2Q3AA

Crystal structure of rhesus macaque cd8 alpha-alpha homodimer
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
117
structure length
117
Chain Sequence
NQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSHFVPVFLPAKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rhesus Macaque CD8 Homodimer Sheds the Lights on the Molecular Basis of Rhesus Macaque MHC class I with CD8 Complex
rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords CD8
total genus 18
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q3aA00
1EZVY 2D7QA 2ZUQC 4DAGL 2JCCA 2C1OB 4IEFB 5D5MF 3OJDA 3EHBC 4X4MA 1QSEA 3TZVC 1RZGA 1OF2A 4TULL 4OF7A 3WFBH 3K80A 4P9HL 4LNRA 4DZBB 1FG2B 3IVKA 1FZMA 3D3VE 4N0FB 3OKEB 1CFTA 3BQUB 4R96B 2E6PA 2FJHB 4XP9L 2IH3B 3GBMH 1OAYH 3MLUH 1KEMH 5EIVA 1ACYH 2AERT 3VFRB 3SDCC 1I1AC 2X4RA 2CLRA 5DFTA 5GGUA 4FS0A 3EO9H 1Q94B 3OWEA 4I18C 3V0WL 5HD8D 4NM4L 3HC3H 5D7JB 4XPAL 4N8VG 1CDYA 5AZ2L 5MEQB 4DUXA 3QDMA 2OJZL 5CEZE 4F7PB 3MRHB 1RZIA 4B0MM 4Z5RA 5I8CA 1YN6B 3N50A 1CGYA 5KANI 3QR2A 3CSBA 3HKFA 2EDBA 1UZ8B 2AK1L 4OZFG 3EOYG 2YPKA 2GJ6A 1F4YH 3P9LB 1EDQA 4ONHB 1OTSC 3RPKA 4Z8FH 4ACPA 3SBWA 1KTLB 3LEYL 5I71B 3SQBA 4FQXC 3Q6GH 4PB9H 2DQIH 3T1FB 5AUMA 3WDJA 1AY1L 2MQCA 3RWJA 5I75C 5IUSA 5HGBA 4P2OD 4UB0H 5EFIB 2HTLC 4JN1H 4MJIE 1SJEA 4BSWB 5DT1H 2DQCH 2FJGB 4PJDF 5D96B 1T1YA 1X3DA 3NZ8B 3S36H 5LBSH 1OP3K 4MJ6A 4BJLA 1FL5A 1MFBH 2ZCLH 3G5YB 4Y4FC 4ERSH 1NGWA 3W9EA 3TF7C 1I85A 2I9TA 5GS2D 4FQ2H 2X4UB 5BVJA 1B88A 3IAQA 5EBWA 3QQ3B 4ZS7L 1GC1H 2CUIA 2CR3A 4LLQA 1NBQA 5TH2A 3DBXA 3U0WL 3DXAA 5JHDA 3VXQA 1SHMA 3PWNA 4U7KA 4MCYA 1MHHA 3KPLA 3WIFB 5E8EA 1JGLH 3TZVB 1BECA 5CJQL 3W0WA 1D3CA 2EZ0C 3FAXA 1QOKA 2HTKD 1KIRB 3SDAB 5CAYB 5ISZA 1QSZA 4JHBA 3T4YB 2EDNA 5CZVH 3RGHA 5HGDA 1A7BA 1N64H 3AAZB 3FO1B 4HMDA 1CDJA 2W0FB 4ZS6D 5J13B 1IT9L 2C7UB 3BI9X 5JHDD 4GUPB 2A6JB 3F7YA 4L3CB 4OKVA 4GT7A 1QLFB 4JFXA 3JWDH 1NCCL 4GQ9L 1I9IH 4P2QE 3HRZA 4P2CG 4M7LH 4G6KL 4X9FA 2VAAA 3PV6A 5EU5B 2XTJC 5I1GL 1A9BB 2ZUXA 5FHBH 4M61B 3C2SA 3OKOB 4HGWA 3LN4A 3N1FC 1VHPA 5D72L 4KUZH 2Q20A 5HBBA 5E6YA 2R9HD 4GBXC 3PNWB 3QG6A 1IRAY 4WFGE 3V7AG 5FCUL 4HUXA 1J11A 3WKML 3WKNA 3OB0K 4HBQA 4LKCA 3IFNH 4NPYB 3BVNB 3EJYD 1RUMH 3IDGA 5GRXG 5JA9A 3RVTC 2UVEA 4U3HA 4NKOA 3EOTL 5IKCB 1ZA3B 1IBGL 2PW2A 2WM0A 4X6FA 2XTLA 3LQAL 4HQQH 2GW5A 5HHPA 1FNLA 4WUKL 4OLVL 1XR8A 1GOHA 2VRAA 1Q9WB 2MKWA 5K9KB 4OZFH 2GCYA 1OP5K 1ZGLP 3T4AA 1L6ZA 2WBWB 4LFHD 3VXUA 1MPAL 1NGXB 3QO1A 3DECA 2X4TB 4FQIL 5ESQA 2Q3AA 1G9NH 5CJ8A 4LU5H 3KYNA 4IRJC 4PGBB 4U1KB 5FUOL 1E28A 3L3HB 4AEIL 2BNQE 1PAMA 1JTPA 5KANG 1KENL 5CEYA 2EEAA 4F33B 4XP4L 4H26A 1MLCB 2QQNL 4Y5XB 5DHVH 4OB5H 3G6JF 4YDVB 5F9DC 3UC0H 4IIQC 1OPGL 4BFBD 1YPZF 2NY1B 1BF8A 5EIIA 3THMH 5T3XH 4H1LG 5JW3L 2XZQL 4ZAKA 2ICWA 1P7QA 2VDLH 4U0QB 4NFDA 5H35A 1BHGA 1HN1A 1CFBA 5IB4A 1BZ9A 3JTTA 4I0PC 3CXHJ 3MCG1 4JZJC 3U9PH 1CLYH 5FHAH 1QFWM 4GAJL 1W72H 4ONGH 1A6WH 4CU6A 1X7QB 1N4XH 4X0KA 2BVOB 4XWOD 4ODTL 2B1AL 4NC0B 2P5WE 1RU9H 4XGZA 5C0IA 3IFLL 1WBYA 1JZ5A 5DHVB 2PUQT 4WI6A 1OF2B 3N0PB 4WHTA 5KSBE 1FO0B 1P7QD 3PQYE 1A4JA 1CDUA 4DZBA 2OTUB 2YD2A 5IW1A 3QYCA 4G9DA 2DIJA 4KDTC 3OKEA 1CFTB 4MZ2A 3FHQA 1P53A 5DRWA 1KCKA 1YY9D 5B4MD 5SWSB 2GKIA 4NUGH 4L3EE 1G7MA 2W1NA 2EDOA 1A7RL 5D7SL 4KJWD 5FDYA 5F6HJ 5BQ7B 4HLJA 4OFPA 4TUOA 4K2UH 2RGSA 5BZDB 3B3IB 2EDDA 1E4XH 5MEQA 2Q7YB 1GGIH 4L8SA 1WAAE 1DVFB 1CD1A 4G6AC 6FABH 4MJ4A 3L3JA 4WFED 1T66D 3MO1B 4MA8L 4Q74A 2YEZA 32C2B 4KROB 4BFGA 3QEQA 3MRHA 2FLBT 3ULSB 4PJFE 4I9WE 1B4JL 1EMTL 5IVXE 3OZ9L 3DYOA 4Z5RB 5I8CB 1HH6B 3RWHB 1RUPL 4LVNB 1QPPA 3FB8B 2CDGB 1UZ8A 5CS7A 4LLUA 3K2MC 2YPKB 2GJ6B 1JE6A 3MLSL 5GPRA 4FFYL 4ONHA 4ZYKA 2DQTL 1KTLA 1V7NL 3PQYD 4DAGH 3T1FA 4MX7A 3WXVL 3N85H 3WLWC 3H9SB 4LQFH 3OB8A 5BZWA 4JZNA 2GITA 3RWJB 4JM2B 3O3BA 3ZT6A 3GMPA 5F7HA 5D7LB 4QRRA 5EFIA 5C07D 4G80B 3HAEB 5FO9B 3SO3C 2MNUA 3G5XB 3VWJB 4J3WA 3AY4C 3AB0B 2A6KB 5GJTL 3F7VA 1KIPB 2RFXB 3OXRA 3NZ8A 4K7PH 3KPRA 2VDMH 4ELKA 2APVA 4DQOH 1NGPL 4KQ4H 2E6QA 3EHBD 1NGWB 3W9EB 3ES6A 5F9JB 1IGML 3QCUL 5C0CD 1FIGL 1ZT1B 5D4QA 5KSBA 2I9TB 5EG6C 5IIEB 4JFQA 2APTA 2X4UA 4L4TD 3UBXA 3QULA 3L5XL 1Q9LA 1MFNA 3DVNA 3HNTL 5EO9A 4JG1L 4R0LC 1XGTB 3GI8H 3ZE1F 5D5MA 5JHDB 3MRGB 1FNHA 4GBXA 4L3AA 1CCZA 3U6RA 4BUHA 5EN2B 3DJ9A 4KJPD 2XPGA 1UWXH 1J12A 4F58L 1QBMH 5I1CH 3SDAA 1JPFB 3MUY1 4JFOB 2IH1B 4OLWL 1V8HA 1F3DH 2YPLA 5B22A 3ARFC 4JO3L 3AAZA 5IVOA 3S36L 1JMZA 3N06B 5MEPA 4DCQA 3GSQA 3CC5A 4XHQA 5CWSB 1FAIH 4R2GC 4OKVB 1QLFA 4OCWH 3WXVH 4Q6IB 3ELAT 3CVHA 5HHMB 3RAJH 3SE8H 3MGTB 1WQVT 1YY8A 4U1JB 2WANA 5EU5A 4L4TE 1MCBA 3ME0A 3OKOA 4HGWB 4IDJH 3TA3B 3QUML 5H94B 1H8OA 4WWKD 3T0WA 2R29L 3Q5OA 5GGTH 5LXGL 4P4KD 4UAOB 5KVFL 5KSUA 1K4CA 4LLVB 4BKLB 4RBPK 4P4RB 4LMQI 4UV4L 4WTXA 3ARYA 3MA9H 4LKCB 4EIZC 1H15B 1JVKA 1J88A 1Q38A 3G04A 1WTGT 4NKOB 5GS1A 2UWEB 5C1MB 5D7SH 3WO4C 2B2XH 2LFGA 1ZA3A 3WIHH 2OK0L 1ZKAA 1FFPA 3VG0H 5HHPB 1AKJB 4WU7B 2E9IA 3HB3D 5J1SC 1SBSH 2R4RH 1L0QA 1T7YA 3X3GL 5DSCA 3KPSB 4LFHG 1AGBA 3T08A 5FYLH 1P84K 1RZJL 1EFXB 2PCPB 5HHVH 1S7QB 5T1DH 4ZUVA 5AG8A 3A67H 2X4PB 3AM8C 1OGAE 5HYQA 1HHKA 3QO1B 4ETYA 2X4TA 5IHZB 2VJXA 1E4KA 1GZPB 1JF1B 3GMQB 1LEIA 1RZ7L 4N0RA 3H3KA 4U1KA 3HE6A 1E28B 3L3HA 5DK3A 3TBTB 2X09A 1I7ZB 2H32A 2UYLB 3TC9A 4JO4L 1WGOA 4H26B 4X5XA 4Z0XB 1KTDA 5EB9A 4Y5XA 2Q86A 4ODVL 5HHMD 1RK0A 1F8TH 3TNMA 3IGAB 4U1SA 3TT1L 2H2SD 1FJ1B 1YYLL 4IIQB 4ODHL 1JUFB 1SQ2N 2ICWB 5E8DL 1UWXK 3BN9D 4G9FE 3VE0B 4YXLH 1CIUA 1W0WB 2EEDA 4Y2DD 3CU1A 5TQ0L 5T5NG 3OKDB 1NBVH 4PGEA 2VZOA 4WVRA 3JVGC 3CPLA 2UUDH 3L3KA 4J3TA 1JGVH 1T21A 3PWUB 4EN3B 1AD9B 2WWKO 1X7QA 3ET9F 4X0KB 1DDHB 4M8QA 1QUNA 2WIMA 4J8RA 5D70L 1JWMA 5E24E 3O8XC 1B0GA 1WBYB 5L9DL 1MCQA 1V05A 1D5XA 5JR1L 4WHTB 5F70A 3BPLB 5B3NA 4HUWB 5M94B 1A4JB 4OT1L 5CZXC 3E6HA 2I5YL 3BGMB 4PJ9C 4IOIA 2OR9L 2Z35B 4XNQB 1OWWA 4HXAL 3I2CL 5E1AA 4X6DF 2YKLH 3ULVE 1LILA 4FRWA 1MFCL 4ZPVA 4KMQA 4UT7H 3EYFB 5I6XC 5B39G 1N8ZA 1I7TA 2ZPKH 5JNYA 4XAWL 3MX0A 3UTSD 1JF5A 1LQSR 2RJMA 1G7MB 5C08B 5HYJD 1MJ7H 3S88L 3QUMH 2JLLA 3BGAA 2AJSL 1NAMA 2F74B 1IGJA 2XKSA 1MH5A 4J4PC 4TUOB 1RUML 8FABA 5HPOA 4LQFL 3B3IA 3CD4A 3GMLA 4GW1A 1KPUB 3QXVA 1CFVL 3O2DA 3KLAA 3V0VB 3MO1A 5F3BA 2YEZB 4DEPB 32C2A 2C3XA 5C92A 4L29A 4DOHE 3QEQB 3CFIC 4JN2B 4BFEA 1OP9A 1VACB 2JIXB 3GSWB 3ILQD 3DO7A 2FB4H 3MLYL 2XKNA 3FB8A 3LDBB 1OLZA 5DURB 3E2HB 5FYLL 4GJTB 1F6AA 4TVPL 5CKGA 3DUHA 6FABL 3DPBA 1Y6MR 3SBWC 2P46B 1HZHL 1CGSL 3MLRH 4NRXA 5IEHB 1MHPH 3NACL 2LV4A 1DN2A 3UXFA 3UX9B 2ORBH 4FFWD 4JM2A 3O3BB 3VFSA 2G60L 3PDOB 3E1F1 3NMEA 2WP3O 4RBPH 3VFMA 3BEWB 1FSKC 4XBGA 4Y4HA 3HAEA 4OGZA 3VWJA 4BH8B 3KPRE 4LSTH 4KI5E 2VLRB 3MOAL 1BFVH 1RHFA 3OHXB 1KIPA 4RSVA 3UTSE 1Y6KR 3OXRB 5ESAB 5GGQH 4LCCC 4YH6A 3K74B 4NN5C 3UZQA 5DJ2A 3OKNA 5DJ8A 4NKIL 3A6BL 3T2QA 3MREB 5J8OA 1QSFD 2GJ6D 5GSVA 3I9GH 2N4IA 1ZT1A 4PLNC 5KSBB 3BZFB 2W59A 1G6RH 4GMTH 5IIEA 4LCYB 3UBXB 3UTTA 3QULB 5GRUH 1IGCL 2LABA 1RUQL 1TZGH 2LAGB 4K8RD 1YNLL 1XGTA 3WCYA 4U49A 4NO2A 3MRGA 5DI8A 4PFEA 2H6PB 3OAYK 3INUL 4L4JA 3DO3A 2M8XA 1GC1L 4PJXF 3RI5K 5K9OB 3PP4L 4KRNA 3PP4H 5DUMH 1ND0B 1BX2A 3PDDA 1X5XA 4KI5F 4TTDC 3WHE0 5MHSD 3NN8B 3QDJA 3GSUA 4KJWC 3ESUF 1RSFA 2ZSWA 1FNEA 3VWKC 5DRZA 2VXTL 2XRAL 1JV5A 4M1DL 3BKCH 4MNHA 2OR9H 2V2XB 4KI5D 1L6XA 3EFDH 1G9EA 4NZUH 4UB0L 1J8HB 4LIQL 4WV1C 4Z7VE 1XF2B 5MEPB 4R7DA 3CC5B 3WO3B 5CWSA 4HPYH 4KMTL 2CPCA 2AKRA 3EBAA 1NEZG 4Q6IA 3O3AB 4OV5B 3IDMA 5H37G 3C5JB 3TIEA 1BBJB 1WT5C 3NCEB 3HNTH 4CVZB 3KDMB 4U1JA 5JXEC 3UJJL 1A7QL 5H94A 4NNYA 3OSKA 2VR5A 3QI9B 1MCOL 3HPLA 4I1NB 3A6BH 2FH8A 2F19H 1W8OA 1OAYL 2XN9B 1FYHB 5I1HH 4PUBH 1QYGL 2JB6B 2JJSA 5KSUB 4KU1A 3SDCB 3O0RL 5F1SA 4R2GB 4P4RA 3CXHK 15C8H 2YN5A 5LGKA 3MJ6A 4YR6B 6CGTA 1H15A 1HHJB 3D69A 3DI3B 1JCKA 5T3ZE 3G04B 2ARJQ 1IE5A 3WXWL 1Q72L 2AV1B 3CSGA 3W2DL 4XCCL 1ZT4B 5J9PB 1ZAGA 3PWPE 5D2NC 4ODBD 3TT3H 4M93B 1MHPL 3NACH 4G7YL 4EBQH 4Y4KD 3KPSA 3FAWA 1I8IB 1MJUH 1TVHA 3VH8B 4L1DA 1TENA 1CGWA 1IVLA 1IEBB 3TN0D 2X4PA 1T0NA 4QTHB 4P9HH 5HYQB 4K71C 4UIKL 3AXLA 1PYWA 4UIKH 3S96A 5IHZA 1CQYA 3I6GB 1GZPA 1UVQB 3GMQA 4WI8A 1LEIB 4HIHA 4PRID 3V0AC 1UB6B 5LCVH 4OD1H 3TBTA 2DWDB 1I7RB 3GMNB 5FYJH 4PJ8C 1SVZA 4W6YB 4F80A 5AD0A 2VDRH 1INDH 1M71B 3TNNA 4D9RD 3WIHL 4Z0XA 1KTDB 1KXVC 3ZTNH 1KIUA 1DN0B 1RK0B 4JDZA 5E94A 2DBJA 3IGAA 3WNKA 2HFGL 3GBNL 2DQHL 3ALWA 3LD8C 5HI5D 4KKBD 5T3ZD 1LE9A 1CDIA 1Z5LA 1JUFA 4W4OA 3QEGL 5L2KB 4WWKA 5D5ME 3PWPD 3PJSA 3WFDL 4N8VA 1HXMA 4NYLB 4JE4B 1W0WA 1PSKH 3MJ9H 2DLFH 4PGEB 5DJXB 1TZIB 3BP4A 3VG9C 3CPLB 3J8F7 3IFLH 1AD9A 2N7AA 2DIAA 3DVGA 1D6VL 1DDHA 4M8QB 4R3SB 4QXGH 2AJXH 4J8RB 1ORSA 1B0GB 3M17B 4LP4A 3FFCA 1D5XB 2CD0A 4NT6B 1BJ1J 2BMKA 2ZUWA 4HUWA 1P7HL 4JO4H 3BGMA 3FQWA 5EZLB 3T2OA 4HUVB 3EJZD 3HUJB 5TE4H 1VGEH 4ZTPL 2ICWI 1A4KB 3HZVB 4K3EL 3BKJL 3NPSC 1U8JB 4CNIA 4ZPVB 1R3LB 3EYFA 2ZUYA 3ALXA 3GJFK 1AO7A 3VD5A 2W91A 4YXKL 5C08A 3L6FA 3QUXB 5I18L 2XICA 1NAMB 2XY2A 5F9OL 1IGJB 4Z7NF 4XP4H 4YBHA 1N0XL 4XWGL 4JO1H 4XP5L 1C12A 2YUZA 8FABB 3GMLB 4S1RL 4GW1B 3UTTD 1KPUA 2DQJL 1N59B 3MYJB 3RY6C 1R3IL 5KVGL 2FX8L 5L2JB 3H3BC 4LLAA 5F3BB 2QHRH 1JGUH 2BOBA 4PP2B 3LKRA 4WHYH 4JN2A 3SGDI 5B21A 5CGYD 3S5LB 2CJUL 1YA5A 2WP3T 4KAQL 1URLA 4E5XB 4WUUD 2XKNB 2YSSA 1RJLB 3LOWA 3SDDC 2I60L 3PWPB 5E00B 1F6AB 2Z8VC 1YEEH 5T5FH 4AM0A 2C5DC 4AEEA 4G8GE 1MRFH 2EDYA 4L8BB 3QH3A 1JYNA 1T89A 4YHKL 2A0LC 1VEMA 3VFSB 3K4ZA 5DVKA 1QFUH 1IARB 3BEWA 4XBGB 4Y4HB 3SKMB 1NUDA 4NZJA 4HGKC 5FYJL 5HDLA 1WIUA 5DRNB 1P4LB 4UU9A 4RAVB 1CI5A 5ESAA 2MCPH 3DROA 1KLFA 2W92A 3TVMA 3JV6B 5KSBF 2ARJA 5E9DA 3KHQA 3VGAB 3OR7A 3O8XD 5DJ8B 3C6SA 3UTTE 1MUJB 5GSVB 1E0OB 1NL0H 2X5PA 3RKDD 4L1HA 5KVDL 1BM3L 4UDUB 5JDJA 4RGOH 2YK1H 3H9ZA 2D2OA 4NO2B 4GQ9H 1WF5A 2IMMA 3KPQA 4P2RD 1J1PL 2KH2B 2H8PB 5IQ7L 2BHYA 2UVFA 2W07A 35C8L 3IFOA 4NGHL 2LU7A 4GG8B 5FM4A 5DD0H 5AG9A 4RQQA 1XIWD 5IB1B 1U92B 2EIZA 4QXGL 1MFDL 4B53A 1TNMA 3C6LB 5FYLD 2ZSWB 2PXYA 1NMBL 5BVPH 2IQAB 1QRND 3B8SA 1IMHC 3Q48A 1RY7B 1FIGH 4F9PA 3VFGH 3E8UH 3UMTA 2VXVL 3UTQB 4TSCH 3WFDH 2AXJA 5BS0A 3GSVB 3ILQC 5T1LA 4O4YL 4QF1A 4PJ7F 1PG7H 3CK0H 3O3AA 4OV5A 5FB8B 1C7SA 1YEJH 2V17H 4WJ5A 3KDMA 1Q0YL 3C08L 5GXBB 4C4KT 1CLYL 4NNYB 4P9ML 4LIQH 4RA0C 3QIWC 3V6FA 4N1CA 5FUCE 1KELH 2MPAH 1KEML 1HNGA 4KQ4L 2XN9A 1IGFH 1YNKH 2WINA 2CLZB 4D9QE 4OCMC 1BJMA 2JB6A 3EKCA 1DUZB 3NCYS 2O5YL 2OR7A 3IB4A 4RFNB 1WTLA 1ULVA 3L3IB 4G42A 1C7TA 3MCLH 3D69B 3T0EE 4JANB 4HJ0C 3ARBB 2NTFA 3MRQB 1K4DA 4PR5B 5D9SA 1KPVA 4JFDE 3CMOL 3KPSE 4F15B 4XP1L 2NMSA 5C6TH 4X6EB 4XNMB 1G7QB 2NY4D 1D6EA 1MLBB 5E99L 4K8RC 5F1IB 4ZG1A 1D5BA 5FUOH 2E7CA 3RZCB 3VXRD 4ODWB 2HVJB 2XG4A 3VH8A 3MLSH 3K8KA 4C56E 3IDNB 1CXIA 4WGVB 2F53A 3UDWC 2WNGA 4G8FB 3AXLB 5J11B 5L2KD 1PYWB 1EH9A 1CTNA 3QDMD 1QFWL 4TYUA 1L9MA 1ZVSA 1S5HA 3BW9B 2XFXA 2P5WA 1GGUA 1S7TA 1TJIH 4BUGA 3OPZH 3FO0L 5ABDE 2DWDA 1I7RA 2D7NA 2ITDB 3CFKB 3F8UB 3GMNA 4JPWL 4U05A 4OM1H 5IFAH 5ISZE 4M3KB 1ZT7A 1T6WA 2VZUA 4DN4H 5AD0B 3QFJA 4D9QD 1M71A 5AZEL 1U8QB 1ITCA 4ODSH 4JPVH 5E94B 3EUUA 1NMCC 3B2VH 3GBML 4R4ND 5E2UH 2W9EL 2X89A 4A6YH 1N5AA 3K46A 1U8NB 1G9ML 4EI5C 5L2KA 3BD5A 3VI3E 3NABL 2EDQA 3QDAA 1IAII 3PJSB 4Y19B 4TN9A 4JAMA 3KLHC 2Q87A 1MIMH 4FOMA 2FIRT 2QTEA 3FKUS 1AXIB 4LPUA 3BP4B 3P2TA 1T3FA 3ILPB 4M1DH 4HH9B 4C56D 1NGYB 2R4SL 4X80L 1A64A 1A7NL 1CLOL 4HWBA 3IJYA 4R3SA 3ROLA 5GS0L 5JPNA 1KCSH 1MRDH 3NVQA 4XTRC 3FFCB 3CMOH 2R0LH 3VRLE 2BMKB 3K4AA 5D1QA 4WTZA 2LVCA 2A74B 4Q9RH 4V1DE 3G5ZA 3FQWB 5D1ZA 5EZLA 5I2IB 5ISZD 3W81A 2DMKA 1A4KA 1GIGL 1TETL 3HZVA 5D7LE 1R3LA 1WWAX 3CVIH 4ZO7A 4JGJA 4DFHA 4PRAB 4OLYH 1HE7A 1N6QL 4UT9H 4X4XB 5DQ9A 5SX4I 4C56A 2NXZB 4Y0GA 1OAUL 2BXZA 3D0VA 1R3JB 4Y2DA 3TVMC 3QUMB 2R8SH 3GMOB 1C12B 5DTFB 5KSAA 3FQNA 3M07A 2DIBA 5FYKH 3L1OL 1MNUH 1CE6B 5C3TA 5JOFA 2VUYA 4O4YH 5J0BA 3IU4H 4KHXH 4PJEA 3LKRB 1CF8L 1RUKH 4WIQA 5DMGC 3S5LA 3S36X 5C71A 4OUUB 1PSKL 4E5XA 4GRWB 1JZ3A 3MLRL 1RJLA 1Q8MA 3PWPA 5E00A 5L8JB 4JREB 1FBIH 5ESVA 4KKBC 3DMMC 2WQRA 4GFTB 5A1AA 4HULB 1A14H 1AIFA 5B8CB 4L8BA 1KJ2L 1YJDL 1EBAA 1TJGL 4N68A 3TBSB 3M8OH 3IKCA 3GKZA 3B43A 4P5TC 3OGCA 2XXMB 2QADB 1LNUA 3TFKD 4MD5A 3LRHA 5IK3B 1J87A 1T5WA 1QR1B 5DRNA 1CK0L 3BEVA 1R24A 3FFCD 3VFVA 3DROB 2Y06L 1XGPA 2MFNA 3TVMB 3BUYB 1IT9H 4Y1AB 5LKNA 5JO5B 2XWJA 5TGBA 2VISA 1KN2H 2VLLA 5IW6B 5F9AC 3FOMB 3WIIL 1RZJH 5HHVL 4PJGA 1P1ZA 5DJCB 4EEEA 3Q3GA 5D6CB 4ZFGH 5GJSH 1F2XK 4MA8H 1P7KB 3SPVB 1JGDB 2ADFL 3BO8B 4Q9QL 4XPAH 4UINL 3HFMH 5T1KA 3I02A 5I75B 1MI5D 1BFOA 4X8JB 4GG8A 5IJKC 1INQB 2IPKB 3RY4A 4KHXL 1BJ8A 1Q72H 4RQQB 1OTUD 1DFBH 3K1KC 1ZV5A 1JPTH 2E9WA 4L4VB 2X6MA 1BQHA 5FYKL 2EH8H 4FG6D 5SWSE 4KK5C 3STZB 1B90A 4QRSB 3F7PC 2MQ3A 1YEEL 5T5FL 1NDGA 2W65A 2Y07L 4F37F 4YFDB 4NO3B 1FO0H 3TCLA 1UH4A 3FFCE 4LASH 5CGYC 1J0ZA 4HFWA 4ZUUA 3UTQA 4PJAB 3QEQE 4FTVB 3TBVA 1T2QH 3ZDXF 1XZ0A 4FNLL 4X4YA 1IAIL 3UTPE 3IJHB 4QF1B 3SDDD 4QGTA 3O2DL 1BP3B 3K1DA 4PTTB 2VC2H 2PYED 4P5MB 4XP5H 4ONGL 4NQCD 2ZOKA 2R0LL 4Y7MA 3I75B 4M4RA 4NWUL 4PPTA 3C5ZB 5FCSH 4BELD 4JLRB 3UEZA 5C08E 3V6FB 1TJHH 4NO0B 1RZJC 4RNRA 2WINB 3VD3A 4G7VL 2EYTB 3NIFE 4Z7WE 1EX0A 5ERWB 1KCRL 3MZTA 4LARL 2HP4A 2OP4H 1KCRH 4LARH 3HRPA 1F11A 3JTSA 3RNKB 3L3IA 4YDJB 5F3HB 3ZTJG 3ZTJH 4OBSA 1Y0LA 2D9CA 5E2WL 4JANA 2I5YH 4LPWA 5C0BB 2NTFB 4BQ8A 4QY8B 4PR5A 1ZGLA 1UH2A 1W72A 5IEKA 3W0WE 1IL1A 1LEGB 1YEGH 2J12B 3OF6A 2QBWA 1EO8L 1N3NA 1D5BB 5C07B 3IJSB 4K9EL 2O61A 1G84A 4JPVL 2SEBA 5CCKH 2HVJA 3U2SB 4NQEA 2BOCA 1E4WH 4RISL 4OCYL 1X6LA 3NCMA 4WFFD 5HGAA 4I77L 4Y5XC 3RWEB 2D0GA 5C6WH 5TQ0H 1UXWB 2PYEE 3QCVH 2JJTC 4NQCE 2Y07H 5D1ZD 3FTGB 1FNFA 3TYFA 1JWUB 3BW9A 3MRRB 3RWFA 3UYRH 1MFAL 1AE6L 1XH3A 2E7BA 3KPMB 2GJJA 5DD6A 2WLZA 4ZPTB 4PJFB 3MRMB 1JNNH 4R9HA 5HYSA 2NY0C 4XPBH 1U8QA 2G2RB 1JZ8A 3S4SG 3H0TB 4GS7B 3GJFH 3ULUC 5CD3A 4ETQB 4H5SB 1UADC 3L7FB 4PJIF 3RDTC 1N5AB 4LAJH 4JPIA 4DKEL 1U8NA 4D3CL 5IG7B 4XAKD 4ZTOL 5GHWH 3VXNA 3O4OC 4FABL 4JAMB 1PVHA 5CSGA 4PJXB 4RZCB 4ZQKA 2XZAH 1NAKH 3ULUL 1NGYA 3S7GA 2C9AA 3WO4B 3CU7A 5L7XH 2P7TB 4NP4L 3VGAC 3T0XA 1UM6L 4MS8C 4HZLB 4KRMB 4MXWH 2ZP0T 1DBAL 1ZOXA 2FO1A 3HC4L 2YD9A 2DLGA 1F58H 2V6HA 1RURL 4HDIA 3AU1A 4U6HB 2FHCA 3SDYL 1CE1H 5D1QB 5MP6H 3T2NH 1MNUL 3MA7B 3QT2A 2X1WL 3SJVD 4HT1H 3WFHA 4M43L 1JRHI 3ZO0A 4LU5L 4PRAA 1HXYB 4HXAH 3AROA 5I19L 2DLFL 1ED3A 4R6UA 4X4XA 5TPWL 2D4DA 3OG4B 5H37H 2ADJB 4PJ5B 4F7EA 3HMWH 3IU3A 5A2LH 5IESH 4PYHA 2QHLA 1HOCA 3GZKA 2X05A 3HS0B 5DTFA 1F3DJ 3FFDB 4HIJB 1IC4H 4DKFL 3FHAA 1YECL 1UXSB 2QR0B 4JO1L 4BQ6A 3B9KB 5DHYB 4PJEB 1HH9B 2V7HA 4PJFF 4M6NL 4CVUA 4WNQA 1QP1A 4OUUA 1MRDL 2UZXB 1FZOA 3BHBB 1FGNH 3DNKA 1KG0B 1XF1A 3HCVA 4O5LL 2NX5D 1EFXD 4AT6A 5C0AD 5J06A 1SYSB 5FCUH 2HJFA 3WV0A 1KJ2A 3P4MA 4NQUA 5TFSH 1AIFB 1DVFD 5B8CA 3SOBH 1VFBB 1U9KA 3TBSA 5JOEA 1VADA 3BQUD 3IKCB 3N1MC 3ZL4L 3HE7B 4S2SA 4DGVL 4PREA 3OGCB 1CGUA 3RU8H 4G3YH 1KACB 1NUFA 3E3QC 3D3VB 1LNUB 5IK3A 1B9ZA 3OXSB 2PW1B 4F7MA 1W0YT 2J5LB 4IRSB 4MCZA 1TLKA 2VDKL 1KXQE 5EU4A 5FKPA 3RA7H 4G6ML 2X40A 1UCBL 3RWDB 5JO5A 3QI9C 5AZEH 3MV7E 3PP3H 2VISB 2ESVE 4K7FA 4KC3B 1EJ6A 4XP6L 3MNVA 3B6SA 3TCXA 1RZ8A 4L5FH 3MUJA 4EI6A 3RBGA 5GGRB 5BRZB 4D0DB 4YFEA 3U7YL 2IAMB 4JM2C 2H2PC 1JGDA 4LBEA 2VZVA 3CFCL 3DVIA 4JM4L 4KKNA 3BO8A 1MCDA 2CDEB 2EYRA 3S34H 1EEUA 2BVUA 2UY7A 3VXUE 4KAQH 1BFOB 4X6CE 4X8JA 2IPKA 3RZWA 1VA9A 2QHRL 1BQHG 1FFNA 3AFLA 1I8LA 4L4VA 3V5KB 2BNRD 4JFYA 4M62H 1TVDA 2MHAB 3PL6B 1YC8A 1CGSH 1WFUA 4AL8H 3STZA 4QRSA 12E8L 1NDGB 5C2UB 4NO3A 2D03L 4OTXH 3HNVH 4ORGB 3KPPA 4MQSB 1FSKB 2NX5B 3VXSA 5HGHA 1F42A 2BDNH 5C09B 1AC0A 2ZSVA 1I9EA 4AY0A 3PUCA 2MCPL 4AQ1B 2X9XA 2ARWA 1GGIL 2ESVD 4YK4B 2MPAL 4RX4A 2VH5L 3U7AA 3E2HC 3CMGA 1ZANH 3VU2A 2Q8AH 3OG6B 2ZOKB 4PJXE 5JHLH 4JLRA 4Z7WA 2XWTB 1YEJL 4P5TD 4RNRB 3LSOB 4ELMF 1DL7L 2IQ9H 3HE6C 5CIPA 1KJ2H 3JXAA 5ERWA 1IAOB 3KNBB 4JCLA 5FOJA 2QSCL 4OZHA 1D5ZA 1G6VK 1F11B 3T3ME 5LVEA 5I1HL 3UTSA 5T33L 3ZYOA 3EYQD 5EUOB 5C0BA 2OLDA 4MSWB 2NY1C 3WEXA 5CUSL 3DXAD 3RPIB 5IEKB 1IL1B 3IXTA 5JXEA 4ENEC 2VLKE 3PXJA 4LSTL 4NQEE 3E3QE 2UUDK 4OZ4B 1KV3A 1K5NB 3IJSA 3S9DB 3WDHA 3LS5L 4PJEF 1AKJD 3SDDB 3U2SA 1QVOA 5CP3A 2P24A 1ONQB 2G75B 3RWGB 4X4ZA 5HGAB 2VDRL 3SKOA 1IGMH 1KUMA 4DGVH 5T5NF 4HMEA 4ELME 3OJ2C 2HN7B 3GJEB 3LKSB 1X5HA 2OTWA 2DQTH 4YHIB 1EGJA 2XN9D 3MRRA 3RWFB 4OD2B 1VPOH 1TETH 3L3DA 4KV5F 2D0FA 3MLYH 3HUJE 1KT2A 4I3RH 2OXHA 1JK8A 1OSZA 3LKOA 4ZS6C 4ZPTA 5J12B 1A7PL 4PJFA 1T03H 5DA0B 5GS0C 4ALAL 3NABH 2G2RA 1SY6A 3DX8A 3VGEA 3ZHLA 5A2IH 3VJ6B 4JPIB 5DUPL 2Z31B 1T0PB 4WI5A 2OBGA 4MB4A 2I9LA 4PJBE 1YMHA 1IFHL 1MQKL 3MMEB 2YD3A 1HHHB 4M9OA 4UT6H 3VD7A 4PJXA 1T83C 4LLWA 3MJ8A 2IFFH 1DLFH 4WI7A 4B50A 1DQTA 5C3LD 5I19H 1WITA 4PJ8A 3VCLB 4JY5H 4M3JA 2GTWB 2QJDA 4QCIB 3JWDC 3EJYC 3HR5A 3PF2A 3VXMD 2LE9A 3BDYH 3RVTD 3BH8B 2WIIB 1IGIL 3E0GA 3OKYA 5EUOF 4CVWA 2VTFA 3CFDB 4XCYB 3SDXF 5IV2A 3AU1B 4U6HA 1MF2H 3MA7A 1FCGA 1P4BL 1CICD 1F97A 4JFFA 4K3JH 4PRPB 3RVWD 1IJ9A 4NP4H 2WWMC 3F62A 4XMLH 2CIKB 1YEGL 4FXGB 2ERJC 5HVWA 5I30L 5JZ7D 5BO1L 1J8KA 1ED3B 4XMPL 4JRWA 2YMXH 4NN6C 4U1MB 4LVOC 2ADJA 1NEZA 4PJ5A 4AZ8A 3HLAA 5TDNA 2X4QA 2YWYA 4LEOA 3BT2H 3EZ8A 4NQXA 3PHQA 1TVBB 4LCWB 4P2QA 3W9DA 4OQTL 4C57C 1TTUA 5MERA 3FO2A 2NY2D 2YXMA 1YYLH 3CSPA 3TO2B 1UXSA 1VENA 2EC9T 4OF6A 4PJDB 4G9FA 1HH9A 2V7HB 2YHGA 2FO4B 2DLEA 1A47A 1KIQA 1LO3H 1AJ7H 2R2EB 2XQBH 1FZOB 4F15C 4HS8L 3PGCB 4P4KB 1Z3GL 3HCVB 1D6VH 2G5RA 3BMWA 4AT6B 2NNAB 2P8PA 1BZQK 1SYSA 4G8GB 3ULUD 1FGVL 1WZLA 3P4MB 2J6EA 3NFNB 1QBLL 3GHBH 5TE6H 2EO9A 4I4WB 4UV7H 2C3VB 2AEPL 3LKQA 3HE7A 3MV9D 1KTRL 2R2BA 3DETD 2FWOA 4OLZH 1KENH 3MRJB 4PJHE 4BQBA 2R4RL 3BD3A 3EAKA 2L7UA 3LZFL 4JZOB 1P4BH 2Y6SD 4NM4H 1RD6A 4LGSB 2ESVA 3UJIH 5EU4B 4OF3A 5FKPB 5KAQG 3RWDA 4NKDB 5E4EC 3TA3C 1KB5H 1PG7X 3GIVA 4GAYB 4JFPB 3ROOA 3OAYH 3B6SB 3B4NA 4EI6B 4APQB 4OJFL 1KCUL 3BP5A 5BMFL 5BRZA 5B4MC 3OQ3B 2CK0H 5IBLC 4D0DA 2IAMA 2Z93A 4JDTL 1GIGH 3QAZC 5GGSY 5MI0C 2EYRB 3QPXL 1F4HA 2IBZX 2MTPA 4ZXBD 3GKWL 1GAFL 3L9RB 4RCAA 1QBAA 1S8DA 4XXCC 3LMJH 1QLRA 3SE8L 1G0DA 2GSIB 2MHAA 3PL6A 4XC1H 5T1MA 4F9LA 4Z18A 5IFHL 4HS6A 1FFQA 1MCHA 4Z9KB 1S7SB 1R3HB 5FGSA 3W2DH 2K7PA 5KVEL 1YPZB 2FJFB 4I5BA 2XQYG 5CMAB 5HGHB 1OY3B 1QRNA 2C4XA 3G6JB 1TJGH 5KOMC 2HJKB 5I30H 2DQEH 4PLKC 5ELIA 3WLWD 4OCLC 4JG0H 1WCQA 3KXFD 1JHLH 5IMLA 5C8JB 1I8MB 1A6AA 5ITBL 1KYOJ 3SE9H 3RVUD 1A7QH 4Z78B 1UCBH 3V5HB 3I3EA 1T20B 5BV7B 2XWTA 4TPRL 2PR4L 2EYSA 4J6RL 1W2KT 2VXSL 3ZT5A 2OR8A 1IAOA 3ZYJA 4ONFL 5BOPA 4MMZC 1D5ZB 3DARA 5DD5L 5DZOA 3I3DA 3MRNB 4KH2A 4BH7A 5FEBA 5HI3C 3VFGL 5I17B 3BKYL 4QRPA 1K3ZA 2GK2A 4KK9D 2M1KA 2XT1B 3WFZA 4GO6B 4DKAA 4GKOA 1QBLH 1Z0MA 3GHBL 1QSFB 3DSFL 4CU8A 4NQDE 3TBWB 2GAZA 2AEWA 2VDKH 5I8EA 4X83A 3U0TB 1WIOA 5SWQB 3FMGL 4ZSOA 4F57H 4JM2D 2HAZA 1FAIL 4ELMA 3SDDA 2K7QA 3AS0A 1QVOB 2ZCKL 2YUXA 2G75A 3P73B 3PQYB 4IBLT 3OAZH 1UWGL 3WS6C 3ZKXB 5C0ND 3MRBB 3GJEA 3LKSA 4XH2B 4ZAKD 2F53D 2XRAH 1JRHH 1TZGL 5EO1A 3B9AA 4TVPD 5EZJB 4OD2A 1T2QL 2QQLH 1WVZA 3L3DB 1T6VN 1QBML 4MNQE 4I18A 5BV7C 4OV6F 1H3VA 4NQSB 1CQKA 4KTEH 2CRZA 2IWGA 5DUML 4OF5A 4PP1D 4LSPH 1L7TL 1BEYL 1MWAA 4NJ9H 5I6XB 1RI8A 2F8XC 5I1EL 3VJ6A 2DTML 1YNLH 1BIIA 1KB9K 1PKQE 2Z31A 2X9YA 3H7BA 5GZOC 4NQDD 4L9LB 1HHGA 4ONOA 1HHHA 4YBLB 3BIAX 2BCKA 3MJ8B 3N1QC 5IFAL 1F4WH 2UZIL 4OIIL 2L0DA 4U1IB 1NH6A 3UJTL 4CDGC 4GRLD 2BNQB 2HRLA 2IG2H 2XA8H 3DGCR 3WUZA 4S0SD 2WIIA 4OLVH 3U82B 3QXTA 1IQDA 1T7XA 1AQKL 3NCYP 5JIHA 5DEFB 4C54A 5KVEH 2D0HA 3CFDA 4M1GL 5IV2B 5LGHH 2CIIA 4HEME 2FD6H 4XC3H 3SDXE 5A2KH 1J1PH 2A9MH 1OVZA 5E6IC 4UUJB 3MLUL 4WU5A 1CK0H 4AYFA 3KR3H 4NN6B 4XPTH 1U3YA 3EYOB 2IANA 1X44A 2CIKA 4FXGA 2V2WA 4PTUB 5E8NA 1FL6B 4U33A 3UYPA 3UO1H 4LF3B 4EDWH 3DYPA 2FB4L 3OKLB 5DC9B 4YQXL 3WXWH 3VFNB 2X4QB 4LEOB 5T1DL 1M1SA 3LKPA 3G6AB 1JHTA 5EZIL 5I1AB 1TVBA 1H3XA 1ZHNA 4LCWA 2EDLA 4P2QB 1PEWA 4ZD3L 2NY3D 1HYRC 4K94L 3FO2B 4LOUC 1WFNA 4L9LC 3VRLF 1IGFL 1FGNL 1X5GA 1WBXB 3WFCH 2VZ1A 2DS4A 1VKXB 3HA0A 4ZMAT 1I3VA 2FO4A 1U8HA 4JJ5B 4DTGL 1CICB 3WS3A 4Z0BL 2GQHA 3V52H 5GS0D 1NDMA 2V17L 5F8RC 3EYSL 2DTMH 2OZ4A 2NNAA 1JGVL 4CN6A 3VFWA 5LGJA 5CJOL 1TCMA 4F7CB 3SE4C 2Q6WB 4KUCF 4I4WA 4HK3N 4YUEL 4N0YL 4O02L 4HWNA 4PRIA 5DWUL 1ZLUH 4X7EC 5IBTH 3VRIB 4YXLL 4OCXH 1MQKH 2VDQH 4MXVE 2FWOB 3NIGF 2OP4L 2PXYC 4M9PA 5KOVC 4NRYB 3S97C 2AS5M 1JFQL 3AY4A 3I6LD 4ZODA 1A6WL 2BHZA 3X17A 4GW4A 2WBKA 2WUCH 1ES0A 5CZXD 3RTQC 4YO0A 4FQQA 4F3FA 2RCSH 4D9LL 5L88L 4KTEL 3FQXA 3SEPA 5HY9B 2UWEF 3NAAH 3OX8A 4E41D 2QSQA 3BPOC 4APQA 5B3JF 4OFVA 3KPOA 1HDMA 1ZHLB 4RGOL 4ORZC 2ZJSL 4U1GB 4FFYH 1XMWA 4MQ7B 5DT1L 4KGLA 4NO5A 3P9MA 1KELL 4P2QD 1T04B 3M45A 5FM5O 4NDMA 2LTQB 3PGDB 4KK6C 3KR3L 5FF6A 2DQIL 2C1PB 1LE5A 3FB5B 3LKNA 1GYAA 4AH2B 1S7SA 4GRWF 4PLOB 5EC2B 4NKMB 1X5IA 4WFGD 3GI9H 5DJZB 4HHAB 5CMAA 3U1SL 3QIWB 1QRNB 4Y1AD 3G6JA 1FVCA 1H5BB 4JFEA 1D9KB 1VDGA 2NY5H 4P46B 3HZMB 4Q9QH 5DEGA 4JB9H 2M26A 1CBVH 1TXKA 3NCBB 1C1EL 4Z77A 5IB3A 3CIQA 2HFGH 3GBNH 4UOW0 5D7KE 1S7UA 5E9DE 4Z78A 4WFEE 3RA7L 4EXPX 1F4XL 1INEL 1N7ML 4LPYA 1RIHH 5D7IE 2AXFA 4A6YA 1UM6H 2XZCH 1HZHH 2JCCB 5SV3A 2JJTA 1UM5H 2QQKL 5C0EB 4PB0L 3VXSD 1QSEB 4YBQC 1LGVA 3MRNA 2BDNL 2X1QA 3C60C 4UDTA 5GSRB 4LNRB 5KSAC 1RK1A 1A22B 4JRXD 1EEZB 4ZSOE 1FZMB 4XPHL 2AXGB 2KPNA 5HVGB 2GAZB 5F8QC 2VDPH 1F3RB 12E8H 2CUHA 4GRLA 1C08B 2IH3A 5SWQA 5C07E 1Q9OA 4Y1AE 3MTRA 3QIBC 4OCWL 4ELMB 1KB5L 4J3SA 3T3MF 1OHQA 3MLWH 2X4RB 2CLRB 1HI6B 2IPUG 3PQYA 1RJZB 5ADOH 2CSPA 3C8DA 2BY0A 2R1YA 1A0QH 3GSXA 4I2XB 3C5ZD 3M8OL 4V2BA 3FT4A 5KVMC 3O2DH 1DQMH 1N26A 3T2PA 4CW1B 4S1DD 4LP5A 5IROC 2X4OB 4IJ3B 3QDMB 5EZJA 2F54B 3AS3A 3CSYB 2V9TA 1G9NL 3E8UL 4NN7C 4YPGA 1JPSH 3KWWA 4M5YL 3MV8D 3V7MA 4GG6E 1NFDA 1RUKL 4X6DA 3P9LA 3HUJF 4R8WL 1L0XA 4P9HC 4RMSA 1EO8H 2EH8L 5JXED 1OL0A 4LCIH 2XTJD 1N4XL 2VXUH 1SY6L 1ACZA 2Z0BA 2DMCA 5AUMB 4DGIH 5JMOC 4HJGA 2PF6A 1P5UA 5HGBB 1HHGB 4GBXD 2BCKB 1ACYL 1BBDH 3GRWL 5EORH 2G5BA 3BKCL 5HVFB 4Z7UE 3TN0B 3MXVL 1T1YB 2ZJSH 3HG1D 5TFSL 1RZ7H 5KVDH 4YC2C 1FL5B 3WHXB 3G5YA 1N5YL 1LK2A 3GHEH 3QZWA 2EXYC 4ODVH 1KN4L 2NTSP 4Z7NE 3QIUB 2CIIB 2QQKH 4KK9C 2IPUK 4I9WD 2XZCL 3Q6GL 5I73C 1DQJB 4PJAF 5SWZD 3EYOA 4MCYB 5JOPE 3QBTB 3KPLB 3WIFA 1A6ZB 3TN0C 1FL6A 2OK0H 4LF3A 3GKWH 5FGBC 3H3PL 4H20L 1BVLB 1EHNA 5D7JC 5DVMA 3OZ9H 1L0YA 1KIRA 1YMME 15C8L 1FP5A 3CX5K 4BM7A 5I1AA 3VXMA 1TJIL 1ZHNB 5ISZB 4AJ0A 2YKLL 1U42A 4XMLL 3T4YA 4PJ8D 2A73A 5AZ2H 1F4WL 2UZIH 4OIIH 1G1YA 1YEDA 1ADQH 4J3XA 4M7KH 3K7UA 1CDGA 3VFUA 2W0FA 4XX1G 5HHOD 5HVHB 1U8HB 1CF8H 1U2HA 2C7UA 2QQQA 3B9VA 3WS3B 1FFOA 4WO4C 3F7YB 5I8OH 4N0UB 4L3CA 4NUGL 4JFXB 1JZ4A 2I25N 3BN3B 1DZBA 1J0KA 4MA1C 4JO2H 2FCBA 4M7LT 3JUYA 4IJ3C 5CINH 3ZE0F 4HZAA 4OGAC 4I0PD 2Q6WA 4M61A 1D7FA 4OGXL 5J56B 3ARRA 1M6OB 2ZG1A 5GZOD 4F7TB 4XVJH 2FGZA 5FYJU 3LH2H 1H8SA 3BXNB 5A43C 1KNOA 5FM8A 3SO5A 4KPHH 5ALCL 1FRGL 5IWLA 1F13A 1JRHL 4HUXB 4G6KH 4Y5YC 3THML 4F58H 4OLUH 2NXZC 4XPTL 4E0RB 4GW4B 2HT2C 1YMMD 5I76A 2YPVL 4M6NH 4NZTL 3S6CA 2AJSH 2YOCA 2CO7B 4HWBL 4XAWH 5GS0H 3OX8B 1EERB 3JBG7 1UFUA 1ZLSH 1U95B 3RHWF 4I0KA 3KPOB 2R4SH 4X80H 3CFBB 4R8WH 3QG7H 1B3JA 5IF0A 4DW2L 5K9KA 3BWUC 3D25A 2CR6A 3VXUB 1TQCC 3VGDA 3GRWH 5EORL 4NO5B 1JPSL 4OBRA 3KJ6H 4BZ2L 1H3WM 2PO6A 3Q5YA 4PY8I 2H1PL 1HILB 4K07A 3KYNB 43C9A 2HFEB 4YC2B 1QQDB 3QDGB 1T80A 4PGBA 2GY5A 1T66C 2C1PA 3NIDF 3FB5A 3LKNB 2ATKA 1LE5B 2Y1VA 3KG5A 1JYWA 3QXAB 1MCEA 2C3HA 1E4KC 4LOUD 3V7AE 3MODH 1NCNA 2CLVB 2N1KA 1CWVA 2V7NA 3EFFA 3ULVD 1OGAA 4FQIH 2DI7A 3BISA 2W0KA 4OM1L 1GGCH 5HHXL 4P46A 1PY4A 3WNMA 3TJHD 1A1MA 4OZGA 4OZFA 5HYJE 4Z77B 5IB3B 5DEZA 2DJSA 3NGBC 3QO0A 1BM3H 2HG5B 2NLJA 2A0LD 3MJ9A 4CN4A 1BZ9B 3NFSH 5H8DA 1OARH 3QNXA 1S7VA 1WBZA 4R4FH 2H41A 1YPZE 5DD0L 2F5BL 5GHWL 4NWUH 1S5IH 1ZANL 1TITA 4XPGH 1B0WA 2BVYA 2AXFB 3WUWG 4AL8L 1OGAD 4F2MB 2BVOA 2FBJH 5KTEL 5C0FA 5C0EA 2YRLA 5GRUL 5DHVA 3WD5H 4KXZH 1KJ3H 1GH7A 1BF2A 4TQEH 4UDTB 5GSRA 3RTQD 4G5ZH 2A1WL 2DMBA 2OTUA 2YWZA 3PL6C 1A6TA 4J12A 1KEGL 1Z9MA 1EEZA 5I1GH 3QDGE 2AXGA 2E8ZA 4LLDB 2XI9A 4J3VA 5ETUA 1QYGH 1RPQA 2E6JA 3FQUA 2A38A 1C08A 5DRWB 5SWSA 1Q9OB 3CX2A 3ZLQC 2XY1A 3C8HA 3KPRD 1FFRA 4JM2F 4P9MH 1YEHH 5J3HC 1J1OL 1FN4B 3MV11 2R1YB 4I2XA 1ROWA 5B3JE 2MKLC 3HFML 3E6FA 2ZUTA 1QSFE 4XNUH 4CW1A 3QUYD 2Y36H 3KJ6L 2Q7YA 4L8SB 1VEPA 2JF1A 1DVFA 1CD1B 1BVZA 4KK6D 4HSQA 4Y4HD 5CUSH 1P84J 3W39B 2OL3L 4C83B 1CZ8H 4YPGB 3GI9L 4IDJL 4LLUB 1EPFA 4YWGL 4YJZL 4X6DB 5F7EL 2MSPA 1NMBH 4RDQG 5DO2D 3UDWA 1RZKC 4QHUB 25C8H 5DD1L 1XT5A 1AH1A 1KYOK 4K3GA 5MHSE 3H9SA 2BJMH 1LO0L 1PZ5A 1ZS8A 5BZWB 4JZNB 3MGOB 1ORQA 4HJGB 5CFHA 4WWKC 5ICXB 4JY4B 4M6AA 3EDFA 4XCFL 1KB5A 4HFUH 3RX5A 1ZE3C 2VWEE 1CT8B 4G80A 3VXRB 5FO9A 3G5XA 2G5BB 1F3JA 3RL1B 3KYMB 4MQXC 3F7VB 2RFXA 4Y16A 1CTOA 3ARGD 2J88H 1J05A 3BH9A 3VFPB 4DN3H 2IAMC 3KPRB 5FO7B 3RTQB 4GKSB 3SDAC 4ELKB 2BP3A 4C4KO 5LQBL 3P30L 3ES6B 3QZWB 5HHQA 3K81A 2GIYA 4N0YH 4L8SC 4JFQB 3QIUA 3H8NA 3ORJA 4WI4A 3DVNB 3W11D 2B1HH 4A6YL 1DQJA 5D5MB 1XR9A 1ZWIB 3CK0L 1NEUA 3AMKA 4PY8J 1BD2E 4CMMB 4GG6F 4KTDH 3VA6A 1BVLA 4DN4L 4P59L 4PRHE 4UINH 5E2VH 3QUKA 3CFEB 3HHRB 5AYQA 3VD9A 2XPGB 1C16B 3HG1B 2JB5H 3TZVD 4WW2B 2ZUVA 3V5DB 3MRFA 1RZFH 3QEGH 4KY1L 4HK3J 3MROB 2DLIA 3PWJA 2MMXA 4ODHH 1TQBC 2EKSB 2PTUA 4HT1L 1YEDB 2DQHH 1CIDA 2X4SB 1JI1A 2DD8L 2UV3A 3VFUB 2Z91A 4MAYA 3BE1H 5E8PA 1I3UA 1DBJH 1FFOB 35C8H 3GSQB 4NGHH 4DCQB 2J3SA 1O7SA 5BXFB 3WUWB 5FM5M 1KN4H 2AW2A 1FDLH 1X5YA 3BN9C 4W81A 4S1RH 3X12A 5F97E 5IBUB 1S5IL 1YY8B 2BVPB 1IC5L 1HINL 5F89A 1BQLL 1FLTX 3HI1B 3VDAA 4F7TA 4YAQA 3ULUF 4P2YA 4O2FB 5MENA 1KNOB 3R1GH 5FHBL 3WYRA 5D93C 1AO7D 1H8NA 1K4CB 2L4OA 1KCUH 5JW3H 4RAUA 4U1HB 1DSFL 4PRHD 2B5IC 2Z8WC 1OTSD 3BPNB 1K6QL 3MQIA 1YDPB 4OIBA 4UI2A 1CLZH 1MHCA 3X14A 2AV7A 5J6GA 1JNNL 1FFPB 3C60A 1FYTE 2HKHL 1AKJA 4WU7A 4P3CL 4X6DE 2ENYA 1CXLA 3T1WA 3QA3A 1IKNC 1K8IB 4WY7H 4MB5A 3HE7C 1AGBB 3D25B 5IGXH 2Y9RT 2HVKA 4KDTA 3TLRA 3X3FL 1IC1A 2PCPA 1S7QA 5FV2A 5K9QG 2PO6B 4KZDL 3V6ZA 3V9FA 1HILA 4J4PD 1A0QL 1JF1A 3VD4A 3P4NB 3VFTA 2VXTH 1X5LA 43C9B 4FMKA 4Y4FD 1CG9A 1GZQB 1QQDA 1VFOA 4GLRI 4Z95L 1A6VH 3BJ91 5DJDB 5TE7L 2EO1A 1JNLH 1I7ZA 2H32B 4NJ9L 5TQ2H 1JZ6A 2XZZA 4J23A 4X5XB 3EFFB 5GRZA 3RL2A 2GSGB 1OGAB 4N8CH 4NO0D 2Q86B 2ZUUA 4H88H 2Z8SA 3DSNA 2BJML 3TNMB 1UENA 4U1SB 4O9HL 4WO4D 1A1MB 2ZCLL 2MJWA 2Q8BH 4OZFB 5L7XL 3SE4A 1P4IH 3QO0B 3OTTA 4U6YB 1T0MA 5I1KH 1J7VR 2NLJB 2ZOLB 3WJJC 1AGDA 3QNXB 3J7HA 1WBZB 2B0SL 5J89A 1B4JH 4OGXH 1FVDB 1FZKB 5HDBF 1MCNA 1T21B 3PWUA 3RX8A 4XMKL 5EULV 1QFHA 4QGYA 1IAIM 4GAFB 4OF0A 2VITA 2D7MA 1JPTL 5C70A 5C0FB 5I8OL 4Z7OE 1QEWB 3ZDYE 4APQC 1FPTL 5E70A 4PRIE 1PKQB 5DMIH 4JB9L 3E6HB 1IGIH 1MPAH 4IOIB 4LPTA 4QRTA 2ADFH 1I8KA 4LLDA 3UYRL 1WZKA 2VDML 3PIQB 5ETUB 2EE6A 4POZC 5DJ6B 4G6FB 3FQUB 3P9WB 1EFQA 1N8ZB 1I7TB 3UZEA 3I6KB 3T8XA 1E4XI 5JNYB 4XP6H 2EE9A 1B2WH 4LSSH 1KN2L 4CMHC 4YHYC 3U1SH 4X7CC 2PNDA 2F74A 4YHZH 1FN4A 5D2NB 3E6FB 1G7JA 1VERA 3MRIA 2G9HA 3GMRB 3G5VA 4OFKA 3V0VA 1WFTA 4ZOCA 4PJ7B 4L29B 4WEUD 4P5KA 3BSZH 3W39A 4RRPG 1P2CB 2J8OA 1J8HE 4LSDA 5DYOB 3WLBB 5CD5C 1VACA 4ERSL 4GKNB 3MCLL 3DO7B 5HDQH 3SOBL 4TRPL 1GCFA 4XBEL 1BREA 4OLWH 3D18A 2IANE 1MFCH 2NYYD 1TZHA 5I1CL 5DF0A 5C09D 4HCRL 4XB8A 4YX2H 1ZVHA 3OAZK 1QSEE 4H25B 4NRXB 5IEHA 5JW4R 4LDEB 2NW2A 1PZ5B 1ZS8B 2A77H 3MGOA 1BAFH 2NY7L 1ZLWK 4JY4A 1GAFH 3QNYB 4IMKA 5FFLA 4OZIF 3VFMB 1M7XA 3VXRA 3QQ4B 4HKBB 2OI9B 5J12C 3QFDB 1JFQH 2VLRA 3MBEC 3OHXA 4PRDB 1S9YA 4MGXA 2J6EH 3BH9B 3VFPA 3OKMA 5J57B 4C59B 5IWLC 5FO7A 3RTQA 1DCLA 1PD6A 1JNHB 5DJ2B 3OKNB 2DQFA 3MREA 4G6JL 5HHQB 5IVNA 4FFZH 3BZFA 2ICEA 4F37K 2LU4A 2DTSA 3X3FH 3TIDA 4KKAD 4LCYA 1NCAL 2F8VA 4Z0BH 4JFHE 3PL6D 4O58H 5BW7C 5CILH 4PJIE 1XR9B 1ZWIA 5DI8B 2FX7L 2H26B 4PRHA 4FQCL 2AQ2A 1G7LA 2IAND 3JV5A 2C4FU 4S1SH 1BX2B 1OAXL 4QTIH 5F9WC 3QUKB 3FT3B 3VA2C 1C16A 3HG1A 3T0ED 1QACA 3MNZA 1KCVH 3NA4A 4WW2A 5GS2H 1T2XA 3V6OE 3MRFB 3B9EA 3QUYC 3MROA 4JFDD 3KPSD 1JV5B 1TIUA 2DBLH 1NBYA 3PWJB 4Y4HC 2EKSA 4GSDH 4MNHB 1A6UL 4H8WH 4JN1L 1MAML 2Z91B 1J8HA 4MAYB 3RRQA 3D48R 3S3PA 4FABH 4HPOL 1YY9C 3GUTB 4YDLB 4P2RA 2HLFD 4NNXB 4PIRF 5F7LB 4MLSA 4NWTL 4TSBL 3WUWA 3O6KH 5CBAB 4HUNB 4OSUH 4Y5VB 3TH3T 4YGAB 3C5JA 5FAAA 3TIEB 2XIDA 3UAJD 1N7MH 3F7QA 3LRGA 4CVZA 3UPAA 3TO4D 3D87B 1R3KA 1C5DA 3RIAF 2IPTH 1S7WB 1NBZB 2A9NL 3HZYB 1U8LA 3BZEA 3HI1A 2RR3A 1BFSA 1U0QA 4L4TB 5B39A 3MA9L 4ZNEA 3RVXD 4KTDL 4X6BA 1RZFL 5TF0A 2F58H 1KPRB 1RUAL 1RZKH 1T5XB 4RAUB 4YHPA 1BFVL 2E7MA 4MVBD 5ITFB 1FLRL 2PYEB 5EIQA 4YR6A 3ZE0E 1HHJA 1UA6H 3SDAD 3O11A 5MP6L 3H3PH 1MCOH 4H20H 5FYLE 3QWOA 4DTGH 4I3SL 3X14B 5J9PA 4MAUL 4LSPL 4FQ1H 1BGXL 3HI5L 4KJQC 5DLML 1L7IL 4NQDB 5E8OB 4RDQF 4YK4C 2DM7A 5LWYL 3QA3B 3W11C 2CRMA 4KMTH 2IADA 3VH8G 2R8SL 1I8IA 1TVHB 4LSUH 1HSBA 4LSRH 1DQDH 2YD7A 4EUPA 2XZAL 1E6OH 5C0AB 3REVA 1OT1A 2GK0B 2Q3ZA 5DRXB 1VSCA 1KCVL 4WTWA 3V6ZB 3S96B 4JO3H 3I6GA 3VFTB 3SN6N 4FFVD 2AJVL 2V2TB 4HIHB 2NW3A 1XF3B 1NLBL 2FGWL 3PDGA 3L7EA 5DJDA 3C8KA 1F45A 4JY6A 4ZO6A 1Z9OA 2DQCL 3O9WB 1BBDL 3L95B 3TNNB 4Z6AT 2GSGA 5IJKA 1LMKA 2DI8A 3DUUB 4PGDA 1Q0YH 1NCDH 1ZHBB 2HFTA 4YWGH 3SCMD 3S37X 3P77B 3WS6A 4IS6B 4M7JH 5HDOA 1Z5LB 1F4YL 1C5BH 4HX1B 4Z8FL 4WWKB 1T0MB 5INCB 1FL3B 2JB5L 1HXMB 2ZOLA 4NYLA 2J6EL 1A9EA 3RHWK 3EOAA 3CH8A 1EK3A 1CZ8L 3MRLA 3NA9H 1TZIA 1FVDA 1WZMA 1KCLA 4P57B 2XKUA 3X3GH 2GT9A 5AYUL 3DVGB 4EOWH 3O4LE 1DBBH 4CAGA 3VG0L 2VITB 5L2KE 1IAKB 2YD6A 2DYPD 4N90D 4Q0XL 3M17A 2FSEA 2VSDA 4NT6A 5KG9B 1VCAA 1H3GA 4CRPA 5IQ7H 1OT2A 3GIZH 1DBKH 1I8KB 2NY2B 5LBSL 1WT5A 2DL9A 2R0KH 1BQUA 1U8JA 4IMKC 4K7PL 4CNIB 3EDEA 3WE6B 4IOFD 4XPHH 3SGEH 1ADQA 3CNKA 3HE7D 3T8XB 2LU3A 1LP9E 3WIIH 1H9VA 5CP7A 5IFHH 2QL1A 4KUZL 3L6FB 1HIMH 1EMTH 3QUXA 4MMXC 4OTXL 4XPGL 1X4XA 4YIQA 5D1XC 5HYJB 1OAQL 2OYPA 2FBJL 4FA8A 5D2NA 4QNPF 3VRJA 2H32H 1G7JB 4K8RL 3QPXH 1IKFH 1V7MH 2Z4QB 2G9HB 3GMRA 1V7NH 4AQOA 5L2JA 3MUGB 2VZSA 4HKXA 4PJ7A 3BYYA 1IAIH 2BSED 3CAFA 4P5KB 1YYML 4HC1H 5L0QB 1KTKE 5DURD 1MJJB 3HB3C 4WDIA 3WLBA 1UZ6E 1PBYA 3EZJB 3FL7A 3NFSL 2OSLA 4IRZH 4N90E 4JM4H 4ZFOB 3B9KC 3D18B 4CN1A 1NGQL 4AM0B 5FUZL 5BMFH 4JHAL 2K3TA 5L8KB 3P3YA 3QH3B 4H25A 4MA1B 4ZO8A 5F6IB 3MC0A 4GXUM 3CLEL 2KQNA 4N1HB 3QNYA 3D5OF 5CCKL 3O3EB 3QQ4A 3UJIL 3SY0B 3KPNA 4JR9L 4HKBA 2V9RA 3TV3H 1J10A 1R3IH 2CRIA 4UV4H 1MRFL 4JG1H 4RAVA 4UU9B 3GB7B 4MA3A 3OKMB 4LRIC 4HUKB 3JV6A 3GFUA 3EYQC 3UTPD 2H2SC 1EEYB 1JNHA 3QG7L 1D5IL 4PBWD 3C6SB 1KFAH 4FHBD 4APQD 2ATPB 2NY1D 1MUJA 4XHJD 3TYGH 4NC1C 1KJ3L 4PJIA 4ENED 3NTCH 5ANMA 5LG1A 1NCDL 2NXYB 5JQHC 4UDUA 3CVIL 4PRPE 4XVSH 2WSKA 5FYJD 3LRSB 3H9SD 3S3JA 1VGEL 4POZD 3KPQB 4Q9RL 4I48A 1F8TL 2DI9A 2IGFL 5IMMB 2H8PA 3QRGL 4TNVF 3GK8H 3X11A 1TPXB 1G7LB 5FA4A 4K23H 3U9PL 3SKJL 4HXBL 1MJ7L 4J3UA 3S88H 4QRQA 3INUH 4MXVF 1U92A 4F57L 5I9QC 2EIZB 4X5WA 1VFAB 3C6LA 3MNZB 4KV5E 1F6FB 4YHML 4NC2B 5ICYA 1JNJA 3DMMA 3U36B 1CXHA 5FK9B 1NBYB 4DFIA 5E6IB 4MQTB 3K2UL 5TPWH 1CR9H 2B5IB 2YPLD 3O6FA 4ZNCD 5CD5D 4MAYC 5JORA 2ID5A 5BS0B 3GSVA 4P2RB 2OJZH 5T1LB 4NNXA 3IU4L 5L9DH 4FQHB 3RIFK 4XI5C 3WNPA 5CBAA 1NSNH 5MI0B 3DV6A 4Y5VA 3QAZB 4EZMA 4HIEA 3SGEI 4U31A 3LQMA 4IMLB 5K9QI 3DUSA 5E2TL 3P4OA 1C5DB 2DKMA 3KLHD 3B2UC 4PRPD 2W38A 1NBZA 5JIPA 3HZYA 2ORBL 3BZEB 4I8DA 4QHKI 2DWEA 4HK0B 4BZ2H 5CIPH 2R56L 4X7TA 5B39B 1UJ3B 2CO6B 1I3RB 2CLZA 2P5EE 4UT6L 4PRNA 1F6LL 3MRDA 1KPRA 1ZGLM 2O5ZH 3NGBB 3S4SA 5ITFA 4G42B 4Z7UA 4JRXA 3GO1H 5T3XE 3JWOL 1P6FA 3ARBA 1BQLH 1A6PA 4XT1C 3S35L 5D9SB 1KPVB 3R06A 5C9KA 5F7MC 2EDHA 4ODTH 3ULVF 4BYHA 4MXWL 4NQDA 1D6EB 1NFDF 2IGFH 4HV8B 2YPLE 1MAJA 4ODWA 2IADB 3V4PL 1EA9C 1HSBB 2DRUA 5I0DA 4XX1E 1EAJA 1SVCP 3BE1L 3IDNA 3IFPB 3DURB 4KI1A 4XXDA 2GK0A 2PETA 2F53B 5DRXA 3PG2A 1AFVH 5JA8B 3QCTH 4LPCA 4P59H 1KLUA 4YPJA 4ZUSB 3UPCA 1S5HB 2O5XH 5DVLA 2XQYK 2XFXB 1DJSA 2P5WB 1S7TB 4G9FD 4YXHL 3UBXI 3FT2B 3C8KB 4JY6B 1YNKL 3U4BH 3CFKA 3O9WA 4HLZG 3ARFB 3L95A 2BSTB 4KMLB 2FEEL 4NHUB 1UKQA 3DUUA 3BIKA 5EOQL 1ZHBA 4Y5YA 3L5JA 2JJUA 3C9NA 3CLEH 3EO0B 2BFVH 4IS6A 1BOGA 1AHWA 2C4FT 2R23A 3P30H 5CILL 5CGTA 4JQIH 4HX1A 5IQ9A 4PUBL 5INCA 3UAJC 4M7ZC 3FRPG 1FL3A 4Y19A 1JZ2A 4FQLH 4OFDA 1HWGB 1A9EB 3K2UH 1PG7W 2KKQA 2BZDA 3QXDB 3VWKD 1U36A 4NFBA 1E4WL 4RISH 1T3FB 3ILPA 2WUBL 1QG3A 4HH9A 4LQ1A 2Y6SC 4JRYB 3RVXC 1HNFA 1A3LH 2WMPA 1XF5B 4WUKH 1PW3A 3IJYB 1S78D 4F9PC 2XQBL 2BY2A 2NX5E 2VXQL 5KW9H 4MVBC 1MCCA 3TA3D 1YUHB 3VFOB 5KG9A 4UTAH 3U48A 1F00I 4YBLC 3GHEL 2AJUH 1JWSB 3H2WA 5IBLD 1UJTA 4S10A 3B5HA 1A7NH 2E7LA 2IMNA 4QRRE 5DZLA 5I1JH 3BMVA 4NN5B 4LSQH 4QLRA 5FKAB 1ZTXL 5CP7B 5DQ9B 4C56B 4U6VL 1OTUC 3DOSA 3D0VB 1FO0L 5HYFA 4UBDD 3U7WL 5CEZH 4WENB 3TESA 3MV7D 2DF3A 3CUPB 5KSAB 4FN0A 3FQNB 2ICCA 3S34L 2VIRB 2OTPA 3MLTA 1DP0A 1MF2L 1CE6A 3MUGA 4HKXB 1MJ8L 1LK3L 1KSRA 4JGUA 4WI2A 3RKPA 3T0AA 1Y18B 1MJJA 1TQBB 5DR5H 4GOSA 4Y4KC 1U41A 1ZHKA 2OSLB 4ZFOA 1I1RA 3SCMC 1QRKA 4N8PA 3ZKMC 5ESVB 3QUYA 2APXA 4N5UA 1B6UA 5EO0A 2R29H 4MA7H 2BNRE 3MOQA 1KB9J 3MR9B 4PGJA 2R69L 2HH0H 2NY6B 1G7HB 3O3EA 1MOEA 1JZ7A 3EOBB 4HJJL 3ECBB 5EA0L 3RAJL 1EO7A 1HIML 5GRWA 1QR1A 5EBGA 4P3WA 1R24B 5C2BL 4XC1L 1GOGA 4L8DA 3VFVB 3GB7A 4MA3B 3A6CL 2OX5A 3QJFB 4JFED 5FHAL 4Y1AA 1QD0A 2D4FA 3LN5A 5TF1L 5B38B 4EDXB 1OARL 4NQVB 1FORH 5C9JA 1V3JA 4PJIB 3ARSA 4PJGB 1JP5A 1Q0XH 4NQTA 3SGKC 1P7KA 3SPVA 3BPLC 3LRSA 2XZQH 4K55A 1J0HA 1CD0A 3DRQB 4D94A 5T1KB 1OTTC 1A6VL 3LDBC 3X11B 5AYUH 3NFPB 4EN3D 2X1OA 5FA4B 1KC5L 1INQA 3FJTA 3VMPA 1AHWC 1BQHB 5D1XD 2D31B 1HKLL 2J8UB 1GL4B 3CDCA 4W4NA 5ICYB 1I1FA 4RMQA 3VI4F 4NZDA 4HD9A 2W65B 3U36A 1RHHA 2YRPA 5GIRA 5E6IA 2J8HA 5C6PB 3AGVA 3EJZC 4DGYL 2OMNA 3DX6B 2YR3A 2YUVA 4NQED 3GSOB 4KKCD 3KAAA 3O6FB 2FX9H 4ZUUB 4HFWB 1ODAA 4FTVA 5JORB 3SDYH 3T2NL 4JFEE 1XZ0B 4X4YB 4HEPG 4R90H 5F7YC 3WN5C 4DW2H 2EDJA 2ZKHL 2IPTL 3DV6B 3KYKL 2ENSA 4XNXL 4HIEB 5KS9E 2EE3A 4CVXB 4PTTA 3DUSB 4P5MA 3ARXA 3P4OB 1KJVB 4G3YL 4JFFD 5DJYA 5M95B 3C5ZA 4HWZA 3O3DA 2WWKT 1EV2E 2DWEB 3IRZA 4HK0A 4CJ0A 3EIFA 1LVEA 4LHUA 1L4IA 5E6ZA 5ADPH 1I3RA 1LO2H 2EYTA 2YUWA 2ZCHH 4PRNB 4K94H 3MRDB 1JI2A 5DK0B 5ALCH 3RWCA 3S4SB 2CGRH 2I07A 3ZKND 3JTSB 3RNKA 4OQ1A 4FTVD 1FC2D 4JRXB 5D8JL 1Y0LB 4W68A 1D9KC 5INDA 4CJ1A 1RULL 2D03H 2ITCA 2C3GA 5BO1H 3IF1B 4HJJH 2BK8A 3CVHL 1LEGA 1OAKL 4XVUC 1OM3L 2BVTA 2YZ8A 1UQSA 5KN5A 1IC4L 4DKFH 3V6OC 5FO8B 4WI9A 4Z76B 1YN7A 2HWZL 3G08B 2A9ML 5C07A 2O61B 4X99A 3LIZH 1FLRH 4FQ1L 2SEBB 3QISA 4DEPC 4NQEB 2BOCB 5FGRA 3DURA 4X7SL 3RWEA 3V2AR 2F15A 1UXWA 2NY3C 5CZVL 5TDOA 1A3RL 4LDLB 5A2JH 3TYFB 1JWUA 3RUGA 1XH3B 2I60H 3KPMA 1C5CL 3FT2A 3FB7A 3RKDC 1EUTA 4M43H 5ILTH 3LN9A 3QUZD 5HYSB 2BSTA 1I3GH 3QQ9C 5JPMB 4NHUA 2APFA 5L8LB 2AAVA 1GHFL 4FTVE 2NY7H 3IS0X 4LHJB 5K33A 2LAAA 2DQJH 4H5SA 1DE4B 3L7FA 1BOGB 2R23B 3F58H 5KS9A 1FVEA 4RMUA 5IQ9B 5IG7A 2OCFD 5F9OH 3VXNB 2J4WH 4XRCA 4Y16D 5DJ0A 3QIUD 4RZCA 2KZ1B 1YJDC 3BESR 1WIPA 4M6ML 3OV6A 5TF1H 3GSNH 4U6TA 1JHKL 4KRPC 2P7TA 2W0PA 1VGKA 4QT5B 4G7VH 1KBGL 3VXOA 4X4ME 4JDVB 1WISA 4WW1B 1KLGA 2QQNH 4YGVB 3A0OA 4XPBL 3N9GH 2ZKHH 3GJFA 5EBMB 5D2LE 3D39B 5ACZA 1YECH 3VMOA 3MBEB 3WFHB 4LHUG 3AC0A 4F8QA 3MLVL 3VGHA 3MV9E 3KS0H 3RWIA 1JYXA 1WWBX 4MHHG 3U79A 4RMVA 4U2YA 4N1EA 4O2EB 1XCTA 3UJTH 1MELA 1PGRB 3OL2A 5FKAA 1HHIB 4JQIL 3ESVF 4AMKL 4F7EB 5JXAH 2D7TH 2XACC 2BY1A 2PR4H 4WV1B 3AB0C 3MNWA 1HOCB 5DDHA 3IXAA 2VO5A 3HS0A 2NR6C 3AVEA 4I13B 1NKRA 3S35X 3AREC 4OZGE 5SX4H 1KGCE 2VIRA 5FYKU 3MLTB 3JWNC 5HYIA 1JHLL 1O5DT 4YX2L 3B9KA 4HPYL 5DHYA 4AIXA 4Z7QF 1Y18A 4D0BA 5FOBB 2CXKA 5ACLA 4N5EC 4WNQB 3AUVA 3BHBA 2OZ4H 1KG0A 4S11A 3TBYA 4OD1L 3TP4A 2IC2A 1AGFA 3TWCH 1WEJH 3R4DA 2R1WB 2HJFB 2A6IA 5BVPL 3ULUH 3K0WA 3QUYB 3ZDZE 4ZFGL 4EI5A 3MRCB 3TM6A 5C0JA 1VFBA 1VADB 4OAWA 4GW5B 4LIQE 3ZYZA 3ZMRA 3AS1A 4P49A 4S2SB 3BOVA 5IVXA 5JTWA 4JKMA 1G7HA 3OBAA 3HE6D 3ECBA 4DKEH 5F96L 4ESKA 3JUZA 4XNZB 3KHOA 4O00A 2DKUA 4PJGE 5IVZA 4ZXBA 2PW1A 4X9HA 4L8DB 1JNLL 3QJFA 3C60D 1S78C 1PFCA 5KSAD 4PS4L 2J7LA 4KK8D 2WUBH 4NIKB 4R4FL 4K7FB 3O2VL 3P4LA 1IM9A 4NQVA 5C9JB 3IYLW 4FXKB 1NCTA 3MNVB 1RZ8B 2A6DA 1IQWH 4OD3L 4BQ9A 5GGRA 1A14L 2PTTB 5DD5H 2J8UE 4QOKB 4AENB 3IDYC 1C1EH 4MHHI 1FIEA 3PHOB 3O4LA 3DRQA 4JHWL 4LCUA 3SGJA 5EDXA 3C5SA 4I77H 1E4JA 1WZ1H 3HNSH 3NFPA 1MCPH 3QEUB 3UZVB 5EWIL 3ULUE 3C5ZC 4U1GC 4BK4A 2ZNXA 1J86A 1IGTA 4PG9B 4QNPE 4GQPH 5FA3A 2PYFB 1PKOA 2D31A 5FECA 1RJYB 3U4BL 4AIZA 1I1FB 4RAHA 3BZ4B 5GIRB 4LMQE 3DX6A 2NX5A 5E7FA 4YXKH 2YD8A 4MYWB 5DZNA 1MRCH 1K8DA 3QWQB 4KQ3H 4J1UA 4N8CL 2ADIB 2VSCA 3O81A 1CFVH 3TPKA 4DVBA 4CVXA 3QWRA 3TVMD 2Y4SA 1M05A 4HW6A 4P23B 3EO1B 4GXVL 1KJVA 1PQZB 4WW2C 5DGQA 5DS8A 4HWZB 3O3DB 4WFHE 5D1XB 4D2NA 3FOLB 4LHUB 4KKLC 4PB9L 4KGJA 4NHCL 5AAMA 2F54D 5ALBH 2WZPD 5K9JL 2P43B 5DMGD 4O02H 3VXRE 3KNBA 5DK0A 1U8IA 3RWCB 4OZHB 3LAFA 4DUVA 3KXFA 3I2CH 3KLDA 4QHKJ 2EXYD 1P9MA 4ZUWB 5INDB 4PGZA 4PJ9A 1CXKA 3QDME 2NY0B 4X7FC 3WEXB 1R6VA 1RJCA 3IF1A 4JFZL 5DC0A 1T4KA 3RVWC 3IXTB 1JBJA 2WWMD 1MCRA 3BAEL 2AJXL 4JO2L 2AJYH 3ULVL 3EDJA 5FO8A 3F12A 5I73B 4JKKA 4Z76A 1K5NA 3G08A 3HAEG 5BV7L 1U6AH 1DANU 3FO0H 5CBEA 3NH7L 2P24B 5D7JD 1OTTD 3C87A 3RWGA 2F58L 3SKOB 4HAFA 4QRPE 3VGBA 2P1YA 3V4UH 2APWA 4I0PB 2HN7A 1AP2A 5IJVA 2OTWB 4MJ5B 3QUZA 4YHIA 3RUGB 3PWVB 2AI0L 3FB7B 1KT2B 4LL9A 4KROC 2ZCHL 3LKOB 3ALPA 4UQ3A 2EXWD 3CVHH 4KKCC 4HG4K 2OJEA 3RI5F 1Q1JH 3ISWA 3UPRA 3DX8B 1MEXH 3FQTA 5JIIA 4K71B 3T65B 5KS9B 4P2OB 4OLEA 1RVFH 2I9LB 1YMHB 2NY4B 3OF6D 4FG6C 3MMEA 3MXWL 2DD8H 5DJ0B 1M4KA 4LLWB 5DD3H 2PO6C 1R5IB 5D72H 4ZFOL 1CU4L 5D2NE 4UT7L 4PJ8B 2YN3A 1AE6H 2VL5A 3VCLA 2NXZD 4H1LA 4DKDC 4QT5A 3HR5B 4ZNEE 3BH8A 3VXOB 1T89C 3QHZH 4JDVA 3B2VL 3ZKNC 4GRMA 3BFOA 1CXEA 2F53E 4YGVA 1WCBB 3EW3B 3GJFB 4DGIL 5EBMA 1I9JH 1CGTA 1SY6H 2AK4D 4JZJA 5ACZB 2A83A 3TO4B 3PE9A 3P0GB 3O45A 3TH2T 3C6LC 4QOKE 4JPWH 4PBVC 1UKSA 2AGJH 4EVNB 4O2EA 4EIGB 3QFJD 4ZXBC 1HHIA 2BRRL 3BP7A 3MV8A 2AP2A 2VABA 1ZA6A 3RY6A 4EQ2A 3O9WC 3T09A 2NY5C 4NQXB 4WV1A 1LEKB 1IFHH 3MNWB 3HI6L 4OLXH 1OB1A 4LNVA 1V3MA 5DDHB 3IXAB 5MERB 1J5OH 2R2HA 1LO0H 2J5LC 4G43A 1EVTC 2WK2A 1KJMB 1YEKL 4PJHF 1FNSL 5FOBA 4D0BB 1RMFL 1I1CA 3REWA 5IB5B 1A7PH 3QQ9D 3IAPA 4QRUB 3TBYB 4PLKD 3TYGL 1CLOH 1AGFB 3AS2A 2P8PB 2VLJA 1YEIH 3HNVL 5E5MA 4XVSL 5F88A 2R2CA 3NFNA 3MRCA 2HYMA 2AK4E 2X42A 1CN4A 5GGVY 4XXCA 5C0CA 1MVUA 4OAWB 3PHSA 5LWYH 2C3VA 3A67L 3LKQB 4QOKD 5JW4N 5J1AA 5EPMB 5HHXH 5IVXB 2OZ4L 43CAB 3W82A 5GGVH 3MV7A 4PB0H 2RHEA 1EXUA 3RQ3A 2DDQH 3OR6B 3L5WA 2OQJA 4JZOA 4LLMA 2FH6A 1RIHL 4M62L 3RUGE 2ESVB 3GM8A 4MA7L 3LEXB 4WHYG 1LO4L 4HCRA 3RDTD 3GIVB 4GAYA 1CLCA 3ROOB 3MCKB 2Y5TA 3MUHL 1D5MB 2A6DB 4HLZH 1Z9LA 4U6VH 5SWSD 1SM3L 2PTTA 4QOKA 4AENA 5C86A 3O4LB 1C5BL 5BCAA 1NAMH 1QFWH 4LCUB 1CVSC 5KVGH 3ZHKA 3G6DH 5EUKA 3QEUA 1AI1L 4LEXH 2VE6A 3VGFA 3L9RA 5C0NC 5HD8C 2ZNWA 2IFGA 1S8DB 3VXSE 3H7LA 1QLRB 4XZUB 5DFVD 2IBZY 5E99H 2PYFA 5T1MB 4Z7UF 3VDBA 4KJYB 4FQPA 4TNWK 5F21B 1RJYA 3ARED 5FECB 5L6YH 1KBGH 4JRXE 2XA3A 5J6HA 4TVPH 1R3HA 5TJWK 1NFIA 1JN6B 5E5UB 2JJSC 3MFFA 4PG2C 4ODUB 3I85A 4LVHC 1YPZA 3ARGB 4PP1C 1SYVB 4ZTPH 4M4PA 2BY3A 2FL5B 1EHLL 1K8DB 3QB7C 4FQXD 2R0KL 5GRVL 2H9GA 2ADIA 4DVBB 2X70B 1P6AB 1A6AB 4OZHE 5IFJB 2HTLD 4NOBA 3C08H 4M7ZB 1I75A 5DS8B 3V5HA 3VW3H 5D1XA 1U3HC 3RBSA 1I3GL 3MPCA 4GRLC 4ZFFB 5F6IC 2EYSB 3U9UA 1U93A 4FFZL 2GFBA 5DWUH 1KOAA 1IEAB 1G7IB 5I1LA 1A1NB 4BH7B 3P0YL 4ZUWA 1NMAL 4P23C 1MAKA 3F6LA 1M7DB 1QFOA 3O41A 2Q1EA 3V52L 1QSFA 2V9QA 4UTBH 1KC5H 2YPVH 1INDL 1C8PA 4ZSOB 1FZJB 4KXZI 1MFDH 3F12B 1DBAH 5I66B 3V6OA 1CL7I 5CBEB 2X7LB 1RURH 1WK0A 2EZ0D 4F8TA 2HTKC 1A21A 1NAKL 1LP9B 2EH7H 2RQ8A 1QR4A 2FATH 3U4EB 4JFDB 1MAMH 3DRTB 1AP2B 4W6XB 2AEQH 1XGQA 4IRSC 5E9DD 1AXSA 3R0NA 2BNUB 1FNGA 3HR6A 2NY6C 4U7MA 1NL0L 3X13B 4UQ3B 4HIXH 1MI5B 3T77B 2H2PD 5E7BA 3QHFL 1OAXH 2YA2A 4BZYA 2HT4C 2OJEB 1MWAB 2HH0L 2CMRL 4KZEL 3G6DL 4CADB 2VXUL 3T65A 1R0AH 4P2OA 1XIWA 4XC3L 3MYZA 1NAML 1A7OH 1SEBA 3BAEH 3H7BB 1RZKL 2BC4A 2CKBH 5F44A 4L3EB 1BZ7B 1UA6L 2ZUQB 2KZWA 4MWFB 2PXYD 5E2VL 1MHEB 4LVOB 4U1IA 3Q0HA 2BVQA 4L3ED 4KKLD 4YDKL 3VWKA 4H1LB 4NNPL 3UJJH 5CKAA 2GUOA 2B4CC 1IQDB 3ARZA 3CX5J 3FZUD 5DEFA 3FB6B 5A40E 1I4FB 4QXWA 2A9NH 1TTFA 1X5ZA 4D8PB 4NZRL 4EQ3A 5HGGS 1IGYA 2A83B 1AR1C 2UWEE 4HPOH 1CD9B 1OAZH 3MJ7B 4GXVH 5I1EH 3SQOL 3BP6A 4ODXA 1MY5A 5GGSB 4OM0L 2GHWB 2IANB 1JPGB 2JJVA 2Y5EA 3MV8E 4I3RL 2V2WB 3AMLA 2JE8A 5JIKA 1U3HB 3S8WA 4HH8A 3BPCA 2VABB 3QHTC 4XBEH 1ZA6B 1EHLH 3EDKA 2R0WL 1LEKA 4MNGB 3G6AA 1JHTB 1YC7A 4FQJH 4IRJD 4PV9A 3WN5A 5IHBA 2VUOA 2GJZB 4FZEH 1BVKA 3QZWG 4H0IA 4R7NA 1MY7A 4JRYD 4YHOH 1WBXA 1U3JA 4LCIL 3TT3L 4M48H 5I16B 4MDJB 3IT8D 3P40A 4DK3A 1TNNA 2PKDA 4JJ5A 4G8EB 1U8PB 1CICA 4P5TB 4OI9A 5GGRY 3REWB 1NDMB 2HRPH 4QRUA 1R5VA 2E27L 3D2UB 5JDSB 3BWAA 1HSAA 4X6CB 1QLEL 5IMOA 4PJGF 4HUMB 2JK5A 5C0CE 1HQ4A 5E5MB 2P45B 5ENWA 5LGJB 5F88B 3FRPA 4R26H 4PYGA 5C0CB 3UTZB 4PRIB 1UM4H 5AWNH 3MOAH 5J1AB 4FP8L 3VRIA 3Q1SL 3U0PB 4OI7A