2Q39A

Beta-lactoglobulin (low humidity)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
160
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title An asymmetric dimer of beta-lactoglobulin in a low humidity crystal form-Structural changes that accompany partial dehydration and protein action.
pubmed doi rcsb
molecule tags Transport protein
total genus 30
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2q39A00
4MVLA 5FENA 2WQ9A 1CRBA 4BOEA 1S7DA 4BQUA 5AQ6A 2G78A 2BLGA 2NNEA 1LKEA 2JU7A 1EIIA 1A3YA 4LZUA 2OVDA 3APVA 1L6MA 3NP1A 5D48A 2P8GA 4DQ3A 4IAWA 2W2FA 3FIQA 1PMPA 1KT4A 1QWDA 2QO4A 1GX9A 4XMEA 4QGWA 1X89A 1PM1X 1OPBA 3BDRA 1BRQA 1AQBA 4I3DA 2X46A 1HMTA 3TZSA 2OVEA 1U0XA 2Q39A 3KFFA 1EALA 4IMNA 1VPRA 5IO7A 3RZYA 1KT3A 3VG5A 3WJCA 2HNXA 3U0DA 1G7NA 4Y0SA 3EMMA 4IB7A 1X8QA 4UU2A 1CBRA 3HWDA 1G74A 3BU9A 1RBPA 4QYPA 4ZHGA 3FW4A 1LF7A 3P6EA 1SXXA 4YBUA 1TXLA 4IMOA 1YWCA 1IKJA 2QO5A 5HCDC 3WJDA 1BSOA 2E4JA 1TOUA 3WVMA 2YG2A 5H8TA 3NX1A 2FT9A 3FW5A 4OS0A 3FR2A 5LJDA 1GM6A 3D96A 1NGLA 3FA8A 4D6BA 5HWZA 3ZQ3A 3C76X 4ORUA 1E06A 1TVQA 2AT3X 4OMXA 3KFIA 2CBRA 2FWVA 4WBKA 3T1DA 3UEWA 4I9SA 1IIUA 4EFGA 4YDAA 3B2LA 2O62A 5D8JA 5K06A 1LPJA 3TGAA 3O19A 3ZUIA 1OEEA 2AT5X 5L8NA 1FEMA 5D47A 1EPBA 2W2BA 1LICA 1UREA 2R56A 5BVSA 1BWYA 1JBHA 1ICNA 3CBSA 4ZJ0A 1ALBA 1MVGA 4NP1A 1U17A 3CWKA 1NP1A 2QOSC 4QYNA 1GKAA 2LFOA 3Q6LA 4IB6A 4YGHA 3PP6A 2QO6A 2FTBA 5D45A 5LJCA 1QY0A 1ADLA 1HMRA 1YWBA 2ALLX 4GNWA 1LIFA 1DZJA 3B2KA 4O9SA 1OEJA 1HBQA 2MJIA 5EDBA 5HA0A 2CM9A 3OJYC 1B0OA 3FMZA 1YWAA 5HZ9A 1VYGA 1YWDA 4N7CA 5KICA 1KT6A 1MX7A 1XKIA 4ZH6A 5HZ6A 3CBCA 4GNYA 3APXA 1YUPA 4NNTA 1SXWA 3JSQA 2G7BA 4ORWA 2FS6A 1HMSA 3P6HA 3FA7A 4R0BA 4NLJA 1I05A 3VG7A 4YH0A 2XKLA 4IB8A 3C77X 1JYJA 2K62A 5D4AA 2AL0X 2AT8X 3FEPA 1GX8A 2RCQA 3HK1A 3BU1A 3WJGA 4ES7A 5H9KA 1B4MA 3VG3A 2KT4B 4AZNA 4YGZA 4QGVA 1ZNKA 2ASNX 3CR6A 1DC9A 1ERXA 1AVGI 3U03A 1LNMA 1SY0A 2GTFX 1SY3A 2OFMX 1ERBA 1CBIA 1DZKA 2FS7A 1BRPA 1QFTA 3F9DA 4YFRA 5H9LA 3TF6A 2QM9A 3NQ3A 4YCEA 1T8VA 2L5PA 1GKAB 1AB0A 1LIDA 3FEKA 5LKEA 2NNDA 5HA1A 4QAEA 2LBAA 3WJFA 1BEBA 3I17A 3BRNA 2RCTA 2L9CA 1BSYA 5F1EA 4EXZA 2ACPX 1GXAA 5LJHA 1QQSA 2GC9A 3VG4A 2AKQA 4A8ZA 1EXSA 5IO6A 3DSZA 2R74A 4M7MA 2W2AA 3BX7A 1HQPA 2XSTA 3NX2A 3FLLA 2JOZA 1XCAA 1OBQA 1E02A 3KQ0A 1EQDA 2RD7C 3GAQA 2DM5A 2FR2A 3HWGA 3KFGA 4D6AA 2HZRA 3O2YA 1E00A 1E5PA 3S26A 1S2PA 4MVKA 3QKGA 4K19A 4GH7A 5HCEC 1A18A 1KZWA 1IFBA 3KFHA 5LJEA 5BVQA 2Q2PA 5FAZA 1LFOA 3PEDA 4LZVA 1HN2A 2RA6A 2OVAA 1KT5A 1NP4A 4KIIA 1D2UA 2Q4NA 4Y0PA 4Y0RA 5B27A 2OFRX 4ARHA 4TKJA 5KHPA 4HFOA 2L68A 4EEJA 5LJKA 5IO5A 1IKEA 4XMDA 4YBPA 2K23A 1A57A 5LJGA 3IFBA 1ICMA 4N7DA 5HZ8A 1QY2A 1LIEA 3FELA 2RQ0A 4YFPA 4UU3A 4GETA 3ZUOA 1LIBA 4GE1A 1GT4A 3B2IA 3P6FA 3TGBA 4PSQA 5EPQA 1ZNDA 4XMFA 3RSWA 1FTPA 2HYSA 5EEEA 1FENA 1H91A 3B2JA 1AELA 5B29A 4ALOA 1QG5A 4RUUA 2AT0X 1VYFA 2NP1A 2AMMX 3EBWA 3HWFA 4LKPA 3WJEA 3PECA 2HMBA 2LKKA 1OBUA 4A60A 4YFQA 1B56A 1OBPA 3STKA 1ZNLA 1O1UA 1ZRYA 5F7GA 1I04A 1CBSA 3BLGA 5FFHA 3HWEA 4GKCA 3WJBA 3FR5A 3P6GA 2A2UA 1KT7A 1EPAA 5EZ2A 4TLJA 1MUPA 3BY0A 4LKTA 4ZHHA 3KZAA 4ZHCA 2CZTA 3K3LA 4XMCA 3U9PC 1KXOA 1OEKA 4ZHFA 1IFCA 1ACDA 3WBGA 5HTDA 2WQAE 1TOWA 2F73A 3EBKA 4HPCA 2JU3A 3MVFA 3NPOA 1ZNHA 4YDBA 4ZR2A 5BVTA 4NLIA 4XMHA 1DFVA 4DQ4A 2Q9SA 3EM0A 1DF3A 2CZUA 5F58A 4ZFXA 2A0AA 4AYHA 1GT1A 3DTQA 4ZH9A 1BJ7A 1DZMA 1FE3A 2A2GA 3I0AA 2NNQA 2EU7X 4YKMA 4QZTA 5CE4A 4ALBA 3IA8A 3ELZA 4ZCBA 3PH5A 1KGLA 5H9NA 3STMX 5C0NA 2OZQA 3BS2A 4MVIA 2A3FX 1JJJA 4YGGA 2CBSA 1R0UA 3CQRA 3FA9A 4AZRA 4WFVA 3D97A 2GJ5A 3UEUA 5H9AA 1T68X 4IB9A 4WFUA 4OS8A 2POAA 1SA8A 4I9RA 5JR8A 1G5WA 3PH6A 1UZ2X 1KQXA 4TQ2A 1X8NA 2FR3A 4IAXA 1JJXA 4IBAA 1QY1A 1GT3A 1HBPA 3G7XA 1P6PA 1IW2A 3NQ9A 2L67A 2R73A 4QZUA 3EYCA 4XMGA 1SY1A 4HPDA 1ML7A 1T0VA 2WWPA 2LB6A 2X45A 3UEVA 3CMPA 2FRSA 2WR6A 4HPAA 4TNNA 2AT6X 4YKOA 1JV4A 2MM3A 4A1HA 2PY1A 3AKMA 3O22A 3SAOA 1SY2A 1TW4A 4EDEA 5HAEA 1D3SA 2MO5A 5HTEA 3BSZE 1G85A 2HZQA 4ORSA 1X8UA 2LBVA 1U18A 3UEXA 1BLRA 4OMWA 3BX8A 2WEXA 1ZNGA 3P6DA 1BBPA 5F6ZA 1PEEA 4I3CA 4YMYA 1QABE 4M6SA 1CJ5A 1O8VA 4CK4A 3APUA 4AZQA 1B8EA 1O1VA 3P6CA 5F6BA 2HLVA 5LKFA 5L8IA 1DZPA 2Q2MA 4AZPA 2KTDA 5L8OA 4OS3A 5DPQA 4AZOA 1X71A 4Y0QA 4QGXA 3APWA 1OPAA 4TJZA 1QFVA 1ZNEA 1YP6A 1Z24A 5EEDA 1GGLA 1YP7A 4GRJA 2FLJA 2AH7X 1A2DA 2A13A 4BVMA 2WEWA 3VG2A 3FENA 3JS1A 3TGCA 2WUTA 3F8AA 3D95A 4HPBA 1RLBE 4ORRA 1KOIA 4ORYA 3B2HA 3FR4A 3NR3A 1PBOA 1EW3A 4TKHA 4NYRA 5DG4A 1JZUA 2G79A 4NNSA 1JYDA 1KZXA 1X8OA 1FELA 1SXUA 3STNA 4NYQA 5HZQA 2N93A 1YIVA 3MBTA 3PPTA 1BM5A 1EIOA 1MX8A 4YCHA 1N0SA 5HCCC 4I3BA 4AW8A 5HZ5A 1S44A 5KIDA 1MDCA 4ORXA 1BSQA 4TKBA 3C78X 1I4UA 4ZGUA 1I06A 2JN3A 3NADA 1FDQA 4AZMA 2JU8A 1X8PA 2ANSA 3ELXA 2ACOA 3WXQA 1KQWA 4A1YA 2CM4A 5LJBA 4RUNA 2IFBA 1DV9A 2WSJA 3FA6A 4ZHDA 1EUOA 3L4RA 4ODDA 3VG6A 1SXYA 5HBSA 3AKNA 1GT5A 3CQNA 1CBQA 5EDCA
chains in the Genus database with same CATH superfamily
3OD9A 4MVLA 2OF8A 2WQ9A 1K24A 5FENA 1CRBA 2PI3O 4BOEA 1SRGA 2Y32A 1S7DA 1SRFA 2RTDB 3H3IA 5AQ6A 4BQUA 2G78A 2BLGA 2NNEA 1LKEA 2JU7A 5L3YA 1SLGB 1A3YA 4LZUA 1EIIA 2OY8A 1EI5A 2OVDA 3APVA 3LTWA 4ML7B 1VWQB 1L6MA 4O4UA 3JQOA 1SWSA 3NP1A 2P8GA 4O3XB 5D48A 4DQ3A 4IAWA 2W2FA 3VE2A 3FIQA 5K67A 1PMPA 4GDZA 4COTA 4Z6JA 3F6ZB 1SWKA 2OY5O 1KT4A 1QWDA 2QO4A 1GX9A 1HQQA 4XMEA 1RSTB 4QGWA 3T6FA 1X89A 1PM1X 1OPBA 2FHLA 3ZWEA 4KC7A 3BDRA 5F2BA 1BRQA 1AQBA 4I3DA 2X46A 1HMTA 3TZSA 4JGLA 2OVEA 2ZAIA 1SWTA 1U0XA 2Q39A 4MISA 3KFFA 1EALA 4IMNA 1VPRA 5IO7A 3RZYA 1KT3A 4BX7B 1VWAB 3VG5A 3WJCA 2RTEB 2HNXA 3U0DA 1G7NA 4Y0SA 2I5VO 3EMMA 4IB7A 1MK5A 3RE6A 1X8QA 2BC3A 2RN4A 4UU2A 1CBRA 2RTFB 4CSBA 3HWDA 1G74A 1SREA 1Y9LA 3BU9A 1RBPA 3PDFA 4KCAA 4GJVA 4QYPA 5CSEA 4ZHGA 3FW4A 3HOEA 1VWCB 1LF7A 5AEOA 4BGFA 1LUQA 3P6EA 1SXXA 4YBUA 1TXLA 4IRWA 4IMOA 1YWCA 1IKJA 4GU8A 2QO5A 5HCDC 3WJDA 1BSOA 2E4JA 1TOUA 4O4OA 3WVMA 2GTLO 2HKDA 2YG2A 3SZIA 2BS5A 5H8TA 3RDMA 3ZW2A 1LCZA 3NX1A 2FKGA 2FT9A 3FW5A 4OS0A 3FR2A 5LJDA 1SMPI 2OVSA 1GM6A 3D96A 1NGLA 3FA8A 2ZAGA 4D6BA 1HXZA 5HWZA 3ZQ3A 3C76X 3OBLA 1I9HA 4O3WA 1E06A 1TVQA 2AT3X 1IJ8A 4OMXA 4ORUA 3KFIA 2CBRA 2FWVA 4WBKA 1VWPB 3T1DA 4CPFA 3NBXX 3UEWA 4I9SA 2DJGA 1IIUA 4EFGA 4YDAA 3B2LA 2O62A 4U9CA 1I78A 5D8JA 1WBIA 2AF5A 5K06A 1LPJA 3TGAA 3D9WA 3O19A 3ZUIA 1OEEA 1VWGB 2AT5X 5L8NA 1VWOB 1FEMA 1E2TA 2IZJA 5D47A 1EPBA 1LICA 1UREA 2R56A 2W2BA 3EW1A 5BVSA 1BWYA 1JBHA 2KW1A 1ICNA 3CBSA 4ZJ0A 4KC8A 1ALBA 1MVGA 4NP1A 1U17A 2IZDB 3CWKA 2I5ZO 5B2AO 1NP1A 2QOSC 4QYNA 1Y52X 3Q34A 1GKAA 2LFOA 3Q6LA 4IB6A 4YGHA 1LCVA 3PP6A 1WUBA 2QO6A 1SWCA 2FTBA 2QMIA 4PJ2A 5D45A 1FJ1E 5LJCA 3LHNA 4MIRA 1QY0A 4CPEA 1ADLA 4GGRA 1HMRA 1YWBA 2ALLX 4GNWA 1LIFA 2X32A 1DZJA 4GGTA 3B2KA 4O9SA 1OEJA 1HBQA 2MJIA 5EDBA 1VWBB 5HA0A 2CM9A 3OJYC 4ID2A 1B0OA 4BX7A 3FMZA 1UYOX 1YWAA 5HZ9A 1VYGA 1YWDA 4N7CA 4BCSA 5KICA 1NQNA 2OL7A 1KT6A 1MX7A 1XKIA 2BS6A 4ZH6A 2Z4IA 5HZ6A 4B55A 2OF9A 2M4LA 3CBCA 4GNYA 2OYBO 2VFBA 4JO6A 5KIDA 3APXA 1YUPA 2RTLA 4NNTA 1NBXA 1SXWA 3JSQA 2G7BA 4ORWA 4BJ8A 2FS6A 1HMSA 3P6HA 3FA7A 4R0BA 4NLJA 1I05A 3VG7A 4YH0A 2XKLA 1SWPA 3C77X 1JYJA 2K62A 4IB8A 4O4SA 5D4AA 4CDEA 2AL0X 2AT8X 3FEPA 3X00A 1GX8A 2RCQA 2RTNB 3HK1A 3VPJE 3BU1A 3CKFA 3WJGA 1SWNA 4ES7A 5H9KA 1B4MA 3VG3A 1MEPA 2KT4B 1VWNB 4AZNA 4YGZA 4QGVA 1ZNKA 2ASNX 3CR6A 1DC9A 1ERXA 1VWEB 1AVGI 2ZSCA 3S5XA 1LNMA 1SY0A 3LV4A 2GTFX 1SY3A 2OFMX 3HOLA 3RDUA 2RTOB 3ZW1B 1ERBA 1CBIA 1DZKA 4JNJA 2FS7A 3ZW0A 1BRPA 1QFTA 3F9DA 4YFRA 5H9LA 3TF6A 2QM9A 2RTRB 1RSUB 1T8VA 2L5PA 3EC5A 3NQ3A 1DF8A 1GKAB 1AB0A 1LIDA 3FEKA 3ZZVA 2NNDA 5LKEA 2RTKA 5HA1A 3RDOA 4QAEA 2LBAA 3WJFA 1BEBA 2A5CA 3I17A 3BRNA 2RCTA 2L9CA 1BSYA 4LQZA 5F1EA 3T6LA 1SWFA 2KTSA 4EXZA 1SRIA 1GXAA 2ACPX 4Z28A 5LJHA 1AVDA 1QQSA 2GC9A 1VWFB 3VG4A 4MVEA 2AKQA 4A8ZA 4Y5DA 5BYPA 1N9YA 1EXSA 2IZEB 3DSZA 2R74A 3VE1A 5IO6A 4M7MA 5FQ6E 2W2AA 1SWHA 3BX7A 1HQPA 2XSTA 3NX2A 2YMSA 3FLLA 2JOZA 3WOVA 1XCAA 1OBQA 1LDOA 1E02A 1EQDA 3KQ0A 2RD7C 3GAQA 4GD9A 2DM5A 1JJUA 3AUMO 2FR2A 3KVNA 3RE5A 3HWGA 2FKJA 1SWLA 1Y55X 3KFGA 4D6AA 1JMXA 5B11O 1SWQA 2HZRA 2IZLB 3O2YA 1E00A 2Z4HA 1SRJA 1E5PA 4BBOA 3SLOA 3S26A 1S2PA 3WZOA 2IZCB 4MVKA 3QKGA 4K19A 1N7YA 4GDAA 4GH7A 4L1NA 5HCEC 1A18A 3RDXA 3RY1A 1KZWA 1IFBA 3KFHA 5LJEA 5BVQA 2Q2PA 2OFAA 4GUZA 5FAZA 1LFOA 3PEDA 4LZVA 1HN2A 4EQAC 2RA6A 2OVAA 4Z2OA 1KT5A 1NP4A 4KIIA 1D2UA 2Q4NA 4Y0PA 4Y0RA 3ZW0B 1SWRA 5B27A 2OFRX 4NV8A 4OEMA 4TKJA 3RDQA 4ARHA 5KHPA 4HFOA 2X34A 4YCEA 2L68A 4EEJA 5LJKA 1STPA 1IKEA 2JGSA 1N43A 4XMDA 4CDCA 4YBPA 2K23A 3SZJA 5IO5A 4Y59A 1A57A 5LJGA 3IFBA 1ICMA 4JHQA 4N7DA 5HZ8A 1QY2A 1LIEA 4GZVA 3FELA 2RQ0A 4YFPA 2BT9A 4UU3A 2RTMA 4DNEA 1VYOA 4GETA 1RXKA 4BX5B 3ZUOA 1MM9A 1LIBA 3ZW1A 1LDQA 4GE1A 1GT4A 4INNA 3B2IA 3P6FA 1AVEA 4U8UM 3TGBA 4PSQA 5EPQA 3RWXA 4Z2PA 1ZNDA 4QQ1A 4XMFA 3RSWA 1LELA 1FTPA 2HYSA 5EEEA 1FENA 1H91A 3B2JA 1AELA 5B29A 4ALOA 1QG5A 4RUUA 2AT0X 1VWDB 4DCBA 1VYFA 2NP1A 4O4XA 2AMMX 2RTPB 2X8FA 1VWRB 3EBWA 3HWFA 4LKPA 3WJEA 2OY1O 3PECA 1KL3A 2HMBA 1KL4A 2LKKA 1OBUA 2C1SA 4A60A 4YFQA 1B56A 1OBPA 3STKA 4Z27A 1ZNLA 1O1UA 1ZRYA 5F7GA 1I04A 1CBSA 3BLGA 3HTYA 3HWEA 5FFHA 3VU1A 4GKCA 3WZPA 2IZAA 3WJBA 3FR5A 2X4MA 3P6GA 2A2UA 2JMBA 2OL6O 1KT7A 1EPAA 5EZ2A 3QQ2A 1NQMA 4TLJA 3WYQA 1MUPA 3BY0A 3CKGA 5B5GA 4CV7A 1VWMB 4LKTA 3FDCA 4ZHHA 4Z2VA 4KH8A 5JD2A 2MHDA 3KZAA 2F09A 4O49A 3WZNA 4ZHCA 2CZTA 1SWGA 3E3CA 3K3LA 4XMCA 3U9PC 1KXOA 1OEKA 4ZHFA 2X55A 1IFCA 4U8UN 1ACDA 1SWUA 3WBGA 5HTDA 2WQAE 2C1QA 2IZBA 1TOWA 2F73A 1LCWA 3EBKA 4HPCA 4BX6A 2JU3A 3MVFA 1JQPA 1GX3A 4WHIA 3NPOA 1ZNHA 2FHNX 4EKVA 4YDBA 1SLDB 2GH7A 2IZFB 4ZR2A 5BVTA 4O3YA 4NLIA 1HY2A 1DFVA 4XMHA 4DQ4A 2Q9SA 3EM0A 2RTHB 2CZUA 3T2WA 1DF3A 1KFFA 5F58A 4ZFXA 2A0AA 2X56A 4AYHA 1GT1A 3DTQA 4ZH9A 3SZHA 1BJ7A 1DZMA 1FE3A 2A2GA 3I0AA 2NNQA 1Y9TA 2EU7X 1VWHB 2BSZA 4YKMA 4QZTA 3SOTA 5CE4A 1NC9A 1SWJA 1SWOA 3RY2A 3D4RA 4ALBA 3IA8A 5B5FA 3ELZA 3NQKA 4ZCBA 3PH5A 2VDFA 1KGLA 1NDJA 5H9NA 3STMX 3UAQA 5C0NA 4U3QA 2OZQA 3BS2A 4MVIA 3VGWA 1STSB 2LA7A 2A3FX 3RBYA 1JJJA 1N4JA 2IZKA 4YGGA 2CBSA 2RTIB 1R0UA 3CQRA 4FBRA 3FA9A 4AZRA 2QOMA 4WFVA 5CYBA 2G8CO 3D97A 4BX5A 2GJ5A 3UEUA 1VWLB 5H9AA 1T68X 3ZI8A 3U03A 4IB9A 4WFUA 4OS8A 5B3MO 2POAA 1SA8A 4I9RA 5JR8A 4I60A 1W5RA 4QNIA 2UZ2A 4ZGFA 1G5WA 3PH6A 1UZ2X 1KQXA 5IRUA 5IRWA 4TQ2A 1X8NA 2F01A 2FR3A 2KD2A 4IAXA 1JJXA 3P24A 3MG5A 1SWAA 4IBAA 1QY1A 4O3ZA 1GT3A 1HBPA 2RTQB 3G7XA 3VHIA 1P6PA 1IW2A 3NQ9A 2L67A 2R73A 4QZUA 3EYCA 2AVIA 4XMGA 2MF6A 4BX6B 1SY1A 2OL8O 1N9MA 4HPDA 1ML7A 1T0VA 2RTGB 2LB6A 2WWPA 2X45A 5IRAA 3UEVA 4CPHA 3VHMA 3CMPA 2FRSA 1SLEB 2WR6A 4HPAA 4MEEA 4TNNA 2AT6X 2JW1A 4YKOA 2A5BA 1JV4A 1Y53X 2MM3A 2RTBB 4A1HA 1Y0GA 3PQUA 3V8UA 2PY1A 3AKMA 3O22A 3SAOA 1SY2A 1TW4A 4EDEA 5HAEA 1D3SA 2RTAA 2MO5A 4FGIB 5HTEA 1VWIB 1PTSA 4FBOA 5FQ7E 3S5VA 1HXLA 3BSZE 5FQ8E 1G85A 2HZQA 4ORSA 1X8UA 2LBVA 1U18A 3UEXA 1BLRA 4OMWA 4CPIA 3BX8A 1RXJA 4GK9A 2CAMA 1ZNGA 1VWKB 2WEXA 1BBPA 3P6DA 5F6ZA 1PEEA 4L3RA 2IZGB 2RTCB 4I3CA 2BHVA 4YMYA 1QABE 3FYFA 2Y3FA 4M6SA 4U8UO 1O8VA 4FQBB 4CK4A 1CJ5A 3APUA 4AZQA 1B8EA 5AJCA 5B10O 1O1VA 3P6CA 1UYNX 5F6BA 2HLVA 5LKFA 5L8IA 1DZPA 2Q2MA 3PK2A 3EW2A 4AZPA 2KTDA 5L8OA 2MWHA 4OS3A 5DPQA 4AZOA 1X71A 1STRB 2GTLM 4U46A 4Y0QA 1SWBA 4QGXA 3APWA 1OPAA 4TJZA 1QFVA 1ZNEA 2G5LA 1YP6A 1Z24A 1SRHA 3PQSA 1GGLA 4OKAA 5EEDA 4NV7A 3T2XA 3S60A 1W6FA 5CHKA 1YP7A 4GRJA 2FLJA 1KL5A 2AH7X 1A2DA 2A13A 4BVMA 2WEWA 1JIWI 3FENA 3OE3A 3VG2A 3JS1A 5AJBA 3WYPA 2OY7A 3TGCA 2WUTA 2WPUA 3F8AA 3MM0A 4YVBA 3D95A 1SWEA 3HPEA 1RLBE 4HPBA 1KOIA 2RTJA 1K3BA 3B2HA 3FR4A 2UYWA 4ORRA 4ORYA 4QRLA 4IABA 3RKGA 3NR3A 5IXGA 1PBOA 1VWJB 1EW3A 4FBVA 3GE2A 1JMZA 2FGSA 4NYRA 4TKHA 5DG4A 3WZQA 4CPHB 1JZUA 2G79A 4NNSA 1JYDA 1KZXA 1X8OA 4CDDA 1FELA 5K68A 1W4TA 1SXUA 4I95A 3STNA 3VHHA 4NYQA 2OFBA 4CDFA 2X8TA 2X8SA 3AEHA 1RXHA 4HWMA 5HZQA 2N93A 1YIVA 3MBTA 3PPTA 4OELA 1BM5A 1EIOA 2IZIA 1MX8A 1MOYA 1OSPO 4YCHA 2C4IA 1N0SA 4NW4A 2DJFA 3MX7A 5HCCC 1SLFB 4I3BA 4AW8A 4GGZA 1S44A 2IZHB 5HZ5A 1MDCA 4ORXA 1RAVA 1BSQA 2GTLN 4ON1A 4C5PA 4TKBA 3C78X 4I6SA 1I4UA 4ZGUA 1I06A 2JN3A 3NADA 1FDQA 3RDSA 2JU8A 3SLTA 4AZMA 1X8PA 3N91A 2VFCA 2ANSA 3ELXA 2ACOA 3FIDA 2QCBA 4KT5A 1KQWA 3WXQA 4A1YA 2CM4A 5LJBA 4RUNA 2Y3EA 2IFBA 3P02A 1DV9A 2A8GA 2WSJA 1PBYA 3FA6A 4ZHDA 1EUOA 3L4RA 1SWDA 4ODDA 3VG6A 1SXYA 5HBSA 3AKNA 3SLJA 1GT5A 3CQNA 4GJSA 1CBQA 5EDCA
chains in the Genus database with same CATH topology
3OD9A 4MVLA 5FENA 2WQ9A 1CRBA 4BOEA 3H3IA 1S7DA 4BQUA 5AQ6A 2G78A 2BLGA 2NNEA 1LKEA 2JU7A 1EIIA 1A3YA 4LZUA 1EI5A 2OVDA 3APVA 4ML7B 1L6MA 4O4UA 3JQOA 3NP1A 4O3XB 2P8GA 5D48A 4DQ3A 4IAWA 2W2FA 3VE2A 3FIQA 1PMPA 4GDZA 4COTA 3F6ZB 1KT4A 1QWDA 2QO4A 1GX9A 4XMEA 4QGWA 1X89A 1PM1X 1OPBA 3ZWEA 4KC7A 3BDRA 1BRQA 1AQBA 4I3DA 2X46A 1HMTA 3TZSA 4JGLA 2OVEA 2ZAIA 1U0XA 2Q39A 4MISA 3KFFA 1EALA 4IMNA 1VPRA 5IO7A 3RZYA 1KT3A 3VG5A 3WJCA 2HNXA 3U0DA 1G7NA 4Y0SA 3EMMA 4IB7A 1X8QA 4UU2A 2RN4A 1CBRA 4CSBA 3HWDA 1G74A 1Y9LA 3BU9A 1RBPA 4KCAA 4QYPA 4ZHGA 3FW4A 3HOEA 1LF7A 5AEOA 3P6EA 1SXXA 4YBUA 1TXLA 4IMOA 1YWCA 1IKJA 4GU8A 2QO5A 5HCDC 3WJDA 1BSOA 2E4JA 1TOUA 4O4OA 3WVMA 2GTLO 2YG2A 3ZW2A 2BS5A 5H8TA 3NX1A 2FT9A 3FW5A 4OS0A 3FR2A 5LJDA 1SMPI 2OVSA 1GM6A 3D96A 1NGLA 3FA8A 2ZAGA 4D6BA 5HWZA 3ZQ3A 3C76X 3OBLA 4O3WA 1E06A 1TVQA 2AT3X 4OMXA 4ORUA 3KFIA 2CBRA 2FWVA 4WBKA 3T1DA 3NBXX 3UEWA 4I9SA 1IIUA 4EFGA 4YDAA 3B2LA 2O62A 4U9CA 5D8JA 5K06A 1LPJA 3TGAA 3O19A 3ZUIA 1OEEA 2AT5X 5L8NA 1FEMA 5D47A 1EPBA 1LICA 1UREA 2R56A 2W2BA 5BVSA 1BWYA 1JBHA 2KW1A 1ICNA 3CBSA 4ZJ0A 4KC8A 1ALBA 1MVGA 4NP1A 1U17A 3CWKA 1NP1A 2QOSC 4QYNA 1GKAA 2LFOA 3Q6LA 4IB6A 4YGHA 3PP6A 2QO6A 2FTBA 2QMIA 4PJ2A 5D45A 5LJCA 3LHNA 4MIRA 1QY0A 1ADLA 1HMRA 1YWBA 2ALLX 4GNWA 1LIFA 1DZJA 3B2KA 4O9SA 1OEJA 1HBQA 2MJIA 5EDBA 5HA0A 2CM9A 3OJYC 4ID2A 1B0OA 3FMZA 1YWAA 5HZ9A 1VYGA 1YWDA 4N7CA 5KICA 1KT6A 1MX7A 1XKIA 2BS6A 4ZH6A 2Z4IA 5HZ6A 2M4LA 3CBCA 4GNYA 3APXA 1YUPA 4NNTA 1SXWA 3JSQA 2G7BA 4ORWA 2FS6A 1HMSA 3P6HA 3FA7A 4R0BA 4NLJA 1I05A 3VG7A 4YH0A 2XKLA 4IB8A 3C77X 1JYJA 2K62A 5D4AA 4O4SA 2AL0X 2AT8X 3FEPA 1GX8A 2RCQA 3HK1A 3VPJE 3BU1A 3WJGA 4ES7A 5H9KA 1B4MA 3VG3A 2KT4B 4AZNA 4YGZA 4QGVA 1ZNKA 2ASNX 3CR6A 1DC9A 1ERXA 1AVGI 3S5XA 3U03A 1LNMA 1SY0A 3LV4A 2GTFX 1SY3A 2OFMX 3HOLA 3ZW1B 1ERBA 1CBIA 1DZKA 2FS7A 3ZW0A 1BRPA 1QFTA 3F9DA 4YFRA 5H9LA 3TF6A 2QM9A 3NQ3A 4YCEA 1T8VA 2L5PA 3ZZVA 1GKAB 1AB0A 1LIDA 3FEKA 5LKEA 2NNDA 5HA1A 4QAEA 2LBAA 3WJFA 1BEBA 3I17A 3BRNA 2RCTA 2L9CA 1BSYA 4LQZA 5F1EA 4EXZA 2KTSA 2ACPX 1GXAA 5LJHA 1QQSA 2GC9A 3VG4A 4MVEA 2AKQA 4A8ZA 5BYPA 1EXSA 5IO6A 3DSZA 2R74A 3VE1A 4M7MA 5FQ6E 2W2AA 3BX7A 1HQPA 2XSTA 3NX2A 2YMSA 3FLLA 2JOZA 3WOVA 1XCAA 1OBQA 1E02A 3KQ0A 1EQDA 2RD7C 3GAQA 2DM5A 2FR2A 3HWGA 3KFGA 4D6AA 2HZRA 3O2YA 1E00A 2Z4HA 1E5PA 3S26A 1S2PA 4MVKA 3QKGA 4K19A 4GH7A 4L1NA 5HCEC 1A18A 1KZWA 1IFBA 3KFHA 5LJEA 5BVQA 2Q2PA 5FAZA 1LFOA 3PEDA 4LZVA 1HN2A 4EQAC 2RA6A 2OVAA 1KT5A 1NP4A 4KIIA 1D2UA 2Q4NA 4Y0PA 4Y0RA 3ZW0B 5B27A 2OFRX 4ARHA 4TKJA 5KHPA 4HFOA 2L68A 4EEJA 5LJKA 5IO5A 1IKEA 4XMDA 4YBPA 2K23A 1A57A 5LJGA 3IFBA 1ICMA 4N7DA 5HZ8A 1QY2A 1LIEA 4GZVA 3FELA 2RQ0A 4YFPA 2BT9A 4UU3A 4GETA 3ZUOA 1LIBA 3ZW1A 4GE1A 4INNA 1GT4A 3B2IA 3P6FA 4U8UM 3TGBA 4PSQA 5EPQA 3RWXA 1ZNDA 4QQ1A 4XMFA 3RSWA 1FTPA 2HYSA 5EEEA 1FENA 1H91A 3B2JA 1AELA 5B29A 4ALOA 1QG5A 4RUUA 2AT0X 1VYFA 2NP1A 4O4XA 2AMMX 2X8FA 3EBWA 3HWFA 4LKPA 3WJEA 3PECA 2HMBA 2LKKA 1OBUA 4A60A 4YFQA 1B56A 1OBPA 3STKA 1ZNLA 1O1UA 1ZRYA 5F7GA 1I04A 1CBSA 3BLGA 3HTYA 3HWEA 5FFHA 3VU1A 4GKCA 3WJBA 3FR5A 3P6GA 2A2UA 2JMBA 1KT7A 1EPAA 5EZ2A 4TLJA 1MUPA 3BY0A 4CV7A 4LKTA 4ZHHA 4KH8A 2MHDA 3KZAA 2F09A 4O49A 4ZHCA 2CZTA 3K3LA 3E3CA 4XMCA 3U9PC 1KXOA 1OEKA 4ZHFA 1IFCA 4U8UN 1ACDA 3WBGA 5HTDA 2WQAE 1TOWA 2F73A 3EBKA 4HPCA 2JU3A 3MVFA 4WHIA 3NPOA 1ZNHA 4YDBA 4ZR2A 5BVTA 4O3YA 4NLIA 4XMHA 1DFVA 4DQ4A 2Q9SA 3EM0A 1DF3A 2CZUA 5F58A 4ZFXA 2A0AA 4AYHA 1GT1A 3DTQA 4ZH9A 1BJ7A 1DZMA 1FE3A 2A2GA 3I0AA 2NNQA 1Y9TA 2EU7X 4YKMA 4QZTA 3SOTA 5CE4A 4ALBA 3D4RA 3IA8A 3ELZA 3NQKA 4ZCBA 3PH5A 1KGLA 3UAQA 5H9NA 3STMX 5C0NA 4U3QA 2OZQA 3BS2A 4MVIA 2LA7A 3RBYA 2A3FX 1JJJA 4YGGA 2CBSA 4FBRA 1R0UA 3CQRA 3FA9A 4AZRA 4WFVA 5CYBA 3D97A 2GJ5A 3UEUA 5H9AA 1T68X 3ZI8A 4IB9A 4WFUA 4OS8A 2POAA 1SA8A 4I9RA 5JR8A 4QNIA 4ZGFA 1G5WA 3PH6A 1UZ2X 1KQXA 4TQ2A 1X8NA 2KD2A 2FR3A 4IAXA 1JJXA 3P24A 4IBAA 1QY1A 4O3ZA 1GT3A 1HBPA 3G7XA 1P6PA 1IW2A 3NQ9A 2L67A 2R73A 4QZUA 3EYCA 4XMGA 1SY1A 4HPDA 1ML7A 1T0VA 2WWPA 2LB6A 2X45A 3UEVA 3CMPA 2FRSA 2WR6A 4HPAA 4TNNA 2AT6X 2JW1A 4YKOA 1JV4A 2MM3A 4A1HA 3V8UA 3PQUA 2PY1A 3AKMA 3O22A 3SAOA 1SY2A 1TW4A 4EDEA 5HAEA 1D3SA 2MO5A 4FGIB 5HTEA 4FBOA 5FQ7E 3S5VA 3BSZE 5FQ8E 1G85A 2HZQA 4ORSA 1X8UA 2LBVA 1U18A 3UEXA 1BLRA 4OMWA 3BX8A 4GK9A 1ZNGA 2WEXA 3P6DA 1BBPA 5F6ZA 1PEEA 4L3RA 4I3CA 2BHVA 4YMYA 1QABE 3FYFA 4M6SA 4U8UO 1CJ5A 1O8VA 4FQBB 4CK4A 3APUA 4AZQA 1B8EA 5AJCA 1O1VA 3P6CA 5F6BA 2HLVA 5LKFA 5L8IA 1DZPA 2Q2MA 4AZPA 2KTDA 5L8OA 2MWHA 4OS3A 5DPQA 4AZOA 1X71A 2GTLM 4Y0QA 4QGXA 3APWA 1OPAA 4TJZA 1QFVA 1ZNEA 3PQSA 1YP6A 1Z24A 5EEDA 1GGLA 3S60A 1YP7A 4GRJA 2FLJA 2AH7X 1A2DA 2A13A 4BVMA 2WEWA 1JIWI 3FENA 3OE3A 3VG2A 3JS1A 5AJBA 3TGCA 2WUTA 3F8AA 3D95A 4HPBA 1RLBE 4ORRA 1KOIA 4ORYA 3B2HA 3FR4A 4QRLA 4IABA 3RKGA 3NR3A 1PBOA 1EW3A 4FBVA 3GE2A 4NYRA 4TKHA 5DG4A 1JZUA 2G79A 4NNSA 1JYDA 1KZXA 1X8OA 1FELA 1SXUA 4I95A 3STNA 4NYQA 2X8TA 2X8SA 4HWMA 5HZQA 2N93A 1YIVA 3MBTA 3PPTA 1BM5A 1EIOA 1MX8A 4YCHA 4NW4A 1N0SA 3MX7A 5HCCC 4I3BA 4AW8A 5HZ5A 1S44A 5KIDA 1MDCA 4ORXA 2GTLN 1BSQA 4ON1A 4TKBA 3C78X 4I6SA 1I4UA 4ZGUA 1I06A 2JN3A 3NADA 1FDQA 4AZMA 2JU8A 1X8PA 3N91A 4KT5A 2ANSA 3ELXA 2ACOA 3WXQA 1KQWA 4A1YA 2CM4A 5LJBA 4RUNA 2IFBA 3P02A 1DV9A 2WSJA 3FA6A 4ZHDA 1EUOA 3L4RA 4ODDA 3VG6A 1SXYA 5HBSA 3AKNA 1GT5A 3CQNA 1CBQA 5EDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVL A;  5FEN A;  2WQ9 A;  1CRB A;  4BOE A;  1S7D A;  4BQU A;  5AQ6 A;  2G78 A;  2BLG A;  2NNE A;  1LKE A;  2JU7 A;  1EII A;  1A3Y A;  4LZU A;  2OVD A;  3APV A;  1L6M A;  3NP1 A;  5D48 A;  2P8G A;  4DQ3 A;  4IAW A;  2W2F A;  3FIQ A;  1PMP A;  1KT4 A;  1QWD A;  2QO4 A;  1GX9 A;  4XME A;  4QGW A;  1X89 A;  1PM1 X;  1OPB A;  3BDR A;  1BRQ A;  1AQB A;  4I3D A;  2X46 A;  1HMT A;  3TZS A;  2OVE A;  1U0X A;  2Q39 A;  3KFF A;  1EAL A;  4IMN A;  1VPR A;  5IO7 A;  3RZY A;  1KT3 A;  3VG5 A;  3WJC A;  2HNX A;  3U0D A;  1G7N A;  4Y0S A;  3EMM A;  4IB7 A;  1X8Q A;  4UU2 A;  1CBR A;  3HWD A;  1G74 A;  3BU9 A;  1RBP A;  4QYP A;  4ZHG A;  3FW4 A;  1LF7 A;  3P6E A;  1SXX A;  4YBU A;  1TXL A;  4IMO A;  1YWC A;  1IKJ A;  2QO5 A;  5HCD C;  3WJD A;  1BSO A;  2E4J A;  1TOU A;  3WVM A;  2YG2 A;  5H8T A;  3NX1 A;  2FT9 A;  3FW5 A;  4OS0 A;  3FR2 A;  5LJD A;  1GM6 A;  3D96 A;  1NGL A;  3FA8 A;  4D6B A;  5HWZ A;  3ZQ3 A;  3C76 X;  4ORU A;  1E06 A;  1TVQ A;  2AT3 X;  4OMX A;  3KFI A;  2CBR A;  2FWV A;  4WBK A;  3T1D A;  3UEW A;  4I9S A;  1IIU A;  4EFG A;  4YDA A;  3B2L A;  2O62 A;  5D8J A;  5K06 A;  1LPJ A;  3TGA A;  3O19 A;  3ZUI A;  1OEE A;  2AT5 X;  5L8N A;  1FEM A;  5D47 A;  1EPB A;  2W2B A;  1LIC A;  1URE A;  2R56 A;  5BVS A;  1BWY A;  1JBH A;  1ICN A;  3CBS A;  4ZJ0 A;  1ALB A;  1MVG A;  4NP1 A;  1U17 A;  3CWK A;  1NP1 A;  2QOS C;  4QYN A;  1GKA A;  2LFO A;  3Q6L A;  4IB6 A;  4YGH A;  3PP6 A;  2QO6 A;  2FTB A;  5D45 A;  5LJC A;  1QY0 A;  1ADL A;  1HMR A;  1YWB A;  2ALL X;  4GNW A;  1LIF A;  1DZJ A;  3B2K A;  4O9S A;  1OEJ A;  1HBQ A;  2MJI A;  5EDB A;  5HA0 A;  2CM9 A;  3OJY C;  1B0O A;  3FMZ A;  1YWA A;  5HZ9 A;  1VYG A;  1YWD A;  4N7C A;  5KIC A;  1KT6 A;  1MX7 A;  1XKI A;  4ZH6 A;  5HZ6 A;  3CBC A;  4GNY A;  3APX A;  1YUP A;  4NNT A;  1SXW A;  3JSQ A;  2G7B A;  4ORW A;  2FS6 A;  1HMS A;  3P6H A;  3FA7 A;  4R0B A;  4NLJ A;  1I05 A;  3VG7 A;  4YH0 A;  2XKL A;  4IB8 A;  3C77 X;  1JYJ A;  2K62 A;  5D4A A;  2AL0 X;  2AT8 X;  3FEP A;  1GX8 A;  2RCQ A;  3HK1 A;  3BU1 A;  3WJG A;  4ES7 A;  5H9K A;  1B4M A;  3VG3 A;  2KT4 B;  4AZN A;  4YGZ A;  4QGV A;  1ZNK A;  2ASN X;  3CR6 A;  1DC9 A;  1ERX A;  1AVG I;  3U03 A;  1LNM A;  1SY0 A;  2GTF X;  1SY3 A;  2OFM X;  1ERB A;  1CBI A;  1DZK A;  2FS7 A;  1BRP A;  1QFT A;  3F9D A;  4YFR A;  5H9L A;  3TF6 A;  2QM9 A;  3NQ3 A;  4YCE A;  1T8V A;  2L5P A;  1GKA B;  1AB0 A;  1LID A;  3FEK A;  5LKE A;  2NND A;  5HA1 A;  4QAE A;  2LBA A;  3WJF A;  1BEB A;  3I17 A;  3BRN A;  2RCT A;  2L9C A;  1BSY A;  5F1E A;  4EXZ A;  2ACP X;  1GXA A;  5LJH A;  1QQS A;  2GC9 A;  3VG4 A;  2AKQ A;  4A8Z A;  1EXS A;  5IO6 A;  3DSZ A;  2R74 A;  4M7M A;  2W2A A;  3BX7 A;  1HQP A;  2XST A;  3NX2 A;  3FLL A;  2JOZ A;  1XCA A;  1OBQ A;  1E02 A;  3KQ0 A;  1EQD A;  2RD7 C;  3GAQ A;  2DM5 A;  2FR2 A;  3HWG A;  3KFG A;  4D6A A;  2HZR A;  3O2Y A;  1E00 A;  1E5P A;  3S26 A;  1S2P A;  4MVK A;  3QKG A;  4K19 A;  4GH7 A;  5HCE C;  1A18 A;  1KZW A;  1IFB A;  3KFH A;  5LJE A;  5BVQ A;  2Q2P A;  5FAZ A;  1LFO A;  3PED A;  4LZV A;  1HN2 A;  2RA6 A;  2OVA A;  1KT5 A;  1NP4 A;  4KII A;  1D2U A;  2Q4N A;  4Y0P A;  4Y0R A;  5B27 A;  2OFR X;  4ARH A;  4TKJ A;  5KHP A;  4HFO A;  2L68 A;  4EEJ A;  5LJK A;  5IO5 A;  1IKE A;  4XMD A;  4YBP A;  2K23 A;  1A57 A;  5LJG A;  3IFB A;  1ICM A;  4N7D A;  5HZ8 A;  1QY2 A;  1LIE A;  3FEL A;  2RQ0 A;  4YFP A;  4UU3 A;  4GET A;  3ZUO A;  1LIB A;  4GE1 A;  1GT4 A;  3B2I A;  3P6F A;  3TGB A;  4PSQ A;  5EPQ A;  1ZND A;  4XMF A;  3RSW A;  1FTP A;  2HYS A;  5EEE A;  1FEN A;  1H91 A;  3B2J A;  1AEL A;  5B29 A;  4ALO A;  1QG5 A;  4RUU A;  2AT0 X;  1VYF A;  2NP1 A;  2AMM X;  3EBW A;  3HWF A;  4LKP A;  3WJE A;  3PEC A;  2HMB A;  2LKK A;  1OBU A;  4A60 A;  4YFQ A;  1B56 A;  1OBP A;  3STK A;  1ZNL A;  1O1U A;  1ZRY A;  5F7G A;  1I04 A;  1CBS A;  3BLG A;  5FFH A;  3HWE A;  4GKC A;  3WJB A;  3FR5 A;  3P6G A;  2A2U A;  1KT7 A;  1EPA A;  5EZ2 A;  4TLJ A;  1MUP A;  3BY0 A;  4LKT A;  4ZHH A;  3KZA A;  4ZHC A;  2CZT A;  3K3L A;  4XMC A;  3U9P C;  1KXO A;  1OEK A;  4ZHF A;  1IFC A;  1ACD A;  3WBG A;  5HTD A;  2WQA E;  1TOW A;  2F73 A;  3EBK A;  4HPC A;  2JU3 A;  3MVF A;  3NPO A;  1ZNH A;  4YDB A;  4ZR2 A;  5BVT A;  4NLI A;  4XMH A;  1DFV A;  4DQ4 A;  2Q9S A;  3EM0 A;  1DF3 A;  2CZU A;  5F58 A;  4ZFX A;  2A0A A;  4AYH A;  1GT1 A;  3DTQ A;  4ZH9 A;  1BJ7 A;  1DZM A;  1FE3 A;  2A2G A;  3I0A A;  2NNQ A;  2EU7 X;  4YKM A;  4QZT A;  5CE4 A;  4ALB A;  3IA8 A;  3ELZ A;  4ZCB A;  3PH5 A;  1KGL A;  5H9N A;  3STM X;  5C0N A;  2OZQ A;  3BS2 A;  4MVI A;  2A3F X;  1JJJ A;  4YGG A;  2CBS A;  1R0U A;  3CQR A;  3FA9 A;  4AZR A;  4WFV A;  3D97 A;  2GJ5 A;  3UEU A;  5H9A A;  1T68 X;  4IB9 A;  4WFU A;  4OS8 A;  2POA A;  1SA8 A;  4I9R A;  5JR8 A;  1G5W A;  3PH6 A;  1UZ2 X;  1KQX A;  4TQ2 A;  1X8N A;  2FR3 A;  4IAX A;  1JJX A;  4IBA A;  1QY1 A;  1GT3 A;  1HBP A;  3G7X A;  1P6P A;  1IW2 A;  3NQ9 A;  2L67 A;  2R73 A;  4QZU A;  3EYC A;  4XMG A;  1SY1 A;  4HPD A;  1ML7 A;  1T0V A;  2WWP A;  2LB6 A;  2X45 A;  3UEV A;  3CMP A;  2FRS A;  2WR6 A;  4HPA A;  4TNN A;  2AT6 X;  4YKO A;  1JV4 A;  2MM3 A;  4A1H A;  2PY1 A;  3AKM A;  3O22 A;  3SAO A;  1SY2 A;  1TW4 A;  4EDE A;  5HAE A;  1D3S A;  2MO5 A;  5HTE A;  3BSZ E;  1G85 A;  2HZQ A;  4ORS A;  1X8U A;  2LBV A;  1U18 A;  3UEX A;  1BLR A;  4OMW A;  3BX8 A;  2WEX A;  1ZNG A;  3P6D A;  1BBP A;  5F6Z A;  1PEE A;  4I3C A;  4YMY A;  1QAB E;  4M6S A;  1CJ5 A;  1O8V A;  4CK4 A;  3APU A;  4AZQ A;  1B8E A;  1O1V A;  3P6C A;  5F6B A;  2HLV A;  5LKF A;  5L8I A;  1DZP A;  2Q2M A;  4AZP A;  2KTD A;  5L8O A;  4OS3 A;  5DPQ A;  4AZO A;  1X71 A;  4Y0Q A;  4QGX A;  3APW A;  1OPA A;  4TJZ A;  1QFV A;  1ZNE A;  1YP6 A;  1Z24 A;  5EED A;  1GGL A;  1YP7 A;  4GRJ A;  2FLJ A;  2AH7 X;  1A2D A;  2A13 A;  4BVM A;  2WEW A;  3VG2 A;  3FEN A;  3JS1 A;  3TGC A;  2WUT A;  3F8A A;  3D95 A;  4HPB A;  1RLB E;  4ORR A;  1KOI A;  4ORY A;  3B2H A;  3FR4 A;  3NR3 A;  1PBO A;  1EW3 A;  4TKH A;  4NYR A;  5DG4 A;  1JZU A;  2G79 A;  4NNS A;  1JYD A;  1KZX A;  1X8O A;  1FEL A;  1SXU A;  3STN A;  4NYQ A;  5HZQ A;  2N93 A;  1YIV A;  3MBT A;  3PPT A;  1BM5 A;  1EIO A;  1MX8 A;  4YCH A;  1N0S A;  5HCC C;  4I3B A;  4AW8 A;  5HZ5 A;  1S44 A;  5KID A;  1MDC A;  4ORX A;  1BSQ A;  4TKB A;  3C78 X;  1I4U A;  4ZGU A;  1I06 A;  2JN3 A;  3NAD A;  1FDQ A;  4AZM A;  2JU8 A;  1X8P A;  2ANS A;  3ELX A;  2ACO A;  3WXQ A;  1KQW A;  4A1Y A;  2CM4 A;  5LJB A;  4RUN A;  2IFB A;  1DV9 A;  2WSJ A;  3FA6 A;  4ZHD A;  1EUO A;  3L4R A;  4ODD A;  3VG6 A;  1SXY A;  5HBS A;  3AKN A;  1GT5 A;  3CQN A;  1CBQ A;  5EDC A; 
#chains in the Genus database with same CATH topology
 3OD9 A;  4MVL A;  2OF8 A;  2WQ9 A;  1K24 A;  5FEN A;  1CRB A;  2PI3 O;  4BOE A;  1SRG A;  2Y32 A;  1S7D A;  1SRF A;  2RTD B;  3H3I A;  5AQ6 A;  4BQU A;  2G78 A;  2BLG A;  2NNE A;  1LKE A;  2JU7 A;  5L3Y A;  1SLG B;  1A3Y A;  4LZU A;  1EII A;  2OY8 A;  1EI5 A;  2OVD A;  3APV A;  3LTW A;  4ML7 B;  1VWQ B;  1L6M A;  4O4U A;  3JQO A;  1SWS A;  3NP1 A;  2P8G A;  4O3X B;  5D48 A;  4DQ3 A;  4IAW A;  2W2F A;  3VE2 A;  3FIQ A;  5K67 A;  1PMP A;  4GDZ A;  4COT A;  4Z6J A;  3F6Z B;  1SWK A;  2OY5 O;  1KT4 A;  1QWD A;  2QO4 A;  1GX9 A;  1HQQ A;  4XME A;  1RST B;  4QGW A;  3T6F A;  1X89 A;  1PM1 X;  1OPB A;  2FHL A;  3ZWE A;  4KC7 A;  3BDR A;  5F2B A;  1BRQ A;  1AQB A;  4I3D A;  2X46 A;  1HMT A;  3TZS A;  4JGL A;  2OVE A;  2ZAI A;  1SWT A;  1U0X A;  2Q39 A;  4MIS A;  3KFF A;  1EAL A;  4IMN A;  1VPR A;  5IO7 A;  3RZY A;  1KT3 A;  4BX7 B;  1VWA B;  3VG5 A;  3WJC A;  2RTE B;  2HNX A;  3U0D A;  1G7N A;  4Y0S A;  2I5V O;  3EMM A;  4IB7 A;  1MK5 A;  3RE6 A;  1X8Q A;  2BC3 A;  2RN4 A;  4UU2 A;  1CBR A;  2RTF B;  4CSB A;  3HWD A;  1G74 A;  1SRE A;  1Y9L A;  3BU9 A;  1RBP A;  3PDF A;  4KCA A;  4GJV A;  4QYP A;  5CSE A;  4ZHG A;  3FW4 A;  3HOE A;  1VWC B;  1LF7 A;  5AEO A;  4BGF A;  1LUQ A;  3P6E A;  1SXX A;  4YBU A;  1TXL A;  4IRW A;  4IMO A;  1YWC A;  1IKJ A;  4GU8 A;  2QO5 A;  5HCD C;  3WJD A;  1BSO A;  2E4J A;  1TOU A;  4O4O A;  3WVM A;  2GTL O;  2HKD A;  2YG2 A;  3SZI A;  2BS5 A;  5H8T A;  3RDM A;  3ZW2 A;  1LCZ A;  3NX1 A;  2FKG A;  2FT9 A;  3FW5 A;  4OS0 A;  3FR2 A;  5LJD A;  1SMP I;  2OVS A;  1GM6 A;  3D96 A;  1NGL A;  3FA8 A;  2ZAG A;  4D6B A;  1HXZ A;  5HWZ A;  3ZQ3 A;  3C76 X;  3OBL A;  1I9H A;  4O3W A;  1E06 A;  1TVQ A;  2AT3 X;  1IJ8 A;  4OMX A;  4ORU A;  3KFI A;  2CBR A;  2FWV A;  4WBK A;  1VWP B;  3T1D A;  4CPF A;  3NBX X;  3UEW A;  4I9S A;  2DJG A;  1IIU A;  4EFG A;  4YDA A;  3B2L A;  2O62 A;  4U9C A;  1I78 A;  5D8J A;  1WBI A;  2AF5 A;  5K06 A;  1LPJ A;  3TGA A;  3D9W A;  3O19 A;  3ZUI A;  1OEE A;  1VWG B;  2AT5 X;  5L8N A;  1VWO B;  1FEM A;  1E2T A;  2IZJ A;  5D47 A;  1EPB A;  1LIC A;  1URE A;  2R56 A;  2W2B A;  3EW1 A;  5BVS A;  1BWY A;  1JBH A;  2KW1 A;  1ICN A;  3CBS A;  4ZJ0 A;  4KC8 A;  1ALB A;  1MVG A;  4NP1 A;  1U17 A;  2IZD B;  3CWK A;  2I5Z O;  5B2A O;  1NP1 A;  2QOS C;  4QYN A;  1Y52 X;  3Q34 A;  1GKA A;  2LFO A;  3Q6L A;  4IB6 A;  4YGH A;  1LCV A;  3PP6 A;  1WUB A;  2QO6 A;  1SWC A;  2FTB A;  2QMI A;  4PJ2 A;  5D45 A;  1FJ1 E;  5LJC A;  3LHN A;  4MIR A;  1QY0 A;  4CPE A;  1ADL A;  4GGR A;  1HMR A;  1YWB A;  2ALL X;  4GNW A;  1LIF A;  2X32 A;  1DZJ A;  4GGT A;  3B2K A;  4O9S A;  1OEJ A;  1HBQ A;  2MJI A;  5EDB A;  1VWB B;  5HA0 A;  2CM9 A;  3OJY C;  4ID2 A;  1B0O A;  4BX7 A;  3FMZ A;  1UYO X;  1YWA A;  5HZ9 A;  1VYG A;  1YWD A;  4N7C A;  4BCS A;  5KIC A;  1NQN A;  2OL7 A;  1KT6 A;  1MX7 A;  1XKI A;  2BS6 A;  4ZH6 A;  2Z4I A;  5HZ6 A;  4B55 A;  2OF9 A;  2M4L A;  3CBC A;  4GNY A;  2OYB O;  2VFB A;  4JO6 A;  5KID A;  3APX A;  1YUP A;  2RTL A;  4NNT A;  1NBX A;  1SXW A;  3JSQ A;  2G7B A;  4ORW A;  4BJ8 A;  2FS6 A;  1HMS A;  3P6H A;  3FA7 A;  4R0B A;  4NLJ A;  1I05 A;  3VG7 A;  4YH0 A;  2XKL A;  1SWP A;  3C77 X;  1JYJ A;  2K62 A;  4IB8 A;  4O4S A;  5D4A A;  4CDE A;  2AL0 X;  2AT8 X;  3FEP A;  3X00 A;  1GX8 A;  2RCQ A;  2RTN B;  3HK1 A;  3VPJ E;  3BU1 A;  3CKF A;  3WJG A;  1SWN A;  4ES7 A;  5H9K A;  1B4M A;  3VG3 A;  1MEP A;  2KT4 B;  1VWN B;  4AZN A;  4YGZ A;  4QGV A;  1ZNK A;  2ASN X;  3CR6 A;  1DC9 A;  1ERX A;  1VWE B;  1AVG I;  2ZSC A;  3S5X A;  1LNM A;  1SY0 A;  3LV4 A;  2GTF X;  1SY3 A;  2OFM X;  3HOL A;  3RDU A;  2RTO B;  3ZW1 B;  1ERB A;  1CBI A;  1DZK A;  4JNJ A;  2FS7 A;  3ZW0 A;  1BRP A;  1QFT A;  3F9D A;  4YFR A;  5H9L A;  3TF6 A;  2QM9 A;  2RTR B;  1RSU B;  1T8V A;  2L5P A;  3EC5 A;  3NQ3 A;  1DF8 A;  1GKA B;  1AB0 A;  1LID A;  3FEK A;  3ZZV A;  2NND A;  5LKE A;  2RTK A;  5HA1 A;  3RDO A;  4QAE A;  2LBA A;  3WJF A;  1BEB A;  2A5C A;  3I17 A;  3BRN A;  2RCT A;  2L9C A;  1BSY A;  4LQZ A;  5F1E A;  3T6L A;  1SWF A;  2KTS A;  4EXZ A;  1SRI A;  1GXA A;  2ACP X;  4Z28 A;  5LJH A;  1AVD A;  1QQS A;  2GC9 A;  1VWF B;  3VG4 A;  4MVE A;  2AKQ A;  4A8Z A;  4Y5D A;  5BYP A;  1N9Y A;  1EXS A;  2IZE B;  3DSZ A;  2R74 A;  3VE1 A;  5IO6 A;  4M7M A;  5FQ6 E;  2W2A A;  1SWH A;  3BX7 A;  1HQP A;  2XST A;  3NX2 A;  2YMS A;  3FLL A;  2JOZ A;  3WOV A;  1XCA A;  1OBQ A;  1LDO A;  1E02 A;  1EQD A;  3KQ0 A;  2RD7 C;  3GAQ A;  4GD9 A;  2DM5 A;  1JJU A;  3AUM O;  2FR2 A;  3KVN A;  3RE5 A;  3HWG A;  2FKJ A;  1SWL A;  1Y55 X;  3KFG A;  4D6A A;  1JMX A;  5B11 O;  1SWQ A;  2HZR A;  2IZL B;  3O2Y A;  1E00 A;  2Z4H A;  1SRJ A;  1E5P A;  4BBO A;  3SLO A;  3S26 A;  1S2P A;  3WZO A;  2IZC B;  4MVK A;  3QKG A;  4K19 A;  1N7Y A;  4GDA A;  4GH7 A;  4L1N A;  5HCE C;  1A18 A;  3RDX A;  3RY1 A;  1KZW A;  1IFB A;  3KFH A;  5LJE A;  5BVQ A;  2Q2P A;  2OFA A;  4GUZ A;  5FAZ A;  1LFO A;  3PED A;  4LZV A;  1HN2 A;  4EQA C;  2RA6 A;  2OVA A;  4Z2O A;  1KT5 A;  1NP4 A;  4KII A;  1D2U A;  2Q4N A;  4Y0P A;  4Y0R A;  3ZW0 B;  1SWR A;  5B27 A;  2OFR X;  4NV8 A;  4OEM A;  4TKJ A;  3RDQ A;  4ARH A;  5KHP A;  4HFO A;  2X34 A;  4YCE A;  2L68 A;  4EEJ A;  5LJK A;  1STP A;  1IKE A;  2JGS A;  1N43 A;  4XMD A;  4CDC A;  4YBP A;  2K23 A;  3SZJ A;  5IO5 A;  4Y59 A;  1A57 A;  5LJG A;  3IFB A;  1ICM A;  4JHQ A;  4N7D A;  5HZ8 A;  1QY2 A;  1LIE A;  4GZV A;  3FEL A;  2RQ0 A;  4YFP A;  2BT9 A;  4UU3 A;  2RTM A;  4DNE A;  1VYO A;  4GET A;  1RXK A;  4BX5 B;  3ZUO A;  1MM9 A;  1LIB A;  3ZW1 A;  1LDQ A;  4GE1 A;  1GT4 A;  4INN A;  3B2I A;  3P6F A;  1AVE A;  4U8U M;  3TGB A;  4PSQ A;  5EPQ A;  3RWX A;  4Z2P A;  1ZND A;  4QQ1 A;  4XMF A;  3RSW A;  1LEL A;  1FTP A;  2HYS A;  5EEE A;  1FEN A;  1H91 A;  3B2J A;  1AEL A;  5B29 A;  4ALO A;  1QG5 A;  4RUU A;  2AT0 X;  1VWD B;  4DCB A;  1VYF A;  2NP1 A;  4O4X A;  2AMM X;  2RTP B;  2X8F A;  1VWR B;  3EBW A;  3HWF A;  4LKP A;  3WJE A;  2OY1 O;  3PEC A;  1KL3 A;  2HMB A;  1KL4 A;  2LKK A;  1OBU A;  2C1S A;  4A60 A;  4YFQ A;  1B56 A;  1OBP A;  3STK A;  4Z27 A;  1ZNL A;  1O1U A;  1ZRY A;  5F7G A;  1I04 A;  1CBS A;  3BLG A;  3HTY A;  3HWE A;  5FFH A;  3VU1 A;  4GKC A;  3WZP A;  2IZA A;  3WJB A;  3FR5 A;  2X4M A;  3P6G A;  2A2U A;  2JMB A;  2OL6 O;  1KT7 A;  1EPA A;  5EZ2 A;  3QQ2 A;  1NQM A;  4TLJ A;  3WYQ A;  1MUP A;  3BY0 A;  3CKG A;  5B5G A;  4CV7 A;  1VWM B;  4LKT A;  3FDC A;  4ZHH A;  4Z2V A;  4KH8 A;  5JD2 A;  2MHD A;  3KZA A;  2F09 A;  4O49 A;  3WZN A;  4ZHC A;  2CZT A;  1SWG A;  3E3C A;  3K3L A;  4XMC A;  3U9P C;  1KXO A;  1OEK A;  4ZHF A;  2X55 A;  1IFC A;  4U8U N;  1ACD A;  1SWU A;  3WBG A;  5HTD A;  2WQA E;  2C1Q A;  2IZB A;  1TOW A;  2F73 A;  1LCW A;  3EBK A;  4HPC A;  4BX6 A;  2JU3 A;  3MVF A;  1JQP A;  1GX3 A;  4WHI A;  3NPO A;  1ZNH A;  2FHN X;  4EKV A;  4YDB A;  1SLD B;  2GH7 A;  2IZF B;  4ZR2 A;  5BVT A;  4O3Y A;  4NLI A;  1HY2 A;  1DFV A;  4XMH A;  4DQ4 A;  2Q9S A;  3EM0 A;  2RTH B;  2CZU A;  3T2W A;  1DF3 A;  1KFF A;  5F58 A;  4ZFX A;  2A0A A;  2X56 A;  4AYH A;  1GT1 A;  3DTQ A;  4ZH9 A;  3SZH A;  1BJ7 A;  1DZM A;  1FE3 A;  2A2G A;  3I0A A;  2NNQ A;  1Y9T A;  2EU7 X;  1VWH B;  2BSZ A;  4YKM A;  4QZT A;  3SOT A;  5CE4 A;  1NC9 A;  1SWJ A;  1SWO A;  3RY2 A;  3D4R A;  4ALB A;  3IA8 A;  5B5F A;  3ELZ A;  3NQK A;  4ZCB A;  3PH5 A;  2VDF A;  1KGL A;  1NDJ A;  5H9N A;  3STM X;  3UAQ A;  5C0N A;  4U3Q A;  2OZQ A;  3BS2 A;  4MVI A;  3VGW A;  1STS B;  2LA7 A;  2A3F X;  3RBY A;  1JJJ A;  1N4J A;  2IZK A;  4YGG A;  2CBS A;  2RTI B;  1R0U A;  3CQR A;  4FBR A;  3FA9 A;  4AZR A;  2QOM A;  4WFV A;  5CYB A;  2G8C O;  3D97 A;  4BX5 A;  2GJ5 A;  3UEU A;  1VWL B;  5H9A A;  1T68 X;  3ZI8 A;  3U03 A;  4IB9 A;  4WFU A;  4OS8 A;  5B3M O;  2POA A;  1SA8 A;  4I9R A;  5JR8 A;  4I60 A;  1W5R A;  4QNI A;  2UZ2 A;  4ZGF A;  1G5W A;  3PH6 A;  1UZ2 X;  1KQX A;  5IRU A;  5IRW A;  4TQ2 A;  1X8N A;  2F01 A;  2FR3 A;  2KD2 A;  4IAX A;  1JJX A;  3P24 A;  3MG5 A;  1SWA A;  4IBA A;  1QY1 A;  4O3Z A;  1GT3 A;  1HBP A;  2RTQ B;  3G7X A;  3VHI A;  1P6P A;  1IW2 A;  3NQ9 A;  2L67 A;  2R73 A;  4QZU A;  3EYC A;  2AVI A;  4XMG A;  2MF6 A;  4BX6 B;  1SY1 A;  2OL8 O;  1N9M A;  4HPD A;  1ML7 A;  1T0V A;  2RTG B;  2LB6 A;  2WWP A;  2X45 A;  5IRA A;  3UEV A;  4CPH A;  3VHM A;  3CMP A;  2FRS A;  1SLE B;  2WR6 A;  4HPA A;  4MEE A;  4TNN A;  2AT6 X;  2JW1 A;  4YKO A;  2A5B A;  1JV4 A;  1Y53 X;  2MM3 A;  2RTB B;  4A1H A;  1Y0G A;  3PQU A;  3V8U A;  2PY1 A;  3AKM A;  3O22 A;  3SAO A;  1SY2 A;  1TW4 A;  4EDE A;  5HAE A;  1D3S A;  2RTA A;  2MO5 A;  4FGI B;  5HTE A;  1VWI B;  1PTS A;  4FBO A;  5FQ7 E;  3S5V A;  1HXL A;  3BSZ E;  5FQ8 E;  1G85 A;  2HZQ A;  4ORS A;  1X8U A;  2LBV A;  1U18 A;  3UEX A;  1BLR A;  4OMW A;  4CPI A;  3BX8 A;  1RXJ A;  4GK9 A;  2CAM A;  1ZNG A;  1VWK B;  2WEX A;  1BBP A;  3P6D A;  5F6Z A;  1PEE A;  4L3R A;  2IZG B;  2RTC B;  4I3C A;  2BHV A;  4YMY A;  1QAB E;  3FYF A;  2Y3F A;  4M6S A;  4U8U O;  1O8V A;  4FQB B;  4CK4 A;  1CJ5 A;  3APU A;  4AZQ A;  1B8E A;  5AJC A;  5B10 O;  1O1V A;  3P6C A;  1UYN X;  5F6B A;  2HLV A;  5LKF A;  5L8I A;  1DZP A;  2Q2M A;  3PK2 A;  3EW2 A;  4AZP A;  2KTD A;  5L8O A;  2MWH A;  4OS3 A;  5DPQ A;  4AZO A;  1X71 A;  1STR B;  2GTL M;  4U46 A;  4Y0Q A;  1SWB A;  4QGX A;  3APW A;  1OPA A;  4TJZ A;  1QFV A;  1ZNE A;  2G5L A;  1YP6 A;  1Z24 A;  1SRH A;  3PQS A;  1GGL A;  4OKA A;  5EED A;  4NV7 A;  3T2X A;  3S60 A;  1W6F A;  5CHK A;  1YP7 A;  4GRJ A;  2FLJ A;  1KL5 A;  2AH7 X;  1A2D A;  2A13 A;  4BVM A;  2WEW A;  1JIW I;  3FEN A;  3OE3 A;  3VG2 A;  3JS1 A;  5AJB A;  3WYP A;  2OY7 A;  3TGC A;  2WUT A;  2WPU A;  3F8A A;  3MM0 A;  4YVB A;  3D95 A;  1SWE A;  3HPE A;  1RLB E;  4HPB A;  1KOI A;  2RTJ A;  1K3B A;  3B2H A;  3FR4 A;  2UYW A;  4ORR A;  4ORY A;  4QRL A;  4IAB A;  3RKG A;  3NR3 A;  5IXG A;  1PBO A;  1VWJ B;  1EW3 A;  4FBV A;  3GE2 A;  1JMZ A;  2FGS A;  4NYR A;  4TKH A;  5DG4 A;  3WZQ A;  4CPH B;  1JZU A;  2G79 A;  4NNS A;  1JYD A;  1KZX A;  1X8O A;  4CDD A;  1FEL A;  5K68 A;  1W4T A;  1SXU A;  4I95 A;  3STN A;  3VHH A;  4NYQ A;  2OFB A;  4CDF A;  2X8T A;  2X8S A;  3AEH A;  1RXH A;  4HWM A;  5HZQ A;  2N93 A;  1YIV A;  3MBT A;  3PPT A;  4OEL A;  1BM5 A;  1EIO A;  2IZI A;  1MX8 A;  1MOY A;  1OSP O;  4YCH A;  2C4I A;  1N0S A;  4NW4 A;  2DJF A;  3MX7 A;  5HCC C;  1SLF B;  4I3B A;  4AW8 A;  4GGZ A;  1S44 A;  2IZH B;  5HZ5 A;  1MDC A;  4ORX A;  1RAV A;  1BSQ A;  2GTL N;  4ON1 A;  4C5P A;  4TKB A;  3C78 X;  4I6S A;  1I4U A;  4ZGU A;  1I06 A;  2JN3 A;  3NAD A;  1FDQ A;  3RDS A;  2JU8 A;  3SLT A;  4AZM A;  1X8P A;  3N91 A;  2VFC A;  2ANS A;  3ELX A;  2ACO A;  3FID A;  2QCB A;  4KT5 A;  1KQW A;  3WXQ A;  4A1Y A;  2CM4 A;  5LJB A;  4RUN A;  2Y3E A;  2IFB A;  3P02 A;  1DV9 A;  2A8G A;  2WSJ A;  1PBY A;  3FA6 A;  4ZHD A;  1EUO A;  3L4R A;  1SWD A;  4ODD A;  3VG6 A;  1SXY A;  5HBS A;  3AKN A;  3SLJ A;  1GT5 A;  3CQN A;  4GJS A;  1CBQ A;  5EDC A; 
#chains in the Genus database with same CATH homology
 3OD9 A;  4MVL A;  5FEN A;  2WQ9 A;  1CRB A;  4BOE A;  3H3I A;  1S7D A;  4BQU A;  5AQ6 A;  2G78 A;  2BLG A;  2NNE A;  1LKE A;  2JU7 A;  1EII A;  1A3Y A;  4LZU A;  1EI5 A;  2OVD A;  3APV A;  4ML7 B;  1L6M A;  4O4U A;  3JQO A;  3NP1 A;  4O3X B;  2P8G A;  5D48 A;  4DQ3 A;  4IAW A;  2W2F A;  3VE2 A;  3FIQ A;  1PMP A;  4GDZ A;  4COT A;  3F6Z B;  1KT4 A;  1QWD A;  2QO4 A;  1GX9 A;  4XME A;  4QGW A;  1X89 A;  1PM1 X;  1OPB A;  3ZWE A;  4KC7 A;  3BDR A;  1BRQ A;  1AQB A;  4I3D A;  2X46 A;  1HMT A;  3TZS A;  4JGL A;  2OVE A;  2ZAI A;  1U0X A;  2Q39 A;  4MIS A;  3KFF A;  1EAL A;  4IMN A;  1VPR A;  5IO7 A;  3RZY A;  1KT3 A;  3VG5 A;  3WJC A;  2HNX A;  3U0D A;  1G7N A;  4Y0S A;  3EMM A;  4IB7 A;  1X8Q A;  4UU2 A;  2RN4 A;  1CBR A;  4CSB A;  3HWD A;  1G74 A;  1Y9L A;  3BU9 A;  1RBP A;  4KCA A;  4QYP A;  4ZHG A;  3FW4 A;  3HOE A;  1LF7 A;  5AEO A;  3P6E A;  1SXX A;  4YBU A;  1TXL A;  4IMO A;  1YWC A;  1IKJ A;  4GU8 A;  2QO5 A;  5HCD C;  3WJD A;  1BSO A;  2E4J A;  1TOU A;  4O4O A;  3WVM A;  2GTL O;  2YG2 A;  3ZW2 A;  2BS5 A;  5H8T A;  3NX1 A;  2FT9 A;  3FW5 A;  4OS0 A;  3FR2 A;  5LJD A;  1SMP I;  2OVS A;  1GM6 A;  3D96 A;  1NGL A;  3FA8 A;  2ZAG A;  4D6B A;  5HWZ A;  3ZQ3 A;  3C76 X;  3OBL A;  4O3W A;  1E06 A;  1TVQ A;  2AT3 X;  4OMX A;  4ORU A;  3KFI A;  2CBR A;  2FWV A;  4WBK A;  3T1D A;  3NBX X;  3UEW A;  4I9S A;  1IIU A;  4EFG A;  4YDA A;  3B2L A;  2O62 A;  4U9C A;  5D8J A;  5K06 A;  1LPJ A;  3TGA A;  3O19 A;  3ZUI A;  1OEE A;  2AT5 X;  5L8N A;  1FEM A;  5D47 A;  1EPB A;  1LIC A;  1URE A;  2R56 A;  2W2B A;  5BVS A;  1BWY A;  1JBH A;  2KW1 A;  1ICN A;  3CBS A;  4ZJ0 A;  4KC8 A;  1ALB A;  1MVG A;  4NP1 A;  1U17 A;  3CWK A;  1NP1 A;  2QOS C;  4QYN A;  1GKA A;  2LFO A;  3Q6L A;  4IB6 A;  4YGH A;  3PP6 A;  2QO6 A;  2FTB A;  2QMI A;  4PJ2 A;  5D45 A;  5LJC A;  3LHN A;  4MIR A;  1QY0 A;  1ADL A;  1HMR A;  1YWB A;  2ALL X;  4GNW A;  1LIF A;  1DZJ A;  3B2K A;  4O9S A;  1OEJ A;  1HBQ A;  2MJI A;  5EDB A;  5HA0 A;  2CM9 A;  3OJY C;  4ID2 A;  1B0O A;  3FMZ A;  1YWA A;  5HZ9 A;  1VYG A;  1YWD A;  4N7C A;  5KIC A;  1KT6 A;  1MX7 A;  1XKI A;  2BS6 A;  4ZH6 A;  2Z4I A;  5HZ6 A;  2M4L A;  3CBC A;  4GNY A;  3APX A;  1YUP A;  4NNT A;  1SXW A;  3JSQ A;  2G7B A;  4ORW A;  2FS6 A;  1HMS A;  3P6H A;  3FA7 A;  4R0B A;  4NLJ A;  1I05 A;  3VG7 A;  4YH0 A;  2XKL A;  4IB8 A;  3C77 X;  1JYJ A;  2K62 A;  5D4A A;  4O4S A;  2AL0 X;  2AT8 X;  3FEP A;  1GX8 A;  2RCQ A;  3HK1 A;  3VPJ E;  3BU1 A;  3WJG A;  4ES7 A;  5H9K A;  1B4M A;  3VG3 A;  2KT4 B;  4AZN A;  4YGZ A;  4QGV A;  1ZNK A;  2ASN X;  3CR6 A;  1DC9 A;  1ERX A;  1AVG I;  3S5X A;  3U03 A;  1LNM A;  1SY0 A;  3LV4 A;  2GTF X;  1SY3 A;  2OFM X;  3HOL A;  3ZW1 B;  1ERB A;  1CBI A;  1DZK A;  2FS7 A;  3ZW0 A;  1BRP A;  1QFT A;  3F9D A;  4YFR A;  5H9L A;  3TF6 A;  2QM9 A;  3NQ3 A;  4YCE A;  1T8V A;  2L5P A;  3ZZV A;  1GKA B;  1AB0 A;  1LID A;  3FEK A;  5LKE A;  2NND A;  5HA1 A;  4QAE A;  2LBA A;  3WJF A;  1BEB A;  3I17 A;  3BRN A;  2RCT A;  2L9C A;  1BSY A;  4LQZ A;  5F1E A;  4EXZ A;  2KTS A;  2ACP X;  1GXA A;  5LJH A;  1QQS A;  2GC9 A;  3VG4 A;  4MVE A;  2AKQ A;  4A8Z A;  5BYP A;  1EXS A;  5IO6 A;  3DSZ A;  2R74 A;  3VE1 A;  4M7M A;  5FQ6 E;  2W2A A;  3BX7 A;  1HQP A;  2XST A;  3NX2 A;  2YMS A;  3FLL A;  2JOZ A;  3WOV A;  1XCA A;  1OBQ A;  1E02 A;  3KQ0 A;  1EQD A;  2RD7 C;  3GAQ A;  2DM5 A;  2FR2 A;  3HWG A;  3KFG A;  4D6A A;  2HZR A;  3O2Y A;  1E00 A;  2Z4H A;  1E5P A;  3S26 A;  1S2P A;  4MVK A;  3QKG A;  4K19 A;  4GH7 A;  4L1N A;  5HCE C;  1A18 A;  1KZW A;  1IFB A;  3KFH A;  5LJE A;  5BVQ A;  2Q2P A;  5FAZ A;  1LFO A;  3PED A;  4LZV A;  1HN2 A;  4EQA C;  2RA6 A;  2OVA A;  1KT5 A;  1NP4 A;  4KII A;  1D2U A;  2Q4N A;  4Y0P A;  4Y0R A;  3ZW0 B;  5B27 A;  2OFR X;  4ARH A;  4TKJ A;  5KHP A;  4HFO A;  2L68 A;  4EEJ A;  5LJK A;  5IO5 A;  1IKE A;  4XMD A;  4YBP A;  2K23 A;  1A57 A;  5LJG A;  3IFB A;  1ICM A;  4N7D A;  5HZ8 A;  1QY2 A;  1LIE A;  4GZV A;  3FEL A;  2RQ0 A;  4YFP A;  2BT9 A;  4UU3 A;  4GET A;  3ZUO A;  1LIB A;  3ZW1 A;  4GE1 A;  4INN A;  1GT4 A;  3B2I A;  3P6F A;  4U8U M;  3TGB A;  4PSQ A;  5EPQ A;  3RWX A;  1ZND A;  4QQ1 A;  4XMF A;  3RSW A;  1FTP A;  2HYS A;  5EEE A;  1FEN A;  1H91 A;  3B2J A;  1AEL A;  5B29 A;  4ALO A;  1QG5 A;  4RUU A;  2AT0 X;  1VYF A;  2NP1 A;  4O4X A;  2AMM X;  2X8F A;  3EBW A;  3HWF A;  4LKP A;  3WJE A;  3PEC A;  2HMB A;  2LKK A;  1OBU A;  4A60 A;  4YFQ A;  1B56 A;  1OBP A;  3STK A;  1ZNL A;  1O1U A;  1ZRY A;  5F7G A;  1I04 A;  1CBS A;  3BLG A;  3HTY A;  3HWE A;  5FFH A;  3VU1 A;  4GKC A;  3WJB A;  3FR5 A;  3P6G A;  2A2U A;  2JMB A;  1KT7 A;  1EPA A;  5EZ2 A;  4TLJ A;  1MUP A;  3BY0 A;  4CV7 A;  4LKT A;  4ZHH A;  4KH8 A;  2MHD A;  3KZA A;  2F09 A;  4O49 A;  4ZHC A;  2CZT A;  3K3L A;  3E3C A;  4XMC A;  3U9P C;  1KXO A;  1OEK A;  4ZHF A;  1IFC A;  4U8U N;  1ACD A;  3WBG A;  5HTD A;  2WQA E;  1TOW A;  2F73 A;  3EBK A;  4HPC A;  2JU3 A;  3MVF A;  4WHI A;  3NPO A;  1ZNH A;  4YDB A;  4ZR2 A;  5BVT A;  4O3Y A;  4NLI A;  4XMH A;  1DFV A;  4DQ4 A;  2Q9S A;  3EM0 A;  1DF3 A;  2CZU A;  5F58 A;  4ZFX A;  2A0A A;  4AYH A;  1GT1 A;  3DTQ A;  4ZH9 A;  1BJ7 A;  1DZM A;  1FE3 A;  2A2G A;  3I0A A;  2NNQ A;  1Y9T A;  2EU7 X;  4YKM A;  4QZT A;  3SOT A;  5CE4 A;  4ALB A;  3D4R A;  3IA8 A;  3ELZ A;  3NQK A;  4ZCB A;  3PH5 A;  1KGL A;  3UAQ A;  5H9N A;  3STM X;  5C0N A;  4U3Q A;  2OZQ A;  3BS2 A;  4MVI A;  2LA7 A;  3RBY A;  2A3F X;  1JJJ A;  4YGG A;  2CBS A;  4FBR A;  1R0U A;  3CQR A;  3FA9 A;  4AZR A;  4WFV A;  5CYB A;  3D97 A;  2GJ5 A;  3UEU A;  5H9A A;  1T68 X;  3ZI8 A;  4IB9 A;  4WFU A;  4OS8 A;  2POA A;  1SA8 A;  4I9R A;  5JR8 A;  4QNI A;  4ZGF A;  1G5W A;  3PH6 A;  1UZ2 X;  1KQX A;  4TQ2 A;  1X8N A;  2KD2 A;  2FR3 A;  4IAX A;  1JJX A;  3P24 A;  4IBA A;  1QY1 A;  4O3Z A;  1GT3 A;  1HBP A;  3G7X A;  1P6P A;  1IW2 A;  3NQ9 A;  2L67 A;  2R73 A;  4QZU A;  3EYC A;  4XMG A;  1SY1 A;  4HPD A;  1ML7 A;  1T0V A;  2WWP A;  2LB6 A;  2X45 A;  3UEV A;  3CMP A;  2FRS A;  2WR6 A;  4HPA A;  4TNN A;  2AT6 X;  2JW1 A;  4YKO A;  1JV4 A;  2MM3 A;  4A1H A;  3V8U A;  3PQU A;  2PY1 A;  3AKM A;  3O22 A;  3SAO A;  1SY2 A;  1TW4 A;  4EDE A;  5HAE A;  1D3S A;  2MO5 A;  4FGI B;  5HTE A;  4FBO A;  5FQ7 E;  3S5V A;  3BSZ E;  5FQ8 E;  1G85 A;  2HZQ A;  4ORS A;  1X8U A;  2LBV A;  1U18 A;  3UEX A;  1BLR A;  4OMW A;  3BX8 A;  4GK9 A;  1ZNG A;  2WEX A;  3P6D A;  1BBP A;  5F6Z A;  1PEE A;  4L3R A;  4I3C A;  2BHV A;  4YMY A;  1QAB E;  3FYF A;  4M6S A;  4U8U O;  1CJ5 A;  1O8V A;  4FQB B;  4CK4 A;  3APU A;  4AZQ A;  1B8E A;  5AJC A;  1O1V A;  3P6C A;  5F6B A;  2HLV A;  5LKF A;  5L8I A;  1DZP A;  2Q2M A;  4AZP A;  2KTD A;  5L8O A;  2MWH A;  4OS3 A;  5DPQ A;  4AZO A;  1X71 A;  2GTL M;  4Y0Q A;  4QGX A;  3APW A;  1OPA A;  4TJZ A;  1QFV A;  1ZNE A;  3PQS A;  1YP6 A;  1Z24 A;  5EED A;  1GGL A;  3S60 A;  1YP7 A;  4GRJ A;  2FLJ A;  2AH7 X;  1A2D A;  2A13 A;  4BVM A;  2WEW A;  1JIW I;  3FEN A;  3OE3 A;  3VG2 A;  3JS1 A;  5AJB A;  3TGC A;  2WUT A;  3F8A A;  3D95 A;  4HPB A;  1RLB E;  4ORR A;  1KOI A;  4ORY A;  3B2H A;  3FR4 A;  4QRL A;  4IAB A;  3RKG A;  3NR3 A;  1PBO A;  1EW3 A;  4FBV A;  3GE2 A;  4NYR A;  4TKH A;  5DG4 A;  1JZU A;  2G79 A;  4NNS A;  1JYD A;  1KZX A;  1X8O A;  1FEL A;  1SXU A;  4I95 A;  3STN A;  4NYQ A;  2X8T A;  2X8S A;  4HWM A;  5HZQ A;  2N93 A;  1YIV A;  3MBT A;  3PPT A;  1BM5 A;  1EIO A;  1MX8 A;  4YCH A;  4NW4 A;  1N0S A;  3MX7 A;  5HCC C;  4I3B A;  4AW8 A;  5HZ5 A;  1S44 A;  5KID A;  1MDC A;  4ORX A;  2GTL N;  1BSQ A;  4ON1 A;  4TKB A;  3C78 X;  4I6S A;  1I4U A;  4ZGU A;  1I06 A;  2JN3 A;  3NAD A;  1FDQ A;  4AZM A;  2JU8 A;  1X8P A;  3N91 A;  4KT5 A;  2ANS A;  3ELX A;  2ACO A;  3WXQ A;  1KQW A;  4A1Y A;  2CM4 A;  5LJB A;  4RUN A;  2IFB A;  3P02 A;  1DV9 A;  2WSJ A;  3FA6 A;  4ZHD A;  1EUO A;  3L4R A;  4ODD A;  3VG6 A;  1SXY A;  5HBS A;  3AKN A;  1GT5 A;  3CQN A;  1CBQ A;  5EDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...