2Q3IA

Crystal structure of the d10-p3/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein between the Coiled-Coil pocket of HIV GP41 an
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
molecule tags Viral protein/inhibitor
total genus 21
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2007-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q3iA00
2Q3IA 4GT1A 1HWTC 3MGNA 3A7OA 1FAVA 3NFQA 3B8EB 2JJLA 2WT7B 1HUCA 2P67A 2VRSA 2YNYA 3LIEA 1MV8A 2R5DA 5AVUB 5AW3B 5AW1B 4EOTA 3V4QA 1CSBA 5AW4B 3HTKA 3L37A 1GU5A 3V5BA 5AW2B 1GK4A 3KQGA 1H8AA 1GK6A 2KP8A 2ZFCA 3A2AA 4LC1A 2YO3A 3KDPB 2WPRA 4RESB 1CZQA 1HBWA 3M9HA 3P7KA 3M0DA 2R3CA 1YYCA 5APVA 2W6AA 4HYTB 3VMXA 2P7JA 1IO4A 2E42A 4AUWA 1H88A 2ZXEB 4I2LC 3VN0A 1JUNA 3I5CA 3TK1A 5AVRB 2WPQA 3SWFA 2YO2A 2BASA 3UIAA 1G2CB 5AW6B 5AW0B 2WWWA 2XU6A 3VYIA 3OAKA 3LIDA 5APSA 5AVZB 4C7NA 3NTNA 4I6MC 2Q7CA 3P32A 1MFZA 4C46A 4JYBA 1CI6A 1SLQA 4KHXA 2C9LY 5AW7B 1OXZA 3NMDA 5AVYB 2E43A 1OWAA 4C7NB 1J2JB 3MD0A 5AW9B 3A5TA 1T2KC 3VMYA 1NWQA 2W27A 3A3YB 3HE4A 2R32A 1JNMA 5CMZA 2IPPA 2XV5A 4XE5B 1S9KD 3VMZA 2Z5HA 1CI6B 1NAFA 5APWA 1S9KE 5AVTB 5APYA 3VTPC 2QM7A 4B86A 3O8ZA 2WTYA 1T2KD 1MUUA 1FOSF 1HJBA 3T97A 4AYCA 3V4WA 5AVXB 3HE4B 2XZRA 3L36A 3TNUA 2R5BA 5APXA 1SP4A 1H89A 2H7HA 5AVVB 2P2UA 3M06A 2Q5UA 2Z5IA 2N9BA 3HE5A 3IR9A 1FOSE 2C9NY 3M9BA 5APTA 1X8YA 1A02J 4JYCA 1A02F 1DH3A 4M3LA 5APUA 5APQA 1GZLA 4DZOA 5AW5B 2WPSA 3TNUB 3M91A 3M0AA 2WT7A 4GKGA 1GU4A 3TYYA 3NXSA 5AVSB 3P8MC 3HE5B 1KQLA 5AW8B 1GD2E 3L35A 1GTWA 5AVQB 5AVWB 2QM8A 4AQRD
chains in the Genus database with same CATH superfamily
1JY3P 1LP1A 3A7OA 1L0LE 2IX7C 2IDBA 1OW6A 1KB9I 2KK7A 2M3EA 1QL1A 1GK6A 2YKQA 2QA4P 2YO3A 1IK7A 1N2DC 3I56P 3TDKA 2NPSA 5KLIB 2MJZA 4U3FJ 1SQQD 2K9JB 1OVVA 2O1KA 4UB8H 1EZVG 4TT3H 3O6QB 2WWWA 1SQXE 3AE5C 1OX3A 4H0LB 4IFDK 4U3FG 4C46A 1BSHA 2BCCE 2XDJA 1LWUC 3AE8C 1KFMA 1S2EA 3MUDC 1N73A 4WVZA 1SQXD 2KB7P 4YXDC 1JO5A 5KJ7A 1JCDA 2JDIH 5B5EH 2BCCD 1MUUA 2WSCH 5H2FH 1MFTA 1EC5A 1USEA 1S1CX 3PP5A 1URQB 1H0TB 3V6IA 5APQA 1Q82Q 2FYUE 4DZOA 1W2BO 3BVHA 2FXOA 2LKMA 1KQLA 3C8VA 1WT6A 1HWTC 1FZCB 3RGUA 2JJLA 1KFNA 4N78E 2FYUD 1LTSC 3HRNA 4GOEA 2C0WA 2IZ0A 1UIIA 1X0TA 4JPZB 3KDPB 2WPRA 3MHVA 1M1JC 1NTKK 1IO4A 2E74D 1NTMD 2HPCA 1EZVE 1KD1Q 4N78D 2WPQA 3SWFA 1RE4A 1GW4A 2ZXXA 1RE3A 4U3FE 5AVZB 4C7NA 1L2PA 3JSVC 3R4YA 3G6EP 5B66E 1G1IA 2B9BA 1ZW0A 2N1TD 2FBWC 1RHZB 1NKZB 1KN7A 4U3FD 4JBZA 1AVOA 2Q9IA 2KSEA 2L91A 2K88A 2W83C 1K04A 1JY3N 3EQ2A 1W5CE 1H89A 1QLED 3GMAA 1SQVK 2WPVB 2G3AA 1QVFO 2I1JA 4L73A 1DH3A 1SFCD 1BCCD 3RK3E 1NU1J 1N7LA 2Y0EA 1KQFB 3B5ND 1EDLA 4RJTA 4GT1A 3S9OA 2HODB 1YITP 2QEXP 1NU1G 1ZN5A 3HTKA 2K9JA 1YJ9P 3HUSC 3PRJA 1VL2A 3O6QA 3M9HA 2R3CA 3L70J 1UIXA 3KPEA 3F89A 3D6ZA 4BWNA 1VQPP 3LW5J 3CC7P 4O9BA 3L70G 3H6PA 1NTZJ 3AEBC 1OXZA 1NO4A 2E43A 1OWAA 1LTIC 1JOCA 1GMJA 3AE9C 1M57D 1JY2O 3VOPA 4IOIH 1NTZG 2ZT9C 3VTPC 2IBZE 5KAIH 5DJTB 1LTBC 1URQA 1LWUB 1H0TA 1JB0J 2FYNC 5CCHA 4Y99C 1JY2N 5APXA 2PRRA 2JWAA 1FOSE 1A02J 1K8AQ 2NRGA 5GTHE 1RF0A 1FZCA 1MZ9A 4YTPC 2IBZD 1JM0A 3F5HA 1G1JA 4IFMA 2XNDH 3L4FA 1Q90D 3MP7B 1MV8A 1NU1E 2IBZI 2JR8A 5AVUB 2A45H 3L73J 5CJ0A 2ZVOB 3WUTA 1NH4A 4ZNCA 4W7YA 1H8AA 2MKVA 1IFJA 3P7KA 2KLVA 2ZXEB 3TGUJ 1N86A 3L73G 3AE6C 2GM4A 2E74B 2WQYC 5AW6B 3II6A 4Z1MH 5KKZB 2BEQD 3TGUG 1RH5B 2W8ZA 1M8OB 3CCQP 1FE6A 3FXEA 3QWOC 3C9IA 4CPGA 1IC2A 3AEFC 3C1LA 4L75A 1Y8AA 1NTZE 1PGPA 2W27A 1NOHA 2R32A 4W7ZA 2N1TB 1S9KD 3AE4C 2K1AA 5AVTB 3V2NA 3O8ZA 4PD4H 2LXCB 1LTGC 1KYOE 2W6BA 2PP6A 3H1KJ 1VPCA 2Q5UA 2QIWA 1NKNA 2OYIC 2JKVA 1X22A 5AW5B 3HD7C 2HODA 3H1LD 2E76C 1VQKP 2WSEH 3H1KG 1SFCB 1SQBD 2E5TA 2HYNA 3MGNA 1LT9B 3HD7D 2E76D 3B8EB 1M56D 4HJGH 4PJ0E 1QL2A 3CMAP 3B5NB 3GLMA 2CPBA 3RL0C 4R4MA 1NYHA 1KYOI 2H88C 3GHGC 1ZRTD 3L73E 1SQQJ 3RL0D 4HYTB 1FBMA 3VMXA 1AQ5A 3Q5SA 1Q86Q 1JUNA 5AVRB 1YQ4C 1VQMP 3USSA 2IYOA 2W6JH 2BASA 3G4SP 3GG2A 1EXIA 1Y47A 5AW0B 4DCKA 2HFED 3TGUE 1FDOA 1SQQG 5KAFH 1L0LK 1N7SC 3D70A 3Q5RA 2OYHC 3U59A 1EXJA 1LWUA 2BCCJ 3CCMP 4B86A 3A0HE 3R2PA 3G3ZA 3RBZA 3WUUA 1S5LH 2R5BA 2D2CC 2A06D 1MKMA 2HG5D 2Q6QA 1KMIZ 2D2CD 3H1KE 3IN6A 5GTIE 4GKGA 1VQ7P 3NXSA 4KJMA 5CJ4A 3Q3DA 4Y99B 2P1JA 1AQTA 3IFMA 1GTWA 1LTTC 3AEDC 4PV1C 1HJ0A 3BCCG 3KYQA 2FYUJ 3AE1C 3LIEA 2FFDB 4PV1D 2FKWB 1OZHA 1SQPD 1GU5A 4WB4A 3V5BA 2SPZA 3M0DC 1NTMJ 2FYUG 1HGVA 1VQ4P 2FXPA 1IFMA 1DEBA 3SFDC 2GUVA 1SQQE 2OYOA 2O1JA 1NTMG 3E1RA 3LIDA 1YIJP 3NTNA 3LW5H 4I6MC 3CI9A 3OA7A 1HTLC 2N1TA 2H43A 2C9LY 2HLOA 3A5TA 3CCRP 2QE7H 2Q1KA 1OVUA 5EFWB 1JMMA 2KYVA 2QVAA 4IL6H 2B89A 3TSIA 2IFNA 1YTZI 1NHLA 2YXQB 1PIXA 3QH9A 1KTMA 1NVOA 1OW7A 1FJKA 5AVVB 2P2UA 2Z5IA 3IR9A 4OH8B 1SFCA 2ZAEB 2V7QH 2RKLA 1BCCJ 4M3LA 3U1CA 1LT9A 3L72D 5TISE 2QRXA 3TNUB 3B5NA 3BCCE 5AVWB 5KLVD 1BCCG 2O01H 2YMKA 3CPWO 1HUCA 1QVGO 2R5DA 5AW1B 1YHQP 3HD7B 3SSUA 3SFEC 2ITAA 3BCCD 4H44C 1L0ND 4RESB 2OTKE 1LTJB 4AUWA 1H88A 2J58A 1S3JA 1PP9G 1JY2P 1NTME 3RL0B 4ZKPA 2WVRA 1X79B 3OAKA 1DX7A 3GHGB 4HKZH 2Q7CA 4EI2A 3CX5H 4KHXA 3BATA 5E79E 3CCSP 4H13C 1L4AC 1SS1A 2OYHB 1IFIA 2WTYA 2R3SA 4AYCA 4H13D 1L4AD 3WUVA 3VMAA 1HGZA 3GW6A 1KB9H 4QMAA 2YXRB 2RMZA 2WPSA 4XA4A 3M91A 2FFDA 4C7RA 3WU2H 1BCCE 2D2CB 1NJIQ 2IBZG 4NPDA 3H1JJ 1FAVA 1T3JA 3JCUE 3GF3A 1ZR2A 4NPEA 4PV1B 1ZR4A 3H1JG 1PP9E 5APVA 1WMKA 1AVYA 4I2LC 1BE3D 1IJDB 4WY4C 3H1ID 1G2CB 4W80A 1VQ8P 1KQGB 4WY4D 3ZDMA 2PGDA 1PP9D 4BRYB 1Q81Q 1NU1K 2I1KA 4PD4D 1SLQA 1KV4A 2M0BA 2WMMA 2XV5A 3VMZA 2WZ7A 5APWA 1P84D 3MZWB 4PD4I 1PPJD 3W68A 2L5GB 1VF5C 2Y9YA 3TNUA 4JF7A 2AEMA 1NTKD 5C39A 1VF5D 5APTA 1X8YA 1P84I 3H1LJ 3S1KA 2OQQA 2LR2A 3CWBG 1SQBJ 1HH0A 1GU4A 1KILC 3P8MC 3Q5PA 3HD7A 2ZYGA 1NTZK 2GUSA 4UB6E 2ZT9D 3H1LG 1KILD 1RE3C 2WT7B 1SQBG 1VDFA 1LTJA 1X9VA 1T8ZA 3CXHD 3H1JE 2KI7B 3L71D 4LC1A 4BXLA 2E75C 3H1HD 3I5CA 3CXHI 4JQ0D 1SQVD 1AA0A 3H1JD 2E75D 3KZIE 5APSA 4D6TE 2WSCJ 1QX8A 1JEKA 3RK2C 1FJPA 1R8EA 3FGAD 2OYHA 4K35A 4DJGA 3NMDA 1T3UA 3L75D 3RK2D 1OFCX 1FU1A 2IYPA 1FDIA 4MN4C 4D6TD 5B66H 2Y0CA 1S9KE 2E5YA 2QM7A 2ZVNB 1M1JB 3ABVC 1HJBA 2AEFA 4I1LA 1PFIA 1FZEA 2CPSA 3CWBE 3M9BA 2M5AB 4H13B 4DT0A 2A06G 3JC22 3H1LE 3JCUH 4I7ZC 1SQBE 2Q3IA 2RN0A 2YKOA 3V2RA 3CWBD 5BVZA 1SQPJ 2P67A 2PFXA 2VRSA 2O3JA 4UB8E 3SWKA 1NAYA 1G2CA 3BRVB 3M0DA 1SQPG 2W6AA 2P7JA 2K9YA 1ZRTE 1YJNP 4BRYA 1BDCA 1OIPA 4RKUJ 1VQ5P 1KZUB 2JEEA 4HH2A 2RH0A 4WWIA 3D6YA 1MFZA 4U7JA 2O01N 4JYBA 1U7MA 4WY4B 3ITKA 1RF0C 1FZCC 1J2JB 1D7MA 1ZV8A 5H2FE 2YIUC 3P8CD 2M3BA 2KUBA 1JTHB 3HUSB 1SQQK 2FY8A 4GIFA 1KC8Q 3AE3C 2KNCB 3B4SA 1HF9A 1ZP0C 3L72J 1N7SD 2C9NY 2A06E 3PH0A 1T6AA 3AE7C 2KZIA 3T97B 1S5LX 2POHA 3MUDA 2WT7A 1VF5B 4UB6H 3FX0A 5KLVJ 3HE5B 3FWNA 2OTJP 3L72G 2IFMA 5GTHH 1GW3A 1SQXK 2YNYA 4WBAA 3BCCJ 4EOTA 5KLVG 2ZT9B 1S72P 1L0NJ 1KILB 3L37A 1SQPE 2FYNB 4IFFA 1HBWA 1L0NG 2YO2A 1ZOYC 3KXDA 4DOJA 2Z4EA 3PJSK 1BGYD 2B88A 2FYUK 1IFPA 1Q2NA 1M1JA 5CHXA 2ZYDA 4ZMDA 1GDTA 1NGMB 1BSNA 3M9QA 4XE5B 1NAFA 3RK2B 1VQ6P 4OVNF 2M5AA 3SWYA 2CK3H 3EFFK 3RL0g 3TF5A 1NTMK 3G71P 3L74D 3HE4B 2FYZA 3OW2O 1SP4A 1TU3F 2WSFJ 4IL6X 2OGUA 2QJYC 1KYOH 3FWLA 3PHLA 3L72E 1RY3A 3PLNA 1GD2E 2A45G 5AVQB 1DIPA 1L0LD 2K3RA 3HTKB 5KLVE 1YQ3C 4GOFA 1DD4A 3V4QA 1VQ9P 2AXCA 2J59M 1GK4A 1BE3J 4I7ZB 2N9YB 3EWKA 4PJ0H 2OTLP 2E42A 1L0NE 1JMBA 3H1IJ 1RF1C 1BDDA 1OMIA 2XNXA 2OYIB 1PP9J 1BE3G 4WY4A 4R4LA 1RQUA 2E76B 4XFJA 2H89C 3H1IG 3OJAB 4GODA 1HVVA 5CCGC 4ASWA 1JTHA 5KAIE 3HUSA 3MTUE 5TJHA 1EDJA 2BEZF 4H44D 1WRGA 2Y9ZA 4NPFX 2QSIA 5CCGD 2KNCA 1EDIA 1CI6B 2WSEJ 5APYA 1J1DC 1LT1A 2KSJA 1FS0E 4EYYQ 1NTKJ 3T97A 1K05A 1XTGB 4KT0J 4LLHA 1PPJG 2YIUB 2N9BA 3HE5A 2J5UA 1ZMEC 2K37A 3A0HH 3AE2C 4L74A 1M1KQ 5APUA 1GZLA 2E74C 1NTKG 2WITA 1N7SB 5KKZC 1Y9BA 5AVSB 1GL2C 2I8DA 4A7PA 4EDFA 1KILA 4AQRD 2JWDA 1IFDA 3NFQA 1K9MQ 1GL2D 5GTIH 5AW3B 3U1AA 1AV1A 3L71J 2B87B 1FZGA 5AW4B 2N1TC 3GF7A 2NPSC 1LGHB 3H1HJ 2ZFCA 3H32B 3VP9A 4EIJA 1EZVD 3VN0A 1SQVJ 2QJKC 2NPSD 5CBOA 3L71G 1BE3E 2JP3A 2A45I 1JY3O 1PZQA 3UIAA 3H1HG 4RO0A 2PAJA 2AXTE 3IF4A 3H1IE 1EZVI 3IAOA 1SQVG 1FDMA 3L75J 1SFCC 4Y28J 1J1EC 4PD4E 1Z56A 1N73C 3CCJP 4D6TJ 1LT9C 2W90A 3MD0A 5KJ7C 3VMYA 2KIKA 3HE4A 2ZYAA 3B5NC 1RQVA 3L75G 2ZJSE 5KJ7D 1P84E 1FOSF 1PPJE 4D6TG 3FXDA 2XZRA 5AVXB 3RK3C 1KQSO 2M8RA 3M06A 1NTKE 4JYCA 2GA1A 3RK3D 2H8PD 1U7JA 1Q7YQ 2QM8A 3CWBJ 1YI2P 5TISH 1KILE 2QJPC 1IFNA 1VQOP 2QJYB 1CSBA 1FZBA 3CXHE 5KTBA 2OYIA 2KP8A 2KS1B 1CZQA 5KAFE 1YYCA 3L71E 3N4XA 1RE4C 2KXPB 3H1HE 2Q3EA 1DD3A 3CC2P 1IK9A 1FZAA 5BU8B 4OGQC 3VYIA 2KOGA 2G8YA 1SQVE 1YJWP 1SQBK 3P32A 1PGJA 1R5SA 4OGQD 3E7KA 3CCUP 1CI6A 1RF1B 1U57A 3GHGA 5AW7B 2V7QJ 5M1BA 5AW9B 1S5LE 1T2KC 5DJUB 1QGKB 1W2EA 4GDOA 2FFDC 3L75E 1OW8A 2Z5HA 1S4XA 1QEXA 4H44B 3B71A 1T2KD 2O01J 3AEGC 3L36A 4L76A 5E79H 3AECC 1N7SA 4ZKUA 3I55P 1E5WA 1A02F 2R44A 2WSFH 3CCEP 3PTZA 1J1DB 2OARA 1M90Q 3TYYA 3S4RA 4YXWH 3CCVP 3CMEP 3A0BE 3L35A 2B87A 3Q2YA 3G9RA 5KLIC 3WMM0 1NU1D 1PGQA 3H32A 1M7LA 1E79H 3L70E 1L4AB 3K5BA 3RBXA 1GL2B 2V4HA 4ASVA 1LP1B 3BASA 5AW2B 1DEEG 1EQ7A 3KQGA 3D71A 3A2AA 3KHUA 3MIWA 4H0LC 2WSSH 1VQLP 5L8RJ 1ZLLA 1JCCA 3CCLP 3TK1A 2AXTH 1KORA 2AEJA 3L70D 2Y0DA 3CLQA 4H0LD 1YBKA 1FZFA 2NPSB 1BGYJ 4OWFA 2LXBA 1AJYA 2QJKB 3AEEC 2FXMA 4IL6E 1N8RQ 3V2PA 1NTZD 3N7NA 5CBNA 1SQPK 1NWQA 1BGYG 3A3YB 1P84H 1JNMA 5CMZA 2IPPA 3L74J 3P8CE 4TLFA 1URQC 3Q1MA 5CCHC 1PGOA 1KYOD 2P10A 1CW5A 1J1EB 2UWJE 3V4WA 1N73B 1URQD 1LTJC 5B5EE 5CCHD 2H7HA 3L74G 1LNQA 3H25A 3CC4P 1L0LJ 1IZNB 3AEAC 2KLUA 1AFOA 3CD6P 3RK3B 2DW3A 3BRTB 1YTZT 1EDKA 2KS1A 3CXHH 1L0LG 1OVRA 1R5LA 2YKPA 2IZ1A 1LJ2A 3L73D 5K5GB 4HB1A 3CL3D 1SQXJ 3CX5E 1SVFA 2QJPB 2NZ2A 3TGUD 1RF1A 1FC2C 2XU6A 1VQNP 4N3YB 2HPCB 2KZJA 1SQXG 1PL5A 5KLVK 2XKMA 5BU5A 1USDA 1K73Q 1XTCC 3CX5D 2BCCG 1BGYE 1LTAC 5AVYB 4C7NB 5CCGA 3KZIH 4K3AA 4OGQB 3V2QA 1PV3A 3W67A 1L0NK 2JO1A 3EFGA 2HR3A 3CX5I 1KB9E 2E75B 3L74E 2P58A 2C0XA 2YMYA 3WU2E 4YPCA 4N6JA 3A0BH 3H1KD 3E1IA 4LGDE 3M0AA 1KB9D 5AW8B 1L4AA 1ZXGA 3VP8A 2QG4A 1GL2A
chains in the Genus database with same CATH topology
1JY3P 2HYNA 2GUSA 3MGNA 1IFDA 1LT9B 3A7OA 3HD7D 3NFQA 3B8EB 1KILD 2IX7C 1RE3C 1GL2D 1QL2A 2WT7B 1VDFA 1LTJA 1X9VA 3B5NB 5AW3B 2CPBA 3U1AA 3RL0C 1FZGA 1T8ZA 5AW4B 2N1TC 1QL1A 2NPSC 1LGHB 3GHGC 1GK6A 2YKQA 2ZFCA 3H32B 4LC1A 2YO3A 1N2DC 3RL0D 3VP9A 2NPSA 4EIJA 2MJZA 4HYTB 1FBMA 3VMXA 1AQ5A 3VN0A 1JUNA 3I5CA 2NPSD 5AVRB 2O1KA 2A45I 1JY3O 2BASA 3UIAA 2PAJA 5AW0B 2WWWA 2HFED 5APSA 4IFDK 1L0LK 1N7SC 4C46A 3RK2C 2OYHC 1FJPA 1FDMA 3U59A 2XDJA 1SFCC 1LWUC 1J1EC 2OYHA 1Z56A 1KFMA 3NMDA 1N73C 1LWUA 1LT9C 1T3UA 3MD0A 3RK2D 5KJ7C 3VMYA 1FU1A 3HE4A 1N73A 3B5NC 2KB7P 1JO5A 5KJ7A 1JCDA 1S9KE 2QM7A 4B86A 3R2PA 3G3ZA 5KJ7D 1MUUA 1FOSF 1M1JB 2WSCH 1HJBA 5AVXB 2XZRA 2R5BA 3RK3C 4I1LA 1PFIA 2M8RA 3M06A 1FZEA 2CPSA 2HG5D 3M9BA 4JYCA 3PP5A 1URQB 5APQA 3RK3D 4DZOA 2H8PD 3BVHA 4GKGA 3NXSA 5CJ4A 4Y99B 2LKMA 1KQLA 2P1JA 3IFMA 1GTWA 1LTTC 1WT6A 2Q3IA 3KYQA 1HWTC 1FZCB 2YKOA 3V2RA 2JJLA 5BVZA 2P67A 2VRSA 3LIEA 2FFDB 1IFNA 1KFNA 4N78E 1LTSC 3HRNA 2FKWB 2C0WA 1CSBA 1GU5A 4WB4A 1FZBA 3V5BA 3M0DC 5KTBA 2OYIA 2KP8A 1G2CA 3BRVB 3KDPB 2WPRA 1CZQA 3M0DA 1M1JC 1NTKK 1YYCA 2W6AA 3N4XA 1IO4A 2P7JA 1HGVA 1RE4C 2HPCA 1IFMA 1DEBA 4N78D 2WPQA 3SWFA 1RE4A 1IK9A 2GUVA 1FZAA 1KZUB 2O1JA 1GW4A 5BU8B 2JEEA 1RE3A 4HH2A 3VYIA 2KOGA 3LIDA 5AVZB 4C7NA 1SQBK 3NTNA 3LW5H 4I6MC 3P32A 1MFZA 3CI9A 3OA7A 1HTLC 2N1TA 2H43A 4JYBA 1G1IA 1CI6A 1RF1B 2C9LY 3GHGA 5AW7B 4WY4B 2N1TD 1NKZB 1RF0C 1FZCC 1J2JB 2HLOA 5AW9B 3A5TA 1ZV8A 1T2KC 1W2EA 2FFDC 3P8CD 2M3BA 2Z5HA 2Q9IA 1JTHB 3HUSB 1JMMA 2KYVA 1T2KD 3TSIA 2IFNA 1YTZI 1NHLA 1SQQK 1JY3N 3L36A 4GIFA 1N7SA 3EQ2A 1FJKA 4ZKUA 1H89A 5AVVB 2P2UA 2Z5IA 1SQVK 3IR9A 4OH8B 1SFCA 1N7SD 2C9NY 1E5WA 2I1JA 1A02F 1DH3A 4M3LA 2WSFH 1SFCD 3U1CA 1LT9A 1J1DB 2OARA 3TNUB 2POHA 3MUDA 2WT7A 3TYYA 3B5NA 3HE5B 3L35A 1N7LA 5AVWB 3B5ND 2IFMA 4GT1A 2O01H 3WMM0 1GW3A 1SQXK 3H32A 1M7LA 1HUCA 2YNYA 4WBAA 2HODB 2R5DA 1L4AB 5AW1B 4EOTA 3HD7B 1KILB 1ZN5A 3HTKA 3L37A 1GL2B 3BASA 5AW2B 1EQ7A 3KQGA 3HUSC 4IFFA 3A2AA 3MIWA 4RESB 1HBWA 3M9HA 1LTJB 2R3CA 1ZLLA 4AUWA 1JCCA 1H88A 2J58A 3TK1A 1JY2P 3KPEA 3RL0B 3CLQA 4ZKPA 2YO2A 1X79B 4DOJA 1FZFA 2NPSB 3OAKA 1DX7A 2Z4EA 3GHGB 4O9BA 2Q7CA 3H6PA 4KHXA 3BATA 2FXMA 1OXZA 1NO4A 3V2PA 2FYUK 2E43A 1OWAA 1LTIC 1M1JA 3N7NA 5CHXA 1JOCA 1GDTA 1SQPK 1NWQA 3A3YB 1JNMA 5CMZA 3M9QA 1JY2O 2IPPA 4XE5B 3VOPA 1L4AC 3P8CE 1NAFA 1URQC 3VTPC 3RK2B 5CCHC 2OYHB 1IFIA 2WTYA 3SWYA 1LTBC 1URQA 1LWUB 1NTMK 1CW5A 5CCHA 1J1EB 4AYCA 4Y99C 3V4WA 3HE4B 1L4AD 2FYZA 1N73B 1JY2N 1URQD 1LTJC 5APXA 1SP4A 5CCHD 2H7HA 1FOSE 1A02J 1HGZA 1RF0A 1FZCA 1MZ9A 2WPSA 4XA4A 3M91A 2FFDA 1AFOA 4C7RA 1RY3A 1GD2E 1G1JA 2A45G 5AVQB 3RK3B 4IFMA 1FAVA 3HTKB 3BRTB 1T3JA 1YTZT 3L4FA 1MV8A 5AVUB 2A45H 5CJ0A 3V4QA 1ZR2A 1NH4A 2J59M 4W7YA 2YKPA 1GK4A 1H8AA 1ZR4A 1IFJA 3P7KA 5APVA 2E42A 2KLVA 3CL3D 2ZXEB 4I2LC 1N86A 2GM4A 1RF1C 1SVFA 1IJDB 4WY4C 2XNXA 2OYIB 1RF1A 1G2CB 5AW6B 3II6A 4WY4A 2XU6A 4W80A 4N3YB 4WY4D 2HPCB 5KLVK 1NU1K 2I1KA 2XKMA 3OJAB 1HVVA 5BU5A 5CCGC 1SLQA 1JTHA 1XTCC 3HUSA 3MTUE 1LTAC 5AVYB 3C9IA 4C7NB 5CCGA 1IC2A 3V2QA 1WRGA 2W27A 1NOHA 2R32A 5CCGD 4W7ZA 2N1TB 2XV5A 1S9KD 3VMZA 1CI6B 1L0NK 2WZ7A 3EFGA 5APWA 5AVTB 5APYA 3V2NA 1J1DC 3O8ZA 2KSJA 2L5GB 3T97A 1XTGB 3TNUA 1LTGC 4LLHA 2W6BA 2C0XA 4JF7A 2YMYA 2PP6A 1VPCA 2Q5UA 2N9BA 3HE5A 5APTA 1X8YA 4N6JA 1NKNA 5APUA 2OYIC 1GZLA 3E1IA 1HH0A 5AW5B 4LGDE 3M0AA 2WITA 1N7SB 1GU4A 3HD7C 2HODA 1KILC 5AVSB 2WSEH 3P8MC 1GL2C 5AW8B 1L4AA 1SFCB 3HD7A 3VP8A 1NTZK 1KILA 2QM8A 4AQRD 1GL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3I A;  4GT1 A;  1HWT C;  3MGN A;  3A7O A;  1FAV A;  3NFQ A;  3B8E B;  2JJL A;  2WT7 B;  1HUC A;  2P67 A;  2VRS A;  2YNY A;  3LIE A;  1MV8 A;  2R5D A;  5AVU B;  5AW3 B;  5AW1 B;  4EOT A;  3V4Q A;  1CSB A;  5AW4 B;  3HTK A;  3L37 A;  1GU5 A;  3V5B A;  5AW2 B;  1GK4 A;  3KQG A;  1H8A A;  1GK6 A;  2KP8 A;  2ZFC A;  3A2A A;  4LC1 A;  2YO3 A;  3KDP B;  2WPR A;  4RES B;  1CZQ A;  1HBW A;  3M9H A;  3P7K A;  3M0D A;  2R3C A;  1YYC A;  5APV A;  2W6A A;  4HYT B;  3VMX A;  2P7J A;  1IO4 A;  2E42 A;  4AUW A;  1H88 A;  2ZXE B;  4I2L C;  3VN0 A;  1JUN A;  3I5C A;  3TK1 A;  5AVR B;  2WPQ A;  3SWF A;  2YO2 A;  2BAS A;  3UIA A;  1G2C B;  5AW6 B;  5AW0 B;  2WWW A;  2XU6 A;  3VYI A;  3OAK A;  3LID A;  5APS A;  5AVZ B;  4C7N A;  3NTN A;  4I6M C;  2Q7C A;  3P32 A;  1MFZ A;  4C46 A;  4JYB A;  1CI6 A;  1SLQ A;  4KHX A;  2C9L Y;  5AW7 B;  1OXZ A;  3NMD A;  5AVY B;  2E43 A;  1OWA A;  4C7N B;  1J2J B;  3MD0 A;  5AW9 B;  3A5T A;  1T2K C;  3VMY A;  1NWQ A;  2W27 A;  3A3Y B;  3HE4 A;  2R32 A;  1JNM A;  5CMZ A;  2IPP A;  2XV5 A;  4XE5 B;  1S9K D;  3VMZ A;  2Z5H A;  1CI6 B;  1NAF A;  5APW A;  1S9K E;  5AVT B;  5APY A;  3VTP C;  2QM7 A;  4B86 A;  3O8Z A;  2WTY A;  1T2K D;  1MUU A;  1FOS F;  1HJB A;  3T97 A;  4AYC A;  3V4W A;  5AVX B;  3HE4 B;  2XZR A;  3L36 A;  3TNU A;  2R5B A;  5APX A;  1SP4 A;  1H89 A;  2H7H A;  5AVV B;  2P2U A;  3M06 A;  2Q5U A;  2Z5I A;  2N9B A;  3HE5 A;  3IR9 A;  1FOS E;  2C9N Y;  3M9B A;  5APT A;  1X8Y A;  1A02 J;  4JYC A;  1A02 F;  1DH3 A;  4M3L A;  5APU A;  5APQ A;  1GZL A;  4DZO A;  5AW5 B;  2WPS A;  3TNU B;  3M91 A;  3M0A A;  2WT7 A;  4GKG A;  1GU4 A;  3TYY A;  3NXS A;  5AVS B;  3P8M C;  3HE5 B;  1KQL A;  5AW8 B;  1GD2 E;  3L35 A;  1GTW A;  5AVQ B;  5AVW B;  2QM8 A;  4AQR D; 
#chains in the Genus database with same CATH topology
 1JY3 P;  1LP1 A;  3A7O A;  1L0L E;  2IX7 C;  2IDB A;  1OW6 A;  1KB9 I;  2KK7 A;  2M3E A;  1QL1 A;  1GK6 A;  2YKQ A;  2QA4 P;  2YO3 A;  1IK7 A;  1N2D C;  3I56 P;  3TDK A;  2NPS A;  5KLI B;  2MJZ A;  4U3F J;  1SQQ D;  2K9J B;  1OVV A;  2O1K A;  4UB8 H;  1EZV G;  4TT3 H;  3O6Q B;  2WWW A;  1SQX E;  3AE5 C;  1OX3 A;  4H0L B;  4IFD K;  4U3F G;  4C46 A;  1BSH A;  2BCC E;  2XDJ A;  1LWU C;  3AE8 C;  1KFM A;  1S2E A;  3MUD C;  1N73 A;  4WVZ A;  1SQX D;  2KB7 P;  4YXD C;  1JO5 A;  5KJ7 A;  1JCD A;  2JDI H;  5B5E H;  2BCC D;  1MUU A;  2WSC H;  5H2F H;  1MFT A;  1EC5 A;  1USE A;  1S1C X;  3PP5 A;  1URQ B;  1H0T B;  3V6I A;  5APQ A;  1Q82 Q;  2FYU E;  4DZO A;  1W2B O;  3BVH A;  2FXO A;  2LKM A;  1KQL A;  3C8V A;  1WT6 A;  1HWT C;  1FZC B;  3RGU A;  2JJL A;  1KFN A;  4N78 E;  2FYU D;  1LTS C;  3HRN A;  4GOE A;  2C0W A;  2IZ0 A;  1UII A;  1X0T A;  4JPZ B;  3KDP B;  2WPR A;  3MHV A;  1M1J C;  1NTK K;  1IO4 A;  2E74 D;  1NTM D;  2HPC A;  1EZV E;  1KD1 Q;  4N78 D;  2WPQ A;  3SWF A;  1RE4 A;  1GW4 A;  2ZXX A;  1RE3 A;  4U3F E;  5AVZ B;  4C7N A;  1L2P A;  3JSV C;  3R4Y A;  3G6E P;  5B66 E;  1G1I A;  2B9B A;  1ZW0 A;  2N1T D;  2FBW C;  1RHZ B;  1NKZ B;  1KN7 A;  4U3F D;  4JBZ A;  1AVO A;  2Q9I A;  2KSE A;  2L91 A;  2K88 A;  2W83 C;  1K04 A;  1JY3 N;  3EQ2 A;  1W5C E;  1H89 A;  1QLE D;  3GMA A;  1SQV K;  2WPV B;  2G3A A;  1QVF O;  2I1J A;  4L73 A;  1DH3 A;  1SFC D;  1BCC D;  3RK3 E;  1NU1 J;  1N7L A;  2Y0E A;  1KQF B;  3B5N D;  1EDL A;  4RJT A;  4GT1 A;  3S9O A;  2HOD B;  1YIT P;  2QEX P;  1NU1 G;  1ZN5 A;  3HTK A;  2K9J A;  1YJ9 P;  3HUS C;  3PRJ A;  1VL2 A;  3O6Q A;  3M9H A;  2R3C A;  3L70 J;  1UIX A;  3KPE A;  3F89 A;  3D6Z A;  4BWN A;  1VQP P;  3LW5 J;  3CC7 P;  4O9B A;  3L70 G;  3H6P A;  1NTZ J;  3AEB C;  1OXZ A;  1NO4 A;  2E43 A;  1OWA A;  1LTI C;  1JOC A;  1GMJ A;  3AE9 C;  1M57 D;  1JY2 O;  3VOP A;  4IOI H;  1NTZ G;  2ZT9 C;  3VTP C;  2IBZ E;  5KAI H;  5DJT B;  1LTB C;  1URQ A;  1LWU B;  1H0T A;  1JB0 J;  2FYN C;  5CCH A;  4Y99 C;  1JY2 N;  5APX A;  2PRR A;  2JWA A;  1FOS E;  1A02 J;  1K8A Q;  2NRG A;  5GTH E;  1RF0 A;  1FZC A;  1MZ9 A;  4YTP C;  2IBZ D;  1JM0 A;  3F5H A;  1G1J A;  4IFM A;  2XND H;  3L4F A;  1Q90 D;  3MP7 B;  1MV8 A;  1NU1 E;  2IBZ I;  2JR8 A;  5AVU B;  2A45 H;  3L73 J;  5CJ0 A;  2ZVO B;  3WUT A;  1NH4 A;  4ZNC A;  4W7Y A;  1H8A A;  2MKV A;  1IFJ A;  3P7K A;  2KLV A;  2ZXE B;  3TGU J;  1N86 A;  3L73 G;  3AE6 C;  2GM4 A;  2E74 B;  2WQY C;  5AW6 B;  3II6 A;  4Z1M H;  5KKZ B;  2BEQ D;  3TGU G;  1RH5 B;  2W8Z A;  1M8O B;  3CCQ P;  1FE6 A;  3FXE A;  3QWO C;  3C9I A;  4CPG A;  1IC2 A;  3AEF C;  3C1L A;  4L75 A;  1Y8A A;  1NTZ E;  1PGP A;  2W27 A;  1NOH A;  2R32 A;  4W7Z A;  2N1T B;  1S9K D;  3AE4 C;  2K1A A;  5AVT B;  3V2N A;  3O8Z A;  4PD4 H;  2LXC B;  1LTG C;  1KYO E;  2W6B A;  2PP6 A;  3H1K J;  1VPC A;  2Q5U A;  2QIW A;  1NKN A;  2OYI C;  2JKV A;  1X22 A;  5AW5 B;  3HD7 C;  2HOD A;  3H1L D;  2E76 C;  1VQK P;  2WSE H;  3H1K G;  1SFC B;  1SQB D;  2E5T A;  2HYN A;  3MGN A;  1LT9 B;  3HD7 D;  2E76 D;  3B8E B;  1M56 D;  4HJG H;  4PJ0 E;  1QL2 A;  3CMA P;  3B5N B;  3GLM A;  2CPB A;  3RL0 C;  4R4M A;  1NYH A;  1KYO I;  2H88 C;  3GHG C;  1ZRT D;  3L73 E;  1SQQ J;  3RL0 D;  4HYT B;  1FBM A;  3VMX A;  1AQ5 A;  3Q5S A;  1Q86 Q;  1JUN A;  5AVR B;  1YQ4 C;  1VQM P;  3USS A;  2IYO A;  2W6J H;  2BAS A;  3G4S P;  3GG2 A;  1EXI A;  1Y47 A;  5AW0 B;  4DCK A;  2HFE D;  3TGU E;  1FDO A;  1SQQ G;  5KAF H;  1L0L K;  1N7S C;  3D70 A;  3Q5R A;  2OYH C;  3U59 A;  1EXJ A;  1LWU A;  2BCC J;  3CCM P;  4B86 A;  3A0H E;  3R2P A;  3G3Z A;  3RBZ A;  3WUU A;  1S5L H;  2R5B A;  2D2C C;  2A06 D;  1MKM A;  2HG5 D;  2Q6Q A;  1KMI Z;  2D2C D;  3H1K E;  3IN6 A;  5GTI E;  4GKG A;  1VQ7 P;  3NXS A;  4KJM A;  5CJ4 A;  3Q3D A;  4Y99 B;  2P1J A;  1AQT A;  3IFM A;  1GTW A;  1LTT C;  3AED C;  4PV1 C;  1HJ0 A;  3BCC G;  3KYQ A;  2FYU J;  3AE1 C;  3LIE A;  2FFD B;  4PV1 D;  2FKW B;  1OZH A;  1SQP D;  1GU5 A;  4WB4 A;  3V5B A;  2SPZ A;  3M0D C;  1NTM J;  2FYU G;  1HGV A;  1VQ4 P;  2FXP A;  1IFM A;  1DEB A;  3SFD C;  2GUV A;  1SQQ E;  2OYO A;  2O1J A;  1NTM G;  3E1R A;  3LID A;  1YIJ P;  3NTN A;  3LW5 H;  4I6M C;  3CI9 A;  3OA7 A;  1HTL C;  2N1T A;  2H43 A;  2C9L Y;  2HLO A;  3A5T A;  3CCR P;  2QE7 H;  2Q1K A;  1OVU A;  5EFW B;  1JMM A;  2KYV A;  2QVA A;  4IL6 H;  2B89 A;  3TSI A;  2IFN A;  1YTZ I;  1NHL A;  2YXQ B;  1PIX A;  3QH9 A;  1KTM A;  1NVO A;  1OW7 A;  1FJK A;  5AVV B;  2P2U A;  2Z5I A;  3IR9 A;  4OH8 B;  1SFC A;  2ZAE B;  2V7Q H;  2RKL A;  1BCC J;  4M3L A;  3U1C A;  1LT9 A;  3L72 D;  5TIS E;  2QRX A;  3TNU B;  3B5N A;  3BCC E;  5AVW B;  5KLV D;  1BCC G;  2O01 H;  2YMK A;  3CPW O;  1HUC A;  1QVG O;  2R5D A;  5AW1 B;  1YHQ P;  3HD7 B;  3SSU A;  3SFE C;  2ITA A;  3BCC D;  4H44 C;  1L0N D;  4RES B;  2OTK E;  1LTJ B;  4AUW A;  1H88 A;  2J58 A;  1S3J A;  1PP9 G;  1JY2 P;  1NTM E;  3RL0 B;  4ZKP A;  2WVR A;  1X79 B;  3OAK A;  1DX7 A;  3GHG B;  4HKZ H;  2Q7C A;  4EI2 A;  3CX5 H;  4KHX A;  3BAT A;  5E79 E;  3CCS P;  4H13 C;  1L4A C;  1SS1 A;  2OYH B;  1IFI A;  2WTY A;  2R3S A;  4AYC A;  4H13 D;  1L4A D;  3WUV A;  3VMA A;  1HGZ A;  3GW6 A;  1KB9 H;  4QMA A;  2YXR B;  2RMZ A;  2WPS A;  4XA4 A;  3M91 A;  2FFD A;  4C7R A;  3WU2 H;  1BCC E;  2D2C B;  1NJI Q;  2IBZ G;  4NPD A;  3H1J J;  1FAV A;  1T3J A;  3JCU E;  3GF3 A;  1ZR2 A;  4NPE A;  4PV1 B;  1ZR4 A;  3H1J G;  1PP9 E;  5APV A;  1WMK A;  1AVY A;  4I2L C;  1BE3 D;  1IJD B;  4WY4 C;  3H1I D;  1G2C B;  4W80 A;  1VQ8 P;  1KQG B;  4WY4 D;  3ZDM A;  2PGD A;  1PP9 D;  4BRY B;  1Q81 Q;  1NU1 K;  2I1K A;  4PD4 D;  1SLQ A;  1KV4 A;  2M0B A;  2WMM A;  2XV5 A;  3VMZ A;  2WZ7 A;  5APW A;  1P84 D;  3MZW B;  4PD4 I;  1PPJ D;  3W68 A;  2L5G B;  1VF5 C;  2Y9Y A;  3TNU A;  4JF7 A;  2AEM A;  1NTK D;  5C39 A;  1VF5 D;  5APT A;  1X8Y A;  1P84 I;  3H1L J;  3S1K A;  2OQQ A;  2LR2 A;  3CWB G;  1SQB J;  1HH0 A;  1GU4 A;  1KIL C;  3P8M C;  3Q5P A;  3HD7 A;  2ZYG A;  1NTZ K;  2GUS A;  4UB6 E;  2ZT9 D;  3H1L G;  1KIL D;  1RE3 C;  2WT7 B;  1SQB G;  1VDF A;  1LTJ A;  1X9V A;  1T8Z A;  3CXH D;  3H1J E;  2KI7 B;  3L71 D;  4LC1 A;  4BXL A;  2E75 C;  3H1H D;  3I5C A;  3CXH I;  4JQ0 D;  1SQV D;  1AA0 A;  3H1J D;  2E75 D;  3KZI E;  5APS A;  4D6T E;  2WSC J;  1QX8 A;  1JEK A;  3RK2 C;  1FJP A;  1R8E A;  3FGA D;  2OYH A;  4K35 A;  4DJG A;  3NMD A;  1T3U A;  3L75 D;  3RK2 D;  1OFC X;  1FU1 A;  2IYP A;  1FDI A;  4MN4 C;  4D6T D;  5B66 H;  2Y0C A;  1S9K E;  2E5Y A;  2QM7 A;  2ZVN B;  1M1J B;  3ABV C;  1HJB A;  2AEF A;  4I1L A;  1PFI A;  1FZE A;  2CPS A;  3CWB E;  3M9B A;  2M5A B;  4H13 B;  4DT0 A;  2A06 G;  3JC2 2;  3H1L E;  3JCU H;  4I7Z C;  1SQB E;  2Q3I A;  2RN0 A;  2YKO A;  3V2R A;  3CWB D;  5BVZ A;  1SQP J;  2P67 A;  2PFX A;  2VRS A;  2O3J A;  4UB8 E;  3SWK A;  1NAY A;  1G2C A;  3BRV B;  3M0D A;  1SQP G;  2W6A A;  2P7J A;  2K9Y A;  1ZRT E;  1YJN P;  4BRY A;  1BDC A;  1OIP A;  4RKU J;  1VQ5 P;  1KZU B;  2JEE A;  4HH2 A;  2RH0 A;  4WWI A;  3D6Y A;  1MFZ A;  4U7J A;  2O01 N;  4JYB A;  1U7M A;  4WY4 B;  3ITK A;  1RF0 C;  1FZC C;  1J2J B;  1D7M A;  1ZV8 A;  5H2F E;  2YIU C;  3P8C D;  2M3B A;  2KUB A;  1JTH B;  3HUS B;  1SQQ K;  2FY8 A;  4GIF A;  1KC8 Q;  3AE3 C;  2KNC B;  3B4S A;  1HF9 A;  1ZP0 C;  3L72 J;  1N7S D;  2C9N Y;  2A06 E;  3PH0 A;  1T6A A;  3AE7 C;  2KZI A;  3T97 B;  1S5L X;  2POH A;  3MUD A;  2WT7 A;  1VF5 B;  4UB6 H;  3FX0 A;  5KLV J;  3HE5 B;  3FWN A;  2OTJ P;  3L72 G;  2IFM A;  5GTH H;  1GW3 A;  1SQX K;  2YNY A;  4WBA A;  3BCC J;  4EOT A;  5KLV G;  2ZT9 B;  1S72 P;  1L0N J;  1KIL B;  3L37 A;  1SQP E;  2FYN B;  4IFF A;  1HBW A;  1L0N G;  2YO2 A;  1ZOY C;  3KXD A;  4DOJ A;  2Z4E A;  3PJS K;  1BGY D;  2B88 A;  2FYU K;  1IFP A;  1Q2N A;  1M1J A;  5CHX A;  2ZYD A;  4ZMD A;  1GDT A;  1NGM B;  1BSN A;  3M9Q A;  4XE5 B;  1NAF A;  3RK2 B;  1VQ6 P;  4OVN F;  2M5A A;  3SWY A;  2CK3 H;  3EFF K;  3RL0 g;  3TF5 A;  1NTM K;  3G71 P;  3L74 D;  3HE4 B;  2FYZ A;  3OW2 O;  1SP4 A;  1TU3 F;  2WSF J;  4IL6 X;  2OGU A;  2QJY C;  1KYO H;  3FWL A;  3PHL A;  3L72 E;  1RY3 A;  3PLN A;  1GD2 E;  2A45 G;  5AVQ B;  1DIP A;  1L0L D;  2K3R A;  3HTK B;  5KLV E;  1YQ3 C;  4GOF A;  1DD4 A;  3V4Q A;  1VQ9 P;  2AXC A;  2J59 M;  1GK4 A;  1BE3 J;  4I7Z B;  2N9Y B;  3EWK A;  4PJ0 H;  2OTL P;  2E42 A;  1L0N E;  1JMB A;  3H1I J;  1RF1 C;  1BDD A;  1OMI A;  2XNX A;  2OYI B;  1PP9 J;  1BE3 G;  4WY4 A;  4R4L A;  1RQU A;  2E76 B;  4XFJ A;  2H89 C;  3H1I G;  3OJA B;  4GOD A;  1HVV A;  5CCG C;  4ASW A;  1JTH A;  5KAI E;  3HUS A;  3MTU E;  5TJH A;  1EDJ A;  2BEZ F;  4H44 D;  1WRG A;  2Y9Z A;  4NPF X;  2QSI A;  5CCG D;  2KNC A;  1EDI A;  1CI6 B;  2WSE J;  5APY A;  1J1D C;  1LT1 A;  2KSJ A;  1FS0 E;  4EYY Q;  1NTK J;  3T97 A;  1K05 A;  1XTG B;  4KT0 J;  4LLH A;  1PPJ G;  2YIU B;  2N9B A;  3HE5 A;  2J5U A;  1ZME C;  2K37 A;  3A0H H;  3AE2 C;  4L74 A;  1M1K Q;  5APU A;  1GZL A;  2E74 C;  1NTK G;  2WIT A;  1N7S B;  5KKZ C;  1Y9B A;  5AVS B;  1GL2 C;  2I8D A;  4A7P A;  4EDF A;  1KIL A;  4AQR D;  2JWD A;  1IFD A;  3NFQ A;  1K9M Q;  1GL2 D;  5GTI H;  5AW3 B;  3U1A A;  1AV1 A;  3L71 J;  2B87 B;  1FZG A;  5AW4 B;  2N1T C;  3GF7 A;  2NPS C;  1LGH B;  3H1H J;  2ZFC A;  3H32 B;  3VP9 A;  4EIJ A;  1EZV D;  3VN0 A;  1SQV J;  2QJK C;  2NPS D;  5CBO A;  3L71 G;  1BE3 E;  2JP3 A;  2A45 I;  1JY3 O;  1PZQ A;  3UIA A;  3H1H G;  4RO0 A;  2PAJ A;  2AXT E;  3IF4 A;  3H1I E;  1EZV I;  3IAO A;  1SQV G;  1FDM A;  3L75 J;  1SFC C;  4Y28 J;  1J1E C;  4PD4 E;  1Z56 A;  1N73 C;  3CCJ P;  4D6T J;  1LT9 C;  2W90 A;  3MD0 A;  5KJ7 C;  3VMY A;  2KIK A;  3HE4 A;  2ZYA A;  3B5N C;  1RQV A;  3L75 G;  2ZJS E;  5KJ7 D;  1P84 E;  1FOS F;  1PPJ E;  4D6T G;  3FXD A;  2XZR A;  5AVX B;  3RK3 C;  1KQS O;  2M8R A;  3M06 A;  1NTK E;  4JYC A;  2GA1 A;  3RK3 D;  2H8P D;  1U7J A;  1Q7Y Q;  2QM8 A;  3CWB J;  1YI2 P;  5TIS H;  1KIL E;  2QJP C;  1IFN A;  1VQO P;  2QJY B;  1CSB A;  1FZB A;  3CXH E;  5KTB A;  2OYI A;  2KP8 A;  2KS1 B;  1CZQ A;  5KAF E;  1YYC A;  3L71 E;  3N4X A;  1RE4 C;  2KXP B;  3H1H E;  2Q3E A;  1DD3 A;  3CC2 P;  1IK9 A;  1FZA A;  5BU8 B;  4OGQ C;  3VYI A;  2KOG A;  2G8Y A;  1SQV E;  1YJW P;  1SQB K;  3P32 A;  1PGJ A;  1R5S A;  4OGQ D;  3E7K A;  3CCU P;  1CI6 A;  1RF1 B;  1U57 A;  3GHG A;  5AW7 B;  2V7Q J;  5M1B A;  5AW9 B;  1S5L E;  1T2K C;  5DJU B;  1QGK B;  1W2E A;  4GDO A;  2FFD C;  3L75 E;  1OW8 A;  2Z5H A;  1S4X A;  1QEX A;  4H44 B;  3B71 A;  1T2K D;  2O01 J;  3AEG C;  3L36 A;  4L76 A;  5E79 H;  3AEC C;  1N7S A;  4ZKU A;  3I55 P;  1E5W A;  1A02 F;  2R44 A;  2WSF H;  3CCE P;  3PTZ A;  1J1D B;  2OAR A;  1M90 Q;  3TYY A;  3S4R A;  4YXW H;  3CCV P;  3CME P;  3A0B E;  3L35 A;  2B87 A;  3Q2Y A;  3G9R A;  5KLI C;  3WMM 0;  1NU1 D;  1PGQ A;  3H32 A;  1M7L A;  1E79 H;  3L70 E;  1L4A B;  3K5B A;  3RBX A;  1GL2 B;  2V4H A;  4ASV A;  1LP1 B;  3BAS A;  5AW2 B;  1DEE G;  1EQ7 A;  3KQG A;  3D71 A;  3A2A A;  3KHU A;  3MIW A;  4H0L C;  2WSS H;  1VQL P;  5L8R J;  1ZLL A;  1JCC A;  3CCL P;  3TK1 A;  2AXT H;  1KOR A;  2AEJ A;  3L70 D;  2Y0D A;  3CLQ A;  4H0L D;  1YBK A;  1FZF A;  2NPS B;  1BGY J;  4OWF A;  2LXB A;  1AJY A;  2QJK B;  3AEE C;  2FXM A;  4IL6 E;  1N8R Q;  3V2P A;  1NTZ D;  3N7N A;  5CBN A;  1SQP K;  1NWQ A;  1BGY G;  3A3Y B;  1P84 H;  1JNM A;  5CMZ A;  2IPP A;  3L74 J;  3P8C E;  4TLF A;  1URQ C;  3Q1M A;  5CCH C;  1PGO A;  1KYO D;  2P10 A;  1CW5 A;  1J1E B;  2UWJ E;  3V4W A;  1N73 B;  1URQ D;  1LTJ C;  5B5E E;  5CCH D;  2H7H A;  3L74 G;  1LNQ A;  3H25 A;  3CC4 P;  1L0L J;  1IZN B;  3AEA C;  2KLU A;  1AFO A;  3CD6 P;  3RK3 B;  2DW3 A;  3BRT B;  1YTZ T;  1EDK A;  2KS1 A;  3CXH H;  1L0L G;  1OVR A;  1R5L A;  2YKP A;  2IZ1 A;  1LJ2 A;  3L73 D;  5K5G B;  4HB1 A;  3CL3 D;  1SQX J;  3CX5 E;  1SVF A;  2QJP B;  2NZ2 A;  3TGU D;  1RF1 A;  1FC2 C;  2XU6 A;  1VQN P;  4N3Y B;  2HPC B;  2KZJ A;  1SQX G;  1PL5 A;  5KLV K;  2XKM A;  5BU5 A;  1USD A;  1K73 Q;  1XTC C;  3CX5 D;  2BCC G;  1BGY E;  1LTA C;  5AVY B;  4C7N B;  5CCG A;  3KZI H;  4K3A A;  4OGQ B;  3V2Q A;  1PV3 A;  3W67 A;  1L0N K;  2JO1 A;  3EFG A;  2HR3 A;  3CX5 I;  1KB9 E;  2E75 B;  3L74 E;  2P58 A;  2C0X A;  2YMY A;  3WU2 E;  4YPC A;  4N6J A;  3A0B H;  3H1K D;  3E1I A;  4LGD E;  3M0A A;  1KB9 D;  5AW8 B;  1L4A A;  1ZXG A;  3VP8 A;  2QG4 A;  1GL2 A; 
#chains in the Genus database with same CATH homology
 1JY3 P;  2HYN A;  2GUS A;  3MGN A;  1IFD A;  1LT9 B;  3A7O A;  3HD7 D;  3NFQ A;  3B8E B;  1KIL D;  2IX7 C;  1RE3 C;  1GL2 D;  1QL2 A;  2WT7 B;  1VDF A;  1LTJ A;  1X9V A;  3B5N B;  5AW3 B;  2CPB A;  3U1A A;  3RL0 C;  1FZG A;  1T8Z A;  5AW4 B;  2N1T C;  1QL1 A;  2NPS C;  1LGH B;  3GHG C;  1GK6 A;  2YKQ A;  2ZFC A;  3H32 B;  4LC1 A;  2YO3 A;  1N2D C;  3RL0 D;  3VP9 A;  2NPS A;  4EIJ A;  2MJZ A;  4HYT B;  1FBM A;  3VMX A;  1AQ5 A;  3VN0 A;  1JUN A;  3I5C A;  2NPS D;  5AVR B;  2O1K A;  2A45 I;  1JY3 O;  2BAS A;  3UIA A;  2PAJ A;  5AW0 B;  2WWW A;  2HFE D;  5APS A;  4IFD K;  1L0L K;  1N7S C;  4C46 A;  3RK2 C;  2OYH C;  1FJP A;  1FDM A;  3U59 A;  2XDJ A;  1SFC C;  1LWU C;  1J1E C;  2OYH A;  1Z56 A;  1KFM A;  3NMD A;  1N73 C;  1LWU A;  1LT9 C;  1T3U A;  3MD0 A;  3RK2 D;  5KJ7 C;  3VMY A;  1FU1 A;  3HE4 A;  1N73 A;  3B5N C;  2KB7 P;  1JO5 A;  5KJ7 A;  1JCD A;  1S9K E;  2QM7 A;  4B86 A;  3R2P A;  3G3Z A;  5KJ7 D;  1MUU A;  1FOS F;  1M1J B;  2WSC H;  1HJB A;  5AVX B;  2XZR A;  2R5B A;  3RK3 C;  4I1L A;  1PFI A;  2M8R A;  3M06 A;  1FZE A;  2CPS A;  2HG5 D;  3M9B A;  4JYC A;  3PP5 A;  1URQ B;  5APQ A;  3RK3 D;  4DZO A;  2H8P D;  3BVH A;  4GKG A;  3NXS A;  5CJ4 A;  4Y99 B;  2LKM A;  1KQL A;  2P1J A;  3IFM A;  1GTW A;  1LTT C;  1WT6 A;  2Q3I A;  3KYQ A;  1HWT C;  1FZC B;  2YKO A;  3V2R A;  2JJL A;  5BVZ A;  2P67 A;  2VRS A;  3LIE A;  2FFD B;  1IFN A;  1KFN A;  4N78 E;  1LTS C;  3HRN A;  2FKW B;  2C0W A;  1CSB A;  1GU5 A;  4WB4 A;  1FZB A;  3V5B A;  3M0D C;  5KTB A;  2OYI A;  2KP8 A;  1G2C A;  3BRV B;  3KDP B;  2WPR A;  1CZQ A;  3M0D A;  1M1J C;  1NTK K;  1YYC A;  2W6A A;  3N4X A;  1IO4 A;  2P7J A;  1HGV A;  1RE4 C;  2HPC A;  1IFM A;  1DEB A;  4N78 D;  2WPQ A;  3SWF A;  1RE4 A;  1IK9 A;  2GUV A;  1FZA A;  1KZU B;  2O1J A;  1GW4 A;  5BU8 B;  2JEE A;  1RE3 A;  4HH2 A;  3VYI A;  2KOG A;  3LID A;  5AVZ B;  4C7N A;  1SQB K;  3NTN A;  3LW5 H;  4I6M C;  3P32 A;  1MFZ A;  3CI9 A;  3OA7 A;  1HTL C;  2N1T A;  2H43 A;  4JYB A;  1G1I A;  1CI6 A;  1RF1 B;  2C9L Y;  3GHG A;  5AW7 B;  4WY4 B;  2N1T D;  1NKZ B;  1RF0 C;  1FZC C;  1J2J B;  2HLO A;  5AW9 B;  3A5T A;  1ZV8 A;  1T2K C;  1W2E A;  2FFD C;  3P8C D;  2M3B A;  2Z5H A;  2Q9I A;  1JTH B;  3HUS B;  1JMM A;  2KYV A;  1T2K D;  3TSI A;  2IFN A;  1YTZ I;  1NHL A;  1SQQ K;  1JY3 N;  3L36 A;  4GIF A;  1N7S A;  3EQ2 A;  1FJK A;  4ZKU A;  1H89 A;  5AVV B;  2P2U A;  2Z5I A;  1SQV K;  3IR9 A;  4OH8 B;  1SFC A;  1N7S D;  2C9N Y;  1E5W A;  2I1J A;  1A02 F;  1DH3 A;  4M3L A;  2WSF H;  1SFC D;  3U1C A;  1LT9 A;  1J1D B;  2OAR A;  3TNU B;  2POH A;  3MUD A;  2WT7 A;  3TYY A;  3B5N A;  3HE5 B;  3L35 A;  1N7L A;  5AVW B;  3B5N D;  2IFM A;  4GT1 A;  2O01 H;  3WMM 0;  1GW3 A;  1SQX K;  3H32 A;  1M7L A;  1HUC A;  2YNY A;  4WBA A;  2HOD B;  2R5D A;  1L4A B;  5AW1 B;  4EOT A;  3HD7 B;  1KIL B;  1ZN5 A;  3HTK A;  3L37 A;  1GL2 B;  3BAS A;  5AW2 B;  1EQ7 A;  3KQG A;  3HUS C;  4IFF A;  3A2A A;  3MIW A;  4RES B;  1HBW A;  3M9H A;  1LTJ B;  2R3C A;  1ZLL A;  4AUW A;  1JCC A;  1H88 A;  2J58 A;  3TK1 A;  1JY2 P;  3KPE A;  3RL0 B;  3CLQ A;  4ZKP A;  2YO2 A;  1X79 B;  4DOJ A;  1FZF A;  2NPS B;  3OAK A;  1DX7 A;  2Z4E A;  3GHG B;  4O9B A;  2Q7C A;  3H6P A;  4KHX A;  3BAT A;  2FXM A;  1OXZ A;  1NO4 A;  3V2P A;  2FYU K;  2E43 A;  1OWA A;  1LTI C;  1M1J A;  3N7N A;  5CHX A;  1JOC A;  1GDT A;  1SQP K;  1NWQ A;  3A3Y B;  1JNM A;  5CMZ A;  3M9Q A;  1JY2 O;  2IPP A;  4XE5 B;  3VOP A;  1L4A C;  3P8C E;  1NAF A;  1URQ C;  3VTP C;  3RK2 B;  5CCH C;  2OYH B;  1IFI A;  2WTY A;  3SWY A;  1LTB C;  1URQ A;  1LWU B;  1NTM K;  1CW5 A;  5CCH A;  1J1E B;  4AYC A;  4Y99 C;  3V4W A;  3HE4 B;  1L4A D;  2FYZ A;  1N73 B;  1JY2 N;  1URQ D;  1LTJ C;  5APX A;  1SP4 A;  5CCH D;  2H7H A;  1FOS E;  1A02 J;  1HGZ A;  1RF0 A;  1FZC A;  1MZ9 A;  2WPS A;  4XA4 A;  3M91 A;  2FFD A;  1AFO A;  4C7R A;  1RY3 A;  1GD2 E;  1G1J A;  2A45 G;  5AVQ B;  3RK3 B;  4IFM A;  1FAV A;  3HTK B;  3BRT B;  1T3J A;  1YTZ T;  3L4F A;  1MV8 A;  5AVU B;  2A45 H;  5CJ0 A;  3V4Q A;  1ZR2 A;  1NH4 A;  2J59 M;  4W7Y A;  2YKP A;  1GK4 A;  1H8A A;  1ZR4 A;  1IFJ A;  3P7K A;  5APV A;  2E42 A;  2KLV A;  3CL3 D;  2ZXE B;  4I2L C;  1N86 A;  2GM4 A;  1RF1 C;  1SVF A;  1IJD B;  4WY4 C;  2XNX A;  2OYI B;  1RF1 A;  1G2C B;  5AW6 B;  3II6 A;  4WY4 A;  2XU6 A;  4W80 A;  4N3Y B;  4WY4 D;  2HPC B;  5KLV K;  1NU1 K;  2I1K A;  2XKM A;  3OJA B;  1HVV A;  5BU5 A;  5CCG C;  1SLQ A;  1JTH A;  1XTC C;  3HUS A;  3MTU E;  1LTA C;  5AVY B;  3C9I A;  4C7N B;  5CCG A;  1IC2 A;  3V2Q A;  1WRG A;  2W27 A;  1NOH A;  2R32 A;  5CCG D;  4W7Z A;  2N1T B;  2XV5 A;  1S9K D;  3VMZ A;  1CI6 B;  1L0N K;  2WZ7 A;  3EFG A;  5APW A;  5AVT B;  5APY A;  3V2N A;  1J1D C;  3O8Z A;  2KSJ A;  2L5G B;  3T97 A;  1XTG B;  3TNU A;  1LTG C;  4LLH A;  2W6B A;  2C0X A;  4JF7 A;  2YMY A;  2PP6 A;  1VPC A;  2Q5U A;  2N9B A;  3HE5 A;  5APT A;  1X8Y A;  4N6J A;  1NKN A;  5APU A;  2OYI C;  1GZL A;  3E1I A;  1HH0 A;  5AW5 B;  4LGD E;  3M0A A;  2WIT A;  1N7S B;  1GU4 A;  3HD7 C;  2HOD A;  1KIL C;  5AVS B;  2WSE H;  3P8M C;  1GL2 C;  5AW8 B;  1L4A A;  1SFC B;  3HD7 A;  3VP8 A;  1NTZ K;  1KIL A;  2QM8 A;  4AQR D;  1GL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...