2Q42A

Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydroxyacylglutathione hydrolase 2
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 86
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q42A00
2GCUA 4H0DA 5LSCA 2BGAA 4RL2A 3PG4A 4LE6A 2OHIA 1JJEA 1VGNA 1WUPA 1YCFA 3T3OA 2M5CA 2CBNA 3RKJA 4D1VA 4B87A 5HH5A 2BMIA 5ACWA 4AD9A 1JT1A 4DILA 5ACTA 4FSBA 2H6AA 5K4KA 4UWOB 2DKFA 2Y87A 2WYLA 1QH3A 2Q0IA 1QH5A 3BK1A 4D02A 4XWWA 5ACUA 2Y8AA 1A8TA 4UAMA 5EWAA 3I14A 4U4LA 2WYMA 2NYPA 1ZTCA 2FU6A 3ZR9A 2BC2A 2FU7A 1VJNA 3G1PA 1JJTA 3X2XA 1M2XA 5AYAA 4PVOA 4TZ9A 2BTNA 4CHLA 4EXSA 4C1GA 2GMNA 2BFZB 5ACSA 2BG7A 3KNRA 3T9MA 2FHXA 3IEMA 3P2UA 4GCWA 3AF5A 4Z5ZA 3FAIA 5EV8A 5ACQA 4UWRB 3KNSA 4XUKA 3SBLA 5AHRA 5A0VA 2YNVA 2YNUA 2HB9A 5EVBA 3SPUA 4V0HA 4AX0B 5HH4A 1SMLA 5AXRA 2QJSA 4C1CA 4TZBA 3SRXA 2AZ4A 5LM6A 3PY6A 5ACRA 4D1TA 4P62A 5EHTA 3H3EA 2FU9A 1MQOA 5K4NA 2UYXA 3KL7A 4ZO3A 4FEKA 3X2ZA 3IOGA 5B15A 3AF6A 4C1HA 5ACVA 2BG8A 1L9YA 2BFLA 5AEBA 3BV6A 4F6HA 3SD9A 1XM8A 3DHBA 4XWTA 1DXKA 3AJ3A 1A7TA 4C09A 3X2YA 1X8GA 2XR1A 2YNWA 3SFPA 5LCHA 2FK6A 4Z60A 2P97A 1WUOA 3A4YA 5KILA 3RPCA 2QDSA 4YSKA 3IEKA 5A5ZA 3F9OA 5K0WA 5EVKA 2Q9UA 2I7XA 3WXCA 4EXYA 3PY5A 2BR6A 2P1EA 3IE0A 3IOFA 3T3NA 2ZZIA 5HISA 5LLDA 4EYFA 1DDKA 4D1WA 4RAMA 5DPXA 3BK2A 4RBSA 3S0ZA 4UA4A 2BG2A 2FU8A 2FHXB 1XTOA 5EV6A 4JO0A 1VMEA 4HL1A 3L6NA 4ZO2A 2R2DA 4ZNBA 2WYMC 4YSLA 4GYQA 1BMCA 2WRSA 2YNTA 5B3RA 1KO2A 1KR3A 2YNTB 3ADRA 4NQ2A 5ACXA 4UWSB 4EY2A 4AWZA 2YNVB 4Z7RA 2AIOA 2NXAA 4UBQA 2BFKA 3I13A 4HKYA 4TZEA 5FQAA 4Z5YA 3IE2A 3ZNBA 4GYUA 4FR7A 3RKKA 2M5DA 4ZEJA 3Q6VA 4KEQA 4BP0A 5LCAA 4C1EA 1Y44A 2Q42A 3IELA 4Z6XA 1KO3A 3BC2A 1P9EA 2E7YA 2I7TA 2BIBA 1WW1A 1X8HA 5LCFA 1YCHA 5LS3A 2BG8B 3DH8A 5EW0A 2Q0JA 4EYLA 3X30A 4BZ3A 1YCGA 5K4MA 2P18A 1ZNBA 2DOOA 2VW8A 3JXPA 1X8IA 2QINA 1ZKPA 5LE1A 5KIKA 4NQ4A 4D1UA 2WHGA 3I0VA 3VPEA 4NQ6A 4NQ5A 2FM6A 1WRAA 4J5FA 2YCBA 5EVDA 3R2UA 5HIPA 2A7MA 5AHOA 3SW3A 5B1UA 4F6ZA 4RAWA 4WD6A 5HH6A 4EYBA 2OHHA 4AX1B 1BVTA 4O98A 5IQKA 3IDZA 3ZWFA 4EFZA 3IE1A 2QDTA 5FQCA 4TYFA 2I7VA 4AWYB 4UWPB 4PVTA 5ACPA 3LVZA 2GFKA 1BC2A 5A0TA 3VQZA 1HLKA 3I15A 5FQBA 2GFJA 4TZFA 5LMCA 2BFZA 3I11A 5EH9A 5HIOA 3QH8A 2YZ3A 4C1FA 2ZNBA 3DHAA 2NZFA 4DIKA 3FCZA 3TP9A 4KEPA 2GKLA 2P4ZA 2BG6A 4C1DA 5AXOA 5HIQA 4HL2A 2ZWRA 3MD7A 1K07A 2OHJA 3ESHA 3DHCA 3ZQ4A 5A87A 2XF4A 4Z67A 2QEDA 4YSBA 4J5HA 4TYTA 1E5DA 2Y8BA 2NZEA 2ZO4A 1DD6A 4RL0A 4RM5A
chains in the Genus database with same CATH superfamily
2GCUA 4H0DA 5LSCA 2BGAA 4RL2A 3PG4A 2CG2A 4LE6A 2OHIA 1JJEA 1VGNA 1WUPA 4NURA 1YCFA 3T3OA 2M5CA 2CBNA 3RKJA 4D1VA 2CG3A 4B87A 5HH5A 2BMIA 5ACWA 4AD9A 1JT1A 4DILA 5ACTA 4FSBA 5AIJA 2H6AA 5K4KA 4UWOB 2DKFA 2Y87A 2WYLA 5AJLA 1QH3A 2Q0IA 1QH5A 3BK1A 4D02A 4XWWA 5ACUA 2Y8AA 1A8TA 4UAMA 5EWAA 3I14A 4U4LA 2WYMA 2NYPA 1ZTCA 2FU6A 3ZR9A 2BC2A 2FU7A 1VJNA 3G1PA 1JJTA 3X2XA 1M2XA 5AYAA 4PVOA 4TZ9A 2BTNA 4CHLA 4EXSA 4C1GA 2GMNA 2BFZB 5ACSA 2BG7A 3KNRA 3T9MA 2FHXA 3IEMA 3P2UA 4GCWA 3AF5A 4Z5ZA 3FAIA 5EV8A 4AV7A 5ACQA 4UWRB 3KNSA 4XUKA 3SBLA 5AHRA 5A0VA 2YNVA 2YNUA 2HB9A 5EVBA 3SPUA 4V0HA 4AX0B 5HH4A 1SMLA 5AXRA 2QJSA 4C1CA 4TZBA 3SRXA 2AZ4A 5LM6A 3PY6A 5ACRA 4D1TA 4P62A 5EHTA 3H3EA 2FU9A 1MQOA 5K4NA 2UYXA 3KL7A 4ZO3A 4FEKA 3X2ZA 3IOGA 5B15A 3AF6A 4C1HA 5ACVA 2BG8A 1L9YA 2BFLA 5AEBA 3BV6A 4F6HA 3SD9A 1XM8A 3DHBA 4XWTA 1DXKA 3AJ3A 1A7TA 2CFZA 4C09A 3X2YA 1X8GA 2XR1A 2YNWA 3SFPA 5LCHA 2FK6A 4Z60A 2P97A 1WUOA 3A4YA 5KILA 3RPCA 2QDSA 4AXHA 4YSKA 3IEKA 5A5ZA 3F9OA 5K0WA 5EVKA 2Q9UA 2I7XA 3WXCA 4EXYA 5A23A 3PY5A 2BR6A 2P1EA 3IE0A 3IOFA 3T3NA 2ZZIA 5HISA 5LLDA 4EYFA 1DDKA 4D1WA 4RAMA 5DPXA 2CFUA 3BK2A 4RBSA 3S0ZA 4UA4A 2BG2A 2FU8A 2FHXB 1XTOA 5EV6A 4JO0A 1VMEA 4HL1A 3L6NA 4ZO2A 2R2DA 4ZNBA 4PDXA 2WYMC 4YSLA 4GYQA 1BMCA 2WRSA 2YNTA 5B3RA 1KO2A 1KR3A 2YNTB 3ADRA 4NQ2A 5ACXA 4UWSB 4EY2A 4AWZA 2YNVB 4Z7RA 2AIOA 2NXAA 4UBQA 2BFKA 3I13A 4HKYA 4TZEA 5FQAA 4Z5YA 3IE2A 3ZNBA 4GYUA 4FR7A 3RKKA 2M5DA 4ZEJA 3Q6VA 4KEQA 4BP0A 5LCAA 4C1EA 1Y44A 2Q42A 3IELA 4Z6XA 1KO3A 3BC2A 1P9EA 2E7YA 2I7TA 2BIBA 1WW1A 1X8HA 5LCFA 1YCHA 5LS3A 2BG8B 3DH8A 5EW0A 2Q0JA 4EYLA 3X30A 4BZ3A 1YCGA 5K4MA 2P18A 1ZNBA 2DOOA 2VW8A 3JXPA 1X8IA 2QINA 1ZKPA 5LE1A 5KIKA 4NQ4A 4D1UA 2WHGA 3I0VA 3VPEA 4NQ6A 4NQ5A 2FM6A 1WRAA 4J5FA 2YCBA 5EVDA 3R2UA 5HIPA 2A7MA 5AHOA 3SW3A 5B1UA 4F6ZA 4RAWA 4WD6A 5HH6A 4EYBA 2OHHA 4AX1B 1BVTA 4O98A 5IQKA 3IDZA 3ZWFA 4EFZA 3IE1A 2QDTA 5FQCA 4TYFA 2I7VA 4AWYB 4UWPB 4PVTA 5ACPA 3LVZA 2GFKA 1BC2A 5A0TA 3VQZA 1HLKA 3I15A 5FQBA 2GFJA 4TZFA 5LMCA 2BFZA 3I11A 5EH9A 5HIOA 3QH8A 2YZ3A 4C1FA 2ZNBA 3DHAA 2NZFA 4DIKA 3FCZA 3TP9A 4KEPA 2YHEA 2GKLA 2P4ZA 2BG6A 4C1DA 5AXOA 5HIQA 4HL2A 2ZWRA 3MD7A 1K07A 2OHJA 3ESHA 3DHCA 3ZQ4A 5A87A 2XF4A 4Z67A 2QEDA 4YSBA 4J5HA 4TYTA 1E5DA 2Y8BA 2NZEA 2ZO4A 1DD6A 4RL0A 4RM5A
chains in the Genus database with same CATH topology
2GCUA 4H0DA 5LSCA 2BGAA 4RL2A 3PG4A 4LE6A 2OHIA 1JJEA 1VGNA 1WUPA 1YCFA 3T3OA 2M5CA 2CBNA 3RKJA 4D1VA 4B87A 5HH5A 2BMIA 5ACWA 4AD9A 1JT1A 4DILA 5ACTA 4FSBA 2H6AA 5K4KA 4UWOB 2DKFA 2Y87A 2WYLA 1QH3A 2Q0IA 1QH5A 3BK1A 4D02A 4XWWA 5ACUA 2Y8AA 1A8TA 4UAMA 5EWAA 3I14A 4U4LA 2WYMA 2NYPA 1ZTCA 2FU6A 3ZR9A 2BC2A 2FU7A 1VJNA 3G1PA 1JJTA 3X2XA 1M2XA 5AYAA 4PVOA 4TZ9A 2BTNA 4CHLA 4EXSA 4C1GA 2GMNA 2BFZB 5ACSA 2BG7A 3KNRA 3T9MA 2FHXA 3IEMA 3P2UA 4GCWA 3AF5A 4Z5ZA 3FAIA 5EV8A 5ACQA 4UWRB 3KNSA 4XUKA 3SBLA 5AHRA 5A0VA 2YNVA 2YNUA 2HB9A 5EVBA 3SPUA 4V0HA 4AX0B 5HH4A 1SMLA 5AXRA 2QJSA 4C1CA 4TZBA 3SRXA 2AZ4A 5LM6A 3PY6A 5ACRA 4D1TA 4P62A 5EHTA 3H3EA 2FU9A 1MQOA 5K4NA 2UYXA 3KL7A 4ZO3A 4FEKA 3X2ZA 3IOGA 5B15A 3AF6A 4C1HA 5ACVA 2BG8A 1L9YA 2BFLA 5AEBA 3BV6A 4F6HA 3SD9A 1XM8A 3DHBA 4XWTA 1DXKA 3AJ3A 1A7TA 4C09A 3X2YA 1X8GA 2XR1A 2YNWA 3SFPA 5LCHA 2FK6A 4Z60A 2P97A 1WUOA 3A4YA 5KILA 3RPCA 2QDSA 4YSKA 3IEKA 5A5ZA 3F9OA 5K0WA 5EVKA 2Q9UA 2I7XA 3WXCA 4EXYA 3PY5A 2BR6A 2P1EA 3IE0A 3IOFA 3T3NA 2ZZIA 5HISA 5LLDA 4EYFA 1DDKA 4D1WA 4RAMA 5DPXA 3BK2A 4RBSA 3S0ZA 4UA4A 2BG2A 2FU8A 2FHXB 1XTOA 5EV6A 4JO0A 1VMEA 4HL1A 3L6NA 4ZO2A 2R2DA 4ZNBA 2WYMC 4YSLA 4GYQA 1BMCA 2WRSA 2YNTA 5B3RA 1KO2A 1KR3A 2YNTB 3ADRA 4NQ2A 5ACXA 4UWSB 4EY2A 4AWZA 2YNVB 4Z7RA 2AIOA 2NXAA 4UBQA 2BFKA 3I13A 4HKYA 4TZEA 5FQAA 4Z5YA 3IE2A 3ZNBA 4GYUA 4FR7A 3RKKA 2M5DA 4ZEJA 3Q6VA 4KEQA 4BP0A 5LCAA 4C1EA 1Y44A 2Q42A 3IELA 4Z6XA 1KO3A 3BC2A 1P9EA 2E7YA 2I7TA 2BIBA 1WW1A 1X8HA 5LCFA 1YCHA 5LS3A 2BG8B 3DH8A 5EW0A 2Q0JA 4EYLA 3X30A 4BZ3A 1YCGA 5K4MA 2P18A 1ZNBA 2DOOA 2VW8A 3JXPA 1X8IA 2QINA 1ZKPA 5LE1A 5KIKA 4NQ4A 4D1UA 2WHGA 3I0VA 3VPEA 4NQ6A 4NQ5A 2FM6A 1WRAA 4J5FA 2YCBA 5EVDA 3R2UA 5HIPA 2A7MA 5AHOA 3SW3A 5B1UA 4F6ZA 4RAWA 4WD6A 5HH6A 4EYBA 2OHHA 4AX1B 1BVTA 4O98A 5IQKA 3IDZA 3ZWFA 4EFZA 3IE1A 2QDTA 5FQCA 4TYFA 2I7VA 4AWYB 4UWPB 4PVTA 5ACPA 3LVZA 2GFKA 1BC2A 5A0TA 3VQZA 1HLKA 3I15A 5FQBA 2GFJA 4TZFA 5LMCA 2BFZA 3I11A 5EH9A 5HIOA 3QH8A 2YZ3A 4C1FA 2ZNBA 3DHAA 2NZFA 4DIKA 3FCZA 3TP9A 4KEPA 2GKLA 2P4ZA 2BG6A 4C1DA 5AXOA 5HIQA 4HL2A 2ZWRA 3MD7A 1K07A 2OHJA 3ESHA 3DHCA 3ZQ4A 5A87A 2XF4A 4Z67A 2QEDA 4YSBA 4J5HA 4TYTA 1E5DA 2Y8BA 2NZEA 2ZO4A 1DD6A 4RL0A 4RM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GCU A;  4H0D A;  5LSC A;  2BGA A;  4RL2 A;  3PG4 A;  4LE6 A;  2OHI A;  1JJE A;  1VGN A;  1WUP A;  1YCF A;  3T3O A;  2M5C A;  2CBN A;  3RKJ A;  4D1V A;  4B87 A;  5HH5 A;  2BMI A;  5ACW A;  4AD9 A;  1JT1 A;  4DIL A;  5ACT A;  4FSB A;  2H6A A;  5K4K A;  4UWO B;  2DKF A;  2Y87 A;  2WYL A;  1QH3 A;  2Q0I A;  1QH5 A;  3BK1 A;  4D02 A;  4XWW A;  5ACU A;  2Y8A A;  1A8T A;  4UAM A;  5EWA A;  3I14 A;  4U4L A;  2WYM A;  2NYP A;  1ZTC A;  2FU6 A;  3ZR9 A;  2BC2 A;  2FU7 A;  1VJN A;  3G1P A;  1JJT A;  3X2X A;  1M2X A;  5AYA A;  4PVO A;  4TZ9 A;  2BTN A;  4CHL A;  4EXS A;  4C1G A;  2GMN A;  2BFZ B;  5ACS A;  2BG7 A;  3KNR A;  3T9M A;  2FHX A;  3IEM A;  3P2U A;  4GCW A;  3AF5 A;  4Z5Z A;  3FAI A;  5EV8 A;  5ACQ A;  4UWR B;  3KNS A;  4XUK A;  3SBL A;  5AHR A;  5A0V A;  2YNV A;  2YNU A;  2HB9 A;  5EVB A;  3SPU A;  4V0H A;  4AX0 B;  5HH4 A;  1SML A;  5AXR A;  2QJS A;  4C1C A;  4TZB A;  3SRX A;  2AZ4 A;  5LM6 A;  3PY6 A;  5ACR A;  4D1T A;  4P62 A;  5EHT A;  3H3E A;  2FU9 A;  1MQO A;  5K4N A;  2UYX A;  3KL7 A;  4ZO3 A;  4FEK A;  3X2Z A;  3IOG A;  5B15 A;  3AF6 A;  4C1H A;  5ACV A;  2BG8 A;  1L9Y A;  2BFL A;  5AEB A;  3BV6 A;  4F6H A;  3SD9 A;  1XM8 A;  3DHB A;  4XWT A;  1DXK A;  3AJ3 A;  1A7T A;  4C09 A;  3X2Y A;  1X8G A;  2XR1 A;  2YNW A;  3SFP A;  5LCH A;  2FK6 A;  4Z60 A;  2P97 A;  1WUO A;  3A4Y A;  5KIL A;  3RPC A;  2QDS A;  4YSK A;  3IEK A;  5A5Z A;  3F9O A;  5K0W A;  5EVK A;  2Q9U A;  2I7X A;  3WXC A;  4EXY A;  3PY5 A;  2BR6 A;  2P1E A;  3IE0 A;  3IOF A;  3T3N A;  2ZZI A;  5HIS A;  5LLD A;  4EYF A;  1DDK A;  4D1W A;  4RAM A;  5DPX A;  3BK2 A;  4RBS A;  3S0Z A;  4UA4 A;  2BG2 A;  2FU8 A;  2FHX B;  1XTO A;  5EV6 A;  4JO0 A;  1VME A;  4HL1 A;  3L6N A;  4ZO2 A;  2R2D A;  4ZNB A;  2WYM C;  4YSL A;  4GYQ A;  1BMC A;  2WRS A;  2YNT A;  5B3R A;  1KO2 A;  1KR3 A;  2YNT B;  3ADR A;  4NQ2 A;  5ACX A;  4UWS B;  4EY2 A;  4AWZ A;  2YNV B;  4Z7R A;  2AIO A;  2NXA A;  4UBQ A;  2BFK A;  3I13 A;  4HKY A;  4TZE A;  5FQA A;  4Z5Y A;  3IE2 A;  3ZNB A;  4GYU A;  4FR7 A;  3RKK A;  2M5D A;  4ZEJ A;  3Q6V A;  4KEQ A;  4BP0 A;  5LCA A;  4C1E A;  1Y44 A;  2Q42 A;  3IEL A;  4Z6X A;  1KO3 A;  3BC2 A;  1P9E A;  2E7Y A;  2I7T A;  2BIB A;  1WW1 A;  1X8H A;  5LCF A;  1YCH A;  5LS3 A;  2BG8 B;  3DH8 A;  5EW0 A;  2Q0J A;  4EYL A;  3X30 A;  4BZ3 A;  1YCG A;  5K4M A;  2P18 A;  1ZNB A;  2DOO A;  2VW8 A;  3JXP A;  1X8I A;  2QIN A;  1ZKP A;  5LE1 A;  5KIK A;  4NQ4 A;  4D1U A;  2WHG A;  3I0V A;  3VPE A;  4NQ6 A;  4NQ5 A;  2FM6 A;  1WRA A;  4J5F A;  2YCB A;  5EVD A;  3R2U A;  5HIP A;  2A7M A;  5AHO A;  3SW3 A;  5B1U A;  4F6Z A;  4RAW A;  4WD6 A;  5HH6 A;  4EYB A;  2OHH A;  4AX1 B;  1BVT A;  4O98 A;  5IQK A;  3IDZ A;  3ZWF A;  4EFZ A;  3IE1 A;  2QDT A;  5FQC A;  4TYF A;  2I7V A;  4AWY B;  4UWP B;  4PVT A;  5ACP A;  3LVZ A;  2GFK A;  1BC2 A;  5A0T A;  3VQZ A;  1HLK A;  3I15 A;  5FQB A;  2GFJ A;  4TZF A;  5LMC A;  2BFZ A;  3I11 A;  5EH9 A;  5HIO A;  3QH8 A;  2YZ3 A;  4C1F A;  2ZNB A;  3DHA A;  2NZF A;  4DIK A;  3FCZ A;  3TP9 A;  4KEP A;  2GKL A;  2P4Z A;  2BG6 A;  4C1D A;  5AXO A;  5HIQ A;  4HL2 A;  2ZWR A;  3MD7 A;  1K07 A;  2OHJ A;  3ESH A;  3DHC A;  3ZQ4 A;  5A87 A;  2XF4 A;  4Z67 A;  2QED A;  4YSB A;  4J5H A;  4TYT A;  1E5D A;  2Y8B A;  2NZE A;  2ZO4 A;  1DD6 A;  4RL0 A;  4RM5 A; 
#chains in the Genus database with same CATH topology
 2GCU A;  4H0D A;  5LSC A;  2BGA A;  4RL2 A;  3PG4 A;  2CG2 A;  4LE6 A;  2OHI A;  1JJE A;  1VGN A;  1WUP A;  4NUR A;  1YCF A;  3T3O A;  2M5C A;  2CBN A;  3RKJ A;  4D1V A;  2CG3 A;  4B87 A;  5HH5 A;  2BMI A;  5ACW A;  4AD9 A;  1JT1 A;  4DIL A;  5ACT A;  4FSB A;  5AIJ A;  2H6A A;  5K4K A;  4UWO B;  2DKF A;  2Y87 A;  2WYL A;  5AJL A;  1QH3 A;  2Q0I A;  1QH5 A;  3BK1 A;  4D02 A;  4XWW A;  5ACU A;  2Y8A A;  1A8T A;  4UAM A;  5EWA A;  3I14 A;  4U4L A;  2WYM A;  2NYP A;  1ZTC A;  2FU6 A;  3ZR9 A;  2BC2 A;  2FU7 A;  1VJN A;  3G1P A;  1JJT A;  3X2X A;  1M2X A;  5AYA A;  4PVO A;  4TZ9 A;  2BTN A;  4CHL A;  4EXS A;  4C1G A;  2GMN A;  2BFZ B;  5ACS A;  2BG7 A;  3KNR A;  3T9M A;  2FHX A;  3IEM A;  3P2U A;  4GCW A;  3AF5 A;  4Z5Z A;  3FAI A;  5EV8 A;  4AV7 A;  5ACQ A;  4UWR B;  3KNS A;  4XUK A;  3SBL A;  5AHR A;  5A0V A;  2YNV A;  2YNU A;  2HB9 A;  5EVB A;  3SPU A;  4V0H A;  4AX0 B;  5HH4 A;  1SML A;  5AXR A;  2QJS A;  4C1C A;  4TZB A;  3SRX A;  2AZ4 A;  5LM6 A;  3PY6 A;  5ACR A;  4D1T A;  4P62 A;  5EHT A;  3H3E A;  2FU9 A;  1MQO A;  5K4N A;  2UYX A;  3KL7 A;  4ZO3 A;  4FEK A;  3X2Z A;  3IOG A;  5B15 A;  3AF6 A;  4C1H A;  5ACV A;  2BG8 A;  1L9Y A;  2BFL A;  5AEB A;  3BV6 A;  4F6H A;  3SD9 A;  1XM8 A;  3DHB A;  4XWT A;  1DXK A;  3AJ3 A;  1A7T A;  2CFZ A;  4C09 A;  3X2Y A;  1X8G A;  2XR1 A;  2YNW A;  3SFP A;  5LCH A;  2FK6 A;  4Z60 A;  2P97 A;  1WUO A;  3A4Y A;  5KIL A;  3RPC A;  2QDS A;  4AXH A;  4YSK A;  3IEK A;  5A5Z A;  3F9O A;  5K0W A;  5EVK A;  2Q9U A;  2I7X A;  3WXC A;  4EXY A;  5A23 A;  3PY5 A;  2BR6 A;  2P1E A;  3IE0 A;  3IOF A;  3T3N A;  2ZZI A;  5HIS A;  5LLD A;  4EYF A;  1DDK A;  4D1W A;  4RAM A;  5DPX A;  2CFU A;  3BK2 A;  4RBS A;  3S0Z A;  4UA4 A;  2BG2 A;  2FU8 A;  2FHX B;  1XTO A;  5EV6 A;  4JO0 A;  1VME A;  4HL1 A;  3L6N A;  4ZO2 A;  2R2D A;  4ZNB A;  4PDX A;  2WYM C;  4YSL A;  4GYQ A;  1BMC A;  2WRS A;  2YNT A;  5B3R A;  1KO2 A;  1KR3 A;  2YNT B;  3ADR A;  4NQ2 A;  5ACX A;  4UWS B;  4EY2 A;  4AWZ A;  2YNV B;  4Z7R A;  2AIO A;  2NXA A;  4UBQ A;  2BFK A;  3I13 A;  4HKY A;  4TZE A;  5FQA A;  4Z5Y A;  3IE2 A;  3ZNB A;  4GYU A;  4FR7 A;  3RKK A;  2M5D A;  4ZEJ A;  3Q6V A;  4KEQ A;  4BP0 A;  5LCA A;  4C1E A;  1Y44 A;  2Q42 A;  3IEL A;  4Z6X A;  1KO3 A;  3BC2 A;  1P9E A;  2E7Y A;  2I7T A;  2BIB A;  1WW1 A;  1X8H A;  5LCF A;  1YCH A;  5LS3 A;  2BG8 B;  3DH8 A;  5EW0 A;  2Q0J A;  4EYL A;  3X30 A;  4BZ3 A;  1YCG A;  5K4M A;  2P18 A;  1ZNB A;  2DOO A;  2VW8 A;  3JXP A;  1X8I A;  2QIN A;  1ZKP A;  5LE1 A;  5KIK A;  4NQ4 A;  4D1U A;  2WHG A;  3I0V A;  3VPE A;  4NQ6 A;  4NQ5 A;  2FM6 A;  1WRA A;  4J5F A;  2YCB A;  5EVD A;  3R2U A;  5HIP A;  2A7M A;  5AHO A;  3SW3 A;  5B1U A;  4F6Z A;  4RAW A;  4WD6 A;  5HH6 A;  4EYB A;  2OHH A;  4AX1 B;  1BVT A;  4O98 A;  5IQK A;  3IDZ A;  3ZWF A;  4EFZ A;  3IE1 A;  2QDT A;  5FQC A;  4TYF A;  2I7V A;  4AWY B;  4UWP B;  4PVT A;  5ACP A;  3LVZ A;  2GFK A;  1BC2 A;  5A0T A;  3VQZ A;  1HLK A;  3I15 A;  5FQB A;  2GFJ A;  4TZF A;  5LMC A;  2BFZ A;  3I11 A;  5EH9 A;  5HIO A;  3QH8 A;  2YZ3 A;  4C1F A;  2ZNB A;  3DHA A;  2NZF A;  4DIK A;  3FCZ A;  3TP9 A;  4KEP A;  2YHE A;  2GKL A;  2P4Z A;  2BG6 A;  4C1D A;  5AXO A;  5HIQ A;  4HL2 A;  2ZWR A;  3MD7 A;  1K07 A;  2OHJ A;  3ESH A;  3DHC A;  3ZQ4 A;  5A87 A;  2XF4 A;  4Z67 A;  2QED A;  4YSB A;  4J5H A;  4TYT A;  1E5D A;  2Y8B A;  2NZE A;  2ZO4 A;  1DD6 A;  4RL0 A;  4RM5 A; 
#chains in the Genus database with same CATH homology
 2GCU A;  4H0D A;  5LSC A;  2BGA A;  4RL2 A;  3PG4 A;  4LE6 A;  2OHI A;  1JJE A;  1VGN A;  1WUP A;  1YCF A;  3T3O A;  2M5C A;  2CBN A;  3RKJ A;  4D1V A;  4B87 A;  5HH5 A;  2BMI A;  5ACW A;  4AD9 A;  1JT1 A;  4DIL A;  5ACT A;  4FSB A;  2H6A A;  5K4K A;  4UWO B;  2DKF A;  2Y87 A;  2WYL A;  1QH3 A;  2Q0I A;  1QH5 A;  3BK1 A;  4D02 A;  4XWW A;  5ACU A;  2Y8A A;  1A8T A;  4UAM A;  5EWA A;  3I14 A;  4U4L A;  2WYM A;  2NYP A;  1ZTC A;  2FU6 A;  3ZR9 A;  2BC2 A;  2FU7 A;  1VJN A;  3G1P A;  1JJT A;  3X2X A;  1M2X A;  5AYA A;  4PVO A;  4TZ9 A;  2BTN A;  4CHL A;  4EXS A;  4C1G A;  2GMN A;  2BFZ B;  5ACS A;  2BG7 A;  3KNR A;  3T9M A;  2FHX A;  3IEM A;  3P2U A;  4GCW A;  3AF5 A;  4Z5Z A;  3FAI A;  5EV8 A;  5ACQ A;  4UWR B;  3KNS A;  4XUK A;  3SBL A;  5AHR A;  5A0V A;  2YNV A;  2YNU A;  2HB9 A;  5EVB A;  3SPU A;  4V0H A;  4AX0 B;  5HH4 A;  1SML A;  5AXR A;  2QJS A;  4C1C A;  4TZB A;  3SRX A;  2AZ4 A;  5LM6 A;  3PY6 A;  5ACR A;  4D1T A;  4P62 A;  5EHT A;  3H3E A;  2FU9 A;  1MQO A;  5K4N A;  2UYX A;  3KL7 A;  4ZO3 A;  4FEK A;  3X2Z A;  3IOG A;  5B15 A;  3AF6 A;  4C1H A;  5ACV A;  2BG8 A;  1L9Y A;  2BFL A;  5AEB A;  3BV6 A;  4F6H A;  3SD9 A;  1XM8 A;  3DHB A;  4XWT A;  1DXK A;  3AJ3 A;  1A7T A;  4C09 A;  3X2Y A;  1X8G A;  2XR1 A;  2YNW A;  3SFP A;  5LCH A;  2FK6 A;  4Z60 A;  2P97 A;  1WUO A;  3A4Y A;  5KIL A;  3RPC A;  2QDS A;  4YSK A;  3IEK A;  5A5Z A;  3F9O A;  5K0W A;  5EVK A;  2Q9U A;  2I7X A;  3WXC A;  4EXY A;  3PY5 A;  2BR6 A;  2P1E A;  3IE0 A;  3IOF A;  3T3N A;  2ZZI A;  5HIS A;  5LLD A;  4EYF A;  1DDK A;  4D1W A;  4RAM A;  5DPX A;  3BK2 A;  4RBS A;  3S0Z A;  4UA4 A;  2BG2 A;  2FU8 A;  2FHX B;  1XTO A;  5EV6 A;  4JO0 A;  1VME A;  4HL1 A;  3L6N A;  4ZO2 A;  2R2D A;  4ZNB A;  2WYM C;  4YSL A;  4GYQ A;  1BMC A;  2WRS A;  2YNT A;  5B3R A;  1KO2 A;  1KR3 A;  2YNT B;  3ADR A;  4NQ2 A;  5ACX A;  4UWS B;  4EY2 A;  4AWZ A;  2YNV B;  4Z7R A;  2AIO A;  2NXA A;  4UBQ A;  2BFK A;  3I13 A;  4HKY A;  4TZE A;  5FQA A;  4Z5Y A;  3IE2 A;  3ZNB A;  4GYU A;  4FR7 A;  3RKK A;  2M5D A;  4ZEJ A;  3Q6V A;  4KEQ A;  4BP0 A;  5LCA A;  4C1E A;  1Y44 A;  2Q42 A;  3IEL A;  4Z6X A;  1KO3 A;  3BC2 A;  1P9E A;  2E7Y A;  2I7T A;  2BIB A;  1WW1 A;  1X8H A;  5LCF A;  1YCH A;  5LS3 A;  2BG8 B;  3DH8 A;  5EW0 A;  2Q0J A;  4EYL A;  3X30 A;  4BZ3 A;  1YCG A;  5K4M A;  2P18 A;  1ZNB A;  2DOO A;  2VW8 A;  3JXP A;  1X8I A;  2QIN A;  1ZKP A;  5LE1 A;  5KIK A;  4NQ4 A;  4D1U A;  2WHG A;  3I0V A;  3VPE A;  4NQ6 A;  4NQ5 A;  2FM6 A;  1WRA A;  4J5F A;  2YCB A;  5EVD A;  3R2U A;  5HIP A;  2A7M A;  5AHO A;  3SW3 A;  5B1U A;  4F6Z A;  4RAW A;  4WD6 A;  5HH6 A;  4EYB A;  2OHH A;  4AX1 B;  1BVT A;  4O98 A;  5IQK A;  3IDZ A;  3ZWF A;  4EFZ A;  3IE1 A;  2QDT A;  5FQC A;  4TYF A;  2I7V A;  4AWY B;  4UWP B;  4PVT A;  5ACP A;  3LVZ A;  2GFK A;  1BC2 A;  5A0T A;  3VQZ A;  1HLK A;  3I15 A;  5FQB A;  2GFJ A;  4TZF A;  5LMC A;  2BFZ A;  3I11 A;  5EH9 A;  5HIO A;  3QH8 A;  2YZ3 A;  4C1F A;  2ZNB A;  3DHA A;  2NZF A;  4DIK A;  3FCZ A;  3TP9 A;  4KEP A;  2GKL A;  2P4Z A;  2BG6 A;  4C1D A;  5AXO A;  5HIQ A;  4HL2 A;  2ZWR A;  3MD7 A;  1K07 A;  2OHJ A;  3ESH A;  3DHC A;  3ZQ4 A;  5A87 A;  2XF4 A;  4Z67 A;  2QED A;  4YSB A;  4J5H A;  4TYT A;  1E5D A;  2Y8B A;  2NZE A;  2ZO4 A;  1DD6 A;  4RL0 A;  4RM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...