The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
117
|
structure length |
117
|
Chain Sequence |
NQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSHFVPVFLPAKPT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of Rhesus Macaque CD8 Homodimer Sheds the Lights on the Molecular Basis of Rhesus Macaque MHC class I with CD8 Complex
rcsb |
| molecule keywords |
CD8
|
| source organism |
Macaca mulatta
|
| molecule tags |
Immune system
|
| total genus |
18
|
| structure length |
117
|
| sequence length |
117
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2007-05-30 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |
