2Q42A

Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Putative hydroxyacylglutathione hydrolase 2
total genus 86
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q42A00
2QDSA 2ZWRA 5ACSA 3T9MA 5DPXA 5ACRA 2FM6A 4D02A 4EYBA 3ESHA 4UWPB 2BFZB 4NQ6A 3BC2A 4C1DA 2YNVB 3IE0A 1ZTCA 4C1CA 2QINA 2BG6A 5B1UA 1YCGA 1JT1A 1WUPA 5AHRA 3BK1A 3PG4A 5EVKA 3BV6A 2WHGA 2BG2A 5EWAA 1YCHA 4RBSA 1JJEA 2ZO4A 2P1EA 5KILA 1KO3A 2BR6A 3RKKA 3A4YA 5FQBA 3WXCA 2OHIA 3SBLA 2AIOA 1KO2A 4B87A 5ACPA 2FU8A 2GFKA 4D1TA 5EW0A 4XUKA 5B3RA 4ZNBA 5KIKA 5B15A 1XM8A 5EV6A 5ACXA 4NQ2A 4XWTA 3KNRA 1QH5A 4FSBA 5LE1A 3G1PA 4TZBA 5A0VA 4Z6XA 2OHHA 5K4KA 1ZKPA 1L9YA 3ADRA 2YNTA 3IEKA 2Y8BA 4KEQA 1X8HA 2BFLA 2XF4A 2QJSA 1K07A 4D1WA 1KR3A 4RAWA 2FK6A 4PVTA 3SRXA 5ACWA 3IDZA 3T3OA 2WYMC 5LMCA 2WYLA 4TYTA 3RPCA 4UWSB 4YSKA 5FQAA 2GFJA 2M5DA 4AWZA 4Z7RA 2A7MA 2QDTA 5AXOA 3X2ZA 4Z60A 4HL1A 1WRAA 4UBQA 3FCZA 1HLKA 2BTNA 2Q0JA 4EXSA 2BFZA 2YNWA 2BMIA 4YSBA 1SMLA 5LS3A 4C1FA 1MQOA 2GCUA 4AWYB 4BZ3A 2Y87A 3VQZA 2WYMA 4TZ9A 5LSCA 1WUOA 2GKLA 5HIQA 3AF6A 2M5CA 4D1UA 2Q0IA 3F9OA 1DD6A 2YNUA 2DOOA 4EY2A 1A8TA 4XWWA 3ZWFA 4C1EA 5FQCA 5A87A 3X2XA 2I7XA 1E5DA 3X30A 1WW1A 1ZNBA 5LCHA 4P62A 4AD9A 2R2DA 3ZQ4A 4ZO3A 3RKJA 2P97A 4FR7A 1X8GA 2FU6A 3TP9A 2YNTB 2NXAA 5ACVA 3FAIA 2GMNA 4EYLA 4FEKA 5IQKA 5LLDA 4GCWA 1X8IA 1DXKA 3VPEA 3I0VA 1XTOA 2YCBA 5HH6A 2XR1A 3DH8A 2ZZIA 5HIOA 4WD6A 4DILA 5A5ZA 5EH9A 3I15A 4U4LA 5HISA 1M2XA 4RL0A 2BIBA 1JJTA 5A0TA 4D1VA 5LCAA 1P9EA 4C09A 2Q9UA 3LVZA 3P2UA 4RL2A 4ZO2A 3I11A 2BG8B 2ZNBA 2QEDA 1VMEA 4GYQA 2BGAA 4TZEA 2Y8AA 2Q42A 3IEMA 3KNSA 3I14A 1YCFA 4HKYA 1DDKA 4F6HA 2UYXA 4HL2A 4UA4A 3DHBA 1QH3A 3H3EA 5EHTA 4KEPA 2WRSA 4Z67A 2I7TA 4C1GA 2AZ4A 2FU7A 4NQ5A 3IE1A 2HB9A 4RM5A 4EYFA 5ACUA 3I13A 4TZFA 5EVDA 2P4ZA 5LM6A 2BFKA 3SD9A 3QH8A 2I7VA 4O98A 3AJ3A 4J5HA 1VJNA 2NZEA 3SPUA 3PY6A 4ZEJA 3AF5A 2FU9A 5ACQA 4RAMA 3IOGA 3L6NA 4F6ZA 4J5FA 4V0HA 4LE6A 4BP0A 3SFPA 4AX0B 1BVTA 3IE2A 5AHOA 5AXRA 2FHXA 3S0ZA 5EV8A 5LCFA 3ZR9A 4C1HA 2E7YA 5HH5A 2VW8A 3JXPA 2YZ3A 3X2YA 1Y44A 4H0DA 1A7TA 3DHCA 4GYUA 3IOFA 5K4MA 1BMCA 2H6AA 4CHLA 2OHJA 2YNVA 2BG8A 2P18A 4JO0A 4EFZA 3BK2A 2BG7A 5AEBA 3KL7A 4PVOA 4UWOB 1BC2A 5HH4A 3R2UA 4NQ4A 5K4NA 4AX1B 3DHAA 5HIPA 4DIKA 2BC2A 2NZFA 4Z5YA 4YSLA 4TYFA 5K0WA 3PY5A 3ZNBA 4UAMA 4EXYA 2FHXB 5EVBA 4Z5ZA 5AYAA 3Q6VA 2CBNA 2DKFA 3MD7A 2NYPA 1VGNA 3IELA 3SW3A 3T3NA 5ACTA 4UWRB
chains in the Genus database with same CATH superfamily
2QDSA 2ZWRA 5ACSA 3T9MA 5DPXA 5ACRA 2FM6A 4D02A 4EYBA 3ESHA 4UWPB 4AV7A 2BFZB 4NQ6A 3BC2A 4C1DA 2YNVB 3IE0A 1ZTCA 4C1CA 2QINA 2BG6A 5B1UA 1YCGA 1JT1A 1WUPA 5AHRA 3BK1A 3PG4A 5EVKA 3BV6A 2WHGA 2BG2A 5EWAA 1YCHA 4RBSA 1JJEA 2ZO4A 2P1EA 5KILA 1KO3A 5AJLA 2BR6A 3RKKA 3A4YA 5FQBA 3WXCA 2OHIA 3SBLA 2AIOA 1KO2A 4B87A 5ACPA 2FU8A 2GFKA 4D1TA 5EW0A 4XUKA 5B3RA 4ZNBA 5KIKA 5B15A 1XM8A 5EV6A 5ACXA 4NQ2A 4XWTA 3KNRA 1QH5A 4FSBA 5LE1A 3G1PA 4TZBA 5A0VA 4Z6XA 2OHHA 5K4KA 1ZKPA 1L9YA 3ADRA 5AIJA 2YNTA 3IEKA 4NURA 2Y8BA 4KEQA 1X8HA 2BFLA 2XF4A 2QJSA 1K07A 4D1WA 1KR3A 4RAWA 2FK6A 4PVTA 3SRXA 5ACWA 3IDZA 3T3OA 2WYMC 5LMCA 2WYLA 4TYTA 3RPCA 4UWSB 4YSKA 5FQAA 2GFJA 2M5DA 4AWZA 2YHEA 4Z7RA 2A7MA 2QDTA 5AXOA 3X2ZA 4Z60A 4HL1A 1WRAA 4UBQA 3FCZA 1HLKA 2BTNA 2Q0JA 4EXSA 2BFZA 2YNWA 2BMIA 4YSBA 1SMLA 5LS3A 4C1FA 1MQOA 2GCUA 4AWYB 4BZ3A 2Y87A 3VQZA 2WYMA 4TZ9A 5LSCA 1WUOA 2GKLA 5HIQA 3AF6A 2CG2A 2M5CA 4D1UA 2Q0IA 3F9OA 1DD6A 2YNUA 2DOOA 4EY2A 1A8TA 4XWWA 3ZWFA 4C1EA 5FQCA 5A87A 3X2XA 2I7XA 1E5DA 3X30A 1WW1A 1ZNBA 5LCHA 4P62A 4AD9A 2R2DA 3ZQ4A 4ZO3A 3RKJA 2CFUA 2P97A 4FR7A 1X8GA 2FU6A 3TP9A 2YNTB 2NXAA 5ACVA 3FAIA 2GMNA 4EYLA 4FEKA 5IQKA 5LLDA 4GCWA 1X8IA 2CFZA 1DXKA 3VPEA 3I0VA 1XTOA 2YCBA 5HH6A 2XR1A 3DH8A 2ZZIA 5HIOA 4WD6A 4DILA 5A5ZA 5EH9A 3I15A 4U4LA 5HISA 1M2XA 4RL0A 2BIBA 1JJTA 5A0TA 4D1VA 5LCAA 1P9EA 4C09A 2Q9UA 3LVZA 3P2UA 4RL2A 4ZO2A 3I11A 2BG8B 2ZNBA 2QEDA 1VMEA 4GYQA 2BGAA 4TZEA 5A23A 2Y8AA 2Q42A 3IEMA 3KNSA 3I14A 1YCFA 4HKYA 1DDKA 4F6HA 2UYXA 4HL2A 4UA4A 3DHBA 1QH3A 3H3EA 5EHTA 4KEPA 2WRSA 4Z67A 2I7TA 4C1GA 2AZ4A 2FU7A 4NQ5A 3IE1A 2HB9A 4RM5A 4EYFA 5ACUA 3I13A 4TZFA 5EVDA 2P4ZA 5LM6A 2BFKA 3SD9A 3QH8A 2I7VA 4O98A 3AJ3A 4J5HA 1VJNA 2NZEA 3SPUA 3PY6A 4PDXA 4ZEJA 3AF5A 2FU9A 5ACQA 4RAMA 3IOGA 3L6NA 4F6ZA 4J5FA 4V0HA 4LE6A 4BP0A 3SFPA 4AX0B 1BVTA 3IE2A 5AHOA 5AXRA 2FHXA 3S0ZA 2CG3A 5EV8A 5LCFA 3ZR9A 4C1HA 2E7YA 5HH5A 2VW8A 3JXPA 2YZ3A 3X2YA 1Y44A 4H0DA 1A7TA 3DHCA 4GYUA 3IOFA 5K4MA 1BMCA 2H6AA 4CHLA 2OHJA 2YNVA 2BG8A 2P18A 4JO0A 4EFZA 3BK2A 4AXHA 2BG7A 5AEBA 3KL7A 4PVOA 4UWOB 1BC2A 5HH4A 3R2UA 4NQ4A 5K4NA 4AX1B 3DHAA 5HIPA 4DIKA 2BC2A 2NZFA 4Z5YA 4YSLA 4TYFA 5K0WA 3PY5A 3ZNBA 4UAMA 4EXYA 2FHXB 5EVBA 4Z5ZA 5AYAA 3Q6VA 2CBNA 2DKFA 3MD7A 2NYPA 1VGNA 3IELA 3SW3A 3T3NA 5ACTA 4UWRB
chains in the Genus database with same CATH topology
2QDSA 2ZWRA 5ACSA 3T9MA 5DPXA 5ACRA 2FM6A 4D02A 4EYBA 3ESHA 4UWPB 2BFZB 4NQ6A 3BC2A 4C1DA 2YNVB 3IE0A 1ZTCA 4C1CA 2QINA 2BG6A 5B1UA 1YCGA 1JT1A 1WUPA 5AHRA 3BK1A 3PG4A 5EVKA 3BV6A 2WHGA 2BG2A 5EWAA 1YCHA 4RBSA 1JJEA 2ZO4A 2P1EA 5KILA 1KO3A 2BR6A 3RKKA 3A4YA 5FQBA 3WXCA 2OHIA 3SBLA 2AIOA 1KO2A 4B87A 5ACPA 2FU8A 2GFKA 4D1TA 5EW0A 4XUKA 5B3RA 4ZNBA 5KIKA 5B15A 1XM8A 5EV6A 5ACXA 4NQ2A 4XWTA 3KNRA 1QH5A 4FSBA 5LE1A 3G1PA 4TZBA 5A0VA 4Z6XA 2OHHA 5K4KA 1ZKPA 1L9YA 3ADRA 2YNTA 3IEKA 2Y8BA 4KEQA 1X8HA 2BFLA 2XF4A 2QJSA 1K07A 4D1WA 1KR3A 4RAWA 2FK6A 4PVTA 3SRXA 5ACWA 3IDZA 3T3OA 2WYMC 5LMCA 2WYLA 4TYTA 3RPCA 4UWSB 4YSKA 5FQAA 2GFJA 2M5DA 4AWZA 4Z7RA 2A7MA 2QDTA 5AXOA 3X2ZA 4Z60A 4HL1A 1WRAA 4UBQA 3FCZA 1HLKA 2BTNA 2Q0JA 4EXSA 2BFZA 2YNWA 2BMIA 4YSBA 1SMLA 5LS3A 4C1FA 1MQOA 2GCUA 4AWYB 4BZ3A 2Y87A 3VQZA 2WYMA 4TZ9A 5LSCA 1WUOA 2GKLA 5HIQA 3AF6A 2M5CA 4D1UA 2Q0IA 3F9OA 1DD6A 2YNUA 2DOOA 4EY2A 1A8TA 4XWWA 3ZWFA 4C1EA 5FQCA 5A87A 3X2XA 2I7XA 1E5DA 3X30A 1WW1A 1ZNBA 5LCHA 4P62A 4AD9A 2R2DA 3ZQ4A 4ZO3A 3RKJA 2P97A 4FR7A 1X8GA 2FU6A 3TP9A 2YNTB 2NXAA 5ACVA 3FAIA 2GMNA 4EYLA 4FEKA 5IQKA 5LLDA 4GCWA 1X8IA 1DXKA 3VPEA 3I0VA 1XTOA 2YCBA 5HH6A 2XR1A 3DH8A 2ZZIA 5HIOA 4WD6A 4DILA 5A5ZA 5EH9A 3I15A 4U4LA 5HISA 1M2XA 4RL0A 2BIBA 1JJTA 5A0TA 4D1VA 5LCAA 1P9EA 4C09A 2Q9UA 3LVZA 3P2UA 4RL2A 4ZO2A 3I11A 2BG8B 2ZNBA 2QEDA 1VMEA 4GYQA 2BGAA 4TZEA 2Y8AA 2Q42A 3IEMA 3KNSA 3I14A 1YCFA 4HKYA 1DDKA 4F6HA 2UYXA 4HL2A 4UA4A 3DHBA 1QH3A 3H3EA 5EHTA 4KEPA 2WRSA 4Z67A 2I7TA 4C1GA 2AZ4A 2FU7A 4NQ5A 3IE1A 2HB9A 4RM5A 4EYFA 5ACUA 3I13A 4TZFA 5EVDA 2P4ZA 5LM6A 2BFKA 3SD9A 3QH8A 2I7VA 4O98A 3AJ3A 4J5HA 1VJNA 2NZEA 3SPUA 3PY6A 4ZEJA 3AF5A 2FU9A 5ACQA 4RAMA 3IOGA 3L6NA 4F6ZA 4J5FA 4V0HA 4LE6A 4BP0A 3SFPA 4AX0B 1BVTA 3IE2A 5AHOA 5AXRA 2FHXA 3S0ZA 5EV8A 5LCFA 3ZR9A 4C1HA 2E7YA 5HH5A 2VW8A 3JXPA 2YZ3A 3X2YA 1Y44A 4H0DA 1A7TA 3DHCA 4GYUA 3IOFA 5K4MA 1BMCA 2H6AA 4CHLA 2OHJA 2YNVA 2BG8A 2P18A 4JO0A 4EFZA 3BK2A 2BG7A 5AEBA 3KL7A 4PVOA 4UWOB 1BC2A 5HH4A 3R2UA 4NQ4A 5K4NA 4AX1B 3DHAA 5HIPA 4DIKA 2BC2A 2NZFA 4Z5YA 4YSLA 4TYFA 5K0WA 3PY5A 3ZNBA 4UAMA 4EXYA 2FHXB 5EVBA 4Z5ZA 5AYAA 3Q6VA 2CBNA 2DKFA 3MD7A 2NYPA 1VGNA 3IELA 3SW3A 3T3NA 5ACTA 4UWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDS A;  2ZWR A;  5ACS A;  3T9M A;  5DPX A;  5ACR A;  2FM6 A;  4D02 A;  4EYB A;  3ESH A;  4UWP B;  2BFZ B;  4NQ6 A;  3BC2 A;  4C1D A;  2YNV B;  3IE0 A;  1ZTC A;  4C1C A;  2QIN A;  2BG6 A;  5B1U A;  1YCG A;  1JT1 A;  1WUP A;  5AHR A;  3BK1 A;  3PG4 A;  5EVK A;  3BV6 A;  2WHG A;  2BG2 A;  5EWA A;  1YCH A;  4RBS A;  1JJE A;  2ZO4 A;  2P1E A;  5KIL A;  1KO3 A;  2BR6 A;  3RKK A;  3A4Y A;  5FQB A;  3WXC A;  2OHI A;  3SBL A;  2AIO A;  1KO2 A;  4B87 A;  5ACP A;  2FU8 A;  2GFK A;  4D1T A;  5EW0 A;  4XUK A;  5B3R A;  4ZNB A;  5KIK A;  5B15 A;  1XM8 A;  5EV6 A;  5ACX A;  4NQ2 A;  4XWT A;  3KNR A;  1QH5 A;  4FSB A;  5LE1 A;  3G1P A;  4TZB A;  5A0V A;  4Z6X A;  2OHH A;  5K4K A;  1ZKP A;  1L9Y A;  3ADR A;  2YNT A;  3IEK A;  2Y8B A;  4KEQ A;  1X8H A;  2BFL A;  2XF4 A;  2QJS A;  1K07 A;  4D1W A;  1KR3 A;  4RAW A;  2FK6 A;  4PVT A;  3SRX A;  5ACW A;  3IDZ A;  3T3O A;  2WYM C;  5LMC A;  2WYL A;  4TYT A;  3RPC A;  4UWS B;  4YSK A;  5FQA A;  2GFJ A;  2M5D A;  4AWZ A;  4Z7R A;  2A7M A;  2QDT A;  5AXO A;  3X2Z A;  4Z60 A;  4HL1 A;  1WRA A;  4UBQ A;  3FCZ A;  1HLK A;  2BTN A;  2Q0J A;  4EXS A;  2BFZ A;  2YNW A;  2BMI A;  4YSB A;  1SML A;  5LS3 A;  4C1F A;  1MQO A;  2GCU A;  4AWY B;  4BZ3 A;  2Y87 A;  3VQZ A;  2WYM A;  4TZ9 A;  5LSC A;  1WUO A;  2GKL A;  5HIQ A;  3AF6 A;  2M5C A;  4D1U A;  2Q0I A;  3F9O A;  1DD6 A;  2YNU A;  2DOO A;  4EY2 A;  1A8T A;  4XWW A;  3ZWF A;  4C1E A;  5FQC A;  5A87 A;  3X2X A;  2I7X A;  1E5D A;  3X30 A;  1WW1 A;  1ZNB A;  5LCH A;  4P62 A;  4AD9 A;  2R2D A;  3ZQ4 A;  4ZO3 A;  3RKJ A;  2P97 A;  4FR7 A;  1X8G A;  2FU6 A;  3TP9 A;  2YNT B;  2NXA A;  5ACV A;  3FAI A;  2GMN A;  4EYL A;  4FEK A;  5IQK A;  5LLD A;  4GCW A;  1X8I A;  1DXK A;  3VPE A;  3I0V A;  1XTO A;  2YCB A;  5HH6 A;  2XR1 A;  3DH8 A;  2ZZI A;  5HIO A;  4WD6 A;  4DIL A;  5A5Z A;  5EH9 A;  3I15 A;  4U4L A;  5HIS A;  1M2X A;  4RL0 A;  2BIB A;  1JJT A;  5A0T A;  4D1V A;  5LCA A;  1P9E A;  4C09 A;  2Q9U A;  3LVZ A;  3P2U A;  4RL2 A;  4ZO2 A;  3I11 A;  2BG8 B;  2ZNB A;  2QED A;  1VME A;  4GYQ A;  2BGA A;  4TZE A;  2Y8A A;  2Q42 A;  3IEM A;  3KNS A;  3I14 A;  1YCF A;  4HKY A;  1DDK A;  4F6H A;  2UYX A;  4HL2 A;  4UA4 A;  3DHB A;  1QH3 A;  3H3E A;  5EHT A;  4KEP A;  2WRS A;  4Z67 A;  2I7T A;  4C1G A;  2AZ4 A;  2FU7 A;  4NQ5 A;  3IE1 A;  2HB9 A;  4RM5 A;  4EYF A;  5ACU A;  3I13 A;  4TZF A;  5EVD A;  2P4Z A;  5LM6 A;  2BFK A;  3SD9 A;  3QH8 A;  2I7V A;  4O98 A;  3AJ3 A;  4J5H A;  1VJN A;  2NZE A;  3SPU A;  3PY6 A;  4ZEJ A;  3AF5 A;  2FU9 A;  5ACQ A;  4RAM A;  3IOG A;  3L6N A;  4F6Z A;  4J5F A;  4V0H A;  4LE6 A;  4BP0 A;  3SFP A;  4AX0 B;  1BVT A;  3IE2 A;  5AHO A;  5AXR A;  2FHX A;  3S0Z A;  5EV8 A;  5LCF A;  3ZR9 A;  4C1H A;  2E7Y A;  5HH5 A;  2VW8 A;  3JXP A;  2YZ3 A;  3X2Y A;  1Y44 A;  4H0D A;  1A7T A;  3DHC A;  4GYU A;  3IOF A;  5K4M A;  1BMC A;  2H6A A;  4CHL A;  2OHJ A;  2YNV A;  2BG8 A;  2P18 A;  4JO0 A;  4EFZ A;  3BK2 A;  2BG7 A;  5AEB A;  3KL7 A;  4PVO A;  4UWO B;  1BC2 A;  5HH4 A;  3R2U A;  4NQ4 A;  5K4N A;  4AX1 B;  3DHA A;  5HIP A;  4DIK A;  2BC2 A;  2NZF A;  4Z5Y A;  4YSL A;  4TYF A;  5K0W A;  3PY5 A;  3ZNB A;  4UAM A;  4EXY A;  2FHX B;  5EVB A;  4Z5Z A;  5AYA A;  3Q6V A;  2CBN A;  2DKF A;  3MD7 A;  2NYP A;  1VGN A;  3IEL A;  3SW3 A;  3T3N A;  5ACT A;  4UWR B; 
#chains in the Genus database with same CATH topology
 2QDS A;  2ZWR A;  5ACS A;  3T9M A;  5DPX A;  5ACR A;  2FM6 A;  4D02 A;  4EYB A;  3ESH A;  4UWP B;  4AV7 A;  2BFZ B;  4NQ6 A;  3BC2 A;  4C1D A;  2YNV B;  3IE0 A;  1ZTC A;  4C1C A;  2QIN A;  2BG6 A;  5B1U A;  1YCG A;  1JT1 A;  1WUP A;  5AHR A;  3BK1 A;  3PG4 A;  5EVK A;  3BV6 A;  2WHG A;  2BG2 A;  5EWA A;  1YCH A;  4RBS A;  1JJE A;  2ZO4 A;  2P1E A;  5KIL A;  1KO3 A;  5AJL A;  2BR6 A;  3RKK A;  3A4Y A;  5FQB A;  3WXC A;  2OHI A;  3SBL A;  2AIO A;  1KO2 A;  4B87 A;  5ACP A;  2FU8 A;  2GFK A;  4D1T A;  5EW0 A;  4XUK A;  5B3R A;  4ZNB A;  5KIK A;  5B15 A;  1XM8 A;  5EV6 A;  5ACX A;  4NQ2 A;  4XWT A;  3KNR A;  1QH5 A;  4FSB A;  5LE1 A;  3G1P A;  4TZB A;  5A0V A;  4Z6X A;  2OHH A;  5K4K A;  1ZKP A;  1L9Y A;  3ADR A;  5AIJ A;  2YNT A;  3IEK A;  4NUR A;  2Y8B A;  4KEQ A;  1X8H A;  2BFL A;  2XF4 A;  2QJS A;  1K07 A;  4D1W A;  1KR3 A;  4RAW A;  2FK6 A;  4PVT A;  3SRX A;  5ACW A;  3IDZ A;  3T3O A;  2WYM C;  5LMC A;  2WYL A;  4TYT A;  3RPC A;  4UWS B;  4YSK A;  5FQA A;  2GFJ A;  2M5D A;  4AWZ A;  2YHE A;  4Z7R A;  2A7M A;  2QDT A;  5AXO A;  3X2Z A;  4Z60 A;  4HL1 A;  1WRA A;  4UBQ A;  3FCZ A;  1HLK A;  2BTN A;  2Q0J A;  4EXS A;  2BFZ A;  2YNW A;  2BMI A;  4YSB A;  1SML A;  5LS3 A;  4C1F A;  1MQO A;  2GCU A;  4AWY B;  4BZ3 A;  2Y87 A;  3VQZ A;  2WYM A;  4TZ9 A;  5LSC A;  1WUO A;  2GKL A;  5HIQ A;  3AF6 A;  2CG2 A;  2M5C A;  4D1U A;  2Q0I A;  3F9O A;  1DD6 A;  2YNU A;  2DOO A;  4EY2 A;  1A8T A;  4XWW A;  3ZWF A;  4C1E A;  5FQC A;  5A87 A;  3X2X A;  2I7X A;  1E5D A;  3X30 A;  1WW1 A;  1ZNB A;  5LCH A;  4P62 A;  4AD9 A;  2R2D A;  3ZQ4 A;  4ZO3 A;  3RKJ A;  2CFU A;  2P97 A;  4FR7 A;  1X8G A;  2FU6 A;  3TP9 A;  2YNT B;  2NXA A;  5ACV A;  3FAI A;  2GMN A;  4EYL A;  4FEK A;  5IQK A;  5LLD A;  4GCW A;  1X8I A;  2CFZ A;  1DXK A;  3VPE A;  3I0V A;  1XTO A;  2YCB A;  5HH6 A;  2XR1 A;  3DH8 A;  2ZZI A;  5HIO A;  4WD6 A;  4DIL A;  5A5Z A;  5EH9 A;  3I15 A;  4U4L A;  5HIS A;  1M2X A;  4RL0 A;  2BIB A;  1JJT A;  5A0T A;  4D1V A;  5LCA A;  1P9E A;  4C09 A;  2Q9U A;  3LVZ A;  3P2U A;  4RL2 A;  4ZO2 A;  3I11 A;  2BG8 B;  2ZNB A;  2QED A;  1VME A;  4GYQ A;  2BGA A;  4TZE A;  5A23 A;  2Y8A A;  2Q42 A;  3IEM A;  3KNS A;  3I14 A;  1YCF A;  4HKY A;  1DDK A;  4F6H A;  2UYX A;  4HL2 A;  4UA4 A;  3DHB A;  1QH3 A;  3H3E A;  5EHT A;  4KEP A;  2WRS A;  4Z67 A;  2I7T A;  4C1G A;  2AZ4 A;  2FU7 A;  4NQ5 A;  3IE1 A;  2HB9 A;  4RM5 A;  4EYF A;  5ACU A;  3I13 A;  4TZF A;  5EVD A;  2P4Z A;  5LM6 A;  2BFK A;  3SD9 A;  3QH8 A;  2I7V A;  4O98 A;  3AJ3 A;  4J5H A;  1VJN A;  2NZE A;  3SPU A;  3PY6 A;  4PDX A;  4ZEJ A;  3AF5 A;  2FU9 A;  5ACQ A;  4RAM A;  3IOG A;  3L6N A;  4F6Z A;  4J5F A;  4V0H A;  4LE6 A;  4BP0 A;  3SFP A;  4AX0 B;  1BVT A;  3IE2 A;  5AHO A;  5AXR A;  2FHX A;  3S0Z A;  2CG3 A;  5EV8 A;  5LCF A;  3ZR9 A;  4C1H A;  2E7Y A;  5HH5 A;  2VW8 A;  3JXP A;  2YZ3 A;  3X2Y A;  1Y44 A;  4H0D A;  1A7T A;  3DHC A;  4GYU A;  3IOF A;  5K4M A;  1BMC A;  2H6A A;  4CHL A;  2OHJ A;  2YNV A;  2BG8 A;  2P18 A;  4JO0 A;  4EFZ A;  3BK2 A;  4AXH A;  2BG7 A;  5AEB A;  3KL7 A;  4PVO A;  4UWO B;  1BC2 A;  5HH4 A;  3R2U A;  4NQ4 A;  5K4N A;  4AX1 B;  3DHA A;  5HIP A;  4DIK A;  2BC2 A;  2NZF A;  4Z5Y A;  4YSL A;  4TYF A;  5K0W A;  3PY5 A;  3ZNB A;  4UAM A;  4EXY A;  2FHX B;  5EVB A;  4Z5Z A;  5AYA A;  3Q6V A;  2CBN A;  2DKF A;  3MD7 A;  2NYP A;  1VGN A;  3IEL A;  3SW3 A;  3T3N A;  5ACT A;  4UWR B; 
#chains in the Genus database with same CATH homology
 2QDS A;  2ZWR A;  5ACS A;  3T9M A;  5DPX A;  5ACR A;  2FM6 A;  4D02 A;  4EYB A;  3ESH A;  4UWP B;  2BFZ B;  4NQ6 A;  3BC2 A;  4C1D A;  2YNV B;  3IE0 A;  1ZTC A;  4C1C A;  2QIN A;  2BG6 A;  5B1U A;  1YCG A;  1JT1 A;  1WUP A;  5AHR A;  3BK1 A;  3PG4 A;  5EVK A;  3BV6 A;  2WHG A;  2BG2 A;  5EWA A;  1YCH A;  4RBS A;  1JJE A;  2ZO4 A;  2P1E A;  5KIL A;  1KO3 A;  2BR6 A;  3RKK A;  3A4Y A;  5FQB A;  3WXC A;  2OHI A;  3SBL A;  2AIO A;  1KO2 A;  4B87 A;  5ACP A;  2FU8 A;  2GFK A;  4D1T A;  5EW0 A;  4XUK A;  5B3R A;  4ZNB A;  5KIK A;  5B15 A;  1XM8 A;  5EV6 A;  5ACX A;  4NQ2 A;  4XWT A;  3KNR A;  1QH5 A;  4FSB A;  5LE1 A;  3G1P A;  4TZB A;  5A0V A;  4Z6X A;  2OHH A;  5K4K A;  1ZKP A;  1L9Y A;  3ADR A;  2YNT A;  3IEK A;  2Y8B A;  4KEQ A;  1X8H A;  2BFL A;  2XF4 A;  2QJS A;  1K07 A;  4D1W A;  1KR3 A;  4RAW A;  2FK6 A;  4PVT A;  3SRX A;  5ACW A;  3IDZ A;  3T3O A;  2WYM C;  5LMC A;  2WYL A;  4TYT A;  3RPC A;  4UWS B;  4YSK A;  5FQA A;  2GFJ A;  2M5D A;  4AWZ A;  4Z7R A;  2A7M A;  2QDT A;  5AXO A;  3X2Z A;  4Z60 A;  4HL1 A;  1WRA A;  4UBQ A;  3FCZ A;  1HLK A;  2BTN A;  2Q0J A;  4EXS A;  2BFZ A;  2YNW A;  2BMI A;  4YSB A;  1SML A;  5LS3 A;  4C1F A;  1MQO A;  2GCU A;  4AWY B;  4BZ3 A;  2Y87 A;  3VQZ A;  2WYM A;  4TZ9 A;  5LSC A;  1WUO A;  2GKL A;  5HIQ A;  3AF6 A;  2M5C A;  4D1U A;  2Q0I A;  3F9O A;  1DD6 A;  2YNU A;  2DOO A;  4EY2 A;  1A8T A;  4XWW A;  3ZWF A;  4C1E A;  5FQC A;  5A87 A;  3X2X A;  2I7X A;  1E5D A;  3X30 A;  1WW1 A;  1ZNB A;  5LCH A;  4P62 A;  4AD9 A;  2R2D A;  3ZQ4 A;  4ZO3 A;  3RKJ A;  2P97 A;  4FR7 A;  1X8G A;  2FU6 A;  3TP9 A;  2YNT B;  2NXA A;  5ACV A;  3FAI A;  2GMN A;  4EYL A;  4FEK A;  5IQK A;  5LLD A;  4GCW A;  1X8I A;  1DXK A;  3VPE A;  3I0V A;  1XTO A;  2YCB A;  5HH6 A;  2XR1 A;  3DH8 A;  2ZZI A;  5HIO A;  4WD6 A;  4DIL A;  5A5Z A;  5EH9 A;  3I15 A;  4U4L A;  5HIS A;  1M2X A;  4RL0 A;  2BIB A;  1JJT A;  5A0T A;  4D1V A;  5LCA A;  1P9E A;  4C09 A;  2Q9U A;  3LVZ A;  3P2U A;  4RL2 A;  4ZO2 A;  3I11 A;  2BG8 B;  2ZNB A;  2QED A;  1VME A;  4GYQ A;  2BGA A;  4TZE A;  2Y8A A;  2Q42 A;  3IEM A;  3KNS A;  3I14 A;  1YCF A;  4HKY A;  1DDK A;  4F6H A;  2UYX A;  4HL2 A;  4UA4 A;  3DHB A;  1QH3 A;  3H3E A;  5EHT A;  4KEP A;  2WRS A;  4Z67 A;  2I7T A;  4C1G A;  2AZ4 A;  2FU7 A;  4NQ5 A;  3IE1 A;  2HB9 A;  4RM5 A;  4EYF A;  5ACU A;  3I13 A;  4TZF A;  5EVD A;  2P4Z A;  5LM6 A;  2BFK A;  3SD9 A;  3QH8 A;  2I7V A;  4O98 A;  3AJ3 A;  4J5H A;  1VJN A;  2NZE A;  3SPU A;  3PY6 A;  4ZEJ A;  3AF5 A;  2FU9 A;  5ACQ A;  4RAM A;  3IOG A;  3L6N A;  4F6Z A;  4J5F A;  4V0H A;  4LE6 A;  4BP0 A;  3SFP A;  4AX0 B;  1BVT A;  3IE2 A;  5AHO A;  5AXR A;  2FHX A;  3S0Z A;  5EV8 A;  5LCF A;  3ZR9 A;  4C1H A;  2E7Y A;  5HH5 A;  2VW8 A;  3JXP A;  2YZ3 A;  3X2Y A;  1Y44 A;  4H0D A;  1A7T A;  3DHC A;  4GYU A;  3IOF A;  5K4M A;  1BMC A;  2H6A A;  4CHL A;  2OHJ A;  2YNV A;  2BG8 A;  2P18 A;  4JO0 A;  4EFZ A;  3BK2 A;  2BG7 A;  5AEB A;  3KL7 A;  4PVO A;  4UWO B;  1BC2 A;  5HH4 A;  3R2U A;  4NQ4 A;  5K4N A;  4AX1 B;  3DHA A;  5HIP A;  4DIK A;  2BC2 A;  2NZF A;  4Z5Y A;  4YSL A;  4TYF A;  5K0W A;  3PY5 A;  3ZNB A;  4UAM A;  4EXY A;  2FHX B;  5EVB A;  4Z5Z A;  5AYA A;  3Q6V A;  2CBN A;  2DKF A;  3MD7 A;  2NYP A;  1VGN A;  3IEL A;  3SW3 A;  3T3N A;  5ACT A;  4UWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...