2Q42A

Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Putative hydroxyacylglutathione hydrolase 2
total genus 86
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q42A00
3ZQ4A 4RAMA 4D02A 2BMIA 2P1EA 5HH5A 2WRSA 2XF4A 4BZ3A 5HH4A 2VW8A 4Z7RA 5ACSA 3RPCA 2DKFA 4DILA 5LLDA 3QH8A 3I11A 2YNVB 4EXSA 4Z60A 2M5DA 1A7TA 1KR3A 5ACUA 3DH8A 1JJTA 5A5ZA 1QH3A 4F6ZA 3KNRA 5ACPA 4O98A 3X2YA 4D1TA 4HL2A 2HB9A 5AEBA 1YCFA 1Y44A 4UBQA 2OHJA 2QEDA 5FQAA 4D1WA 1P9EA 4C1HA 3PG4A 5HISA 4RM5A 4JO0A 3FAIA 1ZTCA 4YSLA 1L9YA 2GFKA 3Q6VA 4XWWA 5EW0A 4Z67A 5A0TA 1X8HA 5HH6A 2GFJA 1BVTA 4EY2A 3FCZA 4NQ5A 3I0VA 3ZNBA 5EV8A 5EV6A 2FU7A 4UWPB 5AXRA 1KO3A 1VGNA 5LCHA 3BK1A 4UWSB 1M2XA 1K07A 2H6AA 1X8GA 2BFKA 2WYMC 1BC2A 4ZNBA 4GYUA 3ESHA 2BC2A 2FK6A 3T9MA 4GYQA 4KEPA 4NQ2A 1BMCA 1YCHA 3AF5A 1QH5A 2FU8A 2BGAA 2QDTA 3X30A 3IDZA 3PY6A 4V0HA 2Y8BA 4LE6A 4AD9A 1YCGA 2AIOA 3WXCA 2NZEA 4P62A 1MQOA 3SW3A 2YNVA 5HIQA 2QJSA 5K4MA 2AZ4A 4J5HA 5EVBA 3I13A 4YSBA 2WYMA 5DPXA 4BP0A 5IQKA 3BK2A 4FSBA 4H0DA 2I7XA 1HLKA 2YNTA 4UA4A 1JT1A 2FU9A 4TZBA 5ACQA 3JXPA 2WHGA 3RKKA 2A7MA 3KL7A 1WRAA 3DHBA 3P2UA 2GMNA 5A0VA 4B87A 5EH9A 2I7TA 4XWTA 1DDKA 3SFPA 2BR6A 2M5CA 2FM6A 4C1GA 2BTNA 4Z5YA 2P18A 4ZEJA 4FR7A 4RBSA 2P97A 2I7VA 5AYAA 3AJ3A 4UWRB 5EWAA 2P4ZA 3DHCA 1VJNA 1XM8A 2Y8AA 4AX1B 3MD7A 2NZFA 4TYTA 4AX0B 5AHRA 5EVKA 3IEMA 3IE0A 4UWOB 2BFZA 3R2UA 4YSKA 5LCAA 3AF6A 2FU6A 4F6HA 4EYFA 4DIKA 4TZFA 2XR1A 4C1FA 1KO2A 2BG2A 5LSCA 2FHXB 3IE1A 4AWYB 2BG6A 4NQ4A 4D1UA 2Q9UA 2FHXA 4ZO3A 3I14A 2BG7A 5B1UA 5B15A 3X2XA 2Y87A 4D1VA 3ZWFA 4TZEA 3SBLA 5LE1A 3T3OA 2YNUA 2ZO4A 5A87A 2ZNBA 4C09A 4XUKA 5FQBA 4FEKA 3SRXA 4RL2A 2BFLA 3IE2A 3A4YA 2BG8A 5FQCA 4C1DA 2ZZIA 4EYLA 2NXAA 2BIBA 1WW1A 3IOGA 3TP9A 4HKYA 3RKJA 2YNWA 4PVOA 5K4KA 2CBNA 4Z6XA 1ZNBA 2R2DA 1DXKA 4GCWA 3BV6A 4RL0A 4NQ6A 3ZR9A 5EHTA 3VPEA 2OHHA 1XTOA 5ACVA 5K0WA 5ACTA 4UAMA 1ZKPA 5AXOA 2YCBA 3DHAA 3S0ZA 3H3EA 2E7YA 4PVTA 2GCUA 5K4NA 2BFZB 4AWZA 3PY5A 4EFZA 3VQZA 4ZO2A 4RAWA 3SD9A 3X2ZA 2ZWRA 5HIPA 4TZ9A 3I15A 3L6NA 4WD6A 1DD6A 2DOOA 5KILA 2Q0JA 2UYXA 5LM6A 4TYFA 2QINA 5LS3A 4CHLA 3F9OA 3IOFA 5B3RA 3BC2A 2WYLA 4EYBA 2QDSA 3IEKA 2YZ3A 3IELA 4J5FA 1E5DA 2GKLA 3G1PA 5AHOA 2BG8B 1JJEA 5ACXA 4U4LA 3T3NA 5KIKA 5ACRA 2OHIA 4KEQA 1A8TA 4EXYA 2Q42A 3ADRA 1VMEA 1WUOA 2NYPA 3LVZA 3KNSA 4C1EA 4HL1A 5HIOA 2Q0IA 1SMLA 3SPUA 5EVDA 5LMCA 1WUPA 5ACWA 4C1CA 5LCFA 4Z5ZA 1X8IA 2YNTB
chains in the Genus database with same CATH superfamily
3ZQ4A 4RAMA 4D02A 2BMIA 2P1EA 5HH5A 2WRSA 2XF4A 4BZ3A 5HH4A 2VW8A 4Z7RA 5ACSA 3RPCA 2DKFA 4DILA 5LLDA 3QH8A 3I11A 2YNVB 4EXSA 4Z60A 5AIJA 2M5DA 1A7TA 1KR3A 5ACUA 3DH8A 1JJTA 5A5ZA 1QH3A 4F6ZA 3KNRA 5ACPA 4O98A 3X2YA 4D1TA 4HL2A 2HB9A 5AEBA 1YCFA 1Y44A 4UBQA 2CFZA 2OHJA 2QEDA 5FQAA 4D1WA 1P9EA 4C1HA 3PG4A 5HISA 4RM5A 4JO0A 3FAIA 1ZTCA 4YSLA 1L9YA 2GFKA 3Q6VA 2CG2A 4XWWA 5EW0A 4Z67A 5A0TA 1X8HA 5HH6A 2GFJA 1BVTA 4EY2A 3FCZA 4NQ5A 4NURA 3I0VA 3ZNBA 5EV8A 5EV6A 2FU7A 4UWPB 5AXRA 1KO3A 1VGNA 5LCHA 3BK1A 4AXHA 4UWSB 1M2XA 1K07A 2H6AA 1X8GA 2BFKA 2WYMC 1BC2A 4ZNBA 4GYUA 3ESHA 2BC2A 2FK6A 3T9MA 4GYQA 4KEPA 4NQ2A 1BMCA 1YCHA 3AF5A 1QH5A 2FU8A 2BGAA 2QDTA 3X30A 3IDZA 3PY6A 4V0HA 2Y8BA 4LE6A 4AD9A 1YCGA 2AIOA 3WXCA 2NZEA 4P62A 1MQOA 3SW3A 2YNVA 5HIQA 2QJSA 5K4MA 2AZ4A 4J5HA 5EVBA 3I13A 4YSBA 2WYMA 5DPXA 4BP0A 5A23A 5IQKA 3BK2A 4FSBA 4H0DA 2I7XA 1HLKA 2YNTA 4UA4A 1JT1A 2FU9A 4TZBA 5ACQA 3JXPA 2WHGA 3RKKA 2A7MA 3KL7A 1WRAA 3DHBA 3P2UA 2GMNA 5A0VA 4B87A 5EH9A 2I7TA 4XWTA 1DDKA 3SFPA 2BR6A 2M5CA 2FM6A 4C1GA 2BTNA 4Z5YA 2P18A 5AJLA 2CFUA 4ZEJA 4FR7A 4RBSA 2P97A 2I7VA 5AYAA 3AJ3A 4UWRB 5EWAA 2P4ZA 3DHCA 1VJNA 1XM8A 2Y8AA 4AX1B 3MD7A 2NZFA 4TYTA 4AX0B 5AHRA 5EVKA 3IEMA 3IE0A 4UWOB 2BFZA 3R2UA 4YSKA 5LCAA 3AF6A 2FU6A 4F6HA 4EYFA 4DIKA 4TZFA 2XR1A 4C1FA 1KO2A 2BG2A 5LSCA 2FHXB 3IE1A 4AWYB 2BG6A 4NQ4A 4D1UA 2Q9UA 2FHXA 4ZO3A 3I14A 2BG7A 5B1UA 5B15A 3X2XA 2Y87A 4D1VA 3ZWFA 4TZEA 3SBLA 5LE1A 3T3OA 2YNUA 2ZO4A 4PDXA 5A87A 2ZNBA 4C09A 4XUKA 5FQBA 4FEKA 3SRXA 4RL2A 2BFLA 3IE2A 3A4YA 2BG8A 5FQCA 4C1DA 2ZZIA 4EYLA 2BIBA 1WW1A 2NXAA 3IOGA 3TP9A 4HKYA 3RKJA 2YNWA 4PVOA 5K4KA 2CBNA 4Z6XA 1ZNBA 2R2DA 1DXKA 2CG3A 4GCWA 3BV6A 4RL0A 4NQ6A 3ZR9A 5EHTA 3VPEA 2OHHA 1XTOA 5ACVA 5K0WA 5ACTA 4UAMA 1ZKPA 5AXOA 2YCBA 3DHAA 3S0ZA 3H3EA 2E7YA 4PVTA 2GCUA 5K4NA 2BFZB 4AWZA 3PY5A 4EFZA 3VQZA 2YHEA 4ZO2A 4RAWA 3SD9A 3X2ZA 2ZWRA 5HIPA 4TZ9A 3I15A 3L6NA 4WD6A 1DD6A 2DOOA 5KILA 2Q0JA 2UYXA 5LM6A 4TYFA 2QINA 5LS3A 4CHLA 3F9OA 3IOFA 5B3RA 3BC2A 2WYLA 4EYBA 2QDSA 3IEKA 2YZ3A 3IELA 4J5FA 1E5DA 2GKLA 3G1PA 5AHOA 2BG8B 1JJEA 5ACXA 4U4LA 3T3NA 5KIKA 5ACRA 2OHIA 4KEQA 1A8TA 4EXYA 2Q42A 3ADRA 1VMEA 1WUOA 2NYPA 3LVZA 3KNSA 4C1EA 4HL1A 5HIOA 2Q0IA 4AV7A 1SMLA 3SPUA 5EVDA 5LMCA 1WUPA 5ACWA 4C1CA 5LCFA 4Z5ZA 1X8IA 2YNTB
chains in the Genus database with same CATH topology
3ZQ4A 4RAMA 4D02A 2BMIA 2P1EA 5HH5A 2WRSA 2XF4A 4BZ3A 5HH4A 2VW8A 4Z7RA 5ACSA 3RPCA 2DKFA 4DILA 5LLDA 3QH8A 3I11A 2YNVB 4EXSA 4Z60A 2M5DA 1A7TA 1KR3A 5ACUA 3DH8A 1JJTA 5A5ZA 1QH3A 4F6ZA 3KNRA 5ACPA 4O98A 3X2YA 4D1TA 4HL2A 2HB9A 5AEBA 1YCFA 1Y44A 4UBQA 2OHJA 2QEDA 5FQAA 4D1WA 1P9EA 4C1HA 3PG4A 5HISA 4RM5A 4JO0A 3FAIA 1ZTCA 4YSLA 1L9YA 2GFKA 3Q6VA 4XWWA 5EW0A 4Z67A 5A0TA 1X8HA 5HH6A 2GFJA 1BVTA 4EY2A 3FCZA 4NQ5A 3I0VA 3ZNBA 5EV8A 5EV6A 2FU7A 4UWPB 5AXRA 1KO3A 1VGNA 5LCHA 3BK1A 4UWSB 1M2XA 1K07A 2H6AA 1X8GA 2BFKA 2WYMC 1BC2A 4ZNBA 4GYUA 3ESHA 2BC2A 2FK6A 3T9MA 4GYQA 4KEPA 4NQ2A 1BMCA 1YCHA 3AF5A 1QH5A 2FU8A 2BGAA 2QDTA 3X30A 3IDZA 3PY6A 4V0HA 2Y8BA 4LE6A 4AD9A 1YCGA 2AIOA 3WXCA 2NZEA 4P62A 1MQOA 3SW3A 2YNVA 5HIQA 2QJSA 5K4MA 2AZ4A 4J5HA 5EVBA 3I13A 4YSBA 2WYMA 5DPXA 4BP0A 5IQKA 3BK2A 4FSBA 4H0DA 2I7XA 1HLKA 2YNTA 4UA4A 1JT1A 2FU9A 4TZBA 5ACQA 3JXPA 2WHGA 3RKKA 2A7MA 3KL7A 1WRAA 3DHBA 3P2UA 2GMNA 5A0VA 4B87A 5EH9A 2I7TA 4XWTA 1DDKA 3SFPA 2BR6A 2M5CA 2FM6A 4C1GA 2BTNA 4Z5YA 2P18A 4ZEJA 4FR7A 4RBSA 2P97A 2I7VA 5AYAA 3AJ3A 4UWRB 5EWAA 2P4ZA 3DHCA 1VJNA 1XM8A 2Y8AA 4AX1B 3MD7A 2NZFA 4TYTA 4AX0B 5AHRA 5EVKA 3IEMA 3IE0A 4UWOB 2BFZA 3R2UA 4YSKA 5LCAA 3AF6A 2FU6A 4F6HA 4EYFA 4DIKA 4TZFA 2XR1A 4C1FA 1KO2A 2BG2A 5LSCA 2FHXB 3IE1A 4AWYB 2BG6A 4NQ4A 4D1UA 2Q9UA 2FHXA 4ZO3A 3I14A 2BG7A 5B1UA 5B15A 3X2XA 2Y87A 4D1VA 3ZWFA 4TZEA 3SBLA 5LE1A 3T3OA 2YNUA 2ZO4A 5A87A 2ZNBA 4C09A 4XUKA 5FQBA 4FEKA 3SRXA 4RL2A 2BFLA 3IE2A 3A4YA 2BG8A 5FQCA 4C1DA 2ZZIA 4EYLA 2NXAA 2BIBA 1WW1A 3IOGA 3TP9A 4HKYA 3RKJA 2YNWA 4PVOA 5K4KA 2CBNA 4Z6XA 1ZNBA 2R2DA 1DXKA 4GCWA 3BV6A 4RL0A 4NQ6A 3ZR9A 5EHTA 3VPEA 2OHHA 1XTOA 5ACVA 5K0WA 5ACTA 4UAMA 1ZKPA 5AXOA 2YCBA 3DHAA 3S0ZA 3H3EA 2E7YA 4PVTA 2GCUA 5K4NA 2BFZB 4AWZA 3PY5A 4EFZA 3VQZA 4ZO2A 4RAWA 3SD9A 3X2ZA 2ZWRA 5HIPA 4TZ9A 3I15A 3L6NA 4WD6A 1DD6A 2DOOA 5KILA 2Q0JA 2UYXA 5LM6A 4TYFA 2QINA 5LS3A 4CHLA 3F9OA 3IOFA 5B3RA 3BC2A 2WYLA 4EYBA 2QDSA 3IEKA 2YZ3A 3IELA 4J5FA 1E5DA 2GKLA 3G1PA 5AHOA 2BG8B 1JJEA 5ACXA 4U4LA 3T3NA 5KIKA 5ACRA 2OHIA 4KEQA 1A8TA 4EXYA 2Q42A 3ADRA 1VMEA 1WUOA 2NYPA 3LVZA 3KNSA 4C1EA 4HL1A 5HIOA 2Q0IA 1SMLA 3SPUA 5EVDA 5LMCA 1WUPA 5ACWA 4C1CA 5LCFA 4Z5ZA 1X8IA 2YNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ4 A;  4RAM A;  4D02 A;  2BMI A;  2P1E A;  5HH5 A;  2WRS A;  2XF4 A;  4BZ3 A;  5HH4 A;  2VW8 A;  4Z7R A;  5ACS A;  3RPC A;  2DKF A;  4DIL A;  5LLD A;  3QH8 A;  3I11 A;  2YNV B;  4EXS A;  4Z60 A;  2M5D A;  1A7T A;  1KR3 A;  5ACU A;  3DH8 A;  1JJT A;  5A5Z A;  1QH3 A;  4F6Z A;  3KNR A;  5ACP A;  4O98 A;  3X2Y A;  4D1T A;  4HL2 A;  2HB9 A;  5AEB A;  1YCF A;  1Y44 A;  4UBQ A;  2OHJ A;  2QED A;  5FQA A;  4D1W A;  1P9E A;  4C1H A;  3PG4 A;  5HIS A;  4RM5 A;  4JO0 A;  3FAI A;  1ZTC A;  4YSL A;  1L9Y A;  2GFK A;  3Q6V A;  4XWW A;  5EW0 A;  4Z67 A;  5A0T A;  1X8H A;  5HH6 A;  2GFJ A;  1BVT A;  4EY2 A;  3FCZ A;  4NQ5 A;  3I0V A;  3ZNB A;  5EV8 A;  5EV6 A;  2FU7 A;  4UWP B;  5AXR A;  1KO3 A;  1VGN A;  5LCH A;  3BK1 A;  4UWS B;  1M2X A;  1K07 A;  2H6A A;  1X8G A;  2BFK A;  2WYM C;  1BC2 A;  4ZNB A;  4GYU A;  3ESH A;  2BC2 A;  2FK6 A;  3T9M A;  4GYQ A;  4KEP A;  4NQ2 A;  1BMC A;  1YCH A;  3AF5 A;  1QH5 A;  2FU8 A;  2BGA A;  2QDT A;  3X30 A;  3IDZ A;  3PY6 A;  4V0H A;  2Y8B A;  4LE6 A;  4AD9 A;  1YCG A;  2AIO A;  3WXC A;  2NZE A;  4P62 A;  1MQO A;  3SW3 A;  2YNV A;  5HIQ A;  2QJS A;  5K4M A;  2AZ4 A;  4J5H A;  5EVB A;  3I13 A;  4YSB A;  2WYM A;  5DPX A;  4BP0 A;  5IQK A;  3BK2 A;  4FSB A;  4H0D A;  2I7X A;  1HLK A;  2YNT A;  4UA4 A;  1JT1 A;  2FU9 A;  4TZB A;  5ACQ A;  3JXP A;  2WHG A;  3RKK A;  2A7M A;  3KL7 A;  1WRA A;  3DHB A;  3P2U A;  2GMN A;  5A0V A;  4B87 A;  5EH9 A;  2I7T A;  4XWT A;  1DDK A;  3SFP A;  2BR6 A;  2M5C A;  2FM6 A;  4C1G A;  2BTN A;  4Z5Y A;  2P18 A;  4ZEJ A;  4FR7 A;  4RBS A;  2P97 A;  2I7V A;  5AYA A;  3AJ3 A;  4UWR B;  5EWA A;  2P4Z A;  3DHC A;  1VJN A;  1XM8 A;  2Y8A A;  4AX1 B;  3MD7 A;  2NZF A;  4TYT A;  4AX0 B;  5AHR A;  5EVK A;  3IEM A;  3IE0 A;  4UWO B;  2BFZ A;  3R2U A;  4YSK A;  5LCA A;  3AF6 A;  2FU6 A;  4F6H A;  4EYF A;  4DIK A;  4TZF A;  2XR1 A;  4C1F A;  1KO2 A;  2BG2 A;  5LSC A;  2FHX B;  3IE1 A;  4AWY B;  2BG6 A;  4NQ4 A;  4D1U A;  2Q9U A;  2FHX A;  4ZO3 A;  3I14 A;  2BG7 A;  5B1U A;  5B15 A;  3X2X A;  2Y87 A;  4D1V A;  3ZWF A;  4TZE A;  3SBL A;  5LE1 A;  3T3O A;  2YNU A;  2ZO4 A;  5A87 A;  2ZNB A;  4C09 A;  4XUK A;  5FQB A;  4FEK A;  3SRX A;  4RL2 A;  2BFL A;  3IE2 A;  3A4Y A;  2BG8 A;  5FQC A;  4C1D A;  2ZZI A;  4EYL A;  2NXA A;  2BIB A;  1WW1 A;  3IOG A;  3TP9 A;  4HKY A;  3RKJ A;  2YNW A;  4PVO A;  5K4K A;  2CBN A;  4Z6X A;  1ZNB A;  2R2D A;  1DXK A;  4GCW A;  3BV6 A;  4RL0 A;  4NQ6 A;  3ZR9 A;  5EHT A;  3VPE A;  2OHH A;  1XTO A;  5ACV A;  5K0W A;  5ACT A;  4UAM A;  1ZKP A;  5AXO A;  2YCB A;  3DHA A;  3S0Z A;  3H3E A;  2E7Y A;  4PVT A;  2GCU A;  5K4N A;  2BFZ B;  4AWZ A;  3PY5 A;  4EFZ A;  3VQZ A;  4ZO2 A;  4RAW A;  3SD9 A;  3X2Z A;  2ZWR A;  5HIP A;  4TZ9 A;  3I15 A;  3L6N A;  4WD6 A;  1DD6 A;  2DOO A;  5KIL A;  2Q0J A;  2UYX A;  5LM6 A;  4TYF A;  2QIN A;  5LS3 A;  4CHL A;  3F9O A;  3IOF A;  5B3R A;  3BC2 A;  2WYL A;  4EYB A;  2QDS A;  3IEK A;  2YZ3 A;  3IEL A;  4J5F A;  1E5D A;  2GKL A;  3G1P A;  5AHO A;  2BG8 B;  1JJE A;  5ACX A;  4U4L A;  3T3N A;  5KIK A;  5ACR A;  2OHI A;  4KEQ A;  1A8T A;  4EXY A;  2Q42 A;  3ADR A;  1VME A;  1WUO A;  2NYP A;  3LVZ A;  3KNS A;  4C1E A;  4HL1 A;  5HIO A;  2Q0I A;  1SML A;  3SPU A;  5EVD A;  5LMC A;  1WUP A;  5ACW A;  4C1C A;  5LCF A;  4Z5Z A;  1X8I A;  2YNT B; 
#chains in the Genus database with same CATH topology
 3ZQ4 A;  4RAM A;  4D02 A;  2BMI A;  2P1E A;  5HH5 A;  2WRS A;  2XF4 A;  4BZ3 A;  5HH4 A;  2VW8 A;  4Z7R A;  5ACS A;  3RPC A;  2DKF A;  4DIL A;  5LLD A;  3QH8 A;  3I11 A;  2YNV B;  4EXS A;  4Z60 A;  5AIJ A;  2M5D A;  1A7T A;  1KR3 A;  5ACU A;  3DH8 A;  1JJT A;  5A5Z A;  1QH3 A;  4F6Z A;  3KNR A;  5ACP A;  4O98 A;  3X2Y A;  4D1T A;  4HL2 A;  2HB9 A;  5AEB A;  1YCF A;  1Y44 A;  4UBQ A;  2CFZ A;  2OHJ A;  2QED A;  5FQA A;  4D1W A;  1P9E A;  4C1H A;  3PG4 A;  5HIS A;  4RM5 A;  4JO0 A;  3FAI A;  1ZTC A;  4YSL A;  1L9Y A;  2GFK A;  3Q6V A;  2CG2 A;  4XWW A;  5EW0 A;  4Z67 A;  5A0T A;  1X8H A;  5HH6 A;  2GFJ A;  1BVT A;  4EY2 A;  3FCZ A;  4NQ5 A;  4NUR A;  3I0V A;  3ZNB A;  5EV8 A;  5EV6 A;  2FU7 A;  4UWP B;  5AXR A;  1KO3 A;  1VGN A;  5LCH A;  3BK1 A;  4AXH A;  4UWS B;  1M2X A;  1K07 A;  2H6A A;  1X8G A;  2BFK A;  2WYM C;  1BC2 A;  4ZNB A;  4GYU A;  3ESH A;  2BC2 A;  2FK6 A;  3T9M A;  4GYQ A;  4KEP A;  4NQ2 A;  1BMC A;  1YCH A;  3AF5 A;  1QH5 A;  2FU8 A;  2BGA A;  2QDT A;  3X30 A;  3IDZ A;  3PY6 A;  4V0H A;  2Y8B A;  4LE6 A;  4AD9 A;  1YCG A;  2AIO A;  3WXC A;  2NZE A;  4P62 A;  1MQO A;  3SW3 A;  2YNV A;  5HIQ A;  2QJS A;  5K4M A;  2AZ4 A;  4J5H A;  5EVB A;  3I13 A;  4YSB A;  2WYM A;  5DPX A;  4BP0 A;  5A23 A;  5IQK A;  3BK2 A;  4FSB A;  4H0D A;  2I7X A;  1HLK A;  2YNT A;  4UA4 A;  1JT1 A;  2FU9 A;  4TZB A;  5ACQ A;  3JXP A;  2WHG A;  3RKK A;  2A7M A;  3KL7 A;  1WRA A;  3DHB A;  3P2U A;  2GMN A;  5A0V A;  4B87 A;  5EH9 A;  2I7T A;  4XWT A;  1DDK A;  3SFP A;  2BR6 A;  2M5C A;  2FM6 A;  4C1G A;  2BTN A;  4Z5Y A;  2P18 A;  5AJL A;  2CFU A;  4ZEJ A;  4FR7 A;  4RBS A;  2P97 A;  2I7V A;  5AYA A;  3AJ3 A;  4UWR B;  5EWA A;  2P4Z A;  3DHC A;  1VJN A;  1XM8 A;  2Y8A A;  4AX1 B;  3MD7 A;  2NZF A;  4TYT A;  4AX0 B;  5AHR A;  5EVK A;  3IEM A;  3IE0 A;  4UWO B;  2BFZ A;  3R2U A;  4YSK A;  5LCA A;  3AF6 A;  2FU6 A;  4F6H A;  4EYF A;  4DIK A;  4TZF A;  2XR1 A;  4C1F A;  1KO2 A;  2BG2 A;  5LSC A;  2FHX B;  3IE1 A;  4AWY B;  2BG6 A;  4NQ4 A;  4D1U A;  2Q9U A;  2FHX A;  4ZO3 A;  3I14 A;  2BG7 A;  5B1U A;  5B15 A;  3X2X A;  2Y87 A;  4D1V A;  3ZWF A;  4TZE A;  3SBL A;  5LE1 A;  3T3O A;  2YNU A;  2ZO4 A;  4PDX A;  5A87 A;  2ZNB A;  4C09 A;  4XUK A;  5FQB A;  4FEK A;  3SRX A;  4RL2 A;  2BFL A;  3IE2 A;  3A4Y A;  2BG8 A;  5FQC A;  4C1D A;  2ZZI A;  4EYL A;  2BIB A;  1WW1 A;  2NXA A;  3IOG A;  3TP9 A;  4HKY A;  3RKJ A;  2YNW A;  4PVO A;  5K4K A;  2CBN A;  4Z6X A;  1ZNB A;  2R2D A;  1DXK A;  2CG3 A;  4GCW A;  3BV6 A;  4RL0 A;  4NQ6 A;  3ZR9 A;  5EHT A;  3VPE A;  2OHH A;  1XTO A;  5ACV A;  5K0W A;  5ACT A;  4UAM A;  1ZKP A;  5AXO A;  2YCB A;  3DHA A;  3S0Z A;  3H3E A;  2E7Y A;  4PVT A;  2GCU A;  5K4N A;  2BFZ B;  4AWZ A;  3PY5 A;  4EFZ A;  3VQZ A;  2YHE A;  4ZO2 A;  4RAW A;  3SD9 A;  3X2Z A;  2ZWR A;  5HIP A;  4TZ9 A;  3I15 A;  3L6N A;  4WD6 A;  1DD6 A;  2DOO A;  5KIL A;  2Q0J A;  2UYX A;  5LM6 A;  4TYF A;  2QIN A;  5LS3 A;  4CHL A;  3F9O A;  3IOF A;  5B3R A;  3BC2 A;  2WYL A;  4EYB A;  2QDS A;  3IEK A;  2YZ3 A;  3IEL A;  4J5F A;  1E5D A;  2GKL A;  3G1P A;  5AHO A;  2BG8 B;  1JJE A;  5ACX A;  4U4L A;  3T3N A;  5KIK A;  5ACR A;  2OHI A;  4KEQ A;  1A8T A;  4EXY A;  2Q42 A;  3ADR A;  1VME A;  1WUO A;  2NYP A;  3LVZ A;  3KNS A;  4C1E A;  4HL1 A;  5HIO A;  2Q0I A;  4AV7 A;  1SML A;  3SPU A;  5EVD A;  5LMC A;  1WUP A;  5ACW A;  4C1C A;  5LCF A;  4Z5Z A;  1X8I A;  2YNT B; 
#chains in the Genus database with same CATH homology
 3ZQ4 A;  4RAM A;  4D02 A;  2BMI A;  2P1E A;  5HH5 A;  2WRS A;  2XF4 A;  4BZ3 A;  5HH4 A;  2VW8 A;  4Z7R A;  5ACS A;  3RPC A;  2DKF A;  4DIL A;  5LLD A;  3QH8 A;  3I11 A;  2YNV B;  4EXS A;  4Z60 A;  2M5D A;  1A7T A;  1KR3 A;  5ACU A;  3DH8 A;  1JJT A;  5A5Z A;  1QH3 A;  4F6Z A;  3KNR A;  5ACP A;  4O98 A;  3X2Y A;  4D1T A;  4HL2 A;  2HB9 A;  5AEB A;  1YCF A;  1Y44 A;  4UBQ A;  2OHJ A;  2QED A;  5FQA A;  4D1W A;  1P9E A;  4C1H A;  3PG4 A;  5HIS A;  4RM5 A;  4JO0 A;  3FAI A;  1ZTC A;  4YSL A;  1L9Y A;  2GFK A;  3Q6V A;  4XWW A;  5EW0 A;  4Z67 A;  5A0T A;  1X8H A;  5HH6 A;  2GFJ A;  1BVT A;  4EY2 A;  3FCZ A;  4NQ5 A;  3I0V A;  3ZNB A;  5EV8 A;  5EV6 A;  2FU7 A;  4UWP B;  5AXR A;  1KO3 A;  1VGN A;  5LCH A;  3BK1 A;  4UWS B;  1M2X A;  1K07 A;  2H6A A;  1X8G A;  2BFK A;  2WYM C;  1BC2 A;  4ZNB A;  4GYU A;  3ESH A;  2BC2 A;  2FK6 A;  3T9M A;  4GYQ A;  4KEP A;  4NQ2 A;  1BMC A;  1YCH A;  3AF5 A;  1QH5 A;  2FU8 A;  2BGA A;  2QDT A;  3X30 A;  3IDZ A;  3PY6 A;  4V0H A;  2Y8B A;  4LE6 A;  4AD9 A;  1YCG A;  2AIO A;  3WXC A;  2NZE A;  4P62 A;  1MQO A;  3SW3 A;  2YNV A;  5HIQ A;  2QJS A;  5K4M A;  2AZ4 A;  4J5H A;  5EVB A;  3I13 A;  4YSB A;  2WYM A;  5DPX A;  4BP0 A;  5IQK A;  3BK2 A;  4FSB A;  4H0D A;  2I7X A;  1HLK A;  2YNT A;  4UA4 A;  1JT1 A;  2FU9 A;  4TZB A;  5ACQ A;  3JXP A;  2WHG A;  3RKK A;  2A7M A;  3KL7 A;  1WRA A;  3DHB A;  3P2U A;  2GMN A;  5A0V A;  4B87 A;  5EH9 A;  2I7T A;  4XWT A;  1DDK A;  3SFP A;  2BR6 A;  2M5C A;  2FM6 A;  4C1G A;  2BTN A;  4Z5Y A;  2P18 A;  4ZEJ A;  4FR7 A;  4RBS A;  2P97 A;  2I7V A;  5AYA A;  3AJ3 A;  4UWR B;  5EWA A;  2P4Z A;  3DHC A;  1VJN A;  1XM8 A;  2Y8A A;  4AX1 B;  3MD7 A;  2NZF A;  4TYT A;  4AX0 B;  5AHR A;  5EVK A;  3IEM A;  3IE0 A;  4UWO B;  2BFZ A;  3R2U A;  4YSK A;  5LCA A;  3AF6 A;  2FU6 A;  4F6H A;  4EYF A;  4DIK A;  4TZF A;  2XR1 A;  4C1F A;  1KO2 A;  2BG2 A;  5LSC A;  2FHX B;  3IE1 A;  4AWY B;  2BG6 A;  4NQ4 A;  4D1U A;  2Q9U A;  2FHX A;  4ZO3 A;  3I14 A;  2BG7 A;  5B1U A;  5B15 A;  3X2X A;  2Y87 A;  4D1V A;  3ZWF A;  4TZE A;  3SBL A;  5LE1 A;  3T3O A;  2YNU A;  2ZO4 A;  5A87 A;  2ZNB A;  4C09 A;  4XUK A;  5FQB A;  4FEK A;  3SRX A;  4RL2 A;  2BFL A;  3IE2 A;  3A4Y A;  2BG8 A;  5FQC A;  4C1D A;  2ZZI A;  4EYL A;  2NXA A;  2BIB A;  1WW1 A;  3IOG A;  3TP9 A;  4HKY A;  3RKJ A;  2YNW A;  4PVO A;  5K4K A;  2CBN A;  4Z6X A;  1ZNB A;  2R2D A;  1DXK A;  4GCW A;  3BV6 A;  4RL0 A;  4NQ6 A;  3ZR9 A;  5EHT A;  3VPE A;  2OHH A;  1XTO A;  5ACV A;  5K0W A;  5ACT A;  4UAM A;  1ZKP A;  5AXO A;  2YCB A;  3DHA A;  3S0Z A;  3H3E A;  2E7Y A;  4PVT A;  2GCU A;  5K4N A;  2BFZ B;  4AWZ A;  3PY5 A;  4EFZ A;  3VQZ A;  4ZO2 A;  4RAW A;  3SD9 A;  3X2Z A;  2ZWR A;  5HIP A;  4TZ9 A;  3I15 A;  3L6N A;  4WD6 A;  1DD6 A;  2DOO A;  5KIL A;  2Q0J A;  2UYX A;  5LM6 A;  4TYF A;  2QIN A;  5LS3 A;  4CHL A;  3F9O A;  3IOF A;  5B3R A;  3BC2 A;  2WYL A;  4EYB A;  2QDS A;  3IEK A;  2YZ3 A;  3IEL A;  4J5F A;  1E5D A;  2GKL A;  3G1P A;  5AHO A;  2BG8 B;  1JJE A;  5ACX A;  4U4L A;  3T3N A;  5KIK A;  5ACR A;  2OHI A;  4KEQ A;  1A8T A;  4EXY A;  2Q42 A;  3ADR A;  1VME A;  1WUO A;  2NYP A;  3LVZ A;  3KNS A;  4C1E A;  4HL1 A;  5HIO A;  2Q0I A;  1SML A;  3SPU A;  5EVD A;  5LMC A;  1WUP A;  5ACW A;  4C1C A;  5LCF A;  4Z5Z A;  1X8I A;  2YNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...