2Q42A

Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
254
structure length
254
Chain Sequence
MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Putative hydroxyacylglutathione hydrolase 2
total genus 86
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q42A00
2FHXB 4UA4A 4Z67A 1P9EA 5LSCA 1ZTCA 4FEKA 5B15A 2BIBA 2BG7A 5LCFA 5A87A 2YNVB 3RKKA 5LCHA 4EYFA 4C09A 2XF4A 2FU6A 4DIKA 2FHXA 5AYAA 2FU8A 3LVZA 2GFKA 5A0TA 3JXPA 1WUPA 1QH5A 1KO2A 5B1UA 4D02A 5ACQA 3SD9A 4Z6XA 2BR6A 2GMNA 4XWTA 3R2UA 4F6HA 5EVDA 3X2ZA 5EVBA 1VMEA 2QJSA 4YSKA 4Z5YA 2UYXA 2QDTA 5HIPA 3IDZA 5HISA 4AWYB 2YNUA 2BTNA 3FCZA 2ZWRA 5LLDA 4HKYA 1WRAA 1BC2A 3IELA 4NQ6A 4TYTA 3IE1A 2WYLA 3L6NA 2BGAA 2NXAA 3FAIA 5ACRA 2FK6A 3IEKA 2BC2A 3DH8A 1KR3A 3KL7A 4NQ2A 4UWOB 4HL1A 2OHHA 1JJTA 1KO3A 1X8HA 4BZ3A 3Q6VA 4GYUA 4J5FA 4V0HA 3IE0A 5ACPA 3PY6A 4AD9A 4C1CA 3ZNBA 4EFZA 4P62A 4HL2A 5AXOA 3BC2A 3T9MA 3PG4A 3MD7A 3SPUA 4EYBA 4WD6A 1MQOA 3AJ3A 4YSLA 5LM6A 4ZEJA 5EVKA 2YCBA 3AF5A 1DDKA 2M5CA 2YNTB 4D1UA 3PY5A 2BFZB 1WUOA 3SBLA 2BG8A 1XTOA 5IQKA 4JO0A 5ACTA 1L9YA 2FU9A 4GYQA 3X2XA 3IOGA 4DILA 3IEMA 5HH6A 4GCWA 2BFZA 1X8IA 2YNVA 2BG8B 5EW0A 2AZ4A 4AX0B 3BK2A 2P18A 5AHOA 5A0VA 2M5DA 2FM6A 3BV6A 4PVTA 1DXKA 4RM5A 4BP0A 4D1WA 2BFKA 5FQCA 3X2YA 3BK1A 2DOOA 2ZNBA 4EY2A 2BG2A 2Q9UA 2GCUA 3X30A 3G1PA 4RAWA 4RL0A 5LMCA 3ZQ4A 5EHTA 3AF6A 2GFJA 5K4KA 1YCGA 4J5HA 2ZO4A 1E5DA 1VGNA 5K0WA 1SMLA 3VQZA 5LE1A 4H0DA 4TZ9A 3I13A 1X8GA 3P2UA 4TZBA 5ACUA 2WYMC 3IE2A 1M2XA 4YSBA 4Z5ZA 2BG6A 3ADRA 4UWRB 5EV6A 4C1FA 3S0ZA 2Y8BA 4UBQA 4XUKA 3ZWFA 3DHCA 4D1VA 4O98A 5KIKA 4C1GA 4RAMA 3H3EA 3QH8A 4C1DA 1WW1A 4C1HA 4ZNBA 3WXCA 3ZR9A 1QH3A 1DD6A 5FQAA 2FU7A 4RBSA 2I7XA 4TZFA 2A7MA 5ACWA 2GKLA 1A8TA 2QDSA 4UWPB 3KNSA 4NQ5A 5HH4A 2YZ3A 2QEDA 4D1TA 2P4ZA 4Z60A 2YNTA 1XM8A 1K07A 5ACVA 2R2DA 2BFLA 2E7YA 3SW3A 4F6ZA 2AIOA 2Q0IA 5HH5A 5HIOA 3T3NA 4U4LA 4KEQA 2NYPA 4EXSA 2P1EA 1YCFA 3KNRA 5B3RA 1Y44A 2P97A 2CBNA 2XR1A 3VPEA 3I14A 2YNWA 4EXYA 2H6AA 3ESHA 4KEPA 5AEBA 5ACXA 5DPXA 2I7TA 4C1EA 5LS3A 2WRSA 2Y8AA 4UAMA 1JT1A 5FQBA 2HB9A 3I11A 4RL2A 3F9OA 5EWAA 4TYFA 2QINA 4AX1B 3RPCA 2NZFA 3DHAA 5EV8A 1ZKPA 3SFPA 1BMCA 2BMIA 5K4NA 3A4YA 1YCHA 4NQ4A 1HLKA 2VW8A 5KILA 4B87A 4FR7A 3T3OA 1A7TA 2Y87A 5AHRA 1JJEA 2ZZIA 3I0VA 5ACSA 4ZO3A 1BVTA 4UWSB 2Q42A 2I7VA 5A5ZA 4TZEA 3I15A 1ZNBA 2NZEA 2OHJA 2Q0JA 4CHLA 4PVOA 1VJNA 5K4MA 4FSBA 2OHIA 5LCAA 2WHGA 4LE6A 2WYMA 3DHBA 3IOFA 5HIQA 3TP9A 4ZO2A 4EYLA 5EH9A 5AXRA 4AWZA 3RKJA 3SRXA 4XWWA 4Z7RA 2DKFA
chains in the Genus database with same CATH superfamily
2FHXB 4UA4A 4Z67A 1P9EA 5LSCA 1ZTCA 4FEKA 5B15A 2BIBA 2BG7A 5LCFA 2YHEA 4AV7A 5A87A 2YNVB 3RKKA 5LCHA 4EYFA 4C09A 2XF4A 2FU6A 4DIKA 2FHXA 5AYAA 2FU8A 3LVZA 2GFKA 5A0TA 3JXPA 1WUPA 1QH5A 1KO2A 5B1UA 4D02A 5ACQA 3SD9A 4Z6XA 2BR6A 2GMNA 4XWTA 3R2UA 4F6HA 5EVDA 3X2ZA 5EVBA 1VMEA 2QJSA 4YSKA 2CFUA 4Z5YA 2UYXA 2QDTA 5HIPA 3IDZA 5HISA 4AWYB 2YNUA 2BTNA 3FCZA 2ZWRA 5LLDA 4HKYA 1WRAA 2CG3A 1BC2A 3IELA 4NQ6A 4TYTA 3IE1A 2WYLA 3L6NA 2BGAA 2NXAA 3FAIA 5ACRA 5AJLA 2FK6A 3IEKA 2BC2A 3DH8A 1KR3A 3KL7A 4NQ2A 4UWOB 4HL1A 2OHHA 1JJTA 1KO3A 1X8HA 4BZ3A 3Q6VA 4GYUA 4J5FA 4V0HA 3IE0A 5ACPA 3PY6A 4AD9A 4C1CA 3ZNBA 4EFZA 4P62A 4HL2A 5AXOA 3BC2A 3T9MA 3PG4A 3MD7A 3SPUA 4EYBA 4WD6A 1MQOA 3AJ3A 4YSLA 5LM6A 4ZEJA 5EVKA 2YCBA 3AF5A 5AIJA 1DDKA 2CFZA 4NURA 2M5CA 2YNTB 4D1UA 3PY5A 2BFZB 1WUOA 3SBLA 2BG8A 1XTOA 5IQKA 4JO0A 5ACTA 1L9YA 2FU9A 4GYQA 2CG2A 3X2XA 3IOGA 4DILA 3IEMA 5HH6A 4GCWA 2BFZA 1X8IA 2YNVA 2BG8B 5EW0A 2AZ4A 4AX0B 3BK2A 2P18A 5AHOA 5A0VA 2M5DA 2FM6A 3BV6A 4PVTA 1DXKA 4RM5A 4BP0A 4D1WA 2BFKA 5FQCA 3X2YA 3BK1A 2DOOA 2ZNBA 4EY2A 2BG2A 2Q9UA 2GCUA 3X30A 3G1PA 4RAWA 4RL0A 5LMCA 3ZQ4A 5EHTA 3AF6A 2GFJA 5K4KA 1YCGA 4J5HA 2ZO4A 1E5DA 1VGNA 5K0WA 1SMLA 3VQZA 5LE1A 4H0DA 4TZ9A 3I13A 1X8GA 3P2UA 4TZBA 5ACUA 2WYMC 3IE2A 1M2XA 4YSBA 4Z5ZA 2BG6A 4PDXA 3ADRA 4UWRB 5EV6A 4C1FA 3S0ZA 2Y8BA 4UBQA 4XUKA 3ZWFA 3DHCA 4D1VA 4O98A 5KIKA 4C1GA 4RAMA 3H3EA 3QH8A 4C1DA 1WW1A 4C1HA 4ZNBA 3WXCA 3ZR9A 1QH3A 1DD6A 5FQAA 2FU7A 4RBSA 2I7XA 4TZFA 2A7MA 5ACWA 2GKLA 1A8TA 2QDSA 4UWPB 3KNSA 4NQ5A 5HH4A 2YZ3A 2QEDA 4D1TA 2P4ZA 4Z60A 2YNTA 1XM8A 1K07A 5ACVA 2R2DA 2BFLA 2E7YA 3SW3A 4F6ZA 2AIOA 2Q0IA 5HH5A 5HIOA 3T3NA 4U4LA 4KEQA 2NYPA 4EXSA 2P1EA 1YCFA 3KNRA 5B3RA 1Y44A 2P97A 2CBNA 2XR1A 3VPEA 3I14A 2YNWA 4EXYA 2H6AA 3ESHA 4KEPA 5AEBA 5ACXA 5DPXA 2I7TA 4C1EA 5LS3A 2WRSA 2Y8AA 4UAMA 1JT1A 5FQBA 2HB9A 3I11A 4RL2A 3F9OA 5EWAA 4TYFA 2QINA 4AX1B 3RPCA 2NZFA 3DHAA 5EV8A 1ZKPA 3SFPA 1BMCA 5A23A 2BMIA 5K4NA 3A4YA 1YCHA 4NQ4A 1HLKA 2VW8A 5KILA 4B87A 4FR7A 3T3OA 1A7TA 2Y87A 5AHRA 1JJEA 2ZZIA 3I0VA 5ACSA 4ZO3A 1BVTA 4UWSB 2Q42A 2I7VA 4AXHA 5A5ZA 4TZEA 3I15A 1ZNBA 2NZEA 2OHJA 2Q0JA 4CHLA 4PVOA 1VJNA 5K4MA 4FSBA 2OHIA 5LCAA 2WHGA 4LE6A 2WYMA 3DHBA 3IOFA 5HIQA 3TP9A 4ZO2A 4EYLA 5EH9A 5AXRA 4AWZA 3RKJA 3SRXA 4XWWA 4Z7RA 2DKFA
chains in the Genus database with same CATH topology
2FHXB 4UA4A 4Z67A 1P9EA 5LSCA 1ZTCA 4FEKA 5B15A 2BIBA 2BG7A 5LCFA 5A87A 2YNVB 3RKKA 5LCHA 4EYFA 4C09A 2XF4A 2FU6A 4DIKA 2FHXA 5AYAA 2FU8A 3LVZA 2GFKA 5A0TA 3JXPA 1WUPA 1QH5A 1KO2A 5B1UA 4D02A 5ACQA 3SD9A 4Z6XA 2BR6A 2GMNA 4XWTA 3R2UA 4F6HA 5EVDA 3X2ZA 5EVBA 1VMEA 2QJSA 4YSKA 4Z5YA 2UYXA 2QDTA 5HIPA 3IDZA 5HISA 4AWYB 2YNUA 2BTNA 3FCZA 2ZWRA 5LLDA 4HKYA 1WRAA 1BC2A 3IELA 4NQ6A 4TYTA 3IE1A 2WYLA 3L6NA 2BGAA 2NXAA 3FAIA 5ACRA 2FK6A 3IEKA 2BC2A 3DH8A 1KR3A 3KL7A 4NQ2A 4UWOB 4HL1A 2OHHA 1JJTA 1KO3A 1X8HA 4BZ3A 3Q6VA 4GYUA 4J5FA 4V0HA 3IE0A 5ACPA 3PY6A 4AD9A 4C1CA 3ZNBA 4EFZA 4P62A 4HL2A 5AXOA 3BC2A 3T9MA 3PG4A 3MD7A 3SPUA 4EYBA 4WD6A 1MQOA 3AJ3A 4YSLA 5LM6A 4ZEJA 5EVKA 2YCBA 3AF5A 1DDKA 2M5CA 2YNTB 4D1UA 3PY5A 2BFZB 1WUOA 3SBLA 2BG8A 1XTOA 5IQKA 4JO0A 5ACTA 1L9YA 2FU9A 4GYQA 3X2XA 3IOGA 4DILA 3IEMA 5HH6A 4GCWA 2BFZA 1X8IA 2YNVA 2BG8B 5EW0A 2AZ4A 4AX0B 3BK2A 2P18A 5AHOA 5A0VA 2M5DA 2FM6A 3BV6A 4PVTA 1DXKA 4RM5A 4BP0A 4D1WA 2BFKA 5FQCA 3X2YA 3BK1A 2DOOA 2ZNBA 4EY2A 2BG2A 2Q9UA 2GCUA 3X30A 3G1PA 4RAWA 4RL0A 5LMCA 3ZQ4A 5EHTA 3AF6A 2GFJA 5K4KA 1YCGA 4J5HA 2ZO4A 1E5DA 1VGNA 5K0WA 1SMLA 3VQZA 5LE1A 4H0DA 4TZ9A 3I13A 1X8GA 3P2UA 4TZBA 5ACUA 2WYMC 3IE2A 1M2XA 4YSBA 4Z5ZA 2BG6A 3ADRA 4UWRB 5EV6A 4C1FA 3S0ZA 2Y8BA 4UBQA 4XUKA 3ZWFA 3DHCA 4D1VA 4O98A 5KIKA 4C1GA 4RAMA 3H3EA 3QH8A 4C1DA 1WW1A 4C1HA 4ZNBA 3WXCA 3ZR9A 1QH3A 1DD6A 5FQAA 2FU7A 4RBSA 2I7XA 4TZFA 2A7MA 5ACWA 2GKLA 1A8TA 2QDSA 4UWPB 3KNSA 4NQ5A 5HH4A 2YZ3A 2QEDA 4D1TA 2P4ZA 4Z60A 2YNTA 1XM8A 1K07A 5ACVA 2R2DA 2BFLA 2E7YA 3SW3A 4F6ZA 2AIOA 2Q0IA 5HH5A 5HIOA 3T3NA 4U4LA 4KEQA 2NYPA 4EXSA 2P1EA 1YCFA 3KNRA 5B3RA 1Y44A 2P97A 2CBNA 2XR1A 3VPEA 3I14A 2YNWA 4EXYA 2H6AA 3ESHA 4KEPA 5AEBA 5ACXA 5DPXA 2I7TA 4C1EA 5LS3A 2WRSA 2Y8AA 4UAMA 1JT1A 5FQBA 2HB9A 3I11A 4RL2A 3F9OA 5EWAA 4TYFA 2QINA 4AX1B 3RPCA 2NZFA 3DHAA 5EV8A 1ZKPA 3SFPA 1BMCA 2BMIA 5K4NA 3A4YA 1YCHA 4NQ4A 1HLKA 2VW8A 5KILA 4B87A 4FR7A 3T3OA 1A7TA 2Y87A 5AHRA 1JJEA 2ZZIA 3I0VA 5ACSA 4ZO3A 1BVTA 4UWSB 2Q42A 2I7VA 5A5ZA 4TZEA 3I15A 1ZNBA 2NZEA 2OHJA 2Q0JA 4CHLA 4PVOA 1VJNA 5K4MA 4FSBA 2OHIA 5LCAA 2WHGA 4LE6A 2WYMA 3DHBA 3IOFA 5HIQA 3TP9A 4ZO2A 4EYLA 5EH9A 5AXRA 4AWZA 3RKJA 3SRXA 4XWWA 4Z7RA 2DKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHX B;  4UA4 A;  4Z67 A;  1P9E A;  5LSC A;  1ZTC A;  4FEK A;  5B15 A;  2BIB A;  2BG7 A;  5LCF A;  5A87 A;  2YNV B;  3RKK A;  5LCH A;  4EYF A;  4C09 A;  2XF4 A;  2FU6 A;  4DIK A;  2FHX A;  5AYA A;  2FU8 A;  3LVZ A;  2GFK A;  5A0T A;  3JXP A;  1WUP A;  1QH5 A;  1KO2 A;  5B1U A;  4D02 A;  5ACQ A;  3SD9 A;  4Z6X A;  2BR6 A;  2GMN A;  4XWT A;  3R2U A;  4F6H A;  5EVD A;  3X2Z A;  5EVB A;  1VME A;  2QJS A;  4YSK A;  4Z5Y A;  2UYX A;  2QDT A;  5HIP A;  3IDZ A;  5HIS A;  4AWY B;  2YNU A;  2BTN A;  3FCZ A;  2ZWR A;  5LLD A;  4HKY A;  1WRA A;  1BC2 A;  3IEL A;  4NQ6 A;  4TYT A;  3IE1 A;  2WYL A;  3L6N A;  2BGA A;  2NXA A;  3FAI A;  5ACR A;  2FK6 A;  3IEK A;  2BC2 A;  3DH8 A;  1KR3 A;  3KL7 A;  4NQ2 A;  4UWO B;  4HL1 A;  2OHH A;  1JJT A;  1KO3 A;  1X8H A;  4BZ3 A;  3Q6V A;  4GYU A;  4J5F A;  4V0H A;  3IE0 A;  5ACP A;  3PY6 A;  4AD9 A;  4C1C A;  3ZNB A;  4EFZ A;  4P62 A;  4HL2 A;  5AXO A;  3BC2 A;  3T9M A;  3PG4 A;  3MD7 A;  3SPU A;  4EYB A;  4WD6 A;  1MQO A;  3AJ3 A;  4YSL A;  5LM6 A;  4ZEJ A;  5EVK A;  2YCB A;  3AF5 A;  1DDK A;  2M5C A;  2YNT B;  4D1U A;  3PY5 A;  2BFZ B;  1WUO A;  3SBL A;  2BG8 A;  1XTO A;  5IQK A;  4JO0 A;  5ACT A;  1L9Y A;  2FU9 A;  4GYQ A;  3X2X A;  3IOG A;  4DIL A;  3IEM A;  5HH6 A;  4GCW A;  2BFZ A;  1X8I A;  2YNV A;  2BG8 B;  5EW0 A;  2AZ4 A;  4AX0 B;  3BK2 A;  2P18 A;  5AHO A;  5A0V A;  2M5D A;  2FM6 A;  3BV6 A;  4PVT A;  1DXK A;  4RM5 A;  4BP0 A;  4D1W A;  2BFK A;  5FQC A;  3X2Y A;  3BK1 A;  2DOO A;  2ZNB A;  4EY2 A;  2BG2 A;  2Q9U A;  2GCU A;  3X30 A;  3G1P A;  4RAW A;  4RL0 A;  5LMC A;  3ZQ4 A;  5EHT A;  3AF6 A;  2GFJ A;  5K4K A;  1YCG A;  4J5H A;  2ZO4 A;  1E5D A;  1VGN A;  5K0W A;  1SML A;  3VQZ A;  5LE1 A;  4H0D A;  4TZ9 A;  3I13 A;  1X8G A;  3P2U A;  4TZB A;  5ACU A;  2WYM C;  3IE2 A;  1M2X A;  4YSB A;  4Z5Z A;  2BG6 A;  3ADR A;  4UWR B;  5EV6 A;  4C1F A;  3S0Z A;  2Y8B A;  4UBQ A;  4XUK A;  3ZWF A;  3DHC A;  4D1V A;  4O98 A;  5KIK A;  4C1G A;  4RAM A;  3H3E A;  3QH8 A;  4C1D A;  1WW1 A;  4C1H A;  4ZNB A;  3WXC A;  3ZR9 A;  1QH3 A;  1DD6 A;  5FQA A;  2FU7 A;  4RBS A;  2I7X A;  4TZF A;  2A7M A;  5ACW A;  2GKL A;  1A8T A;  2QDS A;  4UWP B;  3KNS A;  4NQ5 A;  5HH4 A;  2YZ3 A;  2QED A;  4D1T A;  2P4Z A;  4Z60 A;  2YNT A;  1XM8 A;  1K07 A;  5ACV A;  2R2D A;  2BFL A;  2E7Y A;  3SW3 A;  4F6Z A;  2AIO A;  2Q0I A;  5HH5 A;  5HIO A;  3T3N A;  4U4L A;  4KEQ A;  2NYP A;  4EXS A;  2P1E A;  1YCF A;  3KNR A;  5B3R A;  1Y44 A;  2P97 A;  2CBN A;  2XR1 A;  3VPE A;  3I14 A;  2YNW A;  4EXY A;  2H6A A;  3ESH A;  4KEP A;  5AEB A;  5ACX A;  5DPX A;  2I7T A;  4C1E A;  5LS3 A;  2WRS A;  2Y8A A;  4UAM A;  1JT1 A;  5FQB A;  2HB9 A;  3I11 A;  4RL2 A;  3F9O A;  5EWA A;  4TYF A;  2QIN A;  4AX1 B;  3RPC A;  2NZF A;  3DHA A;  5EV8 A;  1ZKP A;  3SFP A;  1BMC A;  2BMI A;  5K4N A;  3A4Y A;  1YCH A;  4NQ4 A;  1HLK A;  2VW8 A;  5KIL A;  4B87 A;  4FR7 A;  3T3O A;  1A7T A;  2Y87 A;  5AHR A;  1JJE A;  2ZZI A;  3I0V A;  5ACS A;  4ZO3 A;  1BVT A;  4UWS B;  2Q42 A;  2I7V A;  5A5Z A;  4TZE A;  3I15 A;  1ZNB A;  2NZE A;  2OHJ A;  2Q0J A;  4CHL A;  4PVO A;  1VJN A;  5K4M A;  4FSB A;  2OHI A;  5LCA A;  2WHG A;  4LE6 A;  2WYM A;  3DHB A;  3IOF A;  5HIQ A;  3TP9 A;  4ZO2 A;  4EYL A;  5EH9 A;  5AXR A;  4AWZ A;  3RKJ A;  3SRX A;  4XWW A;  4Z7R A;  2DKF A; 
#chains in the Genus database with same CATH topology
 2FHX B;  4UA4 A;  4Z67 A;  1P9E A;  5LSC A;  1ZTC A;  4FEK A;  5B15 A;  2BIB A;  2BG7 A;  5LCF A;  2YHE A;  4AV7 A;  5A87 A;  2YNV B;  3RKK A;  5LCH A;  4EYF A;  4C09 A;  2XF4 A;  2FU6 A;  4DIK A;  2FHX A;  5AYA A;  2FU8 A;  3LVZ A;  2GFK A;  5A0T A;  3JXP A;  1WUP A;  1QH5 A;  1KO2 A;  5B1U A;  4D02 A;  5ACQ A;  3SD9 A;  4Z6X A;  2BR6 A;  2GMN A;  4XWT A;  3R2U A;  4F6H A;  5EVD A;  3X2Z A;  5EVB A;  1VME A;  2QJS A;  4YSK A;  2CFU A;  4Z5Y A;  2UYX A;  2QDT A;  5HIP A;  3IDZ A;  5HIS A;  4AWY B;  2YNU A;  2BTN A;  3FCZ A;  2ZWR A;  5LLD A;  4HKY A;  1WRA A;  2CG3 A;  1BC2 A;  3IEL A;  4NQ6 A;  4TYT A;  3IE1 A;  2WYL A;  3L6N A;  2BGA A;  2NXA A;  3FAI A;  5ACR A;  5AJL A;  2FK6 A;  3IEK A;  2BC2 A;  3DH8 A;  1KR3 A;  3KL7 A;  4NQ2 A;  4UWO B;  4HL1 A;  2OHH A;  1JJT A;  1KO3 A;  1X8H A;  4BZ3 A;  3Q6V A;  4GYU A;  4J5F A;  4V0H A;  3IE0 A;  5ACP A;  3PY6 A;  4AD9 A;  4C1C A;  3ZNB A;  4EFZ A;  4P62 A;  4HL2 A;  5AXO A;  3BC2 A;  3T9M A;  3PG4 A;  3MD7 A;  3SPU A;  4EYB A;  4WD6 A;  1MQO A;  3AJ3 A;  4YSL A;  5LM6 A;  4ZEJ A;  5EVK A;  2YCB A;  3AF5 A;  5AIJ A;  1DDK A;  2CFZ A;  4NUR A;  2M5C A;  2YNT B;  4D1U A;  3PY5 A;  2BFZ B;  1WUO A;  3SBL A;  2BG8 A;  1XTO A;  5IQK A;  4JO0 A;  5ACT A;  1L9Y A;  2FU9 A;  4GYQ A;  2CG2 A;  3X2X A;  3IOG A;  4DIL A;  3IEM A;  5HH6 A;  4GCW A;  2BFZ A;  1X8I A;  2YNV A;  2BG8 B;  5EW0 A;  2AZ4 A;  4AX0 B;  3BK2 A;  2P18 A;  5AHO A;  5A0V A;  2M5D A;  2FM6 A;  3BV6 A;  4PVT A;  1DXK A;  4RM5 A;  4BP0 A;  4D1W A;  2BFK A;  5FQC A;  3X2Y A;  3BK1 A;  2DOO A;  2ZNB A;  4EY2 A;  2BG2 A;  2Q9U A;  2GCU A;  3X30 A;  3G1P A;  4RAW A;  4RL0 A;  5LMC A;  3ZQ4 A;  5EHT A;  3AF6 A;  2GFJ A;  5K4K A;  1YCG A;  4J5H A;  2ZO4 A;  1E5D A;  1VGN A;  5K0W A;  1SML A;  3VQZ A;  5LE1 A;  4H0D A;  4TZ9 A;  3I13 A;  1X8G A;  3P2U A;  4TZB A;  5ACU A;  2WYM C;  3IE2 A;  1M2X A;  4YSB A;  4Z5Z A;  2BG6 A;  4PDX A;  3ADR A;  4UWR B;  5EV6 A;  4C1F A;  3S0Z A;  2Y8B A;  4UBQ A;  4XUK A;  3ZWF A;  3DHC A;  4D1V A;  4O98 A;  5KIK A;  4C1G A;  4RAM A;  3H3E A;  3QH8 A;  4C1D A;  1WW1 A;  4C1H A;  4ZNB A;  3WXC A;  3ZR9 A;  1QH3 A;  1DD6 A;  5FQA A;  2FU7 A;  4RBS A;  2I7X A;  4TZF A;  2A7M A;  5ACW A;  2GKL A;  1A8T A;  2QDS A;  4UWP B;  3KNS A;  4NQ5 A;  5HH4 A;  2YZ3 A;  2QED A;  4D1T A;  2P4Z A;  4Z60 A;  2YNT A;  1XM8 A;  1K07 A;  5ACV A;  2R2D A;  2BFL A;  2E7Y A;  3SW3 A;  4F6Z A;  2AIO A;  2Q0I A;  5HH5 A;  5HIO A;  3T3N A;  4U4L A;  4KEQ A;  2NYP A;  4EXS A;  2P1E A;  1YCF A;  3KNR A;  5B3R A;  1Y44 A;  2P97 A;  2CBN A;  2XR1 A;  3VPE A;  3I14 A;  2YNW A;  4EXY A;  2H6A A;  3ESH A;  4KEP A;  5AEB A;  5ACX A;  5DPX A;  2I7T A;  4C1E A;  5LS3 A;  2WRS A;  2Y8A A;  4UAM A;  1JT1 A;  5FQB A;  2HB9 A;  3I11 A;  4RL2 A;  3F9O A;  5EWA A;  4TYF A;  2QIN A;  4AX1 B;  3RPC A;  2NZF A;  3DHA A;  5EV8 A;  1ZKP A;  3SFP A;  1BMC A;  5A23 A;  2BMI A;  5K4N A;  3A4Y A;  1YCH A;  4NQ4 A;  1HLK A;  2VW8 A;  5KIL A;  4B87 A;  4FR7 A;  3T3O A;  1A7T A;  2Y87 A;  5AHR A;  1JJE A;  2ZZI A;  3I0V A;  5ACS A;  4ZO3 A;  1BVT A;  4UWS B;  2Q42 A;  2I7V A;  4AXH A;  5A5Z A;  4TZE A;  3I15 A;  1ZNB A;  2NZE A;  2OHJ A;  2Q0J A;  4CHL A;  4PVO A;  1VJN A;  5K4M A;  4FSB A;  2OHI A;  5LCA A;  2WHG A;  4LE6 A;  2WYM A;  3DHB A;  3IOF A;  5HIQ A;  3TP9 A;  4ZO2 A;  4EYL A;  5EH9 A;  5AXR A;  4AWZ A;  3RKJ A;  3SRX A;  4XWW A;  4Z7R A;  2DKF A; 
#chains in the Genus database with same CATH homology
 2FHX B;  4UA4 A;  4Z67 A;  1P9E A;  5LSC A;  1ZTC A;  4FEK A;  5B15 A;  2BIB A;  2BG7 A;  5LCF A;  5A87 A;  2YNV B;  3RKK A;  5LCH A;  4EYF A;  4C09 A;  2XF4 A;  2FU6 A;  4DIK A;  2FHX A;  5AYA A;  2FU8 A;  3LVZ A;  2GFK A;  5A0T A;  3JXP A;  1WUP A;  1QH5 A;  1KO2 A;  5B1U A;  4D02 A;  5ACQ A;  3SD9 A;  4Z6X A;  2BR6 A;  2GMN A;  4XWT A;  3R2U A;  4F6H A;  5EVD A;  3X2Z A;  5EVB A;  1VME A;  2QJS A;  4YSK A;  4Z5Y A;  2UYX A;  2QDT A;  5HIP A;  3IDZ A;  5HIS A;  4AWY B;  2YNU A;  2BTN A;  3FCZ A;  2ZWR A;  5LLD A;  4HKY A;  1WRA A;  1BC2 A;  3IEL A;  4NQ6 A;  4TYT A;  3IE1 A;  2WYL A;  3L6N A;  2BGA A;  2NXA A;  3FAI A;  5ACR A;  2FK6 A;  3IEK A;  2BC2 A;  3DH8 A;  1KR3 A;  3KL7 A;  4NQ2 A;  4UWO B;  4HL1 A;  2OHH A;  1JJT A;  1KO3 A;  1X8H A;  4BZ3 A;  3Q6V A;  4GYU A;  4J5F A;  4V0H A;  3IE0 A;  5ACP A;  3PY6 A;  4AD9 A;  4C1C A;  3ZNB A;  4EFZ A;  4P62 A;  4HL2 A;  5AXO A;  3BC2 A;  3T9M A;  3PG4 A;  3MD7 A;  3SPU A;  4EYB A;  4WD6 A;  1MQO A;  3AJ3 A;  4YSL A;  5LM6 A;  4ZEJ A;  5EVK A;  2YCB A;  3AF5 A;  1DDK A;  2M5C A;  2YNT B;  4D1U A;  3PY5 A;  2BFZ B;  1WUO A;  3SBL A;  2BG8 A;  1XTO A;  5IQK A;  4JO0 A;  5ACT A;  1L9Y A;  2FU9 A;  4GYQ A;  3X2X A;  3IOG A;  4DIL A;  3IEM A;  5HH6 A;  4GCW A;  2BFZ A;  1X8I A;  2YNV A;  2BG8 B;  5EW0 A;  2AZ4 A;  4AX0 B;  3BK2 A;  2P18 A;  5AHO A;  5A0V A;  2M5D A;  2FM6 A;  3BV6 A;  4PVT A;  1DXK A;  4RM5 A;  4BP0 A;  4D1W A;  2BFK A;  5FQC A;  3X2Y A;  3BK1 A;  2DOO A;  2ZNB A;  4EY2 A;  2BG2 A;  2Q9U A;  2GCU A;  3X30 A;  3G1P A;  4RAW A;  4RL0 A;  5LMC A;  3ZQ4 A;  5EHT A;  3AF6 A;  2GFJ A;  5K4K A;  1YCG A;  4J5H A;  2ZO4 A;  1E5D A;  1VGN A;  5K0W A;  1SML A;  3VQZ A;  5LE1 A;  4H0D A;  4TZ9 A;  3I13 A;  1X8G A;  3P2U A;  4TZB A;  5ACU A;  2WYM C;  3IE2 A;  1M2X A;  4YSB A;  4Z5Z A;  2BG6 A;  3ADR A;  4UWR B;  5EV6 A;  4C1F A;  3S0Z A;  2Y8B A;  4UBQ A;  4XUK A;  3ZWF A;  3DHC A;  4D1V A;  4O98 A;  5KIK A;  4C1G A;  4RAM A;  3H3E A;  3QH8 A;  4C1D A;  1WW1 A;  4C1H A;  4ZNB A;  3WXC A;  3ZR9 A;  1QH3 A;  1DD6 A;  5FQA A;  2FU7 A;  4RBS A;  2I7X A;  4TZF A;  2A7M A;  5ACW A;  2GKL A;  1A8T A;  2QDS A;  4UWP B;  3KNS A;  4NQ5 A;  5HH4 A;  2YZ3 A;  2QED A;  4D1T A;  2P4Z A;  4Z60 A;  2YNT A;  1XM8 A;  1K07 A;  5ACV A;  2R2D A;  2BFL A;  2E7Y A;  3SW3 A;  4F6Z A;  2AIO A;  2Q0I A;  5HH5 A;  5HIO A;  3T3N A;  4U4L A;  4KEQ A;  2NYP A;  4EXS A;  2P1E A;  1YCF A;  3KNR A;  5B3R A;  1Y44 A;  2P97 A;  2CBN A;  2XR1 A;  3VPE A;  3I14 A;  2YNW A;  4EXY A;  2H6A A;  3ESH A;  4KEP A;  5AEB A;  5ACX A;  5DPX A;  2I7T A;  4C1E A;  5LS3 A;  2WRS A;  2Y8A A;  4UAM A;  1JT1 A;  5FQB A;  2HB9 A;  3I11 A;  4RL2 A;  3F9O A;  5EWA A;  4TYF A;  2QIN A;  4AX1 B;  3RPC A;  2NZF A;  3DHA A;  5EV8 A;  1ZKP A;  3SFP A;  1BMC A;  2BMI A;  5K4N A;  3A4Y A;  1YCH A;  4NQ4 A;  1HLK A;  2VW8 A;  5KIL A;  4B87 A;  4FR7 A;  3T3O A;  1A7T A;  2Y87 A;  5AHR A;  1JJE A;  2ZZI A;  3I0V A;  5ACS A;  4ZO3 A;  1BVT A;  4UWS B;  2Q42 A;  2I7V A;  5A5Z A;  4TZE A;  3I15 A;  1ZNB A;  2NZE A;  2OHJ A;  2Q0J A;  4CHL A;  4PVO A;  1VJN A;  5K4M A;  4FSB A;  2OHI A;  5LCA A;  2WHG A;  4LE6 A;  2WYM A;  3DHB A;  3IOF A;  5HIQ A;  3TP9 A;  4ZO2 A;  4EYL A;  5EH9 A;  5AXR A;  4AWZ A;  3RKJ A;  3SRX A;  4XWW A;  4Z7R A;  2DKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...