2Q3AA

Crystal structure of rhesus macaque cd8 alpha-alpha homodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
b'NQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSHFVPVFLPAKPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD8
molecule tags Immune system
source organism Macaca mulatta
publication title Crystal Structure of Rhesus Macaque CD8 Homodimer Sheds the Lights on the Molecular Basis of Rhesus Macaque MHC class I with CD8 Complex
rcsb
total genus 18
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q3aA00
4N90E 2AJZA 4NKMB 1Q72L 1KBGL 1Q9KB 3EO1B 3G9AB 4M6AA 4WFFE 1JGDA 1HILA 3B9KD 1DUYA 1YNLH 5D1QC 3V2AR 2BNRD 4MD5B 2V7NA 3W9EB 3HA0A 4XB7A 5LBSL 1NBVL 1LP9B 4NGHH 5DD5L 1A6VL 5C0GA 4A2MA 2PKDA 1MHHB 5I18H 2YSSA 5FYKL 5TE6H 4LVOB 1OT1A 3I6LD 1H3WM 2HFGH 2F74A 2QHRL 3VW3L 3PNWB 4EN3A 1A6UH 3RDTA 2H8PA 2BOCB 4GAGL 3UO1L 4HJJH 5C2BL 2KDGA 1GOHA 2GJZA 1JPGB 3LKQB 5DZNA 2HA1A 3EDDA 1MPAL 4JO4L 2W0KA 3E6HA 4NKIL 3CDFA 2A6DB 4RFOH 3UPRB 2R0ZH 2DQGL 3MGTB 1J0KA 4NP4L 5E7FA 2X5PA 3S88L 1F2QA 1MIEL 3BKJL 4OCNC 4ZSOB 3SE9H 4M6NL 3GFUA 1FQ9C 2VLKD 1KPRB 1X5GA 2AXFB 1IM3A 1IC4H 4UBDC 4D8PA 3OR7B 5FIEA 4HBCL 4HXAH 4KI5F 3RWDB 2Z31D 4LNRB 4YHKL 4L9DA 3GHBL 2NCMA 4KKLD 2OTPA 4WDIB 4JFQA 5MENA 4OGZA 3IXAB 5DQJB 5K9KB 1C8PA 3KPSA 5CD3A 3BP7A 1XZ0B 1GC1C 2F5AL 3G5VB 4JO1L 4WJ5A 4JFFD 1LNUA 1XF4B 1BJMA 2YUXA 1JI1A 3GSWA 2WAHA 3BP7B 4DKFL 2J3SA 1UG9A 2DL2A 3RWHA 1N0XL 4X7DC 1XGTB 3BDYL 1SYVB 1D6VL 2P7TA 2Y4SA 3ARBA 3LCYA 5SWZE 4YXKL 4EDWL 2CMRL 3AGVA 3UJJL 5ID0A 1NFIB 3B8YA 5F9WB 3QUMB 3VGFA 3MPCA 5DA4A 3GJFA 2ATPA 1SVCP 2YN5A 3D0LB 4U2ZA 3BJLA 5D7IB 1MUJB 1XR8B 4DVRL 4FS0A 3MXVL 3OGOE 5GSRA 1Q0YH 3BFOA 4J3VA 5GISL 3GJFB 4ZTOL 4CNIA 2P8LB 4TVPD 1MCSA 3GM8A 1WIOA 1R5WA 4PTTB 4N9OB 1I3UA 3QDMD 3WEXB 4V1DA 1QRND 2OL3A 3RNQB 2KQNA 1EEYB 4F15C 3D9AL 4CNIB 3NPSB 3NFSH 4PJIB 2NY4C 2VLRA 3TNNA 4NQDB 1EX0A 3QDGA 1B90A 3TBYA 2BCKA 3MLTA 1A4JB 1HHJB 1JPFA 4HUNB 2YUWA 3OMZA 5HHOB 2HJKB 3ROLB 1D7FA 4L4TA 4NPYA 1AFVH 2AERT 2JELH 5D1QA 1YEKH 5DJXB 1UCTA 2XA8L 3U9PL 4IRZL 3LN4B 4G6MH 3RPIB 5AYQA 2V5YA 1LWRA 4UINL 5IQ9B 3TJHC 4FABL 4NKDA 4LKCA 2X41A 1DE4B 5FOJA 3RHWK 4JPIA 2CGRL 4Z77A 3CZFB 5IBUG 1FC1A 1F5WA 4FQJL 4AYFA 5L7XL 4MHHG 3B5HA 4S1QH 4YBLC 2E3VA 1K5NB 4HZAA 3S98A 3ARFB 3O6LH 5CIPA 4HWUA 3RTQC 3MBEB 1KBGH 3K1DA 3WHE1 1KB5A 4U1GB 3REWB 3QULB 1RUAH 4HLZH 1S5IL 3LB6C 2YPLA 4N1HB 3KLHD 4F7EA 4NRXB 2LVCA 2VNCA 1S7RA 2IAMA 2VMFA 5D93B 1JIBA 3W5NA 5F7EL 1N3NB 2ILLA 3PWJA 3S5LG 1JZ4A 4I18B 5GGQL 3A0OA 4NSKB 4ZQKA 1KELL 3BIBX 1CFQA 5CS7A 5AZEH 2WM0A 4FOMA 3HE7A 2C7UB 3STLB 3I9GH 1HHGA 4JN2B 4XPBL 3N06B 4WI5A 3NH7L 1M4KA 2QR0A 2NX5D 3QWOA 4ZFZB 1R24A 5IB3A 2H8PB 1J0JA 5J7CC 4FXKB 5EIVA 1F02I 4N8CH 2Y36L 1ZANL 3MRPB 3UJTL 3MRCB 5CEXB 2HKHH 5IVZB 4FP8H 1QHOA 4A6YH 2GY5A 1KIQB 1GRWA 4NHUA 3SY0B 2Z35B 3QP3A 1P4LA 1A7NL 1LP9A 3U82B 2X70B 5F1IA 2UVFA 1FP5A 2X1QA 1RZ8A 4IMLB 5K59F 3E6HB 5C0DB 2MQ3A 4OFVA 3UZVB 1A4KB 1CL7I 2Q76B 1OARL 5BVJB 2D7PA 4F3FB 2XI9A 3L5IA 4YR6B 4XVSH 3HZVA 3T77B 3OAYH 3O2DL 4K71C 3C5ZB 4M7ZC 2GT9B 5GJTL 2PTUA 5GSVA 3S3PA 2IBZX 3U9UB 1DLHB 3CFCL 3H2WA 4G5ZL 3GZKA 4XBPB 3FFCD 4TUKL 1QKZL 1INEH 2BNRA 4NC0B 1EERB 4APQD 2H3NB 4G6KL 2XTJB 1OP3H 3RAJH 3IRPX 2D0FA 4D2NA 3EOAA 2C1PA 4JM2C 3HE6B 4UIKL 4CW1B 1U95B 3TBVA 1ZXQA 1A1MB 2PN5A 5DA0B 3O9WC 4HWBL 2BNRB 5DF0A 2R0LL 4O2FB 3IETB 4MJ6A 1TZIB 3GMLA 2X9YA 4F7TB 1REIA 5ISZB 4JFEA 3QDGE 4GFTB 1IKFL 2ED9A 4MXWL 5T5FH 3DIFB 4U31A 4MXWH 1RUMH 3OKMA 4HJGA 3X13A 4L9LA 1WBYB 2BY2A 3DV4A 1TVHB 1EEQA 1WZKA 3E3QE 3S96B 1INDL 2YC1B 1W2KT 3GSOA 3MACL 4P49A 1MAMH 1VEMA 4M1CD 3U0TA 2XTJD 1KEGL 2W9EH 4POZD 3DX9A 2JTDA 4M3KB 3X13B 3MJ6A 3V79C 1R5VA 3PHOA 4K23L 3QDMB 3T04D 5KSBE 2CO7B 4U1GC 1UVQA 3PIQA 4BA8A 1TETL 1GGBL 4H0HB 2VL5B 3AMLA 1WZLA 4NKIH 4P9HC 1XGTA 1HI6B 1RJLB 1Z6JT 4HF5H 5HYJE 1P9MC 2DQGH 5HD8D 2VZVA 4OLUL 2K3TA 2VLKB 4HGMA 3AU1B 3DV6B 1FV1B 3ZE1E 5DYOA 5E08L 3UYPA 2FGWH 4KMTH 1AGBB 4IRZH 3RVXC 3I6GA 4RBPH 2VLLB 1FNFA 4ZAKB 1NAKL 2V2XA 4ISVB 5I1CL 4Y8AA 1FV1A 2JCCF 5CZXD 2BCKB 3MLTB 4EXKA 3JWDC 3BQUD 1QZ1A 2W0PA 3VGBA 1IGJB 3D39D 1LO3H 1QG3A 3RIAK 1JK8A 2AEQL 2PW2B 2YEZB 1J1XH 4X99B 2HH0H 3WNPA 2HN7B 2O5XL 4BZ2L 1JMXA 3S34H 4IRSC 4J7RA 4WHDA 5IQ9A 4AY0A 3MACH 3BZEA 1EEZA 2ZOLB 3V4PL 2ZG3A 3IDUA 4X7SL 1F42A 2BXYA 5TF1H 4JM2A 3FQUA 4NWUL 3DX8B 2CLRA 2OP4L 2JLLA 5DFVC 4N68A 1JYVA 4Z0BL 3BDXA 4GAFB 2P8MA 3QNXA 4WW1B 5K9OB 3S4SG 4F7MB 5TDOA 2EXYC 4L1HA 4BH8B 1AR1D 5EORL 2K1MA 5KZCB 4U3HA 4H20H 2ESVE 4Y4HB 3FKUS 1B4JL 1XCTB 1IGIH 1IQDB 3AROA 2P5EB 4OKVA 5FGCE 3HRPA 3H0TB 2AV1A 4OF8A 5IROC 1LVEA 3ZLQC 2VLME 4UDUB 1X4XA 2FIRT 2A9ML 1CVSC 1UZ6F 5LGKA 3TVMB 4NGHL 3RL2B 5DRZB 4F7PB 4FMFA 3Q5TA 4QOKD 1JGLL 3N1GC 4S1DC 4G9FB 5FHBL 3H3PH 1LO0H 3QJFA 4HJJL 2YSSB 4TRPL 1TNNA 2EC9T 4N0RA 4S0SD 5GRXG 2DD8H 1CDHA 2HLFD 5FO7B 1TQBC 4GAJH 3C6LD 4LLVA 1SYSA 3RVWC 5JIHA 1FG9C 4L8BA 1PG7X 1YEFL 2DS4A 4PG2C 5KVFH 3TN0C 5KVFL 3QUMH 3QEQA 2DYPD 4PFEA 5E6IA 3WD5L 4EI5A 4LVHC 3IAQA 3LKQA 5IVXF 3MUGA 3HPJB 2EH7H 1NFKA 2VZTA 4W6XB 3MRKA 4J1UA 4ONGL 4U1SB 2GITA 3UAJC 5FF6B 4U1LB 5HDQL 5HTSA 2X4OB 1OAQL 3TBTA 4WWKC 4KH2A 4UU9A 2UVEA 1FGVL 4E0RB 5JW4N 3T0EB 2VZ1A 5EUKA 1KPVA 1SVZA 1WTLA 4PPTA 2ZCHH 3U0PA 1HCFX 3KS0J 4LSTL 4AIZB 5ACZA 4KTDH 4K7PL 3U1SH 5D9SA 5ISZE 4ZPTA 2BRQA 3DX7A 4QRPE 1BHGA 3BUYB 4S10A 1EV2E 3SKJH 1JPGA 4IM8A 4N0FB 3H3PL 4UDTB 1IM9D 4KKCC 4L3CA 5L2KA 4KJWC 3TBSA 3WKNA 5HYQB 1T4KB 1N6UA 1T21A 1UADC 4JFFA 2BK8A 5L8LB 4GAJL 1OCWH 1YYLH 3PP4L 1S7SA 1TENA 4D3CL 4Q2ZB 1KENL 3QA3B 4XP4L 2VDLL 4J8RA 1SY6H 3GO1H 3QPXL 2A0LC 2XPGB 2DAVA 2YN3A 1S7SB 1MCHA 1S7XA 5C0AE 3RWGA 3UAJD 4N0YH 1LO5B 1HZHH 2RAMA 2BY1A 3DOSA 1A9EA 1EAPB 4J3UA 1MJ8L 5JQ6L 1JFQL 3OJMB 3O9WA 4KHTL 2A1WL 3LH2L 3L5XL 3OAZK 3GSWB 4LSDA 1NCCL 3EOBA 5T1DL 5I17A 3ET9F 4XVSL 3RPKA 3RVTC 1J8HB 2ENSA 5SWZB 1T04B 4TULL 4L8SA 4TNVK 2DRUA 4Y16A 3QI9D 2VDNH 1UWXH 3FHAA 5KSVB 4NWTL 3QXWA 1NPUA 3OPZH 4NQXB 4CU7A 1CLYH 4C56D 1ZT1A 5DO2D 2W91A 3RAJL 5ID0B 2AJ3A 2VUOA 4PJEB 4HUUB 3SHSA 4L4VD 4LDOB 5TGBA 2VDRL 4MDIB 1SJEA 5KBNC 4W81A 4Y19A 4PJ9B 3KDMA 4LPYA 5CGYC 2IPTH 3SE3A 1P84K 5L6YH 4PJBF 3TJHD 1U6AL 5F9OH 3GHEH 1CXLA 4WWKA 2QSCH 4NHCH 1JCKA 3RVTD 4HKXB 2PTVA 5H35B 3R1GH 1KT2A 3ZSTA 2FX9L 1EFQA 2EEBA 1T1ZB 3DJ9A 1QO3B 2O5XH 2R2CA 4WO4B 2C3WA 4F37F 4PJGB 2UUDH 3N1QC 1NEUA 5DHVH 1NSNH 3B2VL 4F9PA 1YNTB 3E0GA 5MEPB 3VG9C 3JV5A 5EOCH 1MFAL 4WU7A 4QNPE 1ZEAH 2Y5EA 1AGEA 2G5RA 3QEHB 4R96A 2A1WH 2DLFL 4P5KB 2P8MB 4PJ8B 2P5WA 2ADGA 1Y18B 2NTFB 5LWYH 4JO2H 4JKKA 4MZ2A 4Y1AD 1IEHA 3UJIL 1R3LA 2ZUUA 2XT1B 3NPZB 1UXWA 1OWRM 3VH8G 5GS0D 2RCSH 4P48A 4LRIC 3QUYC 3K8MA 3QIBB 4GLRI 3D2UA 4QRQB 4P2CG 1FC2D 3ZDYF 1S9YA 1RQ5A 1T2JA 4NWTH 4QXUH 1G7IB 1XGQB 4UV4H 4NC1E 2CLRB 4UV4L 3VFOA 4FHBD 5FO8B 4OCYL 4H5SB 3Q6GH 3PXJA 3U9UA 3JUZA 4AL8H 1CBVL 4YQXH 4NQUA 2X44D 4R4NC 1AHWA 1FDLH 4OZIE 2NZIA 1MY5A 1YYMH 1GHFL 4K8RD 3CZFA 2QSQA 3SDCD 5F1NA 3HZYB 5K9JH 1YPZB 3HHRB 1J0HA 2A6KA 4D8PB 4X6CE 5FUZL 5I1GL 5J6HA 1RHHA 3IDNA 3VFRB 4MJ6B 1DL7L 1TZIA 4Y8DC 5F21B 3PWUB 4HUKB 4MDJB 4WU5A 3BHBA 3R1GL 2CLZA 1IEBA 1YPZE 1IC5H 3S6CA 3WN5C 5IVOA 1MCRA 1A7NH 4ZFZA 2EDYA 2Q3ZA 3IDJA 3RBGA 4L8BB 5D6CA 1S8DB 4OLYL 2V5MA 1D5BB 2VIRB 1CDIA 5E03A 1WBYA 2RIKA 3VD7A 1CLCA 1QLRB 5D7JC 2QLVB 1KJ2B 3LKRA 4HC1H 4P46C 3LMJH 4L3EE 4XPGL 4M6ML 1FLRL 2W9DH 2XQBH 3MYZA 1KNOA 2OP4H 3VJ6A 5HHME 2V9TA 1F4YH 5CBEB 3RWCB 4ZQKB 3PHOB 1X5ZA 1TNMA 1E4JA 4RGOH 3HMWH 5FA4B 4C57C 1TQCC 1UVQB 4RGOL 1B3JA 1WBZB 3KYNB 3NIGE 5CJ5A 4XTRD 1YJDL 1GGCH 1KELH 5HSFA 2J6EA 4AK1A 4D0BB 1AXSA 5KAQF 3QWOB 2ZOKB 3UPAA 1C16A 4D3CH 3MREA 4NO0A 4QHMA 4ZDHA 1U8NB 2XICA 4QLRA 2GITB 4KUCF 1KG0B 5D7KD 5C0CD 4D9QD 2ATKB 3GGWB 5C1MB 4OV5B 1GH7A 43CAA 4B41A 3SCMD 2ZSVB 3VXMB 3ARGB 4PJFA 1NC2B 4FP8L 1YEEH 1RVFH 3L3IB 1EPFA 5JPNA 1WLHA 5E2VH 2FEEI 4MAUH 1NCBH 5KSAD 3EFDH 3SE3C 4NQDA 5ITFB 4BFIA 4IRJA 4BSJA 1Q94B 5CJXA 3DRQB 1P1ZB 3PP4H 3P0VL 4YO0B 5E2JA 4S1SH 5E4IA 2IH3A 5L8JB 2HTKC 4G8EB 3LIZL 5FOBB 4LCUA 3LQAC 1CD1B 1NMAL 2UYLA 1A6ZA 3BDBA 4OCXL 2BSRA 2IC2A 2J1KA 2QQLH 4LL9A 3B8SA 4CVZB 1FNEA 1SJHA 2QQNL 2VAAB 3PQYD 3U48A 1RFDL 3O45A 2I5YL 4C59B 3LKPA 3UTSE 1J05B 4G9FE 4F7CA 2E7CA 1NC4B 3OXRA 2P49B 5EBWB 1PDKA 1F4WL 4Z7WA 4IRSB 1WWCA 3DIFA 2A73B 3S3SA 1CGXA 4M48H 5L6YL 2K7QA 1LILA 5JUEH 1MCDA 1CF8H 3MFGB 5AZ2L 2YS4A 1UA6H 4HV8A 4U1IA 1IEAA 4PB9H 4U0RC 4UAOB 1R3KA 2PTTA 2ADFH 2YPLB 1WWBX 3MUHL 2Y06H 3MLYH 3MRQA 1DVFD 3OKEB 3RJQB 5IEKB 4X4XB 3VFUB 3L7FB 1YQVH 1VENA 2QHRH 3N9GL 1K6QL 3BI9X 1P4IL 2ICWJ 2FJFB 4WWKB 3QDGB 3TBYB 4KUZH 2WZPD 2ADIB 1AY1H 4U05A 4XXDA 4N8VB 2R4RL 1C12A 5T3ZD 2Q20A 3ARWA 4PJ7E 4EIZC 3B9EA 1EFXB 2VXTL 3OAUH 5BS0A 2EXYD 4KQ4H 3QT2A 4L8SC 5I8CB 2BHZA 5C3LD 4AEHL 1T5XB 2V2XB 2V5TA 5E8PA 1RIVL 4C4KT 1OP9A 3FJTA 2X4TB 5DK2B 5I8KL 3L3JA 1DQQB 4XNQB 5SX5H 4YXHH 3NIDF 1RI8A 4FXKA 5JOFB 1AIFA 5JQ6H 4N90D 4JR9L 3WDIA 4Z76A 2DLFH 1G6RA 5GHWL 2SEBA 1DEDA 1U91A 2HLAB 3CU1A 3NFPA 4WEBL 5FDWB 3L9RA 3HC4L 5C07D 5J12C 1MI5D 1WAAF 4ZS7L 1I1CA 1JGLH 3G04A 3TA3C 4C56B 4YHML 3QEHA 3P9WB 4XNXH 4NNYB 1EFXD 4QXUL 5D2NC 5GPRA 1KN4L 1RJZB 5DJ6B 1I7ZA 2F9BT 3QWQB 3O2DA 4U3CA 4HWEL 2AABL 1UM4L 2GK0A 3OJDB 4RMRA 4KVNL 4K23H 3AXLA 1S5HB 1I9RL 5C6TL 1K8DB 1FVEB 1HOCB 2R9HC 1FO0B 1UH2A 1GPOH 1EH9A 5SWQB 1I4FA 3QWRA 4FTVE 1QR1B 2MMXA 2X4NB 1BFSA 3O3BB 5JO5B 4LCCC 1YJDH 3I85A 4HIEB 3HUJB 5JDSB 4KKLC 3WFEH 4H0IA 2X4NA 3IGAB 3DUSA 5JW5B 1WCBA 5GS0H 4NJAH 5C86A 4P5TC 4JN1L 1I7TB 1T20A 4GKZA 5IMMA 2ZPKL 3CDGB 2KL6A 3MGOA 2JIXD 3DX6A 3UTOA 4LBEA 2BVPA 1FSKB 2EC9U 4U7SA 3PF2A 1UKQA 1EEYA 2VRAA 3QFJD 4XWOD 4K2UL 3Q0HA 5J9PB 1PQZB 4P59L 5I1EH 5I66A 5A3IC 1QA9B 2O5ZH 1I1FA 4JFXB 2AABH 2Y23A 4QHMB 1XF3A 4LPXA 3ULSB 5KSVA 1TJIL 3BPCB 4PY8J 5EFIB 4E41B 3ULVF 3F7YA 1MRDH 1RZFH 1GHFH 1DQDL 1CICA 3IXTA 4Z5RA 3O8XA 3UTZB 3KLSA 3L6FB 2CKNA 5ERWA 3C8DA 4UV7L 3RKPA 2D9CA 5AYUH 4UV7H 1XH3B 2B2XH 1IKNC 1O5DT 1SY6L 1EO8L 3TC9A 3RTQA 4N8CL 1GC1H 1MCOH 1Q0YL 2DQJL 4B50A 1PKQB 2CO6B 1MREH 5DQJA 5K9KA 3O6LL 1E4KC 3TA3A 1ZWIB 3DRQA 5I1HH 1JK8B 4NZRH 4TOYH 1V3MA 1KCUL 1OAYH 5EU7C 4P57B 4B7LA 2DDQL 4MGXA 1UKSA 4MVBC 3IFLL 1I1YA 2O26U 1LEKB 4X4MA 4HFUL 4WI8A 4HXBH 5DI8B 1NCAL 1QVOB 1JZ2A 4PJ5D 3Q2CA 4KK6D 3FT3A 1ZT7A 5HYJB 1IAII 1I8KA 2B1HL 2IANB 3D3VA 3O45B 3OX8B 1ROWA 5E2UH 4ZNCD 2NX5A 4FTVB 1QSFD 1ZSDA 4NRXA 2GTWB 4IOFC 5DT1L 5IBTL 3SGKC 4F57H 2JKXA 1QP1A 4F80A 4D0CA 4QRRA 1FZKA 4RMWA 1FZJA 4JFOA 2BY3A 4Y1AA 5D2NB 2HFFA 4P2OB 3U46A 5D5ME 4OGAC 4LF3A 1YA5A 4MA3A 4H5SA 2CDFB 4LPTA 4ZNEA 2DBLL 4JO4H 2XPGA 5DRXA 2NY2B 4LSVL 2VL4A 4I3RL 5H37H 4OD1H 4PRNA 3DVNA 3QDJD 5C0BE 1MIEH 3BKJH 2A6KB 1BBJB 1LO2H 3D5OF 5E8DH 5GGTA 2XN9E 4HH9A 1R24B 2VQUA 5IB3B 1KYOJ 4FFWD 3TGXA 2HKFL 3QIBC 3PV6A 1MJ7L 4QEGA 5FUOH 1K6QH 3S37L 2FYYB 2OMBA 3W0WE 4PRIA 3BP5B 1E27A 3QFJA 2IMMA 4U1JA 4PJGA 4HPYH 3LV3B 4HUXA 2BXZA 3X12B 3HG1B 3TWCH 4PJXF 1LGVA 4JLRB 5KW9L 1AGCA 2G9HB 3TBWA 4XMKL 1MI5B 4Z7OF 4DN4L 1Y18A 5J13B 3QSKB 2DWDA 3VW3H 3E6FB 3IFOB 1ETZA 4XWGL 4EEEA 1JWSA 4P2QA 1HN1A 1U0QA 5DDHB 5IR1B 3EYOB 3WHE0 3UYRH 4C54A 2FECL 3L9RB 4WUUB 1T66C 1GOFA 4U33A 1I3GH 4XVTH 1VACA 2ZUXA 1JWSB 3DSNA 3BD4A 5F71A 3NPSC 4LPVA 5DJYB 4XP4H 5CIPB 3T65A 1DL7H 4CU6A 5T5FL 3ZE1F 3AM8A 5HYSG 4XXCA 3NIDE 4G7VH 4PJCE 3T3PE 4OAWB 4JQVC 4I8DA 1M05B 5HGAA 2MCPL 1C5DB 3P9LA 1W72L 3MA7A 4KI5C 4PBXA 5IWLC 1MRCH 4G3YL 3MJ9L 1RUPL 2ADGB 3O8XC 1KCKA 1OB1A 2Y7QB 4HLZG 5JHDD 4P4KC 4NNXB 1S7RB 1DANT 2V2TB 3WS6C 3EAKA 3RWHB 4DUWA 1N2RB 1KJ3L 5I19H 4Z95H 2VIRA 1L6XA 3TIDA 2WBJC 3SN6N 4HIXH 4LOUC 2D7NA 4XP5L 4WJ5B 5F72S 2APBA 2FX8H 5I1JH 5DJ0B 4XTRC 4DFIA 4IIQB 1QFPA 1FO0L 2X89D 4PR5A 4MB5A 4JDTL 1JF5A 1G7LB 5BZDA 5E1HB 2XOTA 5ALCH 4PJHA 3ALPA 4J12A 4JE4B 4PY8I 3QRGH 3AB0C 5FECB 4MQ7A 4G8GE 2OSLB 3HB3C 5EO0B 5CSBA 5JW4M 5J89A 4OF7A 1G7LA 5BZDB 5ACLA 1R5WB 1WQVT 2WW8A 1DEEA 2APXA 2QJDA 3VXME 1L7IH 4RDQG 3OSKA 3FB6B 3KXFE 3VRIA 2EYSB 1A2YA 2IEPA 3HE7C 3OJ2C 1FVDA 1SEQL 1I3RA 1TJHL 5I2IB 3BT2L 1WWAX 3CLEH 5MEND 1A9BB 2FCBA 3O4LA 1E4XH 4XP6H 3S36X 5C09B 2QADD 4X8JA 4MD0A 3PHSA 1S7VA 4NM4L 2O61A 1RK0B 2NZ9C 5F9DC 4DEPC 3KXFB 1OT2A 3KPLA 1PKQA 4IRJB 4B5EA 5GGSB 4OIIL 5IVXB 2WQ8A 3WIHL 4PGZA 3LHPL 3KPPA 3KAAA 2EXWD 1FE8L 4U0RB 1FE8H 1LO4H 4EBQL 1MF2L 4H1LG 4L3EB 4S11A 3MLUH 2NY6B 4A6YA 1GSMA 1U8HB 3WXVH 5F96H 1I85C 3O6MH 5ILTL 1YUHA 4PJCB 5J3HC 1CDGA 2QQKL 5DUBA 4LSTH 1T89A 3AC0A 4EQ3A 4NQSB 1Q0XL 3C2SA 4M5ZL 4HW6A 5ITFA 3BZ4B 1BQLL 4IRJD 4K7PX 3OGCA 4P59H 5I1EL 1CFTB 1KCRH 4CVWA 4X7SH 4E41D 1QEWB 1ZGLP 3N85L 5KOMC 3DPBA 3TN0A 4QTHA 2UYLB 2C3HA 5L8KB 3SE4C 3GMMA 2VITB 4ZAKD 5CWSB 1CGYA 3GSUA 4OD1L 4PJEA 4G5ZH 1S7WB 2C4XA 2EE2A 4AH2B 2FBJH 4QTHB 3PV6B 5HGHB 3GO1L 2DQFA 3NZHL 4OCWH 3WNOA 1SEBB 4FQXA 3L1OH 1FFRA 3ARTA 3HMXL 3TO4C 4U1HA 3ILQC 5KSAC 1HZHL 4O02H 5I1HL 3BQUA 4HUXB 1OTTD 4PS4L 2WUBH 3DVFA 3MV9A 5EO1B 3T8XB 3W2DH 5HPMA 1T5XA 5E8PB 3UBXA 5I8EA 1EJOH 1DQQA 4XNQA 1H0DA 1I9IL 3MRQB 3SQBA 1BP3B 4HIIA 1D5BA 3NABL 4JN2A 2A0LD 3QDJE 3A6CL 2X09A 4BQBA 5HPMB 3MV7D 4PUBL 3G5YB 3ULVH 1NFDB 3V5DB 4AIZA 2X1XR 1I8IA 3EFDL 4WHCA 4XWGH 3BRGC 5ESQA 2Y1VA 1OP5K 2ZSWA 1MFBH 1D6VH 3PWVB 1WWWX 3QIBA 3GUTA 1AGFA 1QNZH 5FAAA 2F19H 3ESVF 1ZTXL 1D5IL 5BOZG 1D5IH 4PJ5A 5F3BA 2GSIB 1DZBA 1U2CA 3MJ8A 5GZOC 2WWKT 1DQLL 5K9QG 5BZWA 3CCHA 3ARFC 1HYSD 2VDLH 3M17B 5C0IB 1N59B 2F5BL 1E6OH 1DDHA 4OLWH 2EDTA 4X9GA 1J8HE 5E9DD 3UBXI 5DO2C 4MB4A 3WS3A 4JM2F 4NNXA 1NCDL 5T3XE 2IQAB 2LTQB 5ALCL 4G9FD 3RWJB 3KVQA 4BSWB 3G5VA 3FB5B 3BZFA 3OQ3B 4C56E 3GHBH 3I75A 3SGDH 4U49A 5I1CH 1YJDC 4PGCB 1PKQE 3C9NB 4PD4J 1J88A 4Q97A 3FB5A 4PRPE 5A2JH 3QCVH 4OLZL 3R8QA 1FZMB 2X1OA 3MNVA 1T0MB 4WGVB 1G7HB 1BVLA 4K3GA 2Y9RT 4U1NB 2E6PA 1T6WA 3MXWH 1IAIH 1UH4A 1YQVL 4WY7L 3RX8A 3TCLB 4E41E 4LASL 1ZSDB 1G0YR 4ZMAT 3TIDB 1TLKA 2M26A 3W11C 1S7UA 3TN0D 3UJJH 3GSRB 3M45A 4ODWA 1A3RL 5DYOB 5A2KH 3RRQA 3ARXA 1II4E 4QRPB 3M07A 3OBAA 1BX2B 1RAMA 2X4RA 5AD0A 5GZND 2YA0A 3MXVH 1FFNB 5FECA 4RZCA 2I60L 4N0YL 2I60H 3T0EE 4X8JB 2D7MA 5EU4A 1HINL 3VE0A 3RTQB 2EICA 3BKMH 3QPQD 1KXTB 5J11B 3SO3B 1BFOB 2J6EL 4KK6C 5JXEC 3BWUC 4YBQC 2NPLX 4X7FC 1LD9A 5IFHH 3VE0B 4ZD3H 2VSCA 4MXVE 4XNZC 3QIWA 5MP6H 4OGXH 3TBSB 2NTFA 3SGJA 3IU4L 4M02A 1AXTH 1FIGH 1XIWD 4HSQA 1K3ZA 4Y5VA 3H9YA 1EFXA 3Q6GL 4X6DA 3EZJB 1TJIH 4XB8A 1J8KA 4WHTB 4PP1C 3X3GL 4H26B 2XFXA 3PGCA 3UROR 1NGXA 4JO3H 3O4LD 1WBXA 3MA9L 3VWKA 3L3JB 2OR8A 1A7PL 4K7FB 2A6JB 2MKLC 3GMPA 1MCPL 4X0KB 1VACB 1NGXB 1N7MH 5EO9A 2GHWB 3VFRA 5D7JA 4Z77B 1CGWA 3GMOB 4LNVA 1LQSR 4HV8B 4U1IB 4ZO9A 1C7SA 4XH2B 4GG6F 5B38A 3FQWB 1RHFA 5ENWA 2Y6SD 3ARFA 3QDJB 1QLEH 9CGTA 2W9DL 2QSTA 1JF6A 3P73A 3FB7B 1ZAGA 1TCRA 4S2SA 4HUWB 4WTZA 3W9EA 2FO1A 3VMPA 4I2XE 1FZJB 1FYTD 1N2RA 4JFOB 4L5FH 3KJ4B 1OPGL 4FQHA 3D69B 1AJ7L 4UIMA 1KSRA 3EDKA 1BOGA 3JTSA 4EI5B 5BVPH 2G60H 4HIJB 3HPJA 3BP6A 3I9GL 1SM3H 3B3IB 4JO3L 3CXDH 3BOVA 4NSKA 4NZJA 5T1LA 3C60C 3FQXA 5JUEL 1YEDA 5CFHA 4KKAD 3QR2A 3IFPB 3BP6B 1MCCA 1RUML 5JW3H 4LMQI 1Q9WA 3BP5A 2GJZB 5TF0A 4TYUA 4M1GL 5DJYA 4ODSH 5ADOH 2JJSA 2AEPL 3ARBC 1FVCA 3OKOA 2C9AA 1V3KA 1PSKL 1JTTA 4RGND 4R97C 5AG9A 2B8OT 3BQUC 4YE4L 5BRZD 3EJYD 1QLEL 1NCAH 1S9XB 1U3HC 3G08B 4ZSOA 5D70H 5F7DA 1NGPL 2VLJD 4KKAC 4NQVB 4X7TA 2VXTH 3BN9C 5FYJL 3VWKC 3T0EA 1WGOA 1NGZA 5HVWA 4M7LL 1IAIL 4M7LH 4AIOA 4ZFGL 1R5IA 1LNUB 3PABA 3L1OL 4P23D 4GJTB 1RIVH 4D9RE 2XWJB 3SCMA 1BJ1J 4HBCH 2FNBA 5SWQA 1X5KA 2NY7H 3GSNA 5DEGB 2WUBL 2DBLH 3SGEI 1RZIA 1XEDA 4X6CF 2CD0A 1BQHB 2G2RB 3X3FL 4N8VG 5C08B 4OFIA 3QQ3B 4NHCL 3GJFH 4EZMA 5MERA 4M7LT 3S36H 5IBUB 2HT4D 4HIHA 5JOPE 1U8OA 1GVIA 4JJ5B 3RP1A 1RZKH 3GIZL 3LS4H 4Y5XC 3NN8A 3QHFL 5I1KH 4LSSL 3QXVA 4MNHA 4UUJA 2HT2C 4HIHB 3R0NA 1T1WA 1C1EH 5D96B 3MR9B 4L9LB 4PV9B 5FYKD 1Z2KA 4KAQL 3F58L 1DBAL 2H2PD 2ORBH 4OF3A 1TETH 4FQQA 4HF5L 4JQIH 4CMHC 1UZ6E 4WW2C 1Q8MA 2N7BA 5DFWH 3GB7A 4JFYB 2P48B 2VWEE 3REVB 2VLLA 3CSYA 3HUJF 3UC0H 3IU3A 4X6BA 4C4KO 1G84A 3WNNA 3QUMA 4N9GA 5D1XB 4H20L 1LK2A 5EO0A 2EXWC 4JM4L 3PQYE 3NCMA 3GGWA 3VXNA 3UCRA 5KG9B 2E27H 4QF1A 5F7LB 5DS8A 1OW0A 3PJSA 4YHNB 1U3ZA 4ZS6C 3SDDC 4MX7A 3FO9B 3BEWA 5MP6L 3C8KA 3H6JA 4OCSL 3DROB 3LKNA 4MJIE 1WFNA 2NY6D 1EVTC 4K2UH 4FMKA 4OF5A 3PGCB 3T2NH 1OQXA 1DVFC 1W8NA 5MENE 4PJIA 1KN2L 1OOAA 4OZIB 1HXYB 3HI1A 2XZAH 1GCFA 2DQCH 3O3AB 4RAVA 1UJ3C 3I50H 3LKOA 5BQ7B 1QFUH 3KPMB 5DZOA 1RZ7L 1HXYA 4AENA 4KROC 5B3JF 4OCLC 3HI1B 2VR5A 4HWBA 1BJ1H 4GUPA 4ZTPL 1K8DA 1UYWL 1N7ML 5IIEA 1FO0A 3IRZA 4AEHH 1KFAL 3VXUE 1FYTB 4PRIE 5DRXB 3VWKB 4KFZC 3GRWA 4GUPB 5JHDE 1G9NC 5HYIA 1WV7T 4Q6IC 4YC2B 4IJ3B 1EUUA 1R3KB 2PTTB 4WWKD 5TDPB 3DYOA 1L9MA 2YD1A 2QADC 5F6HJ 4RAUB 3ALXA 4LQ1A 2V5RA 3RIFK 4XCEB 4PGEB 5ALBH 2VERN 4OFYD 3FAXA 1W8OA 5GGTH 3DGGB 2V6HA 3AS2A 3U6RB 1EZVX 4UT6H 4F58L 1QTYT 1O0VA 1NL0L 1KJ2L 1WK0A 3FB7A 4HKZB 3LEXB 4MJ2A 1HKFA 5DMYA 2F54A 1S7WA 3ARYA 3FO0H 1J1PL 3NCFB 5C0BB 1UM5L 2KZ1B 3SKNA 4NUGH 5GRJL 3KPRD 1HYSC 4FFZL 3M1BB 2R0KH 3QYCA 2BVUA 3CFCH 5DDHA 4XC1H 5BVJA 5IR1A 3WIHH 3DWTA 2F54B 4CADA 3WDJA 4PRDA 3QEUB 3U4AA 5CBAA 1EO8H 1IARB 5C0JA 3CAFA 5DSCB 3ROOB 4DKAA 3QEGL 1D5MA 3HMXH 1X5YA 2NXYC 1QD0A 1QSEA 4QT5A 1B4JH 4DFHA 2E9BA 1SJVA 2AXGB 5JW4Q 5KOVC 3P4MB 3QEUA 2ZSVA 2JCCE 1MCEA 3T4YB 1UA6L 4XX1G 3QXDA 4U1LA 3VWJB 3JSSA 5EOCJ 3ULUD 1WEJH 5DJAB 5CGMA 1S9WB 1NCTA 5L2KD 2HVKA 3QEQE 1CE1H 2JK5A 1A4KA 2Q76A 3ZDYE 1SBSH 4N5EC 4OTXL 3EJZC 4OZFA 4XWOC 3N9GH 5FKPB 3SKJL 3U0PB 3PDDA 1C1EL 4BH7B 3KYAA 1VGEH 1YEHL 3ME0A 3QA3A 4IHOA 1W0WA 5F88A 4AEIL 3HC3L 4Z7QE 1ONQB 5JHLL 1F6LL 4Y5VB 4OZFB 5FKPA 5D1QD 4JJ5A 4NZTH 3MCG1 2FEEL 1IZJA 2FL5A 1I7UB 5JXAL 1B0RB 1KENH 3GHEL 4HIEA 5D2NA 1MELA 4KKBC 5HYQA 3L3DB 4NP4H 3TFKC 3WN5B 3WFDL 1DVFA 1HIML 1EAPA 1VDGA 3O41A 1NFIA 2LVEA 2VSDA 2P24B 3VFWB 1H3TA 4KROB 3BYTA 5ISZA 4LSRH 4TTDD 2PUQT 2AGJL 1X9QA 3FOMB 4N0CD 4ZTOH 4OLXL 4QRPA 1Q72H 4V1DD 2NNAA 1INDH 1WZ1H 5IEHB 4H1LB 3A6OA 3BKML 4HC1A 4J23A 1PSKH 4M48L 4QRPD 3JV6A 3LH2H 3HZMA 3REVA 4WEBH 1TVHA 1ADQA 2GFBB 3ZHDA 2DI7A 3T0VA 2EO9A 3NOIA 5IFHL 4TN9A 5DMKB 3EO0B 3VFVA 4HUUA 4M7JL 4PUBH 3H9SD 3ZE2F 2WK2A 4DN4H 3QDMA 3CFJB 4Y5XA 1CLZL 4YGVB 3BRDA 2QEJA 4Z7OE 4R90L 5BW7C 3W5MA 4PV8B 3HPLA 3ARDC 2B39A 4X6EA 3FTGB 1AD9B 1U3YA 4KDVA 1D9KA 5DJCA 4MX7B 1U6AH 5F9OL 5I74B 1OL0A 4Z0BH 1QACA 3CXHK 1H5BC 3V0WH 2R0ZL 5A40E 2WBKA 2V2WB 5HHNB 1XMWA 3SJVE 5EIIA 5IHUH 1N5YH 1Y6MR 4NKDB 4TTDC 2VXQH 1BQUA 2ZG1A 4P5MA 5EN2A 2HWZL 3QHZL 1QSFB 5DJZB 3WE6B 5KSUB 3SDXF 4I4WA 2EEDA 1Z3GL 4QRSB 1YECL 5HYSA 5I71B 2DQIL 1OAUL 2DQIH 1KT2B 1JZ7A 3U7YL 1MCIA 3MMEA 1ZT7B 5TQ0H 4I77H 4M8QB 4WTXA 3K2UH 1K3IA 1G7IA 3A67H 2ZPKH 4U4BA 4XCYB 2P5EA 1QLFB 4OKVB 4EI5C 5IMLA 4Z8FH 3SDCB 1RZ7H 4MXQC 3QQNA 2YKLL 4WI3A 5ENWB 1UH3A 3HZVB 3KPSD 2P5WB 3T77A 2UWEB 3RGVA 1KJVA 4HLJA 4R7NB 4Y4HD 4XP5H 1X6LA 3HZYA 3U4EB 2XA8H 1UB6B 2AK4A 1JZ5A 2R69H 1I4FB 3CU7A 3G5ZA 1G0XA 4O51A 4PRNB 35C8H 4WRLA 5AAWA 5C2UB 2ICCA 4PGJA 2FGZA 4PJAE 1OGAE 3GMPB 2BFVH 4PJBE 5FUZH 4GSDH 5EA0H 5HHVL 3H9SE 5F7UA 4PJ7B 2P5WE 4TVPH 2EKSA 5DEGA 2W0LA 3LRHA 4KK5C 2QQKH 4KV5F 2C3GA 2DQJH 2F54D 1MVUB 5BCAA 4OLVH 4UNVA 4RAUA 4IS6B 4NCC2 1MFDL 4P4KD 5ADOL 1CE6A 3MUGB 2HRLA 5FGRA 1T7ZA 3RDTD 2BX5A 1NDGA 1S5IH 2FO4A 4P2OC 1B6DA 3MV8D 4KGJA 1FH5L 4PRPB 1I85A 2NY0B 4HJ0D 4PRAA 1X5LA 2FBJL 2O5YL 5GIRA 5LKNA 5EH1A 4GMTH 3MODH 5IF0B 3BH9A 4J3OC 3RGHA 2BDNH 2OM5A 3LEVL 2X4RB 5AD0B 2XXCB 2YD7A 1PQZA 4HFWA 2C1OB 5JLZA 4DWHA 2APFA 3I6KB 5C9JA 5HI3D 1JZ6A 1QFWH 4A6YB 4X9FA 3V9FA 4KJYA 3QH3B 1KIPA 5FA3B 4L1DA 3KYOB 3KYKH 3RWJA 4BSWA 3FQNB 3B2UD 4L9LC 4TSCL 4P23B 4ODVL 3ZT5A 1RZGB 1BLNB 1MHCA 3IDGB 5E9DA 2Y06L 3FCTA 3SDDD 3VXSA 5E8DL 1NFDF 2G2RA 1U8NA 2XZQL 4O9HH 2BMKA 4RAHA 2VN7A 3L3OA 1FCCA 1HQRB 1QUNA 3FCTB 3WKMH 1QNZL 5IHBA 2XQBL 4L4VA 3T3ME 3O2DH 2D0HA 2A9NL 3EYQD 1GGBH 4PLKD 1NGPH 5JXAH 4HUVA 1F3JA 4AIXA 3DMMB 4CN4A 3EFFA 1J05A 4IIQA 1XF5A 5FYJH 1FJ1B 4IHOB 2V5SA 2QQLL 4P4KA 3MODL 2ICEA 3JBG7 3S5LB 3HLAB 2J8UA 3O9WB 1UENA 5E08H 4AH2A 1BQHA 5AZEL 5K9OA 3SDDB 5DJ8B 2HRPH 3OKLA 4HWZA 4X0KA 1IBGL 4P2RB 4NQDE 3F5WA 3FZUC 3OG6B 3RVUC 3S5LA 4JCLA 5L88H 2CRZA 4GS7B 3AAZB 5JPMA 2V9QA 4MJID 5TPWL 1K4CB 3I6GB 5LGJA 2Q3AA 3HE7D 4IRSA 4KQ3H 1H8OA 5JW3L 4ZS7H 1AH1A 4ISVA 5FEBA 3GMQA 5E5RB 3TPUA 2ADIA 3G6DL 4XXDB 4X6EB 5C7XL 2E5EA 3VDBA 3UYOD 1K4CA 1WFTA 5T3ZH 1V3LA 3KHOA 3V6FA 4OI9A 1QYGH 3QIWB 2DWEB 3BX7C 3FOLA 1QBBA 2BSTB 5LWYL 3VD9A 2IPTL 3RVUD 5EUOB 2YWZA 5I76A 2DMKA 1T1ZA 5E95B 3TWCL 4Z7WF 1AKJB 2FIKA 4MCZA 2EIBA 2EDRA 4N8VA 4KROD 2DIJA 2XFXB 2FX9H 4BZ1L 1VFAB 2OL3H 5JORB 2OL3L 1HSBB 3GSNH 1Z3GH 2NY7L 4KZDL 4L4JA 5GS0L 3H3BC 4LLMB 4P2QB 1RPQA 3K2UL 5H94B 1AHWB 5AZ2H 5EBLA 2NY3C 1NBZB 5ALBL 1MRFL 3FT2B 4BELD 4YHYB 5IGXH 3ARRA 1MH5A 1AIFB 2CKBH 3OG4B 1TQBB 3BO8A 3MRRB 4NBZB 1R3HB 3DXAA 4Z7NE 3LN5B 4G8GD 4OCYH 1FCGA 2RB8A 4MDJA 4WU5B 3ZKSD 3WDHA 4G6JL 1YEIH 4LVEA 3U6RA 2NY2C 3G04B 5FDYA 1AC0A 5L2JB 3LMJL 1G7PA 3FAWA 4LQFH 1I9RH 5C6TH 4TNWK 2Y7QA 1T4KA 2Y25A 4S0TD 4FFZH 4M62H 2EYTA 1I1AA 4WI9A 3GSRA 1A64A 1TCMA 1NANH 4AG4L 4NN5B 7FABH 3ILQD 5DC0A 5F9JA 1I7TA 1P84J 4OLVL 5B39A 4Z7VB 1T1XB 2EE3A 2D03L 5CJXC 3SGJC 3VRIB 4OD3L 1J0IA 4RISH 1VFUA 4G43A 1IT9L 2XKUA 4U3XA 5FB8B 4MCYA 3ULUC 5DHYB 3ZL4H 1I1FB 5HDOA 3WIFA 1OGTB 4YHZH 2O93L 1P7KA 3C2AL 2XRAH 3LD8B 3EDFA 4K8RH 3BKYH 5DC4B 5C09A 2ZSWB 1KJ2A 3LKRB 3CSGA 2CPCA 4NQEB 2P42B 3DLQR 2Y72A 4Z9KB 5SWZA 4KRPD 1QPXA 1QBLL 1S9VB 2W65B 4LASH 1JHLH 4Y4KD 2V7HB 4MVBD 3EOYG 4LQFL 1CT8A 5C0IA 5E6YA 1OTSC 2DIBA 1ZLWK 5CBAB 5ICZB 1F11A 3QUML 5L2KB 5D1ZB 2AXFA 3BW9A 5IROA 3SCMB 2YPKA 1RMFH 4MMZC 1UXSB 3UTTE 3TFKD 1QOKA 3ARZA 2YA2A 3JWDL 2A77L 3CFEB 2X4PA 4A6YL 5E56A 1G6RL 1EUTA 1YEGL 5GGVH 1P5UA 1V7NH 4D9RD 4HGKC 2YZ8A 3WV0A 1K5NA 1K4DB 2R8SH 4YLQT 4E5XB 3WL9A 5FM5M 3RFZC 1NCCH 3G6JB 5TH2A 4QY8B 1OAXL 3F7VB 3BIKB 3BGFB 2DJSA 5EZIL 5GS3A 5F44A 5E2UL 2D7QA 2L4OA 3FO1A 4ZOAA 2GFBA 4PJDB 3E8UL 5LVEA 2UZYB 4ODWB 2LTQC 1UGNA 4FN0A 4O58L 4QRUA 4HUVB 2PXYD 1CL7L 3M8OH 4LARL 3EYSL 1H3UA 1YQ2A 4Y16B 1MRDL 1RZFL 3C60A 1JHTB 4TUOA 4L8CA 1QSZA 1OCWL 1YYLL 3GB7B 4R9HA 2ARWA 3OWEA 2ICES 1BM3L 1PLGH 4R8WH 1WFOA 3QUYD 3T0XA 1H15B 5EU6A 4OCWL 1DQML 4OF6A 4JKMA 2CIKA 4PTTA 5D7KE 4RGMC 3FQTB 4D9LL 1BFTA 1A7RL 4PJHE 5I8EB 1RV6X 4LSRL 5CJOL 1A6PA 1G6RH 4JRXE 1JGEA 1GZQA 3IFPA 4P3DB 4O02L 3DVNB 4KKCD 4EJ1C 1KLUB 3ZKMC 5CD5C 3S37H 1OAYL 2PXYC 4HDIA 2FJHA 1MCQA 1AGCB 1AY1L 2FIKB 2G9HA 3BPOB 1KB9K 3DROA 3HS0A 4GXUN 4MCZB 3T0AA 3EDJA 2X05A 2YXMA 1ADQH 1MLCA 3B4NA 5IP4A 5BXFB 1LDPH 2JB5L 4U1JB 1LP9E 4JG0H 1U91B 2BSTA 2IFFH 3MJ8B 5E94B 5GS2H 3WUWG 2XKNB 1L4IA 4HS8L 2OJEB 4POZC 1N4XL 2XN9A 1G7QB 3DBXB 5D6DA 2WQRA 5F1KC 3D39B 3PWVA 2W0FB 5GRWA 3SKUD 2C1OA 4K3DH 3QO0B 5JLZB 1DBKH 4UNTA 4R4BA 1KOAA 7FABL 5E1AB 5FK9A 3WO4C 4EKXA 1IC5L 3QIBD 3DETD 5BZWB 2D31A 1M6OA 5DWUH 2YD6A 3SDYH 4G3YH 4JHAH 1FVEA 4GXVH 4F7PA 3NN8B 5DC9B 3KPQB 1QLFA 3TF7C 1CLOH 4K3HA 3O0RL 2PF6A 3L5XH 3HAEA 2UWEE 3S96A 3RY4A 2Q8BL 2Q8BH 3EYFA 3CUPB 4FQXD 2K9UA 4JQIL 3ORJA 3KR3H 1MFCH 3KPTA 3VJ6B 1T1YB 3UC0L 1NDMB 3WCYA 4X80H 1F6AB 4G43B 3QAZB 1RJLA 5DJ2B 1CD1A 5BMFL 2P5ED 4P23C 5EULV 4ERSL 2AJSH 4YHOH 3W9DB 3MRGB 4WEUD 5GIRB 3FMGL 5DLML 3F62A 2N4IA 3PL6D 4Z7NF 4J4PD 3U0WH 1NC4A 5C09D 1GJIA 1Z9LA 2G5BA 1XF3B 3QFDA 1I1AC 2A77H 4MJ5A 3N1MC 2GSGB 4HKJA 3UTQB 3FN3A 4N0UA 2X4SB 2P4AB 1EGJA 2ATKA 4XC3H 3DHJA 3CLEL 5DMKA 3IJHB 1F11B 5ACZB 5AUMB 1IGYA 1EMTH 5GSRB 4XPFL 4NRZA 5A2FA 2P8LA 3A67L 4JRYD 4RRPG 5JPNB 1KLFA 3SQOL 1CR9H 2H3NA 3KPPB 4HQQH 4NJ9H 3UTTD 1LK3H 1AQKL 1EIBA 4NM8L 3KHQA 1T21B 3MRFA 1AFVL 3KPMA 4YO0A 1QBAA 3KXFA 3BSZH 4KK8C 5IB1A 3TNNB 3WNKA 1J0ZA 4G9DB 4MA8L 2X9WA 4F7MA 1WITA 1QHPA 1H8SA 1KIUA 4ZYKA 2ID5A 8CGTA 2IH1A 3BZ4A 1RUQH 4L3EA 1GIGL 2EIZA 4C83B 1NUFA 4ODUA 3TH2T 2YC1A 1H9VA 4GRLA 3BGMA 5A16A 5I75B 1DQJA 4XGZA 3O2WH 4JZJC 5FYLE 2B1AL 1HNFA 4LHUD 5F7MC 4YPGA 2VE6A 5ESAA 5EO9B 1IL1B 1FZOA 4ETQB 4R7NA 1T03H 1KB5L 3MBEA 3PWNB 1T2QL 2EO1A 4XNYL 5ADPH 2A9NH 5CJQL 5I1LA 4UOJA 2VE6B 4DW2L 1CFQB 3AM8C 3O3EA 4LLDA 1HH9A 4G7YH 3Q1SH 2YOCA 1JGUH 3HMWL 1A0QL 2OR9H 5GXBB 2Q6WA 3LV3A 4DZ8B 4RGNE 3EJZD 3W0WD 2W1NA 4QF1B 2XWTB 1F2XK 2PCPA 2QV2A 4WW2A 3X3FH 2LAAA 4LGRB 1A8JH 1OSPH 2XXMB 4YFLF 3DRTA 4UAOC 4M4RA 3C6LA 1I9IH 4PJAF 3E6FA 3IFOA 1F4AA 1KLUA 3KXFD 3VRJA 5I9QB 4E0RA 4ONHA 1XT5A 2V7NB 1VEOA 3FQXB 4HD9A 1G7QA 3DBXA 5J6GA 5I1KL 1ZLVK 4CRPA 3HC0B 2XV6B 4WY7H 4G8IA 4ENED 1G7JA 4KRPC 4CU8A 3OR6A 4R2GD 5IKCB 1VEPA 2E6JA 3IYLW 5I66B 3HR5B 1N59A 4BK4A 4ZOEA 4MNQA 4PJBB 2GTZB 5FO8A 4HPOH 5I1IL 1BZQK 1NBYB 4JY6B 1NMAH 1MFCL 3UTZA 2BC4B 4H1LH 1M7DB 1N8ZB 4UOW0 4JVPA 2AKRA 3DI2B 4JY6A 1CXFA 3HAEB 5C0CA 1OGAA 4OFYA 3B9KC 4PGDA 1TTFA 3LAFA 3JUYA 2Z4QA 2DLHA 4JR9H 1DP0A 1U92B 4OB5L 4M93B 5CCKH 1ZHLA 1KYOK 2VTFA 3GJFK 1YN7B 3JV4B 4DGIH 2YR3A 3B5GA 3WXWH 3KPRB 4HKZA 3LEXA 1D9KC 1U8PA 1BZ7A 2Q87A 5BS0E 4DKFH 4JQXA 1JUFA 3BISA 5IJVB 1IC1A 3VFMB 3FHQA 4HJGB 4PLJC 3ECBB 1FO0H 1I9JH 3IJSA 4I48A 4KUZL 4JKLA 5CZVL 2ICWB 2VLKA 4UINH 3P9MA 2IPKA 3OHXA 3TZVB 1KJMB 2WUCL 2OX5A 5JMRA 3QFDB 4JRYB 1ZVSA 3QDHA 1OTSD 1IKNA 3T4AA 2VAJA 4OCMC 3U4BH 4OZ4A 4KKBD 1LE5A 1S7UB 3P9MB 3VFNA 4PYGA 3FQRA 3BWAA 5ERWB 2C3VB 3QHZH 3BT2H 1KIPB 4Y19E 5LGJB 3DV6A 2VLRB 1XF2B 1UXSA 1NAKH 3FB6A 4Q9RH 1BZ9B 1QSFA 5C92A 4NN6C 4JREB 5CINH 1UWGL 5I15H 2HT3D 5T3XD 1D6EA 2OTUA 4LLWA 4N0UB 4NN7C 3P4OB 4M7KL 1G9NL 1MOEA 3BUYA 4ZD3L 1P6AB 3GSVA 4DGIL 4UDTA 1ZS8B 4I3GA 2LE9A 3WL9B 4MA1B 2VC2H 4I0PA 3D2UB 5DMGC 2IH1B 3DMMA 5TE7H 4ZSOE 2EC8A 1JJUA 3OGCB 2ERJC 1T7WA 4PREA 4U6HA 5EZOH 4PJDA 3H7LA 4NFCA 2XKNA 2P45B 4Y4HA 2W9LA 1A1OB 1PZ5A 4UOW1 1NEZA 1A0QH 2IJ0C 3DSFH 5HDBF 3VU2A 5F1NB 5EBWA 1XGPB 2IAMD 3C87A 1OLLA 1FNHA 1RY7B 1MCFA 5H8DA 4XP9L 3G5XB 2EKSB 4V1DE 4K7FA 4OSUL 5E2VL 1JWMB 1MH5B 5IIEB 4HUWA 4FXGB 1OHQA 2WLYA 3GSQB 3KPNA 3ZKMD 4S1RL 5CD5D 5FCSH 1LEIA 1GXEA 3MFFB 5JXED 2CDEB 3C60D 3VGEA 4LHQB 2JIXA 5B39G 3I3BA 4JFFE 1G7MA 3QULA 4YXLH 3GMNA 3ABZA 2AJ3B 1P7QB 3V5HA 2UY6A 4J3WA 4ZOCA 2YK1H 1FAIH 3STLA 3SKMA 3QI9A 3V6ZA 2PCPB 4GRLC 4WV1B 5T5NG 1OPGH 2NY1B 3OF6D 1JV5B 2CDGB 1JPTH 3KYNA 5KSBF 3PWPA 4IBLT 2R0LH 1E4KA 32C2A 1ORSB 1WJ3A 1I8IB 4F9LA 4G6FB 1D5XA 3PHQB 4PIRF 4PLKC 3MZGB 5FF6A 3MRGA 4JQXC 1NLDH 5DJZA 3WE6A 2ZOKA 3LEYH 4K3DL 4ZXBB 3MLPA 2LAGB 4MAYB 2Y36H 2WIMA 4I5BA 4ODVH 3QEGH 5IWLA 4LHUB 3PHQA 5IW6A 2DTMH 3UBXB 1MWAB 5B8CC 3U36B 4BKLB 1JNHA 4ODSL 4U6YA 2BY0A 5C6WH 1KCUH 1OAZL 1FG2B 4ZODA 3ARUA 5CEXA 2J8UF 4YE4H 3G5YA 3GSXB 5A2IH 1I75A 5CJQH 4LLYA 4JZOA 5FM4A 1UCBH 3MROB 3EGSB 5L0QB 4ZNEE 3ESUF 3RI5K 3KPQA 1UB5B 1KC5H 2VDOL 4M7JH 3VMOA 4RX4A 3IDIB 3V4UL 4Y4HC 2FEDC 1CE1L 4LNRA 4YHIB 4ZFGH 3ZKND 2Z4QB 1AJ7H 5FO9B 3IFNL 1DR9A 3DX7B 3EYSH 1KCVL 3ARBD 3T1FA 4TUJA 4YXKH 2ICEB 1CTNA 1ZV5A 4ERSH 2J8UE 4WGWB 4H88L 1X7QA 3FN9A 3JTTA 1FFOB 4PJEE 4RMUA 4CW1A 1U95A 2WLZA 5K9QI 2ERJB 3LEYL 4TUJB 3HKFA 1NAMA 5SV4A 1V8HA 4UB0L 3GSNB 3MBED 2CKBL 3OZ9L 2EDLA 1IEAB 4LSSH 5FB8A 4W4NA 1I1AD 4PJGF 4DTGL 1D5ZB 1HHIB 5SX5K 3QG6B 1NAMB 2QKIA 4RWHA 3PDOB 4Q9RL 1DQJB 1EMTL 4MJ5B 2VLRD 1RURH 1AI1L 4B7IA 4X4YB 1QSED 3D9AH 4EDXA 4KAQH 3O2VH 2FJFA 5IJVA 4J3SA 2WBJB 4YFLI 5T1KA 1SJXA 4HQQL 4JGUA 4OT1L 3T08A 1IFHL 5F7YC 4OT1H 4OLUH 5TGBB 5T3XH 2BVOA 4UQ2A 4ODXA 4ESKA 3O6FC 4DGVH 4JRYA 2YD3A 4HS8H 4QYOB 4YFDB 4ELME 1LO4L 1CGTA 3ES6B 1NGYB 3HFML 4NDMA 5H35A 2DLGA 3FMGH 1N5AA 2MFNA 1YY8B 1NGQH 5DJXA 3L5WA 5JORA 1N26A 1LK2B 1IGMH 3UTTA 3OKKA 4MD4B 5F3HB 5EDXA 5HYSB 4LPWA 2QADB 4H26A 5DVMA 2ZOLA 4Y5YC 1E4WH 4PBWD 1CFBA 1EZVY 4PRBA 3B6SA 3IU4H 5AWNH 3PL6A 3MJ9H 5C6PB 4PD4K 1HKLH 4QRTB 4OF0A 1LO0L 2W59A 4V2CB 5B8CB 3O0RH 4NWUH 1MCLA 3LN5A 2DQCL 4MQSB 1FNGB 2A83B 5IK3A 4N1CA 3MRIA 4QWWC 4R26H 4QCIA 4PB0L 4J4PC 2E7LA 2BNQD 3OJDA 1B6UA 2J5LB 3NCCB 3AXLB 4M62L 3HE6D 2YPVL 4ZS6D 4K94H 1GL4B 4WNQB 3IAGC 1N64L 2CDFA 4R0LC 2RR3A 5DVNA 1MVFA 4IRSD 5J6HB 4DVBB 3KYMA 4M5YL 1YEGH 5GGVL 4HS6A 5FHAL 35C8L 1SM3L 4HZLB 5E2TL 3RNKB 3P4NB 4ONFH 5LAXA 3QIWD 1DLFH 2DIAA 3TPUB 1GIGH 4MSWA 1C08B 1U9KA 3MO1B 4RDQF 3KPOA 1Z5LB 4OKDA 3MOAL 1E27B 3B9VA 3IDNB 2R2EA 5SWSD 3X11A 1SBSL 3WIFB 3PV7A 3PWUA 4XC3L 1IAOB 5IBTH 3RUGA 1G7HA 5F7WC 5IHZA 4Y4FB 3VXUA 4TRPH 2X4QB 4PLJD 4NUJA 2IALB 4YHYC 4HC1L 1P7QA 2DD8L 1QA9A 2B4CH 2NY2D 5HHXL 4YBHA 2B4CL 3X11B 3BH9B 2GJ6D 3VXUD 1S8DA 4GS7C 4ORGA 3SEPA 2H2SD 2GY7B 3HNTL 2IGFH 4OCXH 1UYWH 4X6FA 3SGDI 3L6FA 4M43H 32C2B 4X6DE 4UTBH 2YD8A 4WW2B 2R1YA 3LEVH 3KLDA 3MROA 5ILTH 4I5BB 4ZPTB 5F8QC 2VDPL 5CP7A 2DI9A 1PAMA 2DN7A 3CLFH 5JQHC 4PB9L 5CCKL 1JP5A 1F13A 1R5IB 4XVUC 4KQ3L 5F89A 4KJQD 5KSBA 1CDYA 3VXTA 4JFHE 1LEKA 3MRHB 2CJUL 3TZVC 4TUKH 3HR6A 1A47A 2EEAA 3KYOA 4XHQA 1A5FL 1ZHLB 4MNQB 1CIUA 1F3DH 3H9ZA 4G8EA 4WTZG 2BSSA 5HHOD 4O58H 2AXJA 2BSRB 2ZUQB 1BVLB 5EWIH 3QZWB 1A3LH 2CMRH 1QR1A 1DBAH 2ORBL 5A2LH 3D3VE 1NDMA 3PABB 3KJ6L 4JHWH 1JHTA 4I48B 5HY9A 1W0WB 3GKWL 3QO1B 4MNHB 1IKFH 4UUJB 5F88B 4PJHB 2FR4B 3JWOH 2F15A 4JREC 5IBLC 3DUSB 1L0YA 3GJEA 1BEYH 2OK0L 3OAYK 2PXYA 4XBGA 5DVKA 1Y6KR 5D1ZC 4R0LB 1Z0NA 5SWSA 5T5NF 1UJ3A 4WI4A 2QL1A 1AI1H 5KANG 3AU1A 3NGBB 4KRLB 1MRFH 2HT3C 3GSQA 3ARPA 3KPNB 4R0LA 4LPCA 5LXGH 2XQYG 3WFHB 3IJSB 3QXAA 2EE9A 2APVA 5D1XD 5D6DC 3X12A 3BAEL 2AXHA 1J8HA 3DI3B 3L5WB 2B5IB 2HN7A 3CGTA 1QYGL 5B21A 5IB4B 4EDWH 3QDAA 1N6QH 2Y6SC 3NAAL 3P11L 4CUCA 5EPMB 4YGVA 1OAKH 5EOTA 1W72B 2FLBT 1OQOA 5KSUA 4TSBH 3D18A 5IB2A 1G9MH 4OLWL 1C12B 3MLSL 2WWMC 5H2BA 3BD3A 1WBXB 1ZHBB 4ODHH 4ELMB 3FN0H 1EVUA 5EOCL 5IK3B 1IGIL 3KG5A 5DURB 1JTPA 3ARGD 3T0ED 4ZUTB 2MPAL 1ND0A 1ZEAL 3RL1B 5KTEL 5IW6B 4WTWA 2RFXA 1JNHB 3HB3D 3OB8A 1AC6A 1OM3L 5TE4L 1VB9A 4QHUA 1PY4A 3FL7A 3NIGF 4YPGB 3VXSE 4O00A 1ZK9A 4NJ9L 2FB4H 3ARED 4KY1L 5CILL 1VHPA 2XY2A 5H94A 5EUOE 5BJTA 2DYPA 4A2LA 4TVSa 4M6OL 3MXWL 2NY0C 3VWKD 3LPWA 2FEDD 1EHLH 4Y5YA 5JZ7C 2I9LB 4AL8L 4DGVL 4XT1C 2WSKA 4CBPA 2VKXA 1HH9B 1S9YB 1N6QL 5BVPL 5E00A 4JZNA 1FL5B 1XGPA 5JOPD 4DVBA 4P3CL 4TVPL 5ISZD 4YUEL 5GGTL 2NY1D 3QUKA 2EH7L 4M43L 2DTSA 2VXQL 4ZFOB 4NZUH 2F58H 1QLRA 1T83C 4KI5D 1CGSH 1CD0A 2F53A 4IOIA 3MGOB 2NY0D 3ARGC 3H9HB 3K80A 2CDEA 1T7VA 1K9TA 5JZ7D 4NCDA 1ACYL 1OAUH 4OD3H 3K74B 4G8GA 4NO2B 2XTLA 5DRWA 4I77L 3R06B 2XA3A 4POUB 3ULUF 5TE4H 4BFGA 3LRGA 1CWVA 5GS0C 2DQTL 3QI9B 2HJFA 3WJJC 4S1SL 1IGYB 4WENB 4LSUH 3ZDXF 4K8RL 1Q1JL 4YDVA 3VH8B 5JIKA 2OZ4H 4RRPA 2NY5L 4KK5D 4F3FA 3TPKA 2XG5A 1FIGL 1EHLL 4TQEL 3O11A 5DT1H 2HT2D 1UWEL 2B7DT 4KTYA 5I73B 3PE9A 3LKSA 3BESR 4L3AA 5CHNA 1IBGH 1V3JA 2KH2B 3W81A 3FQRB 5E2TH 1S9VA 1T0NB 5J12B 1LP9F 4RX4D 4BH7A 3U0WL 3KLHC 5JDJA 5GRVL 4QT5B 3LY6A 3G6AB 2D31B 5TPWH 4L3CB 4K7PH 4QOKE 5I18L 1CGSL 2XKSA 1RVFL 4ACPA 3ARBB 3BW9B 5JHDA 2JJTC 3MNWA 2HKFH 2E7MA 2WINB 2OI9B 3EYFB 3IKCB 3GK8H 4B53A 2R8SL 4Q2ZA 2AV7A 3RWFB 3VXSB 3L95B 4OI7A 4HWNA 3D0LA 3JZ7A 2JK5B 2N7AA 2MOVA 1FNEB 1SJHB 2VAAA 4G6AC 4JDVB 2BNQE 3DXAE 4NM8H 5TH2B 3S88H 1IGCL 1HIMH 3MLZL 5D5MF 2IBGA 2IF7A 3OHXB 3TZVA 4V1DB 4WCYL 3OX8A 1XR9B 3IS1X 1VKXB 1HI6A 4PG9B 1QFHA 4KK8D 1N4XH 4W6YB 5MEOA 3TESA 5DD6A 4TNWF 3PDGA 1C5BH 15C8L 2WV3A 1C5BL 3H42H 1YDPB 4P4KB 2ZJSH 2FR4A 4LDLB 4RQQB 4PG9A 5SX4H 5D2LE 1J86A 4EUPA 3HPLB 2P43B 3U46B 3CFJA 4RCAA 4Y5XB 5J3HD 1N5AB 1D5ZA 1HHIA 1VPOH 1MI5E 5LXGL 3ZTJH 4PRPD 1UJ3B 2MCPH 1IGJA 3V7AE 4CN6A 2JIXB 2FSEB 4MDIA 5EU6B 1KN4H 2PO6D 1MLCB 2OTUB 1E28B 3KS0H 4LLWB 3SDAA 1KN2H 5HPOA 3SOBL 4M03A 4R90H 3TBWB 4GRWB 2EH8L 5EWIL 3SO5A 5IFJB 4HKXA 5GGVY 1TTUA 3C6SA 2HLFC 4R26L 4EOWH 4HDIB 2XN9B 1HXMB 5D7IF 4ALAL 4F8QA 2BRRH 1P2CB 1MCWW 4RFNC 2VLRE 2EIEA 4EUPG 1NBYA 5A3ID 2M2DA 4CN1A 3FONB 5ANME 2L7JA 5BMFH 1W72A 3TCXA 1W0YT 3M17A 4L4TE 4P5TA 3VGGA 3U79A 4ZUSB 2P1YA 4R4BB 4BFBD 1OF2B 4ZO8A 5DQ9A 5I73C 4ODUB 2CH8A 1LMKA 2R9HD 2M8XA 5GHWH 5CINL 1IGML 1A7OL 5CKGA 3P4MA 4X6DF 3I75B 3D0VB 4I18A 4KZEH 1BF8A 1FORH 1GZPB 3AFLA 3KPSB 2YA1A 2WIIA 3LS4L 5CP7B 3H8NA 4UT6L 2B4CC 2IQ9L 4XZUB 1O7VA 4XCEA 5DJAA 1XF1A 1U3JA 4OZGF 4JZNB 2ITCB 4X83A 5CEZE 1Z5LA 3IDIA 1SMAA 4PJ7A 1NUGA 1CFVH 4ODTL 4JPWL 1IEBB 5C8JA 3GNMH 4JZJA 2NY4B 3S37X 4U1MB 2K7PA 2ZP0T 2H2SC 2X40A 4FZ8L 5CEZL 1B2WH 1WCBB 5JW5A 5KS9F 2BVYA 3BSZL 1DUYB 5FYJE 4KWUA 5E8NB 4LCIL 5DD0L 1YMHB 3CXHJ 4UNUA 3F7RA 3O3BA 2R4SL 4NBYB 3WXVL 1ZKAA 4ZXBA 4ETYA 5DJ0A 3WNMA 4X8XA 4S1RH 4FA8A 3TVMC 2BNQA 3QIUD 4R3SB 4U6TA 1FLRH 2A9MH 4HFUH 1CXHA 4XAWH 2XYCA 3RKDC 3HC0A 4WWID 1JHKL 3DUHA 3L3HA 4G42A 3BGFC 4KY1H 4E41A 3LKSB 1ZT4B 2CJUH 1TJHH 3IXTB 5SWZD 2O5ZL 3HCVB 5FHBH 4UT9H 3I6KA 3GI9L 43CAB 4FQIH 1DJSA 2XNAB 5E2WH 2BVOB 2CUHA 5D2LA 2G60L 1KB5H 1S3KH 5E8EA 1AO7D 4ZO6A 5IF0A 5E9DB 3ULUE 2R0KL 4Z7WE 4PV8A 1AXIB 3WO4B 3MV9E 5ECJE 1AO7E 3SDAC 2LU4A 5GGUA 2FLRT 4MNQD 3U0TB 3O8XB 4GRLD 3BE1H 2AV7B 1F3JB 5CD3B 5DHXB 4KHXL 1KTLB 2B20A 1ACYH 2IH3B 3TT1H 3P30L 3Q3GA 1T66D 3I2CL 2J8UB 3H9SA 4FFVC 1T0MA 3D1MC 1OSPL 1P5VA 3VWJC 2PXYB 2X9XA 2F54E 5DUML 1OAXH 1U8HA 2B0SL 1C5CL 4H1LA 1CXIA 1FBIL 2J88L 1EBAA 4E5XA 5F7NC 1KACB 5K59E 2VR9A 2AI0L 1M7XA 3MRIB 4DN3L 1CLYL 2JE8A 1TCRB 4NN6B 4S2SB 4K94C 5BW7A 2ZKHL 5J13C 4UIKH 3TO2A 3N85H 1X5AA 3UEZA 3N0PB 1CG9A 1JMZA 3V6ZB 1KCSH 3D69A 1WT5C 5INDA 1UB6A 4OQ1A 5ADPL 4FFVD 5J06A 4H88H 4KGLA 2FATH 4K71B 4M7ZB 1BM3H 1PLGL 3KYMB 2VH5L 4PRHE 3HE7B 3PWPB 4XC1L 3S36L 3JWOL 3GBNH 4DQOH 5CUSH 3MLYL 2P8PB 3DRTB 1WTGT 3EBAA 4JM2B 5DFTA 2R56L 4K07A 5JPMB 3VXRB 3FO2A 5E0QA 2QQQA 4PRID 3TNMA 4LHUA 2DQHL 4UILH 4M4PA 1NAMH 3F12B 4PJFF 2VDPH 4F33B 4I9WE 2PW1A 1CE6B 5F9WC 3V95A 3NCEB 1A6WH 2NXZB 2XWTA 4JO2L 4X98B 1KV3A 4KZEL 3AREC 3RUGB 3TNMB 2E9JA 3AS3A 5D8JL 4YZFE 5D8JH 1XIWA 1VFAA 1LDSA 4IOFD 1UZ8B 4XNXL 1CFNB 5DEFB 4Y7MA 1PJ9A 3T2PA 4UI2A 1N0XH 2EDWA 4DAGL 3V7AG 3SJVB 3MRRA 3T3MF 4AEIH 4L4VE 1UZ8A 3R4DA 3CVHH 5A1AA 2L7UA 4QRRD 1MCNA 1X5XA 3P40A 3QRGL 5FO9A 3DGCR 5IB2B 4HPOL 5I1IH 4FQPA 4LHUG 4YDKH 2JB6A 3QCUL 4KJPD 5IKCA 3RWDA 4XZUA 3MV7E 4XNMA 1LO3L 5IGXL 2YD5A 4NT6B 2CXKA 1KLGA 1CD8A 2C5DC 4NZUL 3CK0H 3BIAX 2G75A 4KJYB 1NSNL 3B2VH 4NKOA 4QHKI 3STZB 5I71C 3FQNA 2R56H 4J3TA 3CUPA 4AT6B 1A6AB 4LLQA 4LLVB 2R4SH 3D0VA 1HOCA 1N8ZA 1M7DA 4ZFOA 1MHPH 1KLGB 4GG8B 4M9PA 1BZ7B 4JN1H 3RZCD 2FD6L 3OR7A 3CH1B 4XPGH 4RGNC 1LE9B 3QG6A 3SDCC 1UEYA 4FTVD 2XN9D 1HSAB 3I50L 4PJ9D 3TCLA 1ORQB 1VA9A 3ARDA 4OM0L 3MRKB 4OLZH 1BD2B 1YEJL 4JGMA 3S8WA 3IF1B 1VFBA 2YPVH 4F8TA 1ZA3B 4XAKD 4JG0L 1LE9A 2C7UA 2P46B 4PGBA 1N64H 2Z91B 2OJZH 8FABA 3QG7L 1S7QB 4JG1H 3U9PH 2CRYA 2R29H 2EYTB 2XACC 2DQUL 3WYRA 1WBZA 2AJXH 2VZUA 4TPRH 1UACH 1P7KB 5K9JL 5DSCA 4DUXA 2PO6A 5IJKC 5MEOB 4DKEL 3UTPD 4GW1B 3ES6A 2N56A 5HI3C 2P7TB 3V0WL 1CXEA 3S35L 1FYTE 2IPUG 3JWNC 5I6XC 1TPXC 4P2RA 3ZHKA 3MUJA 4DK3A 1UFUA 4HG4K 3BUTA 4KRPB 3UTTB 2EECA 5M7QA 3O2WL 1XH3A 1MLBA 3SDYL 4FG6C 4YEFA 1WIUA 2VXSL 1MEXL 4M3JA 3VFNB 3MOBL 3LKNB 3RX5A 2E7LC 4Y19D 1BWWA 3QUZA 4HAGA 2EDXA 1EEZB 4EVNA 1SMOA 4OM0H 3MLXL 4YK4B 5CSGA 3NBNA 2HTLD 4M61A 4HK0B 2YKLH 5D7IE 3O3AA 4UMGA 1HQRA 5T3XL 3L7EB 3KPRE 3QZWA 2CRMA 4GKNB 5EU3B 1JWUA 2NW3B 4LCWB 1XGUB 5ICZA 1BGXH 1KF9B 2BDNL 4LCIH 4KHXH 3OXSA 2UV3A 4NPYB 3X3GH 3H42L 1U8JA 3KLAB 3AY4C 2P24A 2MCG1 3PUCA 2OTWA 5EA0L 4NNPL 3LKPB 4P3CH 3PGDA 4Z7VE 3RNKA 1MCPH 4LLMA 3F5WB 3O4OC 1DE4A 2RFXB 3Q3GB 5TDNB 1P6FA 4PGEA 2Z31B 5C07B 1DBMH 5FGSA 4K7PY 2HVJB 2ZCLH 4QY8A 3VFPB 4DJMA 3L5JA 2VABB 1GGYA 4G8FA 3GK8L 4L8SB 3VXRD 3W0WB 4K9EL 2Q6WB 3QXAB 1NMBL 4Y5YB 4DW2H 3G6JE 4G8FB 3C5SB 3ILPA 3KJ6H 2E8ZA 4PJGE 2YRPA 3BMVA 1BIIB 4JRWA 4QXTA 4LLAA 2OR9L 2DWEA 4YX2H 5KN5A 1L7TH 1HHGB 2F5BH 3FO2B 3C5JA 2VITA 5INDB 3M1BA 5EU5A 5FHAH 3UZQA 3ZTNL 4NRYA 1P53A 1QBMH 3VRJB 1I3GL 4JPKH 1IQWH 2DQEH 5HVHB 1KIQA 4OB5H 4WFHD 5KS9E 2OJEA 1T1XA 3H9HA 1RUQL 2VLJA 2F5AH 1NFDA 3V5DA 1A6WL 3O6FA 4P3DA 4QXGL 1VPOL 1OF2A 3OKDA 2BNQB 4LAQH 1XGRB 3OR6B 3MLRL 5HD8C 2OYPA 1DANU 4PLNC 4MYWB 4HGWA 4JGJA 1H0DB 4YNYB 3C5ZA 2MHAB 4L4TD 2H32A 1A14L 3CIQA 3VA6A 4YDJA 3SOBH 1EHAA 4XI5C 4ONHB 1GGIH 1NGZB 1M05A 4P2YA 5IM7B 3VG0H 4Z7QF 2Z35A 5HHXH 1ZVHA 1KIRA 3BJ91 1YNKH 4IMKA 2HMIC 2DKUA 2JJUA 2FH6A 4YDJB 1IFHH 4MNQE 1U8QA 3AREA 1QSEE 3CH8A 4JFZH 1XIWC 2OJZL 5D1ZA 4YDIH 2NQCA 3L3DA 4BZ1H 2JCCA 1EXUB 1IGFH 5F93C 4BQCA 1DVFB 4QXWA 3TIEA 2Z93A 5D72L 15C8H 4DGYH 1CK0H 1HSAA 3FRPG 2X1WL 4HMEA 1P7HL 4R2GC 4XPHH 2WIIB 2AKRB 1CU4L 1ZA6B 1ZLSL 3IDXL 5SWSE 1EHXA 5DEZA 1NGWB 5GGRY 2FBOJ 1JUFB 5JOEA 1F3DJ 1FORL 1EA9C 4XMLL 2X89A 3IKCA 4AT6A 3P0YL 4Z95L 1S7QA 3ARFD 1VSCA 4R3SA 3QQ3A 1CQKA 1UEMA 3BEVA 5C7XH 4CAGA 1M7IA 3MREB 4NO0B 4UBDD 1A6TB 4OZIF 3CC5B 1I9JL 1WC7B 4PJXA 2EYRA 5GZOD 1S3KL 1T1WB 4EI5D 1A2YB 3HUJE 5LQBH 5D1XA 3BWAB 1BD2E 4DKEH 3QBTB 4LPUA 4PRHD 3MLWL 1I8LC 1XCQA 4D0DB 4AG4H 4QHLB 1G9ML 5BO1H 5KG9A 2GKIA 2C3XA 5BRZE 1XAUA 5LG1A 1BIHA 3CSBA 3EHBD 3G6AA 1AO7B 4K8RC 4NZRL 1BFVH 3VFGH 1XGYL 4HK3J 5HGDA 1F8TL 1ZLSH 2C3VA 1PG7L 2VLKE 3RVWD 4HAFA 3MV7B 3U83A 1ZOXA 4I0PB 4JDZB 1UJTA 4Q9QH 3GDBA 5JW4R 4LDEB 3WMSA 3UP1A 3HS0B 1QFOA 4WHTA 2YK1L 1FNGA 2A83A 4P4RA 3MTRA 3LKOB 4WI2A 4JDZA 1OD7A 4V2BA 3DUUA 4X99A 4M61B 4FQ2L 2UWEA 2KBGA 4XCNA 4X9HA 4P46B 3DYMA 1T03L 4XXCC 2P5EE 5D4QA 1CDUA 1YEFH 3K46A 5DR5L 3IJYB 1QFUL 3GNML 1F00I 5D71L 1QFWL 5BV7B 4NNPH 4CJ0A 4XBGB 3C60B 4TUOB 1RZJL 4Y2DD 4HCRA 2NNAB 2JJSC 1VGKB 5C08D 2GCYB 5LAXB 4D9LH 3O3EB 4LLDB 4AENB 1U93B 5EOQL 3QDJA 3C09B 1R0AH 4GKOA 3G9VA 5KTEH 4X4ZA 2DDQH 3VI4F 1IT9H 1EEUA 1WIPA 4G9FA 2Q7YA 4IS6A 4HH9B 3EKCA 1JYXA 3RIFF 1ZHNB 2NY5C 5DD5H 2ZUWA 3DMMD 1JHKH 1ZT1B 4XPAH 5D70L 3NABH 4LSUL 3IB4A 4HS3B 3LIZH 4OBSA 5D1XC 1EK3A 4Y2DC 3S97C 1I8LA 1C08A 1GOGA 4YZFF 1L0XA 4KU1A 1BPVA 4FQIL 3ZDZF 2XTJC 5I76B 4Z18A 2R1XB 5HI4D 4NQCB 1T1YA 3ROOA 1J11A 1UM5H 4JKPH 1AE6H 2DQEL 2VH5H 5F7FA 3GEWB 5EZLB 4C56A 3W82A 1FNSH 4Q6IA 5J6GB 3T3PF 1BWMA 1S78D 2Q86A 4PJ5B 5F3BB 2BZDA 4NOFA 4ZUTA 3JWDH 4HMCA 5ANMB 3F6LA 3RTQD 4Z76B 4KRNA 1IGFL 2JJWA 5HVGB 4HXAL 3RVXD 1YN6B 1QRNE 1KIRB 3FT2A 2B5IC 3BPOC 3QDME 4ZUWA 3D2UD 1CLOL 3RDTC 2ZCKH 4AQ1B 3MRLB 4OD2B 3HI5L 1YMMD 2NYYC 3CCHB 3L3GA 5D96C 4NNYA 5EUOF 3BPNC 2DQTH 1NMBH 3CD4A 4LVNC 3RGVB 3F65A 3HNVL 3NCJL 1WEJL 4G8IB 4HJ0C 5E9DE 3OAUL 2YHGA 4HCRL 3VFTA 5IMKA 4HCRH 3IETA 4HUMB 4G6KH 4Z7UA 5EU6E 3OJVC 4JFZL 4QGYA 1T3FA 1NCWL 2PYEA 4M6NH 3BMWA 3EFFB 5F7DB 5C08A 3DNKA 4GKZB 4PJEF 1WZMA 1I1AB 1MJJB 2VWEC 4LCWA 3OKMB 5TFSL 1YC8A 4KZDH 2MQ0A 3MSPA 4R8WL 3ARVA 4R7DA 1S78C 3QCUH 3N50A 3B5TA 5FV2A 3HE6C 3N1FC 3MV8A 3MRBB 5ETUB 2L0DA 4UB0H 1AQDB 3UBXG 4G8GB 1VADB 2VUYA 5CJOH 1FFOA 5HHMB 1DFBL 1G1YA 5ID1A 2IQ9H 3SE4A 4OZGB 4OLXH 4MLIA 1SBBA 4IRJC 2G5BB 2BVQB 2X7LA 2HYMA 3MV8B 4BUGA 1OGTA 1MJUH 2AQ2A 3UDWC 1E4XL 5IEKA 3C09C 2AVGA 2FSEA 3VG0L 5I1DA 4AQOA 5EU4B 3FFCB 4BM7A 5IOPB 1V7MH 2GW5A 3RVVD 4G6FD 3TO2B 4PY7B 3FOLB 5C0EA 1RIUH 5C0BD 3V4UH 2KZWA 3D25A 1MWAL 1DN0A 2ZUYA 2OQJB 1VESA 1D6EB 4X5WA 4JRXB 3BAEH 3F8UB 3CX5J 4Z7VF 1BZ9A 1KFAH 2KPNA 4POYA 2X2YA 3DVGA 4MA8H 4WEMB 3PP3K 4TPRL 3CSYB 5DK0A 5EU5B 4X5WB 4AMKH 2GQHA 3FO9A 1ZS8A 4NJAL 4GOSA 3ZYIA 1JZ3A 4P46D 2E8YA 1YPZF 4G9DA 4PBVC 5E24E 4M7KH 1L7IL 1ZWIA 4QRSA 4PJ7F 2IG2L 1TVBA 3EOTH 1JRHI 1A3QA 1JI2A 5EOTB 3Q6FB 3S34L 1G6RB 2OTWB 1IM9A 2A6JA 2I07B 4HH8A 2AEIT 2HAZA 4JB9L 5TQ2H 2AQ1A 3K3QA 4JRXD 3NA9L 3Q48A 4F9LC 5BJTB 1CXKA 1RURL 1PG7W 4ELMA 4M6MH 4PTUA 2A38A 1KTDB 3MLXH 4XH2A 4CVZA 1FHGA 2FB4L 1A7PH 4OIIH 4D0CB 4G7YL 1FZOB 3BRFA 2YWYA 5CEYB 5E00B 4XCYA 4K3EL 5IMLB 3MRNA 1CGUA 4ENEC 1U8JB 3O6KH 3MFFA 4EBQH 4JAMB 2ITDB 2EDHA 3NCYS 3TVMA 1LEGB 4FG6D 4WI6A 4N0UE 1ED3A 4TOYL 3MO1A 3BPLC 1QBML 4DZ8A 4NQCD 3C6LC 4WFGD 3VFGL 3HNSH 4HT1H 5D7SL 1JV5A 1KCLA 4GSDL 1A7OH 5HHVH 4EQ2A 1WCQA 4FQLL 4RA3A 3AUVA 5LBSH 3IGAA 1TZHB 3MX0A 3FRPA 4XAWL 2DQDL 4HS6B 3QUXD 1NDGB 3B3IA 4HZLA 2B1HH 3VXUB 3I02A 1JPST 2EZ0D 5DHYA 1R6VA 4F33A 3MRJB 1A7QL 1TZHA 5C0BA 2LV4A 2AEPH 4LCWE 3QXTA 3LVEA 3OKDB 1U8PB 3KPOB 4PRAB 4DOHB 1RK1B 4MQTB 2R0WL 3OF6A 3HTLX 3IVKA 3MZTA 3BPCA 3ZE0E 3SY0A 4WI7A 5HHQA 3EYOA 1L7TL 4BQ8A 4OM1L 2IPKB 2PETA 1L6ZA 2GYSA 4S1DD 4KXZI 4ONGH 4WCYH 4YDIL 3UDWA 5DD0H 3GMRB 1I8MB 3VH8A 4LSQH 3L3GB 2JB6B 2VXVH 4QHKJ 2R15A 4X5LA 5JXEA 2VXVL 2PR4L 3VWJA 2SEBB 3EZ8A 5D72H 2BC4A 3CVIL 1U8IA 4WUUE 1U58B 3V5KA 4ELKB 1RZGA 3EOAB 3QIWC 5DMIH 4JFDB 4KHTH 1ZLUK 4GT7A 2VDMH 2XQYK 3RUGF 4HK3N 3TIEB 3HAEH 2H41A 3FB8B 2EZ0C 1RZIB 3NGBC 1J5OH 5C9JB 2PYED 5CAYB 2NY4D 4N1EA 3WXWL 1U92A 2R2HB 1RULL 1JGVH 3MRMA 1INEL 2VDNL 3BIKA 1MQKH 4UT9L 2AI0H 2VQ1B 1C7TA 4GAGH 1G7PB 2AJYH 3VD3A 1NH6A 4HK0A 5ABDE 1B0RA 25C8L 1MFBL 1H3GA 3IFNH 3MNVB 4R7DB 2R0WH 3MRHA 4PJ8D 3CDYA 3IDMB 5B4MC 3QQ9C 4GW5A 4OIBA 3L5HA 1KTKE 4EXPX 4EOWL 8FABB 2ARJQ 3CMGA 5F9JB 2NY3B 3SDAD 1JGUL 3AMKA 1BVKA 4GG6A 2NXYD 1QPPA 4DQOL 2AGJH 2OSLA 4ODHL 2GJ6E 3QCTL 3B9KB 3OKNB 5HHOE 4YXHL 1MCKA 2HG5B 4JFEE 1HINH 1RU9L 1OW0C 3HLAA 4JPKL 3QXUA 5T1KB 5MHSD 2BSED 5C71A 4PJIE 4Z7UF 1X6NA 4ZFOL 3NTCH 1X44A 5I2IA 2HMID 3NVQA 2BVTA 5D1QB 2F53E 4WFED 3TZVD 3LOWA </