2Q3VA

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at2g34160
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
93
Chain Sequence
KKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMAIATVVTVTEILKNNGFAVEKKIMTSIVDIKPVQKAKIEITLVKSEKFDELMAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Protein At2g34160
total genus 23
structure length 93
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01918 Alba Alba
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.20 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Alba-like domain 2q3vA00
1UDVA 1H0XA 2BKYX 1Y9XA 1NFJA 3TOEA 2EH1A 3WBMA 1H0YA 2A2YA 2Q3VA 2Z7CA 1NFHA 1NH9A 3IABA 3IABB 1VM0A 4Z9EA 2EK0A 2H9UA 3U6YA
chains in the Genus database with same CATH superfamily
4K86A 3ZIEA 4K88A 3TTCA 4YDQA 3ZIGA 2A2YA 4FBQA 4HVCA 3IABA 1RQ8A 4FBWA 3HZ7A 4EO0A 3DSCA 3DSDA 3TTDA 2H9UA 1VR4A 1JE3A 3ZIHA 1PAVA 1NJ5A 3TOEA 2L8YA 1H0YA 4YKEA 1NFHA 1NH9A 4WI1A 1JDQA 1XEZA 2GTCA 1LN4A 2LN3A 3TSUA 2Y1BA 2LXRA 1H4TA 1S8EA 4OLFA 4NCXA 1Y2IA 4NZTM 1H4QA 2P9BA 1H0XA 2BKYX 1Y9XA 1NJ2A 3VTHA 1DCJA 3WBMA 2IFEA 1II7A 2Q3VA 3VTIA 3LVKB 1NJ6A 3T1IA 3ZIIA 1NJ8A 4FBKA 4Z9EA 3TSPA 4NZRM 1H4SA 3U6YA 4TWAA 4FCXA 3IALA 1UDVA 1JO0A 4K87A 1NFJA 2EH1A 1NJ1A 4Q15A 2Z7CA 3LVJC 2M71A 3TTFA 3P04A 2CRQA 4HD0A 3IABB 1VM0A 3QKBA 2EK0A 3TSQA 1TIGA 1HC7A 4HVZA
chains in the Genus database with same CATH topology
1UDVA 1H0XA 2BKYX 1Y9XA 1NFJA 3TOEA 2EH1A 3WBMA 1H0YA 2A2YA 2Q3VA 2Z7CA 1NFHA 1NH9A 3IABA 3IABB 1VM0A 4Z9EA 2EK0A 2H9UA 3U6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDV A;  1H0X A;  2BKY X;  1Y9X A;  1NFJ A;  3TOE A;  2EH1 A;  3WBM A;  1H0Y A;  2A2Y A;  2Q3V A;  2Z7C A;  1NFH A;  1NH9 A;  3IAB A;  3IAB B;  1VM0 A;  4Z9E A;  2EK0 A;  2H9U A;  3U6Y A; 
#chains in the Genus database with same CATH topology
 4K86 A;  3ZIE A;  4K88 A;  3TTC A;  4YDQ A;  3ZIG A;  2A2Y A;  4FBQ A;  4HVC A;  3IAB A;  1RQ8 A;  4FBW A;  3HZ7 A;  4EO0 A;  3DSC A;  3DSD A;  3TTD A;  2H9U A;  1VR4 A;  1JE3 A;  3ZIH A;  1PAV A;  1NJ5 A;  3TOE A;  2L8Y A;  1H0Y A;  4YKE A;  1NFH A;  1NH9 A;  4WI1 A;  1JDQ A;  1XEZ A;  2GTC A;  1LN4 A;  2LN3 A;  3TSU A;  2Y1B A;  2LXR A;  1H4T A;  1S8E A;  4OLF A;  4NCX A;  1Y2I A;  4NZT M;  1H4Q A;  2P9B A;  1H0X A;  2BKY X;  1Y9X A;  1NJ2 A;  3VTH A;  1DCJ A;  3WBM A;  2IFE A;  1II7 A;  2Q3V A;  3VTI A;  3LVK B;  1NJ6 A;  3T1I A;  3ZII A;  1NJ8 A;  4FBK A;  4Z9E A;  3TSP A;  4NZR M;  1H4S A;  3U6Y A;  4TWA A;  4FCX A;  3IAL A;  1UDV A;  1JO0 A;  4K87 A;  1NFJ A;  2EH1 A;  1NJ1 A;  4Q15 A;  2Z7C A;  3LVJ C;  2M71 A;  3TTF A;  3P04 A;  2CRQ A;  4HD0 A;  3IAB B;  1VM0 A;  3QKB A;  2EK0 A;  3TSQ A;  1TIG A;  1HC7 A;  4HVZ A; 
#chains in the Genus database with same CATH homology
 1UDV A;  1H0X A;  2BKY X;  1Y9X A;  1NFJ A;  3TOE A;  2EH1 A;  3WBM A;  1H0Y A;  2A2Y A;  2Q3V A;  2Z7C A;  1NFH A;  1NH9 A;  3IAB A;  3IAB B;  1VM0 A;  4Z9E A;  2EK0 A;  2H9U A;  3U6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...