2Q30A

Crystal structure of a rmlc-like cupin protein (dde_2303) from desulfovibrio desulfuricans subsp. at 1.94 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
106
structure length
106
Chain Sequence
b'HMKSHNLLEAVRFDDQRFVMELVHESENFKIVSFTFKAGQELPVHSHNIEGELNIVVLEGEGEFVGDGDAVIPAPRGAVLVAPISTPHGVRAVTDMKVLVTIAPPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_388795.1) from Desulfovibrio desulfuricans G20 at 1.94 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str. g20
molecule tags Unknown function
total genus 17
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2q30A01
1U12A 2H6BA 4XF3A 2E9QA 3RZZA 4J1XA 4D7TA 3LAGA 5KHHA 1CX4A 1LB2A 3H9AA 2MPFA 1EYBA 4Q0QA 2GZWA 1YHFA 5LEKA 5BY5A 3IDBB 4IEOA 1JUHA 4WBBA 2BNOA 2F4PA 4Z07A 3L2HA 2HJIA 3OTFA 4HLTA 4IEUA 1CAVB 4AVBA 4LULA 4XF0A 5I8TA 5JSPA 5I91A 4XFAA 2Q30A 3DV8A 2PHDA 3U10A 5FQ0A 2CAUA 1CAWA 4KU7A 2PHLA 4MX3A 5J7MA 3C3VA 3KMHA 4OLLA 3SCFA 1J3RA 5KHKA 1UPIA 4I01A 1DGRA 1I5ZA 4YRDA 4HN0A 3RDIA 1UD1A 2GAUA 3BPZA 1ZZ8A 1PM7A 2CV6A 1V70A 3NW4A 4X6QB 1LRHA 4Q0UA 5C6CA 5AVPA 1YFWA 2Z69A 3S0MA 2PA7A 2XGXA 2I45A 2PAKA 3H7YA 2D5FA 5KHGA 3FFQA 3ACLA 3QACA 2PAEA 4X6RB 1Q3EA 1DGWA 2DCTA 2Y0OA 4FBFA 4E2GA 1O5UA 3EBRA 3RYRA 4JVAA 3I54A 2BNMA 5CADA 5EZWA 4TLFA 3PVBB 1CAXB 1CAUB 2PYTA 5FLHA 1CGPA 5I93A 4ZU7A 1G6NA 2ET1A 1LKNA 2GC0A 2XKOA 1ZZ7A 1ZRDA 2O1QA 2O8QA 2HKXA 4YARA 4XFBA 4CYDA 4WZCA 1NYWA 4O9EA 3LA3A 1ZVFA 1SEFA 2IXLA 1QWRA 2GH2A 2PAMA 4JTNA 3WW2A 3GBFA 5FLJA 3M3IA 4LEJA 3SCGA 1QXJA 2K0GA 3MDPA 3PLQA 4J1WA 4BIFA 2B5HA 4AXOA 4L2NA 3SMHA 5EFUA 2VPVA 1YWKA 5LEJA 4JV4A 4Q0VA 5T3NA 1VP6A 3DN7A 1WGPA 4I3PA 3HQXA 1UIKA 5FCCA 4H7LA 4LA2A 4MGIE 2V09A 2Q0AA 3LA2A 4R8HA 2KXLA 2P17A 4KL1A 4OFGA 4PJYA 2MHFA 2IXKA 3I59B 1FI2A 5BXXA 3H1YA 2XLGA 4IETA 2UYBA 4Q0SA 2WFPA 5I0SA 3MZHA 1J58A 3KGZA 5F1RA 1O3SA 4ZU5A 3FX3A 5CU1A 4YYOA 2PTMA 1QXRA 4KWJA 1QY4A 4N9IA 4IEPA 1VR3A 5LRRA 2CAVA 3NL1A 1IPKA 3DL3A 5I0RA 3IBMA 5FPZA 3WW3A 4I0BA 3TNQA 4I09A 4XEZA 4XFHA 4EWDA 4HZFA 4EWAA 4EV0A 2IXIA 1O3QA 4BYYA 4PIZA 1OMIA 3B02A 3IIAA 4MGZE 5FQ0B 1CAWB 1J1LA 1X8EA 3BALA 5FPXA 4LLOA 4HSLA 2IXHA 3H7JA 4WVZA 1FT9A 4XETA 5HI0A 1Q43A 4UBGA 3H1MA 4EROA 3EJKA 1ZZBA 3FJSA 1YFYA 3DKWA 4QM8A 1X7NA 3SCHA 3D0JA 1XE8A 1RC6A 2UY8A 3FZ3A 3SXWA 1O3RA 1GQHA 3ST7A 5JAXA 4HVQA 3HT1A 1ZREA 1OFNA 1O7FA 3EO6A 3NVCA 4FAHA 5JSRA 4HMZA 1EPZA 2VECA 5KHIA 4IEWA 4B29A 3LA7A 2BGCA 2EA7A 2IXJA 4ONUA 2IXCA 2QCSB 5C8WA 3OF1A 2GC2A 3CJXA 5BPXA 2PQQA 4MV2A 4I0AA 3O14A 1NE4A 4F8AA 4QM9A 2EVXA 5JCTA 4MGKE 3BCWA 4XFFA 5CVRA 5FDBA 3KSCA 4XFGA 3RYPA 3ELNA 3TNPB 2XL9A 3HIFA 5BUVA 4YNIA 1ZX5A 2D93A 3E6DA 3RYKA 2PFWA 2B8MA 2OPKA 1EY2A 1PMIA 2ATFA 4RD7A 2Q4SA 4LUKA 4AVCA 1DZRA 1H1IA 1RGSA 3MYXA 3N4MA 1RL3A 3E5UA 1UW8A 5D1IA 3RNSA 1SQ4A 3H50A 4HBNA 1Q5OA 3CLPA 1IPJA 3UKNA 4QGLA 4UXAA 4IEQA 4KU8A 3E6BA 1L3JA 1SFNA 1ZZ6A 1RUNA 1ZZCA 2ET7A 3ZDSA 5KHJA 4IERA 5J3UA 4UBHA 3H1WA 4XF9A 4L11A 2QVSB 1O5LA 4I2OA 2BEOA 4O9GA 4AQ6A 1Y3TA 3E97A 3UKTA 1ZRRA 3ROUA 4YSFA 3OGJA 5JR7B 4IESA 4AQ2A 1O3TA 2C0ZA 3S7IA 1H1MA 4XF1A 3E5QA 4LTAA 4MZUA 2OA2A 4Z82A 5FLIA 1X8MA 2D40A 3G7DA 2H6CA 3H3UA 1O4TA 1ZRCA 4IEVA 2FMYA 2MNGA 4BHPA 3SHRA 1J3PA 2CGPA 1NE6A 2ETEA 4Q29A 3R6SA 4FAGA 3WW4A 1LR5A 5J48A 5KBFA 4MUVA 5E1RA 5E16A 5I0TA 4HN1A 3H8UA 2VQAA 2XL7A 5I8SA 1TQ5A 4MGYE 3LWCA 1ZRFA 3ES1A 4IEZA 4GULA 1XE7A 2XKPA 1VJ2A 3U0ZA 1XRUA 3PNAA 1CAVA 3H3ZA 2K9ZA 5LRSA 3BB6A 1NZCA 1YUDA 3EQEA 3LZZA 4R52A 3E6CC 4P9GA 3EHKA 4META 4PIXA 3NSTA 3I7DA 2FQPA 1HW5A 2WC2A 2OYZA 4QGMA 3NKTA 2IC1A 4D7SA 3IDCB 3OD0A 1I6XA 2Q1ZB 4E2QA 3UKVA 4E2SA 5BV6A 3LOIA 4HVRA 1ZZ9A 4Q0PA 2H0VA 3KCCA 4XFCA 3JZVA 4A2UA 4KWKA 2GC3A 4NVPA 4ZU4A 3GYDA 2XHKA 2XLAA 3OCPA 2N7GA 2QJVA 3BU7A 2BNNA 4I02A 4LUMA 2QDRA 2ZCWA 1YFXA 4QXKA 4HSJA 3D82A 4FT8A 1Y9QA 1UCXA 3ETQA 2B9UA 3NJZA 5K8SA 2OZJA 2EAAA 3HT2A 3D0SA 1GQGA 1CAXA 1CAUA 2UY9A 4PIYA 1OD5A 3FHIB 1EP0A 1RUOA 4JTOA 1J3QA 2BYVE 2GU9A 4ORFA 2OZ6A 4KWLA 4AVAA 4QMAA 2GC1A 3U11A 4BH9A 4MH0E 3VHRA 4EWEA 1WA4A 4IEYA 3RPQA 1J59A 3IWZA 2ZKLA 3ES4A 4HVOA 4IEXA 4LA3A 4N9HA 3CEWA 4XFIA 3MPBA 5JSOA 1OI6A 3CF6E 1YLLA 3FWEA 4XF4A 3M70A 3S7EA 1ZNPA 1X82A 1DZTA 3CL1A 1FXZA 5I8YA 3WW1A 3CO2A 2D5HA 1UIJA 5I0UA 4QGNA 3FE5A 1WLTA 2UYAA 3E5XA 4K8FA 4QX5A 4DINB 3QOPA 4F7ZA 2Z2SB 2QNKA 1YFUA 3USSA 2XLFA 3I59A 1NXMA 1RTVA 3KGLA
chains in the Genus database with same CATH superfamily
4AFCA 3GJBA 1QJU2 2H6BA 5FFOC 2E9QA 3RZZA 2JG9A 4J1XA 4D7TA 2A70A 1VBB1 3I2IA 1CWPA 4L8QA 2NMOA 3AX4A 1LB2A 3H9AA 2KM2A 3WLUA 4WZFA 4JGYA 1EV12 3VB9A 1XNKA 1SFPA 1SDDB 4XHXA 2V4VA 3O7OA 2A75A 3ZFGA 5LEKA 1W8OA 5BY5A 4FTBA 1B35A 1DYPA 2VOVA 3IDBB 4LORA 1JUHA 1PO23 2YFZA 1LECA 2ZX0A 2Z4FA 3TN93 4QKBA 1TMF2 2FDHA 4H14A 4AVBA 2UU8A 1ZYBA 2XXZA 4XF0A 2VXJA 1B09A 2XJVA 2GNDA 3K3NA 4CPBA 1SLCA 1JYXA 1V6LA 1OQEA 2HWC1 2JG8A 4PQQA 4XFAA 1LESA 4CU9A 2HWB1 1FAYA 4ISQA 4LOSA 4B1MA 5FQ0A 4RFRB 1CN1A 2A7AA 2Y6FA 4MX3A 4K7JA 2GNBA 4HETA 1SBDA 3KS7A 3WG1A 4I01A 3ZYFA 1BKZA 5A6QA 1WW6A 1SPPA 5FWEA 3FBMA 3Q8AA 1Z0HA 3KCYA 1PM7A 2YROA 1D7PM 4V1PA 5FP9A 4X8PA 4XMIA 4AVTA 3AK0A 4X6QB 4JHTA 4Q0UA 3ZSEA 5C6CA 4BMEA 2XWJB 1VBA2 4YM0A 4RR3C 1UXZA 2PA7A 2Y60A 1QJU3 2YU2A 4DUWA 4N53A 2EALA 3FUOA 5BNPA 1W6OB 2V73A 4P14A 3VZKA 3W20A 3AYEA 1L7QA 1W9TA 1Q3EA 2BWCA 1S0CA 1EV13 4Q1RA 3NJXA 2CYFA 4XJZA 3VBRB 5JPMB 4E2GA 3EBRA 5DZFA 2PLV2 4JVAA 4XMAA 1XSRA 4Y1YA 5GZCA 2VMGA 4PDWC 4UF0B 3I2KA 3TEYA 3I54A 1HJFA 4K8RB 2FCUA 1OLRA 5CADA 4QX1A 2ZHLA 4M0HA 3K4AA 2EXJA 2VUJA 1DQ0A 3ZYRA 1TMF3 4NRQA 3AZWA 3C7EA 2Q1MA 3IMNA 4XUQA 4AHWA 2W39A 2WFF1 2X8KA 1NY72 1G6NA 3K77A 1CPMA 2ET1A 3KQ4B 1W0NA 1JS9A 3AKTA 5A7NA 3VBRC 5C3QA 4K1ZA 1W6QA 3UYJA 4FPJA 1R64A 1S0BA 5FYHA 4AI9A 4MADA 4HK9A 1G86A 4YARA 4CYDA 4WM7B 3OPWA 1UMZA 1AR62 2Y33A 3NNLA 5C3RA 4QPYA 1ZVFA 3CJIB 5IVJA 1JODA 1VMFA 3N3HA 3KVAA 5FY5A 5DAQA 3T30A 1QWRA 2PAMA 4MSVA 3UNPA 2JE8A 3AYCA 3B5LB 3FLPA 3KV6A 1RHI2 1OSGA 3T09A 4E4SA 3RZGA 3IN9A 1HXS2 1QU0A 1VBA3 2D6OX 2VZ3A 1SLIA 5EP9A 4A3XA 5FZ7A 1U5ZA 3OEAA 2R041 2VUCA 3PLQA 4ZY9A 3S6PA 5F2SA 4OHWA 3SMHA 2VZVA 2W5FA 2R0HA 4JX0A 3CJIC 2KD7A 5CG9A 2NLRA 2R32A 3HD8B 4JV4A 5T3NA 1F5FA 1VP6A 1RYYA 4PI0A 4A42A 3FMGA 1WGPA 1BVP1 3HQXA 1GR3A 2XB6C 3N7MA 3NRUA 5FCCA 5FREA 3SH5A 4ARYA 3I49A 4P9XA 5FZ3A 2WN3A 1AYN1 1XPWA 3ETPA 1AR91 2Q0AA 2VMHA 4YW7A 2B45X 1GZ9A 1S2EA 1W9SA 4GJZA 1V6JA 1PZ7A 2IXKA 4S2HA 5DG2A 1FI2A 2R30A 3RWKX 1V6NA 3CZUA 3K51A 4Q2FA 3P1IA 3T2OA 2FD8A 3KWVA 3WNPA 5FY7A 3POIA 4IETA 1MS4A 4BISA 4LBLA 1NCRA 2P6CA 1HRV2 3L9JT 2XJUA 4HANA 4AF9A 4BIOA 4JGYB 1HQLA 1S0IA 2JD9A 1JN2P 4LJHA 4Q8LA 5DDJ2 1AR63 1ONAA 4RQPA 4ZS2A 2WS91 1QIQA 1QY4A 3FBYA 1EAH1 4N9IA 4P5YA 2CAVA 1LOFA 3HOBA 5I0RA 1JHJA 4GIQA 5FPZA 2A5ZA 2VBBA 3ZO0B 3K2OA 3WQ1A 1RHI3 5L19A 4L0PA 5FZMA 4XEZA 2D98A 2ARXA 2WT2A 3N9OA 4QHOA 4QX0A 2W87A 1QJY1 4QQPA 1QH7A 3ZDVA 1N1VA 1OUSA 1YI7A 2JG8B 1F9KA 2XDVA 4AFBA 2ADDA 5HCHA 1X9PA 4YW4A 1V9U2 1TZOA 1WLDA 1ZBE2 5FQ0B 2W1SA 3VGIA 4EE2A 1JYTA 1PNGA 2BFUL 1JMUB 1NLQA 5G05L 5A3TA 2YB7A 3UJQA 1R081 1MVQA 1UO9A 2D6LX 4V2VA 3GF6A 1PGW2 2A6VA 3J7MA 5LK5A 3UESA 1SPPB 5HXMA 5CKMA 5LA1A 3POWA 1CD3G 4XETA 1Q43A 4R9DA 1O59A 4CUGA 1S0FA 2Q8DA 1DBNA 1RUE1 2WNEA 4QHZA 5JDBA 1ENSA 4JKLA 4FXGB 1AVBA 3VKMA 4AZZA 1UOGA 2XG3A 2EICA 4TYSA 1X7NA 1GZWB 4D8MA 1OPMA 1XE8A 5BNPB 3DCQA 1HRV3 4D69A 5HCFA 3MUY1 5L9BA 4DOUA 5DDJ3 1KS4A 3SXWA 2ORXA 5HCBA 4DY5A 3D4KA 4Y20A 3HT1A 5T5PA 3ZR6A 3ZXLA 1OFNA 1YQ6A 1JUIA 3ZYBA 2W1WA 4FAHA 4YLZA 1FATA 2ZX1A 5FYSA 4NPLA 3LSDA 4JQRA 4N7IA 4W8JA 5L7OB 2J22A 2JKXA 2VECA 5KHIA 1NXD1 4B29A 4CUBA 4BZ4A 1W9WA 1QQP1 2VW1A 1OF4A 2BRTA 4IV3C 3HBKA 4UW5A 2QCSB 1K5MA 4Q4W2 4HKOA 1PGL2 1O8PA 5JIAA 4AG4A 4DO0A 1W6QB 1V9U3 3O14A 4QM9A 1ZBE3 4W6XA 3BU0A 2YC2A 4YWAA 4BCUA 4YG3A 1UNBA 2E7QA 5L7OC 4YVWA 1RMU2 4CCNA 3U4XA 1BXHA 2FZ1A 2IVIB 4ZS3A 5FDBA 1EUTA 4BQ4A 3ZKYA 3RYPA 1F5JA 3POSA 3TNPB 1Q56A 4XXAA 2C26A 3K48A 4K1YA 2ES3A 5FTTC 3A7QA 1JHNA 3A21A 2A6XA 2W1QA 3KT4A 1CZTA 1JXNA 1W6PA 5C71A 3RYKA 3MO4A 5FMDA 5CFCA 1JZ6A 2B8MA 2VMIA 3O0WA 4B7KA 1PMIA 1C57A 3SLIA 1JYVA 1MS9A 5JZGB 2X05A 3V0BA 2J1UA 4DXZA 3MIFA 3J7NA 5GLUA 1CPNA 2WZR2 3ZXDA 2WR9A 3QBQA 2CL2A 3HN1A 1H1IA 4BK5A 1N47A 2DVAA 2WO3A 2BJSA 4IV1A 3MYXA 3OGRA 2RJLA 4QAWA 1G9AA 2P3IA 4Y22B 5A3LA 4K40A 2AGSA 1JW6A 1Q5OA 3MIBA 3CLPA 4MHUA 4Y5Z0 5FYIA 1R1A2 4A44A 1C3HA 5JZGC 1L3JA 3QH6A 2OS2A 3UGHA 4IGOA 4Q4W3 2QKDA 4AL9A 2VOKA 3POEA 3M3EA 1UKGA 1NCRB 2PQSA 2JX9A 2TNFA 3LDKA 5KHJA 4AGRA 5J3UA 1ODMA 4GJYA 1RMU3 4NHLA 1AYM2 1Y43B 2WYSA 3EMRA 3FHQA 2DCKA 5GLVA 3DYPA 2JB8A 1OH3A 4L11A 1TME1 3AP7A 2KA3A 5ANNA 1VBA1 4AFAA 1NUKA 3JB4C 4ATFA 1Y3TA 2YXSA 3HBZA 4Q8KA 1UY2A 2WIIB 1UKRA 4R9AA 4AQ2A 4KGGA 1AJOA 2BU9A 4QX3A 3ZPOA 4YZ5A 3S7IA 5KWRA 1UOBA 1H1MA 3MI8A 3CDZB 3LEGA 3ZXKA 1LGBA 4LTAA 5FXZA 5L73A 1LU2A 4BB3A 3K3OA 3MFAA 4JAAA 3I3MA 1RJ8A 4COZA 5KC6A 3IIIA 2DVDA 3KV4A 4RFT0 3C7OA 2WZR3 4QQ2A 2FMYA 5GZDA 1W8ZA 3B9CA 1KFUL 1PGSA 2AREA 3SHRA 4BHPA 1J3PA 1WCKA 4LE4A 4Q29A 2ZAHA 4AK3A 1SZBA 5J1XA 1RVF2 1M06G 1LR5A 4XILA 3BODA 4QPGA 2E33A 2R071 4RSUA 5E1RA 4I3GA 4A45A 1LCLA 4M01A 3B9IA 4QKDA 5A3WA 5CISA 3GZTB 1SFYA 1R1A3 5C4WA 4CPBD 1H4GA 1RUG2 3SNMA 2ZACA 2R061 2VQTA 3ES1A 4TTGA 1QKQA 4IEZA 5CKQA 1LNSA 1ASJ1 4GULA 1I9RA 3OPZA 3U4SA 4A41A 3KF5A 3U0ZA 3WQ0A 1CAVA 1AYM3 1O4ZA 2X5IA 1RUH2 4RGAA 1GBGA 1NZCA 4JDOA 4R52A 4COVA 5GZGA 4XC9A 1K3IA 1VBC2 1ZM1A 5KXEA 5A6XA 3PUSA 4META 3VKLA 4PIXA 1A78A 1EPWA 1RUD2 2VVEA 4NHMA 3URFA 4CE8A 1XNBA 3K4ZA 1ENQA 2BVBA 5GJ6A 1UY1A 2OYZA 4C1XA 3AXDA 4NUBA 2RHPA 1BVVA 2Q5TA 1K5MB 2LROA 3HQUA 3LDRA 4BQ1A 4FOVA 1I6XA 1N3PA 4XJAA 1BBT3 2RMU2 4NIHA 3WDWA 2VCAA 2W9XA 3MPPG 3OY8A 1V6IA 4Z1VA 5BV6A 4HVRA 4Q0PA 3WQBA 4OI2A 1YQCA 1MZ6A 3GZAA 1VBE1 4FP2A 4QDRA 2RS12 4YVWB 1S0EA 1UMHA 4JGZA 2G9FA 1OOPA 5ERLA 1NLRA 5F37A 1RVF3 4IQPA 3J8F2 2WJSA 2Y38A 3ZOIA 2VZUA 4BPZA 3O1PA 3GNEA 3VDDC 2VOXA 4OI0A 3AZYA 1DQ1A 2N7GA 1UX6A 1GOHA 4UFIA 3O12A 1HRV1 2BNNA 1XNAA 2HEYF 4AYUA 4EN6B 4LLFA 2J1AA 1VMJA 3DPRA 3NMBA 1SCSA 5DDJ1 4CDUB 1G8WA 4FT8A 4W6WA 1VB4A 2HWD1 4R9BA 5K8SA 1BJQA 1SDWA 4AOCA 1JZ5A 5FYVA 2ZJCA 1F35A 3LSEA 4FO9A 1CAXA 1CAUA 2UY9A 1IS5A 2PHWA 3VLBB 4ATEA 5FKCA 1OD5A 1RUH3 2DFBA 1KQRA 2UWBA 3LIHA 4AHYA 4HONA 2Q1FA 3AZZA 2WNVC 4YVSA 4LK7A 1VBC3 2BYVE 1AX1A 2ZEYA 3M4FA 4GH4A 4ORFA 4OI1A 2VMFA 3WDUA 5DN2A 3B94A 4PHZA 4AGVA 1W8TA 2ZGUA 3I2GA 4CDUC 3U11A 2VZOA 2VM9A 3MBWA 3ACGA 1JZ4A 1H9WA 3VHOA 2CDPA 4OULA 4SLIA 5IVYA 3TBDA 2RDNA 3ZR5A 2RMU3 3AMNA 4QHBA 5ABJA 2BGOA 1AZDA 3MF6A 1FPN2 1O6UA 4FQZA 3WEZA 3R0RA 1YI9A 5BNOA 2RS13 1QNWA 2BZDA 4H2AA 4C8DA 3J8F3 5A7QA 4CCOA 3FWEA 2YY1A 5FZ1A 1WLCA 4XF4A 1ZNPA 5EYXA 1CR7A 1X82A 1VALA 4XJ9A 3WNOA 4L99A 3PL0A 3CKHA 1OBNA 1TG7A 2UURA 3BVCA 2VVFA 1PIV2 4AFDA 2D5HA 1OA2A 1LGNA 3C7GA 2JIGA 2UYAA 4K8FA 5KR7A 1H6YA 4DINB 3QOPA 2E31A 2R0FA 3I2DA 1S1AA 3I2HA 4BDVB 4LNVA 3USUA 2C1FA 2BTVC 1VRH1 3GJAA 4FPLA 4GWMA 4GA9A 1VAVA 2QNKA 1YFUA 1GKBA 3I59A 5B4NA 4C0BA 3RZKA 1RTVA 4Q4Y2 1H2MA 4QPGB 1OPOA 5M0TA 3WD5A 2VW0A 3OPTA 3ZN5A 4GWNA 4D94A 2X09A 2I74A 2BBAA 2WN2A 5AVAA 1EYBA 2VTFA 3Q8BA 2OVUA 4BQXA 2GZWA 4Q26A 4NROA 4XAAA 3RZJA 1UZVA 3MLKA 2VQ0A 1VB2A 1PVXA 2RS32 2QQPA 5LBFA 4IEOA 1FPN3 1QOTA 2ZGMA 4Z07A 5ISLA 3L2HA 4QQLA 3OTFA 4IEUA 4HLTA 1WUVA 1CAVB 3AMHA 3LGRA 4LULA 1H9PA 5I8TA 3N9PA 3OG2A 1ENRA 1IG0A 5FY9A 5I91A 2V4AA 2HWE1 1LU1A 2Q30A 3AP9A 5C3PA 1AL22 3U10A 1CAWA 4KU7A 5J7MA 4F3JA 3C3VA 3KMHA 2Y0IA 2ZHNA 5AFEA 1JZ3A 1PIV3 1UPIA 2WZR1 4RR3A 3HNMA 2BFUS 3PMSA 4K20A 1RUF2 2DURA 2WT0A 1DQ2A 1ALYA 3Q8CA 4HN0A 4YW6A 3RDIA 4GQ7A 4BOWA 1UD1A 3KD4A 5JXGA 3OY8B 2E32A 1DLCA 4NPRA 3WDXA 4P9JA 1XC6A 4NOTA 2C6SA 1NOVA 1N1YA 1VBD2 4SBVA 4BQ2A 2W47A 1HV0A 1T2XA 3DYMA 5AVPA 2OUHA 1QXPA 2XONA 1KDMA 2YBSA 2P34A 5T55A 4PDWA 2QQJA 5K7PA 3MLLA 3PDQA 4PF1A 2DF7A 4Q4X1 3MICA 2RS51 2C9KA 1Y7BA 2JIJA 5I0DA 1K42A 2JEMA 4QD2A 2WINB 1O5UA 2WLPA 5AC92 1AYM1 4Q4V1 4XJ8A 2RS33 2BNMA 3VBRA 3RJRA 1POV0 1DF0A 5FPBA 5EZWA 1W8FA 4TLFA 1BYHA 3AB0A 3ZX7A 1CAXB 1CAUB 5FLHA 3DEMA 2XQXA 3ZPYA 1R092 5I93A 1QF3A 4JHZA 4XTPA 3BTYA 4ZU7A 1GP5A 1MZEA 4P9YA 1LKNA 4MLOA 1ZZ7A 4AEDC 3T4HB 1KGYA 3O0VA 3ZIWA 1ZRDA 2O1QA 1AL23 1XXNA 2VGDA 4GMP0 1BBT1 2HKXA 1DYOA 2FCTA 5JLVA 1PHMA 1NYWA 1RUF3 1W05A 2AENA 5FUPA 1SEFA 3L2YA 3AC0A 1RVF1 2D6PA 3RMYA 5ABJB 5C3SA 1HRI2 1SLLA 3JU9A 1DCSA 1ULDA 1YNAA 2GH2A 3CJIA 1VBD3 5CAZA 1OKQA 1U5IA 2LW8A 2VVDA 4JTNA 1LEMA 3WP4A 4M3CF 3WW2A 1E5SA 3NV1A 1GSLA 1AX0A 1JOBA 3M3IA 1QGLA 2OT7A 1XU2A 3PURA 1C28A 2K0GA 3SCGA 3MDPA 1OURA 1RXGA 4BIFA 4XXPA 5J96B 4QKFA 5LEJA 3U1XA 1REEA 3ZN4A 3NWKA 3OBTA 1GFF2 2KR2A 3DN7A 4I3PA 3VDBA 4RS5C 4QU2A 5FMBA 1UIKA 4OYUA 5JI7A 3SQOA 3WX5A 4LBMA 4MGTA 2DYCA 4MGIE 2V09A 1VBC1 3LA2A 1YJKA 4LBNA 5IJRA 3MIDA 3USUB 1QOOA 4KL1A 1HQNA 2K46A 2VUAA 4PJYA 4HL0A 1R093 2XVGA 4WVWA 4BMBA 3T2QA 3I59B 5FP4A 4CP9B 4PF5A 2ADEA 1W04A 4AGGA 3H1YA 5C70A 2VCBA 2HEWF 3RG0A 5FOBB 5JI9A 5I0SA 2WFPA 1FOD1 3DECA 3HQRA 1W6MA 2JDUA 1O91A 2RDQA 4I0WB 4AAXA 4AI1A 4B4PA 5C5TA 5JXIA 1SMVA 4JRAA 3GGLA 4NIAA 3VL8A 3NNFA 1GYKA 3OUHA 2QQIA 2RS11 5DZEA 4OUMA 2VZTA 3RZLA 1AR72 5LRRA 1IPKA 3DL3A 1HRI3 2F6BA 3TNQA 1L7LA 2IFWA 1JYNA 5BNNB 5FZ4A 3GBGA 3BTXA 1OFSA 4UWDA 5DUVA 4HZFA 3IB3A 2IXIA 5F7UA 5F5QA 2XUEA 1OF3A 2JDHA 4BYYA 2P2KA 4PIZA 1OMIA 3BGAA 5FAXA 5A7WB 2MEV1 3IIAA 4DRRA 2JKBA 4MGZE 4QB1A 2BUKA 1CAWB 3AFKA 2HWF1 4H3WA 2Y8KA 2ZBJA 3JQWA 3OUJA 3VD4A 1DFQA 1W99A 1BCXA 1YIFA 2YHJA 3OGVA 1UZZA 5A6ZA 5FPXA 4FTEA 3AYAA 4RR3B 5BNNC 2CDOA 5GZEA 1A8MA 2QBXA 1IHMA 3AP6A 2DU1A 3J4UH 3UGFA 2DDUA 2VMDA 2VE1A 5HI0A 3RGBA 4IE0A 3T1MA 2BGPA 1UZWA 5FZOA 4CDWC 3EJKA 2ZGRA 1BMV2 1ZZBA 3M7AA 4FFIA 2DVGA 3VD9A 4PDWB 1NA1C 2RVAA 2ZMKA 4FPEA 2RM23 3SCHA 2P5BA 3D0JA 5F3EA 3ZYPA 3NO8A 4BWOA 5C33A 3WINE 1UL9A 1RC6A 3WNKA 1C8NA 3OOXA 3CQOA 2UY8A 2GDFA 1IZ3A 1IGOA 1GZWA 2VG9A 3WR0A 1QOSA 4G3YC 4XHBA 1Z7S1 2RR12 1GQHA 2DUQA 3ST7A 4IV3A 3IAQA 2NP0A 1ZREA 4Y5SA 1AR73 1WBFA 3NVCA 5FJHA 3ZFFB 5JSRA 3GCWA 4A6SA 2JECA 3G6JB 4GB32 3ASIA 4HMZA 1VAKA 4AE2A 2OQ7A 4CCDA 2J1VA 4QWNA 1EPZA 3T0BA 2W08A 5F8PA 5FZHA 3VZJA 1C5HA 2IZWA 5L7OA 2DVFA 4KI5M 4ISRA 1QJFA 2VC9A 4ONUA 3BUCA 3N9MA 2ZMLA 2IXCA 1DGWX 3PVEA 1WD3A 3CJXA 2XJTA 4YGCA 4GKYA 3S5AA 1C4RA 3O1UA 2DBNA 1RUJ2 2EVXA 4AHXA 4D6RA 3ZFFC 1OLQA 1CESA 3BCWA 2Y6JA 4XFFA 2WWSA 1SLBA 4MGQA 3KSCA 3WG4A 2OX0A 4XFGA 3UK9A 4Q27A 4ZHNA 1ULPA 3ELNA 2XL9A 1KEXA 4BA6A 5ACA1 1QNYA 1HKDA 4AQTA 2E63A 4OUSA 4Z92B 2PELA 5GALA 2D93A 1FMD2 1WZXA 5GLZA 3E6DA 2ZPXA 3ILFA 4MYEA 2PFWA 4XBNA 3ZSJA 2AEZA 1QJX1 3O0XA 1RUI1 5LWBA 1EY2A 5FY0A 2Q4SA 2RS31 1LULA 2VQUA 1DIWA 3AVRA 4DUXA 3LPGA 3JD72 3ZYJB 4AVCA 2JDPA 2X29A 3ECQA 2RR13 1PO12 4RHV2 5JZGA 2HBTA 4GXLA 4TWTA 4B8EA 3BIEA 5IVVA 1RGSA 4ZONA 3N4MA 2VZQA 1RL3A 1WW5A 4NAMA 1UW8A 3N7JA 2PLV3 1SQ4A 4KGQA 1XNCA 2WA4A 4EN9B 3VZNA 1IPJA 4Y22A 4CP1A 5T54A 3UKNA 3CIHA 1M4WA 1NZIA 3NQHA 4IEQA 4KU8A 4LHSA 4EZHA 5C9AC 4N43C 1SFNA 2W1UA 4KWUA 2YU1A 4LKSA 5FYTA 5FK7A 1LEDA 3APBA 5A70A 2R1DA 1RUJ3 1COV2 4RYDA 2WZPP 1W6MB 5JOYA 2FBEA 3BTZA 4UBHA 3RFRA 3LEIA 4JCKA 4N8MA 4URTA 1KJRA 2IVJA 1VBD1 4NIGA 4P00B 2G9GA 1CZVA 1UAIA 1FNZA 2QVSB 1Q8OA 3P3PA 4BU2A 2P3KA 4O9GA 3TEWA 3E97A 3ZYIB 1AR81 4KBZA 3ACIA 1RUC2 1FMD3 1IQDC 3ROUA 4L9BA 3ZXEA 4ET7A 3C2UA 3GXUA 3N7LA 4YSFA 3KB5A 3WNLA 5D21A 1O3TA 2C0ZA 4CEWB 5FO8B 2YG0A 1N1TA 1UQXA 3E5QA 5C5UA 1HXS3 1C1FA 1H2NA 2ZX4A 1PMHX 5F5IA 2D40A 3JD73 3THDA 1AXZA 3SC7X 1ODNA 4RHV3 1PO13 1H8TB 2W2IA 1YRZA 3WVJA 2MNGA 4CDQB 1GQPA 4YM1A 4PI2A 3T1LA 3KT1A 1W2OA 3WW4A 4NHXA 1BLZA 4CEWC 1W2TA 1W8WA 1H0BA 4W65A 3WHUA 5A1FA 1A8DA 1WMDA 3H8UA 1JZ2A 4ZZ5A 4LBQA 1FV2A 2ENRA 5FMOS 2V72A 3BKZA 4YPJA 2VQAA 5FZOB 2ZXQA 4M3CE 3MV11 2CWMA 3GALA 1C8M2 1ZRFA 4DEQA 3JCIA 3WG2A 1H8TC 1UYPA 4CDQC 2WL1A 1COV3 1E5HA 1XE7A 2XKPA 3WT3A 1XRUA 3LFIA 1J84A 2B7YA 3GBWA 4U2AA 2K9ZA 5IVFA 1G9DA 1POV3 4IV3B 1YUDA 2QQVA 3EQEA 3LZZA 1PO21 4K21A 3SKJE 3TN91 1IPSA 3EHKA 2VL4A 3IDAA 4LO8A 2XBO2 2NPIA 3MGUA 1RUC3 3VKNA 2A6WA 4YGDA 3W59A 3MF9A 1W28A 2ZA9A 4QGMA 2OIIA 1S55A 4CCKA 3W5MA 3O1TA 1BK1A 2R7EB 4IE4A 4DY3A 3IDCB 2C4XA 3JBG2 3PUHA 2VUDA 5GZFA 3TAYA 4PLOA 3IT8A 2Q1ZB 5E8AA 4BQWA 4TZDA 4CRQA 1UN1A 4MOAA 3UGGA 3VDDA 1TNFA 3LOIA 3DYOA 3F2ZA 3BPSA 4XFCA 2WA3A 2WUHA 5FXXA 4KWKA 4UW6A 2DCJA 2JJ6A 3V65A 5EWSA 2XHKA 4Q1PA 3C8XA 5FK8A 4FXKB 5LATA 3VBHC 3B69A 3JB8A 3T2PA 3IPVB 3N7KA 3LQCA 3OBZA 1QMJA 1W39A 4FFGA 5K9YA 2RM21 3AKQA 3OBRA 4V2WA 3TB0A 3FUQA 2D44A 1YQ5A 5DAPA 1QJU1 4FPFA 4Y1UA 1W2NA 1C8M3 2D6MA 2NMNA 2VZPA 3ME2A 2WNVA 4HSJA 3D82A 4B3NA 1FYUA 3P5BA 1Y9QA 1UCXA 1HN1A 2B9UA 2P1BA 2SLIA 4CUAA 3O1SA 3AMQA 1EV11 3LEMA 5A1AA 4CDUA 1GQGA 4H55A 5FY4A 3O1MA 4H7MA 4NMIA 4JTOA 5JMOA 1Q8PA 5HV0A 2PMWB 1X33A 4CTEA 2J1RA 2JXAA 1TMF1 2XBO3 4AVAA 5C3OA 5IVCA 3ZLIA 1BHGA 4EWDA 4BH9A 4MH0E 1VPHA 3LF7A 1XJAA 4B1LA 5DUXA 1WA4A 2DU0A 1J59A 3JBG3 3EXUA 1PNFA 4HVOA 4LA3A 5L36A 1V00A 3CEWA 3POYA 1HIXA 2E26A 1WCQA 1MACA 5FZAA 2DVBA 4OHVA 5DG1A 2W0XA 1QEXA 2DUPA 4GWJA 1ND3B 1OI6A 5IVEA 1YLLA 3TEXA 3PJQA 4FPKA 5EIYB 2YZ4A 3S7EA 1F15A 1YO8A 1FX5A 3DUIA 3FL7A 1DZTA 3CL1A 5IYYA 3MHZA 1W0OA 1ULCA 4NO4A 1FXZA 5I8YA 3AKPA 3HWJA 1GU3A 4UW3A 5FV3A 4XTMA 2D3PA 4CU8A 4COWA 3W5NA 1ND3C 1VIWB 1UXXX 3BIWE 4Y5TA 1IKPA 4BXFA 1DG6A 2IWGB 2PLV1 4YW2A 1WMFA 4ZZ8A 4LOTA 3ABZA 2YBPA 3D8CA 3HJRA 2VNVA 2WNOA 1K45A 4YM2A 3PUIA 1U12A 4XF3A 4AI0A 4NN0A 2P4EA 2ERFA 4YGBA 1N1SA 3SH3A 4YZ1A 1NY71 4LBQB 1RUJ1 2MPFA 4C90A 4Q0QA 4NRPA 4BQYA 2D43A 4EN7B 3JQXA 1C1LA 3VD3A 2W92A 4CP0A 4WBBA 2BNOA 2XUMA 3W21A 2HJIA 1AR61 3R05A 1CIYA 4FOYA 2GALA 2XHNA 4KH9A 3JUUA 1FMD1 3TOJA 3VDCA 1GP4A 4P5HA 4PCRA 3VUOA 2C24A 3MFCA 1DGLA 1OQDA 1ZRIA 1RHI1 3DV8A 4YW5A 4LMFA 4XUTA 1OA3A 1HXS1 3VHNA 2CAUA 1PK6B 2PHLA 4CCLA 1KRIA 1HQWA 4OLLA 1J3RA 1LGCA 2B4KA 4A7KA 2NN8A 1CJDA 1KFXL 2BOIA 2ILMA 5L9VA 4YRDA 1TEIA 3FLRA 5CB7A 4PBOA 3VDDB 1ULOA 2W52A 3HEIA 3K75B 1ST8A 1OA4A 3N9NA 5F3IA 4XVHA 1LRHA 1UU5A 4I30A 1JYIA 1TNRA 1YFWA 2Z69A 3AZXA 1SG3A 1PK6C 1R1ZA 3CBNA 4HT1T 1ND2B 5FYBA 5FP7A 2I45A 2PAKA 4UFLA 5FR3A 2GNMA 1MEC2 2WZ8A 1VE0A 2D5FA 3H7YA 4LBOA 4LKFA 3PJYA 3FFQA 1WD4A 3ACLA 1RIRA 2JDAA 3FLTA 2PXJA 3KCXA 1UYXA 3MV01 3QACA 3NAPC 5CZKA 4BK4A 4X6RB 4DXTA 1JZ7A 4LT5A 2DCTA 3CNAA 4FBFA 1UZYA 2W94A 4GKXA 1XOYA 4XQWA 4M00A 4YGEA 2WNVB 4P9WA 3RYRA 4CXXA 5F39A 3U78A 4AHZA 1NLSA 2PN5A 4E27A 4AEDA 1UOJA 1POQA 5FZDA 1RUG3 1ZBA2 1D2QA 1ND2C 2BP6A 3D6EA 3K46A 3I2FA 2R16A 1VBB2 5CKNA 3VZLA 3WDVA 3LCPA 3WY6A 1W6NB 2CY6A 2EXIA 1OD3A 5G04L 2XKOA 4A7YA 1S0JA 2VZRA 4COYA 2O8QA 4M4PA 3LPFA 3I8TA 1HB3A 4XFBA 3INAA 2V5YA 2ZHMA 1RUD3 5EPAA 4YG6A 2JENA 1HDKA 3B7MA 1XNTA 3RS6A 4N90A 3KV5A 1V9U1 1ZBE1 4CCCA 2YYOA 5D8AC 2HWC2 1LODA 3CZJA 1AF9A 3AM2A 4QX7A 1ACCA 1VRBA 1PGW1 3OD4A 1E5IA 4HOOA 5A80A 2HWB2 5FZ8A 4CXWA 3GBFA 4QPIB 1J83A 4COUA 4RS5A 3H42B 4LEJA 1MEC3 2YPJA 1QXJA 2HYXA 4FQ4A 4J25A 4PLMA 4CU7A 2B5HA 2V5DA 3H3LA 4L2NA 4AXOA 2J1EA 1GLHA 3N9LA 4JQTA 5E6HA 5EFUA 1D2SA 1YWKA 2ID4A 4S2DA 3V64A 4Q0VA 4BLIA 5IK8A 4R4ZA 3WOGA 2Y6GA 3SH4A 2VCCA 1OQ1A 1SCRA 4P9IA 4EN8B 4QXBA 1XQNA 1XYPA 4O7XA 4HK8A 1I1EA 2XJQA 3OEBA 4XYXA 4QPIC 4FTSA 1ZBA3 3I4IA 5A3MA 3AYDA 4C91A 1RITA 5F5AA 2XBO1 2P17A 4JZRA 1VBB3 5AFBA 2MHFA 4Y1XA 1PZ9A 1I3HA 3ZXJA 1GV9A 5BXXA 1YIPA 3VKOA 3JBG1 5E89A 1PVC2 4XDQA 5A33B 4CP9A 3MZHA 4E8DA 3KGZA 1O3SA 1OT5A 3VBFB 1JYWA 2QE3A 4Q4W1 3H8OA 1UY3A 3B3QE 1PGL1 1LHUA 5CU1A 4G4FA 4LR4A 2OKXA 4YW1A 1QXRA 2HH9A 3T2TA 4KWJA 3AFGA 3M3OA 2VNRA 1UF2C 4XJWA 2VAUA 2RDRA 5DABA 4UAPA 1RMU1 2HWC3 3IBMA 4JKMA 4OZOA 1YXWA 3VBOB 5CFDB 3OGGA 2HWB3 2Y34A 3M3QA 1MS3A 4I09A 2QZ3A 3ACFA 2B46X 4URAA 1DGRN 4EWAA 2VCMA 4LHLA 3VBFC 5BNNA 1O3QA 3UV9A 2ZKNA 2EIEA 2JDMA 3FC0A 3B02A 3M8LA 3H8XA 4FSJA 4OUEA 5FZ9A 3X29B 4OHZA 1J1LA 5A7WA 1XNDA 1JBCA 1X8EA 4CDWA 2GSYA 3VBOC 1OLMA 5CFDC 4LLOA 4HSLA 1OC1A 2IXHA 4C0HA 1LHNA 5J36A 3H7JA 2AACA 1GWLA 1NA1A 5FY1A 4QU1A 3JXSA 1FT9A 4AQSA 2FDFA 1U5YA 4EROA 3H1MA 1WMXA 2YV8A 4XUNA 2R042 3WF0A 1JZ8A 4PT6A 2WABA 3WSOA 1YFYA 5HV4A 1QJEA 1OVSA 2A71A 1DYKA 4HXCA 4QX8A 4CEYB 3B00A 1PVC3 2VZ1A 2EXHA 3ON7A 4OZXA 2WNUC 2ARCA 4XUOA 1PM4A 4S2GA 5LK7B 1R1A1 4Q4Y3 3VBUC 4PQ9A 1OVPA 1PMJX 1AYN2 3BI3A 1AR92 1CX1A 1O3RA 3LEKA 5JAXA 1MZFA 3HMYA 4HVQA 1O7FA 2EXKA 2WQ4A 1LJ7A 2L9LA 2XJRA 4WV8A 3WDYA 3FFZA 1PX4A 4AEDB 4QB2A 1X9TA 2BOJA 2J1SA 3I3QA 5FRAA 3HPNA 4LXLA 4CEYC 3ZFFA 4OCTA 2EA7A 2OQ6A 4GZ9A 1LAJA 2IXJA 3ZFEB 4NIDA 3AKRA 2QQUA 3ENRA 1S2KA 2EAKA 5C8WA 2JDZA 1F2NA 1A3KA 3DGTA 2PQQA 2VO5A 3BOWA 4I0AA 3W58A 2P3JA 1NE4A 2WS92 4MXWA 3WUCA 5F6KA 2PHTA 1VMHA 5LA2A 2WYFA 5JCTA 2VTXJ 1EAH2 4MGKE 1LOCA 4Z8BA 4ZPIA 2LS6A 2PHRA 2Z42A 4UFKA 5CVRA 4QXHA 2VW2A 1AXYA 2ZEWA 2OUJA 2WWJA 3DXTA 1QDOA 2WO2A 3ITQA 3ZFEC 3TRSB 4DIQA 1QJY2 2YMZA 3RMXA 3VBSC 4YNIA 3VHPA 4JDMA 4NWVA 2R043 3QLQA 2SBAA 2Q8EA 4AEMA 4NJ4A 5E88A 4BQ5A 5DQ0A 2WO7A 4RS5B 2A6YA 4LO6B 1WLWA 4QDQA 4JDNA 3AP4A 1W8HA 4N7UA 5F32A 1UMIA 1R082 2QFEA 1MPXA 1FNYA 1F31A 4WM8B 4LUKA 4R4XA 1H8VA 1AYN3 1AR93 1RUG1 5A3OA 1AX2A 4BQ3A 3IDEA 2RE9A 4Y33A 3WQ7A 4DUVA 4XCBA 1DZRA 5C9AA 1MS0A 1U5XA 5KXDA 1GWMA 4LK6A 4N43A 4YZ3A 3GDBA 2VY0A 1RUE2 2ZTNA 3E5UA 5AC93 5K0UC 4A4AA 1V6OA 2AUYA 3RNSA 5IT6A 5LBBA 1RUH1 2ZGQA 3HAGA 3POBA 5A7OA 3H50A 2FMDA 4MXVA 2LALA 1HX6A 4QGLA 2ZAAA 4UXAA 4WM8C 1GICA 3E6BA 4S2FA 1RUD1 1V6KA 4LPLA 5F3CA 4YM3A 1RUNA 1Q8QA 3AMPA 1XU1A 2WS93 5DAWA 1DHKB 2ET7A 3GM8A 1EAH3 1PZ8A 2HLEA 3O1RA 4IERA 1DP0A 3H1WA 5FXWA 2RMU1 4RGGA 4TSVA 3DF0A 1AJKA 4FFHA 5JOZA 1HB1A 1QQP2 3U14A 3WNNA 2GN3A 1QJY3 5B4XA 4AQ6A 4E4ZA 5K4LA 2WT1A 4E4HA 1NX9A 1ZRRA 3J8F1 2Z79A 2RG4A 4IESA 4XURA 1ZA4A 4YFWA 4DPNA 5IATA 4XF1A 1IOAA 4NHKA 2DBIA 1R083 4MZUA 5LZ6A 1XE0A 4CEWA 4XIKA 5FLIA 2BERA 2ZOEB 1X8MA 3OSDA 4XDPA 2FZ2A 2H6CA 1O4TA 3J7LA 1ZRCA 3SITA 4IEVA 4CDWB 3A22A 3E1F1 1JTZX 3LFMA 2NM1A 4IXLA 1HJGA 1TE1B 1RUE3 2VXRA 1V6MA 2ZHKA 4HPKB 3R6SA 1WW4A 3WXPA 1H8TA 4J6GA 1NA1B 1REDA 1YQ2A 1GANA 4MUVA 4CDQA 5E16A 5I0TA 3V0AA 4HN1A 3HN3A 1XSQA 1YEWA 3ZKUA 4G9SB 3ALQA 2CWSA 5T5JA 5TSWA 3C7FA 5GLTA 3KQRA 1DDLA 2XL7A 5JMCA 3VV1A 4IGPA 4UI9L 4CA9A 4DQAA 5SV5A 2A6ZA 3LWCA 5C7GA 1IQAA 1REFA 1LHVA 4UYBA 4EJRA 2IFRA 3WV6A 2XR4A 1A6CA 1VJ2A 2UWCA 3POGA 2BVVA 1MVEA 3PNAA 2WO1A 3H3ZA 4LHNA 1WKYA 2VU9A 2B42B 3BB6A 3BTAA 4FPGA 4B4RA 2W3JA 5FMCA 2XPJA 1ZA7A 1FPN1 2GNTA 3A0NA 1QQP3 4GAZA 1UY4A 4P9GA 3HR9A 1W0PA 4AFMA 3E6CC 3CHXA 1W8NA 5JWPA 2NYYA 3AL6A 2GH8A 2NQYA 3NSTA 5A32A 2FQPA 4XZUG 5LY2A 2QZ2A 4DXSA 5FYCA 3NKTA 3ACHA 2HBUA 1UU6A 4D7SA 3UETA 3VBHA 1RB8G 4IDZA 5LBEA 4MXWB 3PHMA 1TME2 3VN4A 3MEPA 4CCMA 1PIV1 2YC0A 5F3GA 3WF2A 1W3VA 3QCWA 2H0VA 5FYUA 4ZXKA 4LIUA 2XH6A 3KCCA 3JZVA 4A3ZA 4ES9A 1MS8A 5LBCA 2AYHA 5JUVA 1LTEA 5IW0A 5F6LB 4AI2A 4TLGA 3MW2A 4IUGA 2LRPA 3OCPA 4W4ZA 1BEV2 3WCRA 5CBLA 1N3OA 1PVC1 2DUOA 2YC4A 3OUIA 1K12A 4HKWA 1DQ6A 1G9FA 3IPVA 5JXHA 4Q4Y1 4I02A 4UW4A 2QDRA 4UOJA 1YFXA 2BWAA 5FJKA 2JB4A 5FYMA 4DZGA 5D2AA 1KJLA 3ETQA 5A3UA 1CVNA 3NJZA 1YYNA 3DKQA 1Z78A 4D6SA 5LCWL 2OZJA 4CZSA 2EAAA 3D0SA 2D3SA 4PIYA 1S0DA 2R072 3PUQA 4CDXB 5EQUA 1UOFA 2WSVA 3GZUC 1QHDA 1NCQA 4EQVA 5C9AB 5CIRA 1GZCA 2B9VA 4N43B 4LO7A 1ULFA 2CHHA 5FZFA 1AUYA 4L97A 4A7ZA 1UX7A 4D6QA 1CIWA 2OZ6A 2J42A 4KWLA 2GP3A 5FZIA 1DQ4A 2FDJA 2R062 2XOMA 4OMCA 2ZZJA 1UWWA 4GB33 4LQRA 1ASJ2 3S30A 4Q5OA 3O5SA 4NHYA 2VOTA 4MVTA 3VHRA 5IVBA 4UT5A 2BQPA 4CSWA 4XPVA 4QT6A 3RPQA 4EWEA 2JDYA 2ZKLA 1RXFA 3ES4A 3OJBA 1UPSA 4CDXC 1AHSA 4Z2WA 1AL21 4XDOA 1XYNA 4FPHA 4N9HA 2CNAA 4XFIA 1F4AA 1ULEA 1TME3 3SEEA 4AAPA 4ARXA 4O61A 1CQ9A 3KHBA 3D3AA 3MPBA 5FZBA 3ZSKA 2ZX3A 1RUF1 3ILNA 4XIOA 4AI8A 4WM7C 1JU4A 1SLTA 2DTWA 3AP5A 3CF6E 4LKEA 1X50A 2IUWA 4CXYA 2R6QA 1OKOA 3J9SA 2A3XA 1W3XA 2WDBA 3LKJA 1DZQA 3M70A 1BEV3 4NE9A 3UT0A 1ND3A 2AR6A 2HEVF 2VR4A 4BM8A 4NR1A 4TN7A 5H9SA 5C8CB 3A23A 1RINA 2XJSA 3VL9A 4YFZA 4CU6A 3WW1A 3NNGA 1RJ7A 2VJXA 3F95A 4AVSA 4CCJA 4B7EA 1KD7A 1VBE2 2P37A 1URXA 1WBLA 4QGNA 5I0UA 1WLTA 3R4UA 3SKVA 3N35A 1AXKA 3B01A 2LTNA 3PUAA 4OMDA 4AR2A 1NQJA 3T3YA 1BQPA 5AC91 1WW7A 2R073 4F7ZA 2AC1A 2JG9B 2J1TA 2XLFA 5C8CC 5F2WA 1VR3A 3KGLA 2ZGTA 5DZGA 3RJ2X 3LOBA 3LAGA 3V0AB 5KHHA 1U0AA 2A1XA 1R091 2R063 1CX4A 1W2AX 3PVOA 4LO4B 2G19A 1X36A 1ASJ3 1SBFA 5H9RA 3WNMA 4ZXEA 2HWD2 2Z5WA 3ZFGB 5CEHA 1KS5A 1Y4WA 1H2KA 3VZMA 1B35B 2UWAA 3POJA 5CA6A 5BNQA 1YHFA 2EIDA 1TVGA 4YG0A 2JG9C 1ULGA 2F4PA 4XQ4A 5FYZA 3FN9A 4JGYC 5A1LA 3CMGA 4NRMA 3UL2A 4XAEA 2W95A 5DPNA 1HRI1 5FO7B 4FVVA 3ZFGC 5JSPA 1B35C 3N36A 5F5CA 2XJPA 2DCZA 5A32B 5HCAA 2PHDA 2O8OA 1APNA 1LHWA 2TEPA 2Q8CA 1T6GC 5FUNA 1QDCA 3SEPA 1OXCA 3SCFA 4OQ8A 5KHKA 1VBE3 2CSGA 3RRDA 1DGRA 1I5ZA 1PK6A 2JG8C 1S0GA 3VBHB 2D7FA 2GAUA 3BOPA 3BPZA 3K4DA 4OQ9A 1ZZ8A 2VBPA 2CV6A 1V70A 3NW4A 3NAPA 4GMP3 2BDRA 4P02B 5IUQA 4N53B 3NKGA 2ZGLA 2I07B 2CGNA 1W9FA 3IAPA 1O4YA 3LIGA 3S0MA 2XGXA 3KV9A 2A3WA 1HB4A 2W46A 3KVBA 5DAVA 5KHGA 3VD5A 2PHFA 5SV8A 3M3CA 1ND2A 3GZEA 2PAEA 4XOGA 5FPLA 1MS1A 1W9YA 2HWD3 5FY8A 1DGWA 2TUNA 2Y0OA 1LOBA 2E53A 1NAEA 3EYPA 5IK7A 1VRH2 2C9AA 4N53C 1WMEA 1F8VA 5BYNA 5FBZA 3LD8A 5BNPC 3Q8FA 3WG3A 5H9QA 3GHNA 3PVBB 2CU5A 2PYTA 1OUXA 5FZLA 5CYYA 1AR71 1CGPA 1NCQB 4BXSV 3O1VA 4DNYA 2GMMA 1JOPA 2VH9A 4GD4A 2AH2A 3U75A 2GC0A 4IGQA 5CNAA 1OLME 1W06A 3IKWA 4E4DX 5D8AA 1IG3A 5LY1A 1W6NA 3PIGA 3PVNA 1XB9A 3NV3A 4WZCA 5B2GB 3OB8A 1QJZA 2XVLA 4XE9A 2DWRA 4FPYA 4O9EA 4XJUA 1H6XA 5FUIA 3LA3A 2OW4A 2ZZQA 1I5PA 1FV3A 5FYYA 2E51A 1NCQC 2LUWA 2E7AA 2JE9A 2WLQA 3CU7A 3ZVXA 3H8RA 3NNMA 1WCUA 2BW8A 2IXLA 4ZKTB 5FZEA 5JVVA 2HWE2 1NG0A 2QQOA 4IE5A 4QQHA 2WRAA 4KQ7A 4LITA 5FLJA 1S2BA 5A7PA 1YCIA 3TEZA 3B93A 4WVVA 1NT0A 4IL7A 4J1WA 2VTXA 2ZMNA 4QPIA 3ZXGA 1BMV1 4FOWA 4QB6A 1Q8SA 2VPVA 2FDKA 2E7TA 5FPUA 4OI4A 2D6KA 5DUUA 1D4M2 1LOGA 2RDSA 1SBEA 4FOQA 3V56A 1VRH3 2RJKA 5J09A 5FO9B 1T6BX 4H7LA 4LA2A 3R4SA 5FZ6A 5FBJA 3PU3A 4UFHA 4R8HA 4FI9A 2RR11 5FXVA 1IKQA 3ZSLA 1MR5A 2KXLA 3Q8EA 2WBKA 4NWWA 4RA0A 4OFGA 5A3NA 1UZ0A 4KNCA 2QQKA 4GB31 5IAVA 4Q4X2 4JKKA 2RS52 1GNHA 4E8CA 1GP6A 2NZ9A 2XLGA 2JD4A 1JH5A 2UYBA 3AXEA 4Q0SA 1H30A 5LASA 3HVDA 3I3BA 4KMQA 4RQPB 3D5OA 4Q4V2 1J58A 5F1RA 3LB9A 3NJVA 4MG2A 3I2JA 3TWIA 2E6VA 4ZU5A 5A33A 1D0GA 1S4CA 3A4UA 3FX3A 4YYOA 1MQTA 2PTMA 4K9SA 1US2A 4AEJA 1KXGA 2ZGSA 3VBFA 3AZVA 4IEPA 4FPOB 3RVHA 2FHRA 1NCRC 2WZEA 3NL1A 4ASMB 3WW3A 4I0BA 5GLWA 3ZYHA 1BEV1 5DXDA 2HWE3 1BZWA 4F83A 3ZM8A 3NV2A 2Y26A 1BBT2 4RQPC 4XFHA 3VBOA 5CFDA 1LOEA 3VZOA 3MIHA 3ZXAC 4ES8A 4EV0A 1US3A 2J7MA 2ZX2A 2GN7A 4D7YA 1LOFC 1GMMA 2Y6LA 4XQDA 3I97A 4XACA 2CGOA 3GHMA 1D4M3 2XWBB 5IK4A 2W91A 3KT7A 3BALA 2B39A 3RSJA 3T0AA 4Y1VA 2I2SA 2BV4A 1GUIA 1D4VB 3A0KA 5EJZB 1V0AA 1Q8VA 3JD71 1SLAA 3I3EA 2ZS6B 5APAA 4IE7A 5FIXA 4RHV1 1PO11 5LB6A 2WNUA 4WVZA 4YW3A 3QH7A 3AJZA 3NAPB 4UBGA 3VBUA 4X8NA 5IHRA 4EN0A 4Q4X3 3ZMNA 3LDBA 3FJSA 2RS53 3T08A 2O14A 3DKWA 4QM8A 1XYOA 5LW9A 3P3NA 1O8SA 3RI8A 2TBVA 3ILRA 4M4RA 4DXRA 3RI9A 4Q4V3 4CEYA 4LO5B 4Y20B 5FZKA 4XUPA 5T5OA 2EIGA 3FZ3A 4HKLA 4K3UA 2WAAA 1HLCA 4Y24A 3J26N 2VNOA 1COV1 3ZN6A 2P3YA 3EO6A 1OHFA 3WF3A 5EYYA 2WSUA 4LKDA 2O0OA 3WP5A 1WA6X 4IEWA 1POV1 4K6BA 2F17A 2Y64A 3LA7A 3WF1A 2BGCA 4LHKA 3J7HA 1FOD2 1G7YA 1OH4A 4ITCA 4JC1A 3IM0A 4Y4YA 4CCEA 1SHWB 3OF1A 3WCSA 2GC2A 2CTVA 1RUC1 4QPWA 4MV2A 5BPXA 3ZFEA 3HNBM 4RN5A 5D8AB 4F8AA 5KXCA 1HN0A 5T50A 3VBSA 5IK5A 5JIUA 2VBDA 5JPNB 5J37A 4BE3A 5JOWA 4GMP1 2QQNA 3PTYA 1GNYA 1K5MC 5FZGA 4Y26A 3RZMA 2EF6A 4O65A 3T0DA 3HIFA 1W6PB 5BUVA 1K5JA 3N9QA 5EJ1B 1YC61 2R49A 3AL5A 1CJPA 1ZX5A 3BYWA 3M2MA 2JDNA 2YDEA 2QTWB 4FP3A 2MEV2 4AEKA 4CP2A 5CFCB 4YVWC 1PX3A 3PIJA 1G9CA 4W6YA 2ZEXA 2HWF2 1WCSA 3VD7A 3V0BB 3MW4A 4EYUA 2OPKA 4MO3M 2ATFA 1G9BA 5K0UA 1F4HA 2RJ2A 4RD7A 3WHTA 5IWFA 4AWDA 4IV1B 5IFPA 1C8M1 1DLLA 1GZTA 1LOAA 4XBQA 3Q9OA 2Q8OA 4WM8A 1KDKA 2G9ZA 5HXVA 2RV9A 3NJYA 5CFCC 3MUZ1 2X53S 3RQ0A 4INDA 5A6YA 3AKSA 3RZHA 2AZ5A 5D1IA 2QDNA 1VAMA 4HBNA 2FDGA 2DTYA 1FOD3 2QQMA 1CZSA 5T5LA 2WQZC 1A34A 3KLSA 1DQ5A 1GWKA 3OYWA 4IV1C 5FPVA 1ZZ6A 2ZABA 3THPA 3WZ1A 1CONA 2D6NA 4M3CA 4U36A 3S5QA 1Z7S2 1ZZCA 2VMEA 3FHAA 5A3PA 4OHYA 2DCYA 3U07A 3AJYA 3NV4A 2YPDA 3ZDSA 2GMPA 1W2UA 2G1MA 2ARBA 3O1OA 1KITA 2G4IA 4GALA 4LE3A 2EIBA 4WVMA 1D0HA 1MQTB 5J98B 1WWYA 4A6OA 4XF9A 4PBPA 2C5DA 2XMLA 1H1AA 1O5LA 4FCAA 5JR2A 4I2OA 2BEOA 1YQ8A 3UKTA 3DXUA 2XQRA 3PU8A 3P6BA 5C4WB 2JE7A 2MEV3 2WFF2 3MLJA 3OGJA 5JR7B 5H9PA 3IMMA 4QXCA 5HBAA 1UU4A 1IS3A 2BBVA 2HWF3 3KHCA 5CG8A 4DRVA 2VOWA 5JOXA 1E5RA 1N3QA 1W03A 1MQTC 2OA2A 4OHXA 4Z82A 4KBBA 2DV9A 4NIIA 1GOGA 3G7DA 2VZSA 3R4DB 3H3UA 3NNJA 5ANQA 5FMOL 3RWNA 5ACA2 4FPCA 2ZGPA 1L7RA 3MW3A 2CGPA 2ETEA 1NE6A 3ATGA 4L92A 3WDTA 3VDAA 4FAGA 1MZ5A 4LBQD 5J48A 4QDSA 3AVSA 2FCVA 5EXOA 4YZ4A 5KBFA 3POFA 2ZGOA 4CUCA 2WNUB 1JOJA 4OVEA 4AW7A 1QH6A 1QJX2 2K2SA 3MIEA 4HPKA 1RUI2 2QUOA 2YGMA 2YUEA 3VBUB 3U37A 1Y9GA 4HG6B 5I8SA 2VNGA 3EB7A 1TQ5A 4RL7A 1W90A 4HFSA 4MHRA 4MGYE 2OXBA 1WCDJ 1Z7S3 2ARAA 2WQ8A 5KXBA 4QPGC 5FZ0A 4RGKA 5A7SA 3OBAA 2X5IB 2Y6KA 1C5IA 4Y4RA 5FKBA 5GM0A 1Y9MA 5IFTA 1VLNA 3W9AA 5IAXA 3PMEA 4XZPA 5LRSA 5DUWA 5C4WC 3WF4A 3ZN6B 1STMA 1E57A 2AEYA 1DU3D 1H2LA 2D3RA 4DS0A 5HPOA 3AMMA 4DFSA 3ZSMA 2GMEA 3I7DA 1HW5A 2WFF3 2WC2A 5FWJA 2H0BA 5T52A 2Y6HA 2X5IC 2ZEZA 2P6HA 4QKNA 2IC1A 1D4M1 3HNYM 4BJ0A 3I2OA 3OD0A 4EZ4A 4E2QA 4XABA 3KZ4C 3UKVA 2D97A 1NKGA 4E2SA 2ZGKA 1YJLA 4JGZB 3VBSB 3VKFC 3WP3A 1OOPB 1ZZ9A 3QD6A 5FPAA 1JI6A 2XVKA 4AVVA 3S57A 3MIGA 4JRLA 5ACA3 4A2UA 2GC3A 1AR82 1NQDA 4NVPA 2QQWA 3GYDA 4QX2A 4ZU4A 4BLJA 5KC5A 2XLAA 2PHUA 3M1HA 4FFFA 4AI3A 4XCAA 1W6OA 1QJX3 5JXJA 1RUI3 3DPRB 2QJVA 3BU7A 4LBJA 1HV1A 4IW3A 2YBKA 5FOJB 4JGZC 4LUMA 3WUDA 2ZCWA 3THTA 4B4QA 1OOPC 4QXKA 5FP8A 4ASLA 1IS4A 1UY0A 2YGLA 5FP3A 2JDKA 4R9CA 4QQOA 4DMIA 4UF0A 3T4VA 1GNZA 1SACA 3UJOA 4KG8A 4PLNA 3TYJA 4NPMA 2ORZA 5K0UB 1MS5A 2X10A 2JWPA 2LM3A 5DMYA 2VMCA 3HT2A 4DEVA 4YVSB 1LHOA 3GCXA 3WNXA 4GH4B 1H4HA 4M0NA 3ORJA 2A3YA 1EP0A 3DPRC 3FHIB 4UFJA 1RUOA 2GP5A 1JYCA 4TXWA 1UYYA 1P8JA 2JICA 1J3QA 4CDXA 2GU9A 4GWIA 4D3WA 4DB5A 4P08A 2WAOA 4YZ2A 4QMAA 2GC1A 4D0QA 4ASKA 3LE0A 4Z2AA 2WWUA 5F9TA 4LBKA 4C1WA 4IEYA 4WM7A 2F4LA 3IWZA 3OYWB 4Y3OA 4YVSC 4IEXA 4M3CB 4GH4C 2FDIA 2HYKA 5BNOB 5DAXA 5GKAC 2A73B 1PO22 1UYZA 4NAOA 5EJ3A 2DFCA 3TN92 4IE6A 2WKKA 3ZYGA 5JSOA 3THCA 3I3DA 1AR83 2VD7A 4WVMB 3SISA 4E9KA 2BPA2 4P9LA 4UFMA 5L9RA 5ABJC 1IS6A 3OGSA 1ENXA 4LIVA 2VULA 1GOFA 5EHDA 2ZGNA 4Y1ZA 5BNOC 1J1TA 2PHXA 4XW3A 1XBFA 1LENA 1MEC1 3C7HA 2R1BA 3CO2A 5C8CA 1BK0A 5FZCA 1UIJA 3FE5A 4KG0A 3E5XA 2YFUA 3PTRB 1W8UA 1JU3A 1EUUA 3IZOA 3BN6A 4QX5A 1HB2A 3WP6A 3ZXFA 5LA0A 2W68A 3KM5A 4XBLA 5EV7A 3ZMOA 4CVUA 3KF3A 3H0OA 1AL0G 4W50A 3ZIXA 2OPWA 2Z2SB 4MGSA 2QQLA 3USSA 5LA9A 2RM22 1NXMA 1ZBA1
chains in the Genus database with same CATH topology
4AFCA 1QJU2 2H6BA 5FFOC 2E9QA 3RZZA 2JG9A 4J1XA 4D7TA 2A70A 1VBB1 4L8QA 2NMOA 3AX4A 1LB2A 3H9AA 2KM2A 3WLUA 4WZFA 4JGYA 1EV12 1XNKA 4XHXA 3O7OA 2A75A 3ZFGA 5LEKA 5BY5A 4FTBA 1B35A 1DYPA 2VOVA 3IDBB 1JUHA 1PO23 2ZX0A 1LECA 3TN93 1TMF2 4H14A 4AVBA 2UU8A 1ZYBA 4XF0A 1B09A 2XJVA 2GNDA 1SLCA 1V6LA 1OQEA 2HWC1 2JG8A 4XFAA 1LESA 2HWB1 1FAYA 4ISQA 5FQ0A 1CN1A 2A7AA 4MX3A 4K7JA 2GNBA 4HETA 1SBDA 3KS7A 3WG1A 4I01A 1BKZA 1WW6A 3FBMA 1Z0HA 3KCYA 1PM7A 2YROA 4V1PA 4X8PA 4XMIA 4AVTA 3AK0A 4X6QB 4Q0UA 3ZSEA 5C6CA 4BMEA 2XWJB 1VBA2 4YM0A 4RR3C 2PA7A 1QJU3 4N53A 2EALA 3FUOA 5BNPA 1W6OB 2V73A 4P14A 3VZKA 3AYEA 1Q3EA 2BWCA 1S0CA 1EV13 4Q1RA 4XJZA 2CYFA 3VBRB 4E2GA 3EBRA 5DZFA 2PLV2 4JVAA 4XMAA 5GZCA 4Y1YA 2VMGA 4PDWC 3I54A 5CADA 1OLRA 2ZHLA 4M0HA 2EXJA 2VUJA 1DQ0A 3ZYRA 1TMF3 3AZWA 3IMNA 2Q1MA 4AHWA 2W39A 2WFF1 2X8KA 1NY72 1G6NA 1CPMA 2ET1A 3AKTA 3VBRC 4K1ZA 1W6QA 4FPJA 1S0BA 4HK9A 1G86A 4YARA 4CYDA 4WM7B 1UMZA 1AR62 4QPYA 1ZVFA 3CJIB 3N3HA 1QWRA 2PAMA 4MSVA 3AYCA 3B5LB 3FLPA 4E4SA 1RHI2 1OSGA 3IN9A 1HXS2 1QU0A 1VBA3 2D6OX 1SLIA 4A3XA 1U5ZA 3PLQA 2R041 3S6PA 4OHWA 3SMHA 2R0HA 3CJIC 5CG9A 2NLRA 2R32A 3HD8B 4JV4A 5T3NA 1F5FA 1VP6A 3FMGA 1WGPA 1BVP1 3HQXA 1GR3A 2XB6C 3N7MA 5FCCA 5FREA 3SH5A 4P9XA 1AYN1 1AR91 2Q0AA 2VMHA 2B45X 1GZ9A 1V6JA 1PZ7A 2IXKA 4S2HA 5DG2A 1FI2A 2R30A 1V6NA 3K51A 4Q2FA 4IETA 1MS4A 4LBLA 1NCRA 1HRV2 3L9JT 2XJUA 4HANA 4AF9A 4BIOA 4JGYB 1HQLA 1S0IA 1JN2P 4Q8LA 5DDJ2 1AR63 1ONAA 4RQPA 2WS91 1QY4A 3FBYA 1EAH1 4N9IA 2CAVA 1LOFA 5I0RA 4GIQA 5FPZA 2A5ZA 3ZO0B 3WQ1A 1RHI3 5L19A 4XEZA 2D98A 2ARXA 2WT2A 1QJY1 4QQPA 1QH7A 1N1VA 1YI7A 2JG8B 1F9KA 4AFBA 4YW4A 1V9U2 1WLDA 1ZBE2 5FQ0B 3VGIA 1PNGA 2BFUL 3UJQA 1R081 1MVQA 3T2TA 2D6LX 3GF6A 1PGW2 2A6VA 5LK5A 3POWA 1CD3G 4XETA 1Q43A 4R9DA 1S0FA 1DBNA 1RUE1 2WNEA 5JDBA 1ENSA 4FXGB 1AVBA 3VKMA 2XG3A 4TYSA 1X7NA 1GZWB 1OPMA 1XE8A 5BNPB 1HRV3 4D69A 5HCFA 4DOUA 5DDJ3 1KS4A 3SXWA 5HCBA 4DY5A 3D4KA 4Y20A 3HT1A 5T5PA 3ZXLA 1OFNA 1JUIA 4FAHA 4YLZA 1FATA 2ZX1A 5L7OB 3LSDA 4JQRA 4N7IA 2VECA 5KHIA 1NXD1 4B29A 4BZ4A 1QQP1 2VW1A 4IV3C 4UW5A 2QCSB 1K5MA 4Q4W2 4HKOA 1PGL2 5JIAA 4AG4A 1W6QB 1V9U3 3O14A 4QM9A 1ZBE3 4W6XA 4BCUA 4YG3A 2E7QA 5L7OC 4YVWA 1RMU2 3U4XA 1BXHA 2FZ1A 5FDBA 3RYPA 1F5JA 3POSA 3TNPB 1Q56A 4XXAA 3K48A 4K1YA 2ES3A 5FTTC 1JHNA 2A6XA 3KT4A 1JXNA 1W6PA 3RYKA 5CFCA 2B8MA 2VMIA 3O0WA 4B7KA 1PMIA 1C57A 3SLIA 1MS9A 5JZGB 3V0BA 4DXZA 3MIFA 3ZXDA 5GLUA 1CPNA 2WZR2 3QBQA 2CL2A 3HN1A 1H1IA 1N47A 2DVAA 4IV1A 3MYXA 2RJLA 1G9AA 2P3IA 4Y22B 5A3LA 4K40A 2AGSA 1JW6A 1Q5OA 3MIBA 3CLPA 4Y5Z0 1R1A2 5JZGC 1C3HA 1L3JA 3QH6A 4Q4W3 2QKDA 2VOKA 3M3EA 1UKGA 1NCRB 2JX9A 2TNFA 5KHJA 4AGRA 5J3UA 1RMU3 4NHLA 1AYM2 1Y43B 2DCKA 5GLVA 4L11A 1TME1 3AP7A 2KA3A 1VBA1 4AFAA 3JB4C 4ATFA 1Y3TA 2YXSA 3HBZA 4Q8KA 2WIIB 1UKRA 4R9AA 4AQ2A 4KGGA 1AJOA 4YZ5A 3S7IA 5KWRA 1H1MA 3MI8A 3ZXKA 1LGBA 4LTAA 5L73A 1LU2A 3MFAA 4JAAA 1RJ8A 4COZA 5KC6A 2DVDA 4RFT0 2WZR3 4QQ2A 2FMYA 5GZDA 3B9CA 1KFUL 1PGSA 2AREA 3SHRA 4BHPA 1J3PA 1WCKA 4LE4A 4Q29A 2ZAHA 4AK3A 1RVF2 1M06G 1LR5A 4XILA 3BODA 4QPGA 4RSUA 2R071 5E1RA 4I3GA 1LCLA 4M01A 3B9IA 3GZTB 1SFYA 1R1A3 5C4WA 1H4GA 1RUG2 3SNMA 2ZACA 2R061 3ES1A 1QKQA 4IEZA 1ASJ1 4GULA 1I9RA 3OPZA 3U0ZA 3WQ0A 1CAVA 1AYM3 1O4ZA 2X5IA 1RUH2 4RGAA 1GBGA 1NZCA 4JDOA 4R52A 4COVA 5GZGA 1VBC2 1ZM1A 5KXEA 3VKLA 4META 4PIXA 1A78A 1EPWA 1RUD2 2VVEA 4NHMA 3URFA 1XNBA 1ENQA 2BVBA 5GJ6A 2OYZA 4C1XA 3AXDA 2RHPA 1BVVA 2Q5TA 1K5MB 4BQ1A 4FOVA 1I6XA 1N3PA 4XJAA 1BBT3 2RMU2 3WDWA 3MPPG 3OY8A 1V6IA 4Z1VA 5BV6A 4HVRA 4Q0PA 4OI2A 1MZ6A 3GZAA 1VBE1 4FP2A 2RS12 4YVWB 1S0EA 4JGZA 2G9FA 1OOPA 1NLRA 1RVF3 4IQPA 3J8F2 2WJSA 2Y38A 4BPZA 3GNEA 3VDDC 2VOXA 3AZYA 1DQ1A 2N7GA 1UX6A 3O12A 1HRV1 2BNNA 2HEYF 4AYUA 4EN6B 4LLFA 3DPRA 1SCSA 5DDJ1 4CDUB 1G8WA 4FT8A 4W6WA 1VB4A 2HWD1 4R9BA 5K8SA 1BJQA 1SDWA 2ZJCA 3LSEA 4FO9A 1CAXA 1CAUA 2UY9A 1IS5A 2PHWA 3VLBB 4ATEA 1OD5A 1RUH3 2DFBA 1KQRA 2UWBA 4AHYA 3AZZA 2WNVC 4YVSA 1VBC3 2BYVE 1AX1A 3M4FA 4GH4A 4ORFA 4OI1A 3WDUA 4AGVA 3B94A 2ZGUA 4CDUC 3U11A 1H9WA 3VHOA 4OULA 4SLIA 3TBDA 2RMU3 3AMNA 4QHBA 5ABJA 3MF6A 1AZDA 1FPN2 4FQZA 3R0RA 1YI9A 5BNOA 2RS13 1QNWA 3J8F3 3FWEA 2YY1A 1WLCA 4XF4A 1ZNPA 5EYXA 1CR7A 1X82A 1VALA 4XJ9A 4L99A 2UURA 2VVFA 1PIV2 4AFDA 2D5HA 1OA2A 1LGNA 2UYAA 4K8FA 4DINB 3QOPA 3I2DA 2R0FA 1S1AA 4LNVA 3USUA 2C1FA 2BTVC 1VRH1 4FPLA 4GWMA 4GA9A 1VAVA 2QNKA 1YFUA 1GKBA 3I59A 4C0BA 1RTVA 4Q4Y2 1H2MA 4QPGB 1OPOA 3WD5A 2VW0A 3ZN5A 4GWNA 4D94A 2I74A 5AVAA 1EYBA 2OVUA 2GZWA 4Q26A 3MLKA 2VQ0A 1VB2A 1PVXA 2RS32 2QQPA 4IEOA 1FPN3 1QOTA 2ZGMA 4Z07A 3L2HA 4QQLA 3OTFA 4IEUA 4HLTA 1WUVA 1CAVB 3AMHA 3LGRA 4LULA 1H9PA 5I8TA 1ENRA 5I91A 2HWE1 1LU1A 2Q30A 3AP9A 1AL22 3U10A 1CAWA 4KU7A 5J7MA 4F3JA 3C3VA 3KMHA 2Y0IA 2ZHNA 5AFEA 1PIV3 1UPIA 2WZR1 4RR3A 4K20A 2BFUS 3PMSA 2WZPP 1RUF2 2DURA 2WT0A 1DQ2A 1ALYA 4HN0A 3RDIA 4BOWA 4GQ7A 1UD1A 3KD4A 3OY8B 4NPRA 4P9JA 4NOTA 1NOVA 1N1YA 1VBD2 4SBVA 1HV0A 5AVPA 2OUHA 1QXPA 1KDMA 2P34A 5T55A 4PDWA 5K7PA 3MLLA 2DF7A 4Q4X1 3MICA 2RS51 1Y7BA 2JEMA 4QD2A 2WINB 1O5UA 2WLPA 5AC92 1AYM1 4Q4V1 4XJ8A 2RS33 2BNMA 3VBRA 3RJRA 1POV0 1DF0A 5EZWA 4TLFA 1BYHA 3AB0A 3ZX7A 1CAXB 1CAUB 5FLHA 3ZPYA 1R092 5I93A 1QF3A 4XTPA 4ZU7A 1MZEA 4P9YA 1LKNA 4MLOA 1ZZ7A 4AEDC 3ZIWA 3O0VA 1ZRDA 2O1QA 1AL23 1XXNA 2VGDA 4GMP0 1BBT1 2HKXA 5JLVA 1PHMA 1NYWA 1RUF3 2AENA 1SEFA 3L2YA 5ABJB 1RVF1 2D6PA 3RMYA 1HRI2 1SLLA 3JU9A 1ULDA 5CAZA 1YNAA 2GH2A 3CJIA 1VBD3 1OKQA 1U5IA 2VVDA 4JTNA 1LEMA 3WP4A 4M3CF 3WW2A 3NV1A 1GSLA 1AX0A 3M3IA 1QGLA 1XU2A 3SCGA 1C28A 2K0GA 3MDPA 4BIFA 4XXPA 5J96B 5LEJA 1REEA 3ZN4A 3NWKA 3OBTA 1GFF2 3DN7A 4I3PA 4RS5C 4QU2A 5JI7A 1UIKA 3WX5A 4LBMA 2DYCA 4MGIE 2V09A 1VBC1 3LA2A 1YJKA 4LBNA 3MIDA 3USUB 1QOOA 4KL1A 1HQNA 2VUAA 4PJYA 4HL0A 1R093 2XVGA 4WVWA 4BMBA 3I59B 4PF5A 4AGGA 3H1YA 2HEWF 3RG0A 5FOBB 5JI9A 5I0SA 2WFPA 1FOD1 1W6MA 4AI1A 1O91A 4I0WB 4B4PA 1SMVA 4JRAA 3VL8A 1GYKA 2RS11 5DZEA 4OUMA 1AR72 5LRRA 1IPKA 3DL3A 1HRI3 2F6BA 3TNQA 2IFWA 5BNNB 3GBGA 1OFSA 5DUVA 4HZFA 2IXIA 5F5QA 4BYYA 2P2KA 4PIZA 1OMIA 5FAXA 2MEV1 3IIAA 4DRRA 2JKBA 4MGZE 2BUKA 1CAWB 3AFKA 2HWF1 4H3WA 2ZBJA 3JQWA 1DFQA 1BCXA 1YIFA 2YHJA 5FPXA 1UZZA 4FTEA 3AYAA 4RR3B 5BNNC 5GZEA 1A8MA 1IHMA 3AP6A 2DU1A 3J4UH 5HI0A 3T1MA 4CDWC 3EJKA 2ZGRA 1BMV2 1ZZBA 3M7AA 2DVGA 4PDWB 1NA1C 2ZMKA 3ZYPA 4FPEA 2RM23 3SCHA 4BWOA 3D0JA 5C33A 3NO8A 3WINE 1UL9A 1RC6A 1C8NA 2UY8A 2GDFA 1IZ3A 1IGOA 1GZWA 2VG9A 3WR0A 1QOSA 4G3YC 4XHBA 1Z7S1 2RR12 1GQHA 2DUQA 3ST7A 4IV3A 2NP0A 1ZREA 1AR73 1WBFA 3NVCA 3ZFFB 5JSRA 2JECA 3G6JB 4GB32 3ASIA 4HMZA 1VAKA 4AE2A 1EPZA 2W08A 3VZJA 1C5HA 2IZWA 5L7OA 2DVFA 4ISRA 4ONUA 2ZMLA 2IXCA 1DGWX 3PVEA 1WD3A 3CJXA 2XJTA 4YGCA 4GKYA 1C4RA 1RUJ2 2EVXA 4AHXA 3ZFFC 1OLQA 1CESA 3BCWA 4XFFA 2WWSA 1SLBA 3KSCA 4XFGA 3UK9A 4Q27A 3ELNA 2XL9A 4BA6A 5ACA1 1QNYA 1HKDA 4AQTA 2E63A 4OUSA 4Z92B 2PELA 5GALA 2D93A 1FMD2 5GLZA 3E6DA 2ZPXA 3ILFA 4MYEA 2PFWA 4XBNA 3ZSJA 1QJX1 3O0XA 1RUI1 1EY2A 2Q4SA 2RS31 1LULA 1DIWA 3JD72 3ZYJB 4AVCA 2X29A 3ECQA 2RR13 1PO12 4RHV2 5JZGA 4GXLA 4TWTA 4B8EA 1RGSA 3N4MA 1RL3A 1WW5A 1UW8A 3N7JA 2PLV3 1SQ4A 4KGQA 1XNCA 2WA4A 4EN9B 3VZNA 1IPJA 4Y22A 4CP1A 5T54A 3UKNA 1M4WA 4IEQA 4KU8A 5C9AC 4N43C 1SFNA 1LEDA 3APBA 2R1DA 1RUJ3 1COV2 5JOYA 1W6MB 2FBEA 4UBHA 4JCKA 4URTA 1KJRA 1VBD1 2G9GA 1UAIA 1FNZA 2QVSB 1Q8OA 3P3PA 2P3KA 4O9GA 3E97A 1AR81 1RUC2 1FMD3 3ROUA 4L9BA 3ZXEA 4YSFA 3C2UA 3N7LA 3KB5A 1O3TA 2C0ZA 4CEWB 5FO8B 1N1TA 3E5QA 1HXS3 1C1FA 1H2NA 2ZX4A 2D40A 3JD73 1AXZA 4RHV3 1PO13 1H8TB 3WVJA 1YRZA 2MNGA 4CDQB 4YM1A 3T1LA 3KT1A 3WW4A 4CEWC 4OI0A 1H0BA 4W65A 3WHUA 1A8DA 1WMDA 3H8UA 4LBQA 1FV2A 2ENRA 5FMOS 2VQAA 4M3CE 2CWMA 3GALA 1C8M2 1ZRFA 3JCIA 3WG2A 1H8TC 4CDQC 2WL1A 1COV3 1XE7A 2XKPA 3WT3A 1XRUA 2B7YA 3GBWA 4U2AA 2K9ZA 1G9DA 1POV3 4IV3B 1YUDA 3EQEA 3LZZA 1PO21 4K21A 3TN91 3EHKA 4LO8A 2XBO2 2NPIA 3MGUA 1RUC3 3VKNA 2A6WA 4YGDA 3W59A 3MF9A 2ZA9A 4QGMA 2OIIA 1S55A 1BK1A 3IDCB 3JBG2 3TAYA 5GZFA 4PLOA 3IT8A 2Q1ZB 5E8AA 4TZDA 4CRQA 1UN1A 3VDDA 1TNFA 3LOIA 4XFCA 2WA3A 4KWKA 4UW6A 2DCJA 2JJ6A 3V65A 5EWSA 2XHKA 4Q1PA 4FXKB 3VBHC 3B69A 3JB8A 3IPVB 3N7KA 1QMJA 1W39A 5K9YA 2RM21 3AKQA 3OBRA 3TB0A 3FUQA 2D44A 1QJU1 4FPFA 4Y1UA 1C8M3 2D6MA 2NMNA 3ME2A 4HSJA 2WNVA 4B3NA 3D82A 1FYUA 1Y9QA 1UCXA 2B9UA 2SLIA 3AMQA 1EV11 4CDUA 1GQGA 4H55A 4H7MA 4JTOA 1Q8PA 1X33A 4CTEA 2JXAA 1TMF1 2XBO3 4AVAA 4EWDA 4BH9A 4MH0E 5DUXA 1WA4A 2DU0A 1J59A 3JBG3 3EXUA 1PNFA 4HVOA 4LA3A 5L36A 1V00A 3CEWA 3POYA 1HIXA 1MACA 2DVBA 4OHVA 5DG1A 2W0XA 2DUPA 1ND3B 1OI6A 1YLLA 3PJQA 4FPKA 2YZ4A 3S7EA 1YO8A 1FX5A 3DUIA 1DZTA 3CL1A 4NO4A 1W0OA 1ULCA 1FXZA 5I8YA 3AKPA 3HWJA 4UW3A 4XTMA 2D3PA 4COWA 1ND3C 1VIWB 3BIWE 1IKPA 1DG6A 2IWGB 2PLV1 4YW2A 1WMFA 3D8CA 4YM2A 1U12A 4XF3A 4AI0A 4NN0A 2ERFA 4YGBA 1N1SA 3SH3A 4YZ1A 1NY71 4LBQB 1RUJ1 2MPFA 4C90A 4Q0QA 4EN7B 2D43A 3JQXA 1C1LA 4CP0A 4WBBA 2BNOA 2XUMA 2HJIA 1AR61 3R05A 4FOYA 4KH9A 2GALA 3JUUA 1FMD1 3TOJA 4P5HA 4PCRA 3VUOA 3MFCA 1DGLA 1OQDA 3DV8A 1RHI1 4YW5A 1OA3A 1HXS1 3VHNA 2CAUA 1PK6B 2PHLA 1KRIA 1HQWA 4OLLA 1J3RA 1LGCA 4A7KA 2NN8A 1CJDA 1KFXL 2ILMA 4YRDA 1TEIA 3FLRA 5CB7A 4PBOA 3VDDB 2W52A 1OA4A 1LRHA 1UU5A 4I30A 1JYIA 1TNRA 1YFWA 2Z69A 3AZXA 1PK6C 1R1ZA 4HT1T 1ND2B 2I45A 2PAKA 2GNMA 1MEC2 3H7YA 2D5FA 4LBOA 3PJYA 3FFQA 1WD4A 3ACLA 1RIRA 3FLTA 3KCXA 3QACA 3NAPC 4X6RB 4LT5A 2DCTA 3CNAA 4FBFA 1UZYA 4XQWA 4GKXA 3RYRA 4M00A 4YGEA 2WNVB 4P9WA 4AHZA 4E27A 1NLSA 2PN5A 4AEDA 1RUG3 1ZBA2 1D2QA 1ND2C 3D6EA 2R16A 1VBB2 3VZLA 3WDVA 3LCPA 3WY6A 1W6NB 2CY6A 2EXIA 2XKOA 4A7YA 1S0JA 4COYA 2O8QA 3I8TA 4XFBA 3INAA 2V5YA 2ZHMA 1RUD3 4YG6A 2JENA 1HDKA 3B7MA 3RS6A 4N90A 1V9U1 1ZBE1 2YYOA 5D8AC 1LODA 2HWC2 1AF9A 3AM2A 1PGW1 3OD4A 2HWB2 3GBFA 4QPIB 4COUA 4RS5A 4LEJA 1MEC3 2YPJA 1QXJA 4FQ4A 4PLMA 2B5HA 4AXOA 4L2NA 1GLHA 5EFUA 1D2SA 1YWKA 4S2DA 3V64A 4Q0VA 4BLIA 5IK8A 4R4ZA 3WOGA 3SH4A 1OQ1A 1SCRA 4P9IA 4EN8B 1XQNA 1XYPA 4HK8A 1I1EA 2XJQA 4XYXA 4FTSA 4QPIC 1ZBA3 3I4IA 5A3MA 3AYDA 4C91A 1RITA 2XBO1 2P17A 1VBB3 5AFBA 2MHFA 4Y1XA 1PZ9A 1I3HA 3ZXJA 1GV9A 5BXXA 1YIPA 3VKOA 3JBG1 5E89A 1PVC2 4XDQA 5A33B 3MZHA 3KGZA 1O3SA 3VBFB 2QE3A 4Q4W1 1PGL1 3B3QE 1LHU