2WSUA 4Q4V3 2C1FA 2HWD3 3P3PA 3KD4A 3TWIA 1WLWA 1SLLA 5BYNA 4WM8B 4HSJA 3V0BA 3B93A 2DYCA 1VBE3 1VBE2 1QH7A 1UAIA 3J9SA 5IK7A 4FCAA 4FPCA 4QPIA 4G3YC 3S7IA 2UWBA 1DGRA 4LO4B 4ZU4A 1FMD3 1VP6A 5JZGA 1HXS1 2XJRA 1LHVA 4GMP0 4YFWA 3NV3A 1M4WA 3KSCA 2ZGNA 3ZMNA 2VW1A 2RMU2 1PIV2 4FAGA 5E1RA 2YGMA 4K6BA 4Q4X3 1VBA3 2R073 1CONA 3D0JA 3GZAA 3QH7A 3ZSKA 4XJAA 3NWKA 3FUQA 2PHTA 2ZTNA 1AR83 3ZFEB 1FPN2 4RQPA 5K7PA 4WM7B 1IOAA 3T1MA 4ATFA 5C6CA 5KC6A 1I9RA 1HRV2 1EAH2 1KITA 3OD4A 4XTPA 1G86A 4YGCA 3RRDA 3OPZA 4MYEA 2EA7A 1LB2A 5DUVA 1GSLA 3LSDA 3SCGA 2GNMA 1RUH1 1AL23 4RA0A 3VGIA 2E63A 2WZR3 4JDNA 4LBQB 1NXMA 1POV3 4CP1A 2O8OA 5BNOA 4QU2A 3M2MA 3VBUA 4LLOA 1DBNA 4AFMA 1W6QB 1RUG1 1DZQA 1ZA4A 3H9AA 4I0WB 5BNNC 2EAAA 3RI9A 2FBEA 3MDPA 2G9GA 2BGCA 2FZ1A 1RUI1 1CAVB 1JUHA 4F7ZA 1H2LA 4ONUA 2AUYA 1J3PA 4Y20B 3FHIB 1E57A 4HVOA 4DRVA 4TYSA 3O12A 1ULEA 4HK9A 2VQ0A 3ZN5A 2PAEA 5JMCA 3O5SA 2RMU3 5I0RA 5FPXA 1EY2A 2WNVA 1VBD2 4J1XA 4XQ4A 1XE8A 4DS0A 2HWF1 2DVBA 4YW1A 3MW3A 5FQ0B 2Q8OA 5J98B 4R4ZA 5BUVA 3D5OA 3ZXKA 5L73A 1HW5A 1ASJ2 5IK8A 1YHFA 3VL8A 2X5IB 4QM8A 1KFUL 1W6NA 5DZFA 3TN92 2ILMA 2R32A 5GZFA 3ZIWA 1O3TA 2NP0A 1NY71 3N7JA 5LEJA 1CX4A 1F5FA 4CDQA 2HWD2 4XHBA 4B29A 1C28A 1RUE1 4QQOA 4ISQA 3I2DA 3VBHA 1UF2C 1XNBA 3FLPA 3FE5A 2CWMA 1HQLA 2R072 2HEWF 2WLPA 3VBSC 1JH5A 4BM8A 2TEPA 1BMV2 2D3SA 3EBRA 3IN9A 3PVOA 3LAGA 1F5JA 2ENRA 3GHMA 2WINB 1QU0A 2YDEA 1FMD2 4HT1T 5FMOL 1V6MA 5BXXA 1Q43A 1LOCA 4IEXA 1PHMA 1K5MC 3O14A 3ENRA 2W08A 1RVF1 3WUCA 3AYAA 4YW2A 2R1DA 3BTAA 1ND3A 1QF3A 3ASIA 1H2KA 3E6DA 1XYOA 2JICA 2ZS6B 4OHXA 4LE3A 4C1XA 4COWA 5KHIA 4X6QB 4W6YA 1AR71 3CO2A 5ABJA 2NM1A 4PLMA 3VHOA 4FPEA 4Q4V2 2EVXA 1LHUA 4FPYA 1R1A1 5JIAA 1WCKA 4ATEA 1H8TB 1BVP1 1SLTA 3VBHC 4QPGC 2AENA 2MPFA 3HQXA 4P9XA 4LBJA 4M0NA 5BNPA 5CG8A 2MNGA 2X8KA 4A7YA 1ND2C 4LTAA 3V56A 1POV0 1VIWB 1RB8G 3AZZA 4JTNA 2R062 2VOVA 3J8F2 1QQP3 1C3HA 1GNHA 2DUPA 1TMF2 1ZRCA 2HEYF 3LA3A 1IKPA 1X8EA 2XB6C 3KGLA 1DGLA 1VRH3 1O3RA 1AXKA 2PA7A 5FDBA 5J48A 3MIDA 3SHRA 3ZXJA 4FXGB 5JZGC 5FO8B 1XYPA 2ZZJA 3ACLA 3AFKA 3ZN4A 3HR9A 1Q8PA 2RR11 2QVSB 4MSVA 3JD71 1NG0A 3MW4A 3AYCA 5I8TA 2NPIA 4J1WA 1MS8A 4FAHA 3H8UA 4PLNA 4W65A 1QXJA 3B94A 1WW6A 2G4IA 1BEV1 1T6GC 5TSWA 1FOD3 1PVXA 4IXLA 3C2UA 3ECQA 3AXDA 3JBG1 5GLVA 1KQRA 1OD5A 3JQXA 1Z78A