2Q43A

Ensemble refinement of the protein crystal structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords IAA-amino acid hydrolase ILR1-like 2
total genus 113
structure length 375
sequence length 392
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q43A01
4EMEA 2WZNA 3B35A 2PJ4A 2EK9A 4NGRA 4B6ZA 3B3VA 3FECA 2ZOFA 4P4FA 4TNUA 8CPAA 2IJZA 2C6PA 3PB9X 4YWYA 1IGBA 1YLOA 4UF4A 5DS0A 2XEGA 3WC7A 1OBRA 3VARA 3IO1A 1ZLHA 3B7IA 1BPMA 2ZEHA 3H8GA 2AFUA 2JBKA 2ABZA 4MHPA 5F09A 4JYWA 6CPAA 2NSMA 3WT4A 3NH5A 5LRJA 3BI1A 3BHXA 5LRGA 1DE4C 3TX8A 2PCUA 1BPNA 4P4EA 3KASA 2PVVA 2AFSA 1ELMP 4NGSA 3I1UA 4NFRA 3N5FA 4UEZA 1ZG9A 3PFEA 4MCPA 1VHOA 2OR4A 4UEEA 4DYOA 1VHEA 3SJEA 2HC9A 3D7GA 1PYTB 4UEFA 2ZEOA 2RFHA 4PXCA 3GUXA 3SI1A 2PRQA 2AFOA 4X2TA 4MMOA 1EE3P 4MCRA 3FEEA 4MHZA 4RUHA 5K8OA 4OMEA 4P45A 2GREA 4OC2A 1LOKA 5HVFA 1IY7A 4FAIA 4EFDA 2IQ6A 3VATA 4P4IA 2Q51A 3H8FA 5J1QA 3VH9A 4NJRA 3IJ3A 1DTDA 2JBJA 3KR5A 2PJ5A 4PXEA 4P4JA 3FEDA 2NYQA 2QVPA 1ZLIA 4OIDA 3PBBA 1LAMA 4OKOA 4A38A 5LYLA 1TKJA 4Q7AA 1CP7A 4O23A 2C6GA 2FVGA 4ZY0A 3NH8A 2AFWA 2G9DA 1LFWA 1ZG8A 2Q4ZA 4OC1A 3NFZA 1F2PA 3SI0A 1RTQA 3JRUA 3NA6A 1AYEA 1CPXA 2PJ1A 2RB7A 1TXRA 3D67A 4IAVA 1Y7EA 2I3CA 3PBEA 5D8NA 1M4LA 1HDQA 3KHXA 2VL1A 1CG2A 5HVGA 1BAVA 1LAPA 5IB9A 3D4UA 2C1CA 3CDXA 2BO9A 5HXDA 1Z8LA 5JH9A 7CPAA 1KWMA 3IIBA 2C6CA 3K2KA 4P44A 3HLPA 3PB7X 4MCSA 3KI9A 1CP6A 3PB6X 4KSIA 3TC8A 4R8FA 1HEEA 3NH4A 2ZEEA 4W9YA 4G1PA 1QMUA 5LRKA 2PVWA 4NGPA 3B3WA 1YMEA 2JEWA 2PJ0A 3QNVA 3ISZA 2PJ7A 4A39A 4FUUA 4ZX8A 4ZY2A 2EWBA 2CTBA 3PB8X 1YW6A 3B3TA 4OP4A 3WC5A 2WYRA 2ZEPA 4UIAA 3BI0A 4R76A 5JM6A 1LANA 4X3RA 2PJ6A 3CPAA 4H2KA 4NGMA 4IK2A 3B3CA 4P10A 2POKA 2ANPA 1XBUA 2PJ9A 2V8DA 5D29A 1R43A 4BD9A 3KHZA 1VGYA 1ARMA 3IC1A 3FVLA 4NGTA 3D7HA 4MRIA 2AFXA 4WWVA 2HB6A 1YW4A 3PFOA 3K9TA 4CPAA 4PQAA 5I4MA 1GYTA 2PJ2A 2V77A 4K3NA 2QJ8A 3L2NA 1NSAA 4OC3A 1LCPA 1BLLE 4EWTA 4MCQA 4PPZA 3DLJA 1XFOA 5LYFA 3WC6A 2ZELA 3S9MA 1TKFA 4OC4A 3DGVA 2ZEDA 3IEHA 4MXUA 2PJ8A 1XMBA 3B3SA 4OC0A 1XRYA 3BXMA 1QQ9A 3LMSA 1AMPA 2ZEMA 1UWYA 4WJBA 4AXVA 3FH4A 5THWA 4ONWA 2PJBA 1VIXA 1FNOA 2EK8A 3KQZA 4R7MA 4F9UA 4OIWA 4OC5A 1XJOA 3HUVA 1ZG7A 2O4HA 3D66A 1F57A 2BOAA 1ARLA 3KQXA 2DEAA 4PXBA 4A37A 3V38A 3MN8A 2GLJA 2ZEGA 3LWUA 2PIYA 5LYIA 3S9NA 4YU9A 2PE3A 2V8VA 5HVHA 4FWUA 2AFZA 2CIJA 3D7FA 3KR4A 4NGNA 5ELYA 2GU2A 2AFMA 3FMCA 4NJQA 4LQGA 4F9VA 1Z5RA 3MRUA 4R6TA 2V8GA 3H8EA 5CBMA 3KL9A 4MHNA 2F8HA 3GB0A 2PJ3A 4MHYA 3FJUA 4Z65A 3RZAA 1H8LA 3FX6A 3FF3A 3KZWA 5CPAA 2ZENA 4X8IA 2J9AA 3IWWA 3RBUA 4IHMA 3D68A 3GLJA 4P6YA 2ZOGA 1TF9A 3WABA 4P4DA 2GLFA 2XEJA 5LYDA 4PXDA 4TWEA 2XEFA 1CX8A 3IFEA 1TKHA 1R3NA 2PIZA 5K8MA 3S9LA 3ISXA 3CT9A 3RAMA 4JZ0A 3PB4X 1Y0RA 1TF8A 2ZEFA 2Q43A 1CBXA 1JQGA 3SJGA 4NGQA 4A94A 4ZY1A 3T8WA 3CPXA 2XEIA 5JGFA 2OOTA 4ZI6A 3B2YA 2CF4A 3SJXA 2CTCA 4DJLA 4UIBA 4F8ZA 4ZX9A 1PCAA 3SI2A 2V8HA 2O53A 1HDUA 4ZYQA 4GM5A 2F7VA 1CPSA 1YSJA 2PJAA 2PJCA 2QYVA 1Z2LA 5K8NA 4P4BA 3KGQA 3V7ZA 3PEIA 3SJFA 4FBEA 3D7DA 1Q7LA 1FT7A 1F2OA 2BCOA 2IMOA 4DUKA 1ELLP 1Y0YA 5K8PA 3PRTA
chains in the Genus database with same CATH superfamily
4F4KA 2HBQB 4DV6F 2XMMA 3FMWA 3THTA 1WKLA 2VJVA 2ASDA 5EUHA 3GV8B 2DVIA 4C0BA 5C42B 1FJGJ 2VDIA 3FCHA 2X1GA 3DYAB 1S1UA 1FD2A 2GS8A 3MI7X 4NZ7A 4RLEA 4C2YA 2WPWA 4ONUA 3J80U 3G87A 4B11A 3H8GA 1FRMA 5KFIA 1EAYC 4F04B 4CI0B 1RAIB 2LKZA 1L3UA 2GIRA 4PWDA 4HR2A 1BWEA 2AHOB 5LRGA 4PYAA 3W2WA 2VBWA 3PYDA 2FHKA 4GVBA 4MCPA 3F0NA 2V6AA 4DSLA 1RTIB 4DUTA 1S9EA 4LF2A 4M5JA 2YTCA 2FQQB 5L1LA 1FY7A 4EVYA 2VZ9A 2CJKA 2UXDJ 1UFHA 3QO9A 4ZVPB 2OKQA 2B6AA 4CQ1A 4UCNA 4OHZA 3RB0A 3I96A 1WG5A 4CRYB 2Q6CA 3AA8A 2GQCA 4DHVA 3H98A 4USWA 1KLMB 4RI1A 3K2YA 5KOWA 1IKXB 4KIAA 1OIAA 2BQRA 3EVWA 3R5CA 4PK3A 3W5ZA 2KYXA 1LWEB 5H9FJ 1K4JA 2JRSA 3GIUA 3DN9A 4CRZB 2NS1B 3Q8PB 2AX1A 2XTJP 4QOTA 3EXCX 5HVGA 4TKTA 2GVZB 2CKWA 1K1SA 1YX0A 3QGIA 3O3LA 5DM7Q 4LF6J 1XF8A 5JH9A 4EZ6A 2Z3KA 2EI5A 4E8UA 4X62J 4LF4J 4J9QA 4ZK7M 1QSNA 2GX8A 4WF9Q 1OY6A 4G1PA 2YKNA 1UAWA 3FXTA 4RR5A 1EB0A 1MMDA 1ZTTA 1Q5YA 1Z8XA 3D3BJ 4F50A 3TOBA 4ZY2A 2EWBA 4KHRA 2KU7A 3GCWP 1U6FA 2ZEPA 2AV5A 4LJMA 3J81j 4UIAA 4MIAA 4IKAA 1S1XA 2D1CA 1LANA 2Q04A 5E5NA 3MM9B 2UP1A 3R5JB 1J5OA 2N7YA 3MPVA 2CPHA 1JNRB 2V8DA 5D29A 1YK3A 2W24A 2IRYA 1PAEX 3CJ3A 1C0UA 4J5OA 3I4PA 2G0IA 2MQPA 3VGVA 2M8DB 3KNGA 3KLFB 3K7RA 2WOMA 4KS9A 3MAHA 1I1GA 2MZTA 3GR1A 4DL6A 2ZM6J 2XS2A 1FI4A 4DSJA 2R7VA 5C2GA 3PKYA 3T1HF 2VA2A 3IAM9 4UWJA 2AJ0A 1VYAA 2CAJA 2XCAA 2YNDA 3HF5A 4V19X 2UUBJ 3VWEA 2ZNYA 2PJBA 3KLVA 3UCGA 1RWWB 4XNHC 1XR7A 2DR6A 3D66A 1RT3B 3POTA 4I49A 4BBHA 1YRTA 1JLGB 2JH3A 2FVRA 5GAHI 1QSTA 2PIYA 2QC3A 2RD5C 4NA3A 5KT4A 1QSSA 3Q2SC 2WONB 4EFAC 5I3UA 3SI8A 3FEYB 3GWCA 1D9DA 5EN1A 3V4IB 4JYAJ 4RNNA 4C9DA 3UCUP 5C5JA 2Q3PA 1FXLA 3I5CA 1CM0A 3SFUA 4RL1A 1IR1A 3LP1B 4ETXA 2YNHA 3KKFA 2KZZA 1U45A 1HHTP 3N6LA 1CSJA 1CC8A 3GB0A 3TNVA 2IC3B 2LXFA 1UWAA 4U9YA 9RUBA 4PCQA 4NLPA 1S6OA 2DNNA 4F8RA 2ZENA 3H4DA 4DV0F 1JIHA 4AVBA 1NB2A 1LXJA 2ZOGA 4C2XA 4ECRA 4B3RF 3NAIA 4WPAA 4ES1A 3SDEB 3UVJB 5GVQA 5M2UA 2X7BA 5KTQA 2VKZG 2RH3A 4IO1A 4A8SA 4F7VA 1P6TA 2AQ4A 2AJQA 2ZC3A 2R8KA 5F8LA 4OJ3A 3MDFA 1RQ0A 2LQ5A 2NQPA 3T19A 4Y2AA 1OQ6A 4KE5A 1HA1A 2KH9A 2ATCB 4HI1A 5KFAA 3M05A 4DR4J 3PW2A 1ZPWX 1W25A 3B2YA 3SXNA 1S77D 2ZBQA 4XAKA 1RWPB 4QB9A 2FC8A 4UIBA 1S6PA 3CCSS 2AZ1A 4USHA 5D4LA 3RTVA 2VEZA 1JMTA 1DURA 1NAQA 3TA2A 1W2BR 2PJCA 3RNZA 3V7ZA 2XBPA 3BGFA 4MFBA 3MMJA 3UCZP 1NPRA 3V5RA 4HDGA 1OWXA 4Q0BA 2X1AA 2CWXA 3CW2C 1G3OA 3IR7B 3GONA 2EBGA 3KLIB 4WP8A 2GQ2A 4NGRA 4B6ZA 2B9YA 1CJVB 2W9BA 2XMJA 3DGPB 8CPAA 3A8KA 1T9TA 4K30A 2NSBA 2OEKA 2B4DB 3TO8A 1M90T 1WK4A 3GFYA 2EXUA 3MGJA 2HFVA 1SJFA 1WF2A 2E1CA 3FQKA 2L9WA 4HT7A 4X4QA 3H5YA 2B5JA 1IIDA 2KJVA 3HDSA 3HXMA 1UCNA 1OQ3A 4KSFA 2M9KA 4R3KA 2H5IB 3MCSA 2XMTA 2PCUA 4IR9A 2AFSA 2HNZA 2G2OA 1WF0A 1N34J 1ZG9A 1JLEB 1QE1B 1JJHA 1T95A 3KLEB 1HBOB 5JVGQ 4UEFA 3T1YJ 4BWJA 1V3SA 1WC1A 1FKPB 2MQ8A 2AFOA 2VA3A 2BACA 4X2TA 4NXYA 2GHPA 1H3DA 4MHZA 3KG4A 4P45A 3QFHA 1BWVA 6FDRA 1FXDA 1S1XB 4DR3F 2Z3NA 1O0PA 3O1LA 4LQ9A 3KR5A 1U0HB 1YITS 4CH0S 4YS2A 1OY8A 3DKDA 5A8WA 1FKPA 2IM0A 3BR8A 1EIYB 1H73A 2IMWP 2KO1A 3MOZA 3SQGA 1KN6A 2YXLA 3T41A 3TAQA 1RTHA 1TXRA 1PUAA 1X4EA 2MSTA 1Y7EA 3I31A 2FE7A 1NDKA 1TVRB 5IB9A 1Q2CA 3A3OB 4AL5A 5AE2A 1Z2ZA 3P2HA 2V50A 4ICLB 2HIYA 2WVFA 2V69A 3QRQA 3SCKE 2QLJB 4KRWA 3B4MA 3H2UB 3V4MA 4C11B 1QMUA 1Q82T 1SC4B 5I3QA 2YQ1A 2NMTA 2VKRA 1NK8A 5ETSA 4A39A 3S6GA 1VKCA 4D3GA 3VZHA 3JXOA 2BJ1A 4C7HA 2CTBA 2COLA 4J3GA 2MKCA 4GO7X 3KTQA 4QWBA 4JV1A 4NGMA 1SJQA 2PDAA 4C8LA 2CA9A 1UP1A 1YJTA 3IS9B 1R43A 3W1YC 3QATA 4PWDB 3GV7B 1VQ8S 2ZEJA 4OX7A 3IG1A 5LXYA 2ZJPQ 1Z4EA 2HZVA 3RRHA 3AOCA 2CQ2A 2PJ2A 2DIVA 2FT0A 2QJ8A 3MUVP 1MSWD 2J9DA 4G3IA 4PG7A 3PO5A 2B5GB 4NASA 2QGFB 4NCGA 2WBRA 1S7NA 1WELA 3MXHP 4UWIA 4UUXA 2WBMA 1X9MA 5G0RB 5IWAJ 2R1IA 4RS2A 1F5BA 4F0KA 4OC0A 4UFWA 3BXMA 4M6HA 3LMSA 3AD9C 2ZBPA 4XDDA 1KTQA 4KHMA 1M1DA 3VV2B 3AH6A 3Q8UA 1KR4A 4P2XA 2EK8A 4N7TA 4P6QA 1TL1B 3QGHA 3M9MB 2MSSA 4L75A 1NB7A 3UW1A 1WSRA 1YRUA 2J5AA 1WDTA 4EO6A 3V6JA 3OSNA 1SB6A 2I00A 2FL4A 1QM9A 4RW4B 1SH0A 1TIQA 1F1BB 2KDOA 2W9AA 3DDNA 1DY3A 3NMRA 3P3DA 4JI0F 3HT0A 4LSLA 2R8IA 4B3MF 2PSWA 3OR1B 3OXFA 1W2IA 1W7WA 3FRMA 4LQGA 2RHQB 1ELOA 1WHWA 2V94A 3H8EA 4JI5F 2Z3OA 1QVFR 4MHYA 4NLVA 3KLIA 2JDCA 1MMNA 5FLXY 3FX6A 1IBLJ 2B3UA 1Y0HA 4UOCA 1H6KX 4WU2A 1VQNS 1YR0A 1OY9A 5KT2A 2XEXA 2FXFA 1UA0A 1CX8A 3CDUA 2CVIA 3ILJA 3CD0A 2LXIA 3HFVA 3FZ2A 2IA0A 5KFUA 2XMVA 3D1QA 1TKXB 2MLYA 2W8KA 4GXHA 2ZEFA 1B99A 2WVCA 1G2EA 2AJ2A 2VPWB 3W6XA 2N3LA 4RUAA 1HMVB 2XEIA 5JGFA 3W5YA 3ENWA 3V2UC 1T9WA 1X0FA 4PQUB 5HP1B 2FPHX 4FZVA 1QSMA 2DGVA 1TKXA 5SZTA 4K4VA 1JLGA 2LU2A 1QSOA 1H98A 2JC0A 2EO8A 4LSLB 4TU9A 4USUA 3TZXA 4R8UB 3HHLB 1WHYA 2Y8WA 5H84A 3WQPA 1Q7LA 1HMVA 2Z4PA 2B4OA 4HDHA 2BCOA 3DDDA 1YX2A 2BW2A 4USJC 4KV8B 4B10A 5HP1A 3U27A 5A2QY 2L08A 2W9CA 1YJUA 1IKYB 2JL9A 3ZTPA 4DSFA 1VK3A 4D3HA 2B7BB 1B4SA 3BF4A 2GVDB 1ZLHA 2HG4A 2E1PA 2NUUG 2GE3A 1PGZA 1OJ4A 3BGOP 4OYZA 3K58A 2JBKA 3QBCA 3D0IE 3VF0B 3DOMA 3NG8A 2JZ5A 1V5VA 1OPZA 2PVVA 3V4IA 1RBAA 1ELMP 2ABYA 3ENQA 2ZH4A 3M2VA 2NYHA 2H54B 5BR8J 2XYPB 3H59A 1T0TV 2RF2A 3Q24A 3TEGA 2H4YB 4HVZA 3K9UA 4Y49B 2NXEA 4AXIA 1YBUA 4M5IA 5C2CA 3CF5Q 1IBMJ 3CCRS 1FX2A 4CCHA 2VUGA 4UFXA 4F2SA 2GO8A 4N47A 4ZN3A 2Z3MA 2ZH7A 2CPEA 1RXTA 4CTAB 2L41A 4DUZF 2JWNA 3ZZZA 5HROB 4DR6J 2G3TA 2RQCA 4IRCA 2XS5A 2B51A 4DF8A 1YRXA 5E41A 1TKJA 2Z2YB 5CD4A 3MUMP 2XULA 1M5VC 4Y3CA 2XCPA 1YQHA 3W7BA 4KGMA 4K4SA 2K06A 1DBDA 3QQCD 3A4TA 4LX9A 3TUPA 1AYEA 4QW9A 1B70B 5A0YB 2F8MA 5F0UA 3SSQA 1BE4A 3S8SA 3BQ1A 3AOBA 2BM0A 5HXDA 3SHPA 4FD4A 4DR7J 1AUSL 1N0UA 3JTNA 3W66A 4DSKA 2D3UA 1LWFA 1X8DA 3PYGA 3WDOA 6AT1B 1MK4A 4JI6F 4K2JA 4IFVB 3MR7A 2ZEEA 5LRKA 2PVWA 1TK8A 4BINA 2UZAA 4I6WA 2AEJA 2CRLA 2QA4G 4DV6J 1CJTA 4ANEA 2KN4A 3DYAA 2D69A 4ES2A 1PG5B 2KG0A 3OTDA 3BI0A 2B5GA 2DCLA 5JM6A 1FJGF 1S6QA 3V6HA 1PYSB 3IBCB 4H6UA 3HPOA 4LRDA 5C88A 1IKXA 1T11A 3G6YA 4NA2A 2AEFA 1CS4A 3FEZA 1RTJB 2GJ2A 1HL6A 2B5JB 4PG6A 1U0HA 4I2QB 1HYSB 1VGYA 3UDCA 3QAYA 4WWVA 2ASLA 1OZPA 5HH1A 5IQQA 4DL3A 1YW4A 3PFOA 3IM8A 2E5LJ 1LWEA 3D2PA 4LUBA 3EY5A 3H5XA 4JB8B 1S6QB 4DV3F 5KFKA 2HKEA 4J9PA 4OV1A 4ENOA 1Y9WA 4WTOB 4V1Ak 3DGVA 3A8EA 1KRPA 4USMA 5J2QB 5D77A 2HHVA 2QMXA 4FPIA 1R8HA 1T02A 3EVMA 3GR0A 1Y9KA 4PG8A 2KVIA 2KRRA 3C2PA 3UPFA 4ZIWA 1N5SA 2CPDA 4TYBA 5HLFA 2DRDA 4DNCA 3KK1B 2O4HA 3I0SA 1TR0A 1U1PA 2PEBA 4PABA 1ARLA 1Q86T 5KFGA 1XIQA 3KDOA 4YEAA 1UWBB 4DQSA 1Q8IA 4NMXA 2GLJA 5ETOA 5FJ4A 2YNCC 4JV2A 2WVBA 2LVWA 1IWGA 3KHGA 4KGZB 2DPIA 4K4ZA 2AFZA 5GAEU 3HVTB 1L3VA 3U1NA 3R9GA 1A6LA 2UVUA 4OI4A 3G2XA 1IXKA 4BHQA 3NS5A 4OX8A 4P7VA 2Z10A 5LSOA 2GIFA 2OI2A 1C2PA 4BDPA 3PHEA 4TY9A 4OYWA 4ZN1A 3Q8VA 4AQYF 4CLZA 2QJ3A 2OTJS 3KZWA 3ETMA 1NJZA 4X4VA 4UW2A 1AB8A 3RJMB 1VHIA 2E9TA 4W98A 2RRNA 2ODFA 3I56S 3R6GB 4RO0A 3M2RA 3HK2A 1M0SA 3K8WA 2R8GA 1PBAA 4O3QA 3MPWA 3TJ8A 2BJ9A 5HQLA 3R3TA 1RHMB 4NGQA 2I6WA 2PFFB 2OMOA 3AAWB 1WI8A 2DY9A 2FS5A 1EQMA 5KFBA 3KYLA 2ZJRQ 4U8YA 2JFKA 4C8NA 4H89A 1M1GA 2IA6A 2XQCA 4N41A 1WOPA 5EC4A 2QV6A 2V8HA 4MJKA 4WCEQ 3EPGA 5AG7A 4O4RA 2XYHB 2I79A 5G1ZA 1FE4A 3W91A 2P6TA 3TZWA 2PJAA 2V4QA 2IBOA 4P4BA 3KGQA 1U2CA 2IC3A 2ALZA 2YNEA 3MMAB 4X4OA 4QIVA 2OPSB 5EBVA 4BCAA 4JI8F 4HTJA 3FECA 4OZLA 3EGVA 2ZKUA 3ILIA 2A18A 3EYZA 2GQQA 4MI4A 4DL0C 1M4IA 2IJZA 5K5MA 3A9LA 4ECVA 4IFYB 1P9QC 3GE9A 5KFYA 1RYRA 3IWLA 4LFBJ 4OJHA 1S1VA 3D0GE 3O6QA 3AODA 4XTTA 3OL7A 5ETRA 2YNGB 1B0VA 2AYMA 3OL8A 3KHRA 1YGHA 1T7PA 5J1NA 3WX8A 3FFIA 3VGTA 4R25A 3PFEA 5ETQA 1IWAA 3B8HA 4IQXA 5G0RA 1VHEA 5I42A 4WFBQ 5KOXA 3B54A 3GUXA 4CRJA 2LQ9A 2MKIA 5IM0B 1KQSR 1N34F 4MCRA 3CNQP 3MEGA 2Y1LB 3OFFA 2H3EB 1QSYA 3LACA 2HHTA 3DLHA 3QRPA 1KHVA 1WD6A 3JUWA 4CM2A 1S1WA 4JI2J 2Q7SA 4ID8A 4YY3J 1LAMA 4DG1B 2B7CB 2CXAA 5LSLA 2KHCA 3AHPA 1CP7A 2NZCA 1WOSA 4ZITA 1D09B 1SH2A 4WFYA 2CXEA 1Q8BA 2FVPA 4C3KA 3KFWX 4JI6J 4WZMA 1SCJB 2DXFA 3G82A 3FCVA 2JDJA 4DL2A 5KFRA 2HEKA 2YKPA 1R57A 3TVZA 2OZHA 2YNFA 5DO2A 1UA1A 4ED6A 2ZW5A 4KY3A 2F4VF 4TVAB 3QT5A 1UZHA 4LR8A 5K9FA 1RACB 4ZLPA 1JLBA 2BQUA 1CJTB 2A2DA 1MLAA 1QY7A 4B3TJ 3HP6A 1P4NA 1KC8T 7AT1B 2ATLA 2C6CA 4ZHRB 5LOQA 4ZIVA 4MKAA 1VQ5S 4NXMF 1J2VA 3HSGA 3G71S 3LGHA 3SSRA 3QO9B 5GADI 4NGPA 4DL4A 4W90B 1J5EF 3QZ8A 2W8LA 2GMLA 2CIMA 1I1DA 2IFXA 2X1FA 2ZC4A 3ZZ0A 3R1HA 1WORA 4L3KA 5F49A 1XMOF 4CLWA 2OFGX 2Y3YA 4FYWB 2HURA 4LFBF 4P10A 3NP5A 4PEOA 2AIRB 1IU8A 2CPIA 2PJ9A 2XSFA 1RLDA 1SL1A 4QW8A 5SUHA 4HKQA 2LQJA 1X5OA 1XN9A 5MLCV 2ZE2B 3D1HA 4FPRA 1KBRA 1QE1A 3K9TA 4CPAA 5I4MA 4X65J 2JNJA 3B78A 1HBNA 1SQGA 5KFFA 4GC6A 2VG5B 1SUQB 3ISND 3W5XA 3HVRA 4OC3A 3VWDA 1EQ0A 4QVTA 4PG4A 1QAXA 1QAJA 4J9NA 1TL3B 3WC6A 4WE1B 3OBIA 4P2MA 2X51A 4CLTA 4CGMA 2FHOB 2PJ8A 1RT1A 2DHXA 3JSMA 4YB1P 3Q8YA 4QWDA 2JLEA 4YDXA 3M8YA 1RAAB 1NRKA 2Z2LA 1XJOA 2P8IA 3HUVA 2GIQA 5D4NA 1ZG7A 5D78A 3RRKA 4TY8B 2FLPA 4C7IA 5E3AA 1XNRJ 3OVSA 2NCKL 8ATCB 5CAAA 2CNLB 4Y2CA 2DK2A 3DRPB 3P5TL 3IXQA 2P6GA 4F0XA 3R9LA 5A28A 3D6HB 2CQIA 5DZ7A 5J1EA 3FEXB 4NRUA 1PC4A 2ZNZA 4S0MA 2EFPA 3TT2A 3EDRB 5C42A 5DETA 3HCXA 2V0NA 2LP4A 1RWMB 1YK9A 2WW4A 3S6HA 3CZXA 2BUEA 2AJ4A 1MW7A 4B3MJ 4OMFG 4IUFA 2J9AA 4KOXA 3DRPA 5KFJA 4KOYA 3W2VA 3WABA 3CD6S 2C3UA 2MQNA 1RT6B 3MPYA 5L39A 3GG0A 3FBEA 3NLCA 4DFPA 1GK8A 2GGPB 2DHGA 5CQGA 5GAHU 4RNOA 2VFRA 4EGLA 4FNIA 3RAMA 1TP7A 3KNAA 3PB4X 2HFZA 4OX9J 1HBMA 3G6XA 2BABA 3CJSA 3MPUB 5K14B 4DZDA 4QPXA 5F9NA 4LF5F 1BQNA 1GAOA 4NLSA 1B0TA 4RW4A 5ETMA 2HLTA 1OO0B 2BYCA 1KTVA 2BKPA 5HMNA 1HNVB 4CYUA 3BJYA 3TR5A 3IRXB 3N28A 5G20A 2QIRA 2O66A 1NK6A 4GM5A 2F7VA 2EVNA 3DRYA 3QSIA 2HAIA 2DR7A 1E6VB 4MYUA 1VFJA 4AD6A 4K0KJ 2EC0A 5LJ3Y 4QYZJ 1GX5A 3S01A 3VAMA 3ZZUA 1TKTB 2A10A 2NR0A 2Y1RI 2YH1A 1PAUB 5JVHQ 1HW8A 4AL7A 4IRKA 3BS9A 1TL7A 3Q22A 3PB9X 4KT0C 2U1AA 1CS4B 1DTQB 4FN5A 3G82B 1LWCA 1HQUB 2QA1A 3TUIC 1N33J 3B8GA 4ILLA 3HD2A 1BOBA 4HH1A 1S0VA 4DU7A 1UWBA 4GS4A 3OTEA 5J2NB 3TQ1A 2RT3A 4UQTA 1RHJB 2UUAJ 2XWXA 5IXUA 2AKWB 4CAWA 4ED2A 4OZ1A 3V81A 5F8JA 1BQMB 4URGA 5T7LA 2GHWA 2V8PA 2VFVA 1RT4A 4OZJA 2HQYA 2VQFJ 4RN7A 4ED8A 1Y10A 1XJWB 3M8QB 1JK9B 4Y00A 1HPZA 1HNXJ 2PMWA 4P7TA 3DXSX 1QSRA 3VH9A 3CXCR 3CJ2A 5KFSA 4OZ3A 1Y5IB 5D4OA 3PBBA 5H9FK 4A38A 5DLGA 4YFJA 2X3DA 3MAAB 2FVGA 3KUEA 1S9GA 1M1HA 4MKVA 4A47A 4LREA 4GMKA 1S59A 5AXKA 1U8SA 3ETOA 4J9RA 5EDWA 4IOBA 1YBAA 2BXJA 3E2EA 4M5NA 1UVNA 3SZ2A 2DRBA 2XZDB 1MJBA 2VL1A 1CG2A 4HLBA 4EZ9A 2DD8S 1M1KT 2LFVA 4OV6A 3MECB 2CJQA 3LOUA 1N48A 3PY8A 1F2GA 1RWOB 2K7KA 3FDSA 3T6BA 1VMBA 3BJ7A 3CULA 1DFDA 3I6PA 3D6MB 4MYTA 5HQ8A 3NH4A 3TUZC 4F2RA 2GO9A 4C0HA 3BBBA 3ISZA 2W9CB 2JDDA 1BLUA 2HGLA 2MZQA 3V6DA 2XG8A 2V9KA 4ZCLA 2J7WA 1YREA 1G6BA 3WC5A 1LWFB 1WG1A 5A8RB 2ACYA 2BX6A 4J9LA 1SJ1A 4UOGA 3S1TA 2YX4A 3CCWA 2Z3PA 3PW5A 2H5MA 2PC1A 5HBMB 2KVQE 4R3LA 1XBUA 2LCWA 4I2PA 4WP3A 2VC1A 3WIVA 4PKDB 4O0IA 2MDAA 2ZD1B 2CJAA 2W2QP 4BS2A 1GYTA 2JC1A 1MG7A 4OFZA 1IR2A 3RG6A 1M5KC 2EK1A 2CQ4A 1WC5A 1S1UB 3T5LA 3UDLA 1TUVA 4H4KC 1FHTA 3DCAA 3MGDA 1LK7A 3KJVA 3LANA 3MUTP 2XO6A 2C3OA 2DKOB 1D3WA 1VHSA 4FYXB 2XMKA 5HN0A 3KQZA 4U9RA 2CQBA 5KG3A 1S6PB 3N6MA 2QYCA 2J6UA 2KTQA 1Y7PA 3BREA 2OPQA 2ZW4A 2B9XA 3V38A 2JEGA 2VOOA 5C25A 4LQ6A 1WF1A 5FLXU 1XIXA 2VODA 3D7FA 1F3VA 5ELYA 4HTIA 2GU2A 4BC7A 4OX9F 3R1LA 3NS7B 4ZJOA 1SKSA 4A32A 5IB0A 3FJUA 2W1BA 4LF8J 3PM9A 2G4BA 4WKYA 2FIWA 4GKKF 2NSCA 1DTQA 4KFBB 3PZJA 1HI0P 5KFOA 5A8KB 4X66F 4P6YA 4F36A 2XM3A 2DR5A 4C8ZA 5LYDA 1VQMS 3ADAC 3DM2A 3D3CJ 1FFSB 3LPEA 3ONQA 2PIZA 2DPSA 4OI1A 4B14A 4L73A 2HVDA 2GFQA 2R9LA 3CT9A 4KOSA 2R42A 3TJ9A 2E1RA 4Q5VA 1DZ5A 3L3CA 2QL5B 3LTOA 5B0FA 4HHJA 5HLFB 1B7FA 4JUZA 3CMQA 3CMAS 5CHCB 4ZY1A 2U2FA 2VBQA 3RR7A 4DR1J 4FYDA 4M63A 1IOIA 2VZZA 4DU8A 1U09A 4ZX9A 5GMKa 1HD0A 3D6FB 4ZYQA 1WHVA 4LF1A 3PEJA 2AGOA 5DDRC 1ZS6A 5EWGA 2EW9A 3D7DA 1S60A 2FIAA 2Z8QA 4I0WA 4JV5F 4IO9Q 2R3VA 1J5OB 2GCFA 3QAHA 1RTDB 2V63A 3MMCB 5D6GA 3FIXA 3KXDA 1FE0A 4JV0A 2C6PA 2XLIA 5D8HB 5T14A 4UF4A 1YHQS 3VWSA 3WC0A 2AGQA 4KUBA 4PZVA 5HMYA 3B7IA 1BPMA 3KLFA 3FK4A 4DX5A 1JJCB 4IG0A 2F63A 1Y4ZB 2XWYA 4UOFA 1GHEA 1IM4A 1JJ2R 2J6SA 1NH7A 1CJUB 3BHXA 1DE4C 3TX8A 4NSQA 3EGWB 2ADBA 1KONA 3KWMA 2CJBA 4RKUC 4ZCKA 3CCMS 3IAS9 1GXLA 2HBRB 1KOOA 5J2MB 3SJEA 1V9OA 5JXSA 2BANB 5CYMB 1EKSA 3IWEA 2ZBRA 2FC9A 1LFPA 3OXLA 2ZPAA 4NYOA 1IYKA 1T9YA 1N5YA 2RDDA 4MMOA 1HWLA 2DNKA 4OC2A 3QYYA 4NCAA 2YQ3A 1TMJA 3I87A 1DTDA 4KKOB 2PJ5A 4X2BA 1RAGB 2ALYB 2AT1B 4JOUA 2EFGA 3TEHB 1DLOA 3PHTA 4HNWB 2C6GA 3Q8SB 1S97A 1HWIA 4KORA 3I5AA 2AYGA 4F4XA 1NKBA 3EZOA 4ZGYB 4O0NA 4DLEA 2D3O1 1WC6A 4K7QA 5KG0A 2HRYA 4X5KA 2YH0A 4Y2KA 3MMBA 1U4BA 5KFNA 2VBXA 4DWIA 3KHXA 4B17A 4Z2XA 1BC6A 3I55S 3CDWA 1AUGA 2B4UA 4NZ6A 1EJ7L 3MMAA 3PXGa 3NXZA 4QQBA 2EBJA 3MMBB 1U6ZA 1SL2A 3FSXA 3NEKA 4TQRA 3PB7X 1OYDA 1TKZA 1RYSA 3QGPA 3DU6A 3H0PA 2WB4A 5EGYA 4W9YA 2CNSA 2E9RX 3MZIA 2E5IA 1QAYA 3DMJA 2C2RA 5IT4A 3KG0A 2ZW6A 1WC3A 5A2QU 3SV3A 2OO4A 1IJEB 4M5MA 3TO6A 1GXUA 1N4LA 1UPPA 4CM0A 4IRDA 3PGPA 1R8AA 4N8OA 3PZPA 2IJNA 3DOKA 4R0EA 3NBPB 3MOJB 4DUYF 2I5JA 3B3CA 1ZPVA 5LMNJ 1XR5A 3TZYA 2EUIA 3UD4P 7FD1A 3KHZA 1GEHA 1S72S 4ILRA 1U2FA 1YDLA 5LL6d 2W4CA 3CD7A 4DPUA 2D4PA 4KFBA 2V77A 4M95A 3CJTA 4O3PA 3ENAA 1AZSA 4KOVA 4JLYA 3Q89A 1W26A 5IFMA 4ZPAA 1RGVA 2ZZMA 1PYTA 2N7CA 4EYIB 3IEHA 1K0TA 5J1PA 1NU4A 1UMJA 4XK8C 2UXDF 2KFYA 3O44A 2CQDA 2WZ1A 5D0RA 4C8MA 4KGXB 4OIWA 3LWLA 5LSRA 1HWKA 4UTGA 3J81Y 2BV3A 3CXQA 1Q16B 3SCJE 1FXRA 5BYSA 1S9EB 3GJSB 4BC9A 5EX3A 5E96A 2IAJB 4A8XA 5LYIA 1MROB 1R6YA 2B58A 1RWKB 3BPDA 5DRKA 2LEBA 4C8KA 4CAFA 1HBOA 4DS5A 4P75A 2VQYA 1BO4A 5HI7A 3OHAA 2CQPA 4NA1A 2D3ZA 3VALA 3J7A1 2QA4S 4F9VA 4EUVA 3AT1B 2IVMA 2D9PA 3TWZA 4B9TA 2RNEA 1Q78A 3P6YC 4NLWA 3TYTA 2FTRA 2YKOA 1Q5VA 2OD4A 2CYYA 2K5TA 2MZSA 4F6AA 3R5BA 2XEJA 1TFYA 5AE3A 3D0HE 2VG7A 3NGRA 2CADA 3MFIA 4XPCA 3OFEA 4CT9A 3Q86A 3KK2B 1XMTA 1HI8A 1AT1B 5CZXA 1FRJA 3M32B 3H40A 2V2KA 2EFVA 3ILLA 3TE4A 3AJ2A 3DI6B 4CP5A 1RHRB 4FD5A 2JEVA 2FCKA 3GIJA 1K8AT 2IPOB 3CCTA 1VLYA 3FSIA 2BUNA 1VHFA 5B0CA 4F25A 4QU6A 3C19A 4O3OA 1FDDA 2LA4A 1NK0A 4LF7F 2B4BA 4YR0A 1HWJA 2J8RA 1HHQA 3JSMB 4C48A 2QRRA 3TCVA 1WEZA 4F67A 4ZVUB 2R7SA 2AP6A 3B82A 2WZNA 3B35A 3M6VA 2ZOFA 1VBXA 4OQJA 3DRRA 1FDAA 2REEA 2QZ8A 1X9SA 4WYWA 3C14B 1X5TA 4TU7A 2YX7A 4RBTA 1KQGB 3CJKA 4MFLA 5HO4A 2GW8A 3IO1A 4QBJA 2L3MA 4F4ZA 1WC4A 4I7FB 3JB9k 1CEZA 5MAOA 4I4BA 2HQCA 6CPAA 1RCOB 2W2NP 2HFSA 3HT3A 3MEDB 5LRJA 3GPAA 1ZO0A 5ETTA 1NH8A 4JD6A 3KASA 1EZZB 3S6EA 3I1UA 3MEEA 2J0XA 3NS6A 2HNYA 1TZ0A 3TVYA 1SXLA 3W6SA 1ZH5A 2DITA 4DYOA 5CYQA 1XC9A 3P8BB 5IS2A 4J9UE 4AYBD 1VRUB 2J8NA 1S0NA 1HNWF 3NNHA 3HSZA 1N56A 4QCLA 2EFOA 1YJNS 4EO8A 5HVFA 2BQ3A 2Y0BB 4YB5A 1VIOA 3BKTA 3FBCA 4U7UD 3VGSA 2FZGB 1AXQA 4R5PA 1S76D 2JBJA 4JI4J 3BO2A 2JLGA 2BJ7A 5IM0A 1FRKA 4KLVA 4WFNQ 5HSPA 4K4TA 2VV5A 1VRUA 4QR0A 3VTIA 2QA2A 4DSIA 1B6BA 1QVGR 1KNZA 1ZA1B 2PDOA 1F2PA 2DGOA 5H9EK 2JVOA 2B56A 5LT5A 2ZKTA 1SJ4P 3MAAA 3M9NB 2LEAA 1S9GB 3NE7A 4IG0B 1HNZF 3OLAA 2BE9B 4MK7A 3DRSB 4P44A 3P96A 1URRA 3U02A 4E2AA 1EETA 4KSIA 3V81B 1H0HB 2K8GA 2BOPA 1T3OA 1YMEA 1QSLA 4DBQA 4CNZA 1F5AA 4YR2A 1B3TA 1PJ6A 3R8YA 3Q0AA 2OIHA 3EXYA 4F0HA 2UV8A 3WBZA 1LWCB 1RKJA 4CO3A 2IM3A 5M2RA 4ECYA 2GAHC 5AXMA 1R8CA 3TVKA 3DRSA 4NXNF 1X7VA 1WWHA 2PJ6A 2JVRA 1U6BA 2FLOA 4C0OC 4MK8A 2DY1A 3KOAA 3BSAA 2ACMA 2DGXA 3CO9A 2V68A 4Q0BB 1VC0A 3GILA 1VJWA 4P71A 2IDLA 5HJYA 1YGYA 4MIBA 4YOEA 5JUMA 1JXVA 4PQAA 3J80Y 1QLNA 1N5QA 4K3NA 3OT9A 4P72A 4FKXA 2FZKB 4C4WA 3TFYA 1HPZB 5CCMA 1RTDA 1YLXA 4K4YA 5F3TA 4KSEB 2MHEA 2P5VA 2VI7A 1N5YB 2ZITA 3PJXA 5HROA 1XWLA 1RISA 3OR2B 4RW7A 1UWYA 1U7LA 2OPRA 2R7HA 2R98A 5THWA 4WWSA 3M8PA 1OYEA 1SI9A 2MKKA 3GYGA 3VAIA 3WIUA 2LEPA 3KMSA 3G3SA 2C2DA 3S6KA 2QFIA 3KQXA 2EG2A 1S4EA 4A30A 2Z2ZA 3DC2A 5E2QA 4LF6F 2D41A 4A4JA 1GT8A 3S9NA 3KUGA 2FJWA 2V8VA 2QE5A 3R2DJ 2HGNA 4YHHF 2M52A 5KT6A 5AJ3F 3LAKA 2BA9A 2HVEA 2RKIA 2CQCA 4O44A 1FTCA 1RT2B 1H8LA 1HHSA 2PSZA 5IT9Y 2WSEC 2ZDPA 2GJFA 4H54A 3QPIA 3IWWA 3RBUA 4F4YA 3D68A 1U2RA 1YVFA 4WBFA 2IM1A 3R9EA 3KK3A 4Z7YA 2IDEA 3HI9A 4OYMA 5K8MA 4ANDA 2CDRB 5HBMA 3QAUA 3GTYX 4KAIA 2ZUGA 4V19J 3JTPA 4N56A 2WSCC 3QFWA 1Q0NA 2CZ9A 2Q66A 4WK3A 4ZLNA 3GIKA 4DV7F 4FVCA 3TTHA 4X64F 2YNIB 4ZJLA 1S7LA 4M5DA 2VB6A 1VBZA 4M3SA 1U47A 1AW0A 4LQ3A 3K0JA 3JTKA 4CYNA 2E7WA 1M44A 1CC7A 4CO5A 4LSNB 1NUEA 2HZAA 1WOOA 2M70A 2YWGA 4ID5B 3QRRA 1LK5A 2YPZA 1UFLA 2FHJD 2C2OB 3BDEA 2O3DA 3PJ9A 3UD3P 4WIIA 1IKVA 3SBMA 3GMGA 1K73T 4Q8EA 2RS2A 4FS1A 1RA6A 2CQ1A 2V4RA 5DDQC 1P1TA 1OPIA 1MN7A 2AD9A 1TK5A 3M2UB 2ZE2A 3D6TB 2JJ4D 1S0OA 4A48A 1YVKA 3EMTA 1R27B 4DR6F 2DT9A 4ALZA 3PDNA 3LP2B 1O5JA 3RBEA 4UEZA 1UJ4A 2IYGA 3MM9A 4ZJQA 1Y9OA 3PR5B 3BQ0A 1GQEA 1RTJA 4RUHA 2ZUAA 3W65A 3MCOA 1BQMA 2IRUA 4QR2A 3LUYA 4FAIA 4DX6A 2HHHJ 5ADZA 4FD7A 3NL0A 3CGIA 1T9XA 1J27A 1NSLA 4Q36A 4P4JA 3T5KA 3CJ5A 4Z7CA 2HVIA 1UL3A 3MM5A 5AXNA 4CYOA 4CO0A 2B9WA 3VCDA 2CPFA 1RBOB 3LP0A 2J0QD 3KG1A 1ZTWA 1SIWB 2YWEA 3DLEA 2XLKA 2VXKA 1CPXA 3CMES 4TYAA 1FJEB 1CJUA 3ZC4A 3DOLB 3QIPA 1KFSA 4FYYB 3FCWA 4KR0B 5LJ5Y 5E3QA 1BAVA 3OSPA 3HULA 5F9LA 4NLGA 3TX0A 3KK1A 4KHPJ 3ZFVA 1KWMA 1QUVA 2RIJA 2OAUA 3K5OA 4BLGA 1GMUA 3G8QA 4USVA 4E2FB 2GA7A 2WUUA 3MMCA 4FXWA 2O1PA 1KS2A 3C6UB 1KVKA 3AY0A 3J7ZT 1NSQA 3DR8A 3C14A 1Q53A 3M6UA 4Q43A 3MM7B 2H65B 3IBFB 5DDOC 4RNFA 2B43A 3NOGA 1NLKL 3NWRA 2XMAA 2EKYA 1FNMA 4ATNA 2BM1A 2HFNA 2NREA 4NCZA 3D7HA 3NNCA 1UPMB 4Y6IA 4LF7J 2IY5B 1LW0A 2N3OA 3N7ZA 3NBPA 3T1HJ 4HACA 1T03A 3M30B 4JI1F 2R7WA 3MM7A 3EFAA 2J8AA 3P49B 2FSRA 3PJWA 2F40A 3QLHB 1R0AA 1PIEA 3DRRB 4YB6A 2VDHA 3N5BA 5DQGA 2A0FB 2BE2A 1Z9UA 4RZRA 2BJEA 2L9NA 3M1VB 4WJBA 4AXVA 2HNDB 5EWFA 3NGUA 3JTOA 2QSFA 2MJNA 4OC5A 4U5YA 3PR4A 4P2FA 1JLCB 1KFDA 5FIIA 1TMMA 4Q44A 1DTTB 1RT6A 1DQAA 2HBZB 3L7PA 5JJBA 4JJXA 1G1XA 3BKUA 2ROPA 3LWUA 1ZM9A 4LBIA 3CC7S 3K5LA 1IKWB 3LGNA 4OI2A 3ISNC 3E51A 2E44A 2CIJA 1HBMB 5IC6B 4OHXA 2I2YA 4ZP7A 2XMWA 2AFMA 2QLXA 3MCMA 1U02A 3GIIA 1Z5RA 1TL7B 2FLNA 4B9UA 2XC9A 2NLWA 4E98A 4OHVA 2VASA 4MHNA 3MD3A 4DDFA 4FS2A 4WKRA 4W4MA 2VOPA 5CXTA 2UXBJ 2HQGA 1T03B 4WZQA 4IHMA 3CCJS 2KXNB 4ZOSA 4MT1A 1YTYA 2Q7BA 4PXDA 2ZBCA 4DOZA 1TKHA 4DS4A 4X4UA 5J2NA 4C2MA 1L3SA 1FFGB 2JEJA 3PYFA 4IH5A 2YNIA 2NXNA 3ISXA 4JXQA 2R8VA 3HZGA 1VBKA 4HT5A 2JEIA 2QX0A 2VZYA 3VVTA 4KTQA 2HNDA 1K1QA 3M6WA 2Q43A 1JQGA 5FD1A 1BQXA 2QL9B 1QAIA 5A76A 1XNQF 3GSIA 5HMWA 4F4AA 5KG4A 2FJDB 1UEUA 1MROA 1HW9A 1P9YA 3SEOA 4QYZK 1CJWA 1UVLA 2FHMA 4DV4F 2WAQD 2E5JA 4ANCA 3ZXWA 1BGXT 5G22A 1RT1B 4LF8F 2J0WA 1DQ9A 2BEIA 1RHUB 3HKWA 3H2LA 1HI1A 2ZZNA 3HLUA 2J6TA 2GMHA 1JJ4A 3QIDA 4GO5X 3DLKB 4YP3A 4LVNP 4L3NA 2G0JA 1VRTB 5KFEA 3M8PB 1YQEA 1CQNA 3UN3A 3VAKA 5DS0A 2HRTA 3OXGA 4X4TA 4CIOA 4DUYJ 3D4JA 5DS7A 5LMNF 4LVOP 2KXFA 1TL4A 1JKHB 3CB4A 1UFWA 2R7UA 3WC2A 1TL3A 4M5HA 3FC9A 3ZZOA 1NK5A 1FWLA 1JLAB 4HNYB 4DV0J 3LO3A 4O4GB 4MY3A 2OR4A 3LW5C 3JS9A 2B3VA 4OYPA 3PW0A 2K2PA 3HSJA 4PXCA 2C2MB 4RW7B 3IGVA 2DGQA 5F46A 1EE3P 3RBZA 4ZLLA 2HSEB 3DLEB 3IA0A 3PEHA 2B0GA 3RBDA 4ED4A 3T1AA 5ETVA 3T6JA 4P4IA 4QC6A 3OW2R 1NE9A 3FBUA 4DR4F 5KFHA 3IM9A 3ZZPA 3DNSA 2NYQA 3BH7B 5BYRA 4OIDA 2ZD1A 3T9NA 2GFFA 1PJ5A 4OZ2A 4DPXA 4NLUA 1S5KA 2FB0A 2VONA 2Q4ZA 1HIYA 2HWHA 4Y34A 2V34A 4QUSA 4JP8A 2XY5A 3SI0A 1V6HA 3F8KA 4KVXA 5AE1A 4UCPA 3JVNA 4KH1B 1X4BA 3CD5A 2G13A 3E01A 1Y5LB 3IS9A 5AGEA 4OYIA 1TV6A 1LAPA 2OLWA 3CPWR 2HNYB 3M8SA 2DH7A 1DHMA 2YKAA 4IG3B 3W8GA 4OYXA 4AE5A 7CPAA 2WVDA 2CPJA 3GP9A 2H5JB 5KT3A 4DPOA 2CQHA 2XY6A 4NRTA 4R8FA 1U48A 1N0VC 3BN7A 3RO0A 3C15A 2PJ0A 3QNVA 3IWNC 4IG3A 3JSRA 4QIEA 2Y9HA 2P0WA 4XPKA 1JLFB 1RADB 2RDJA 1S1VB 2HQIA 4OP4A 3R6LB 4WFXA 3SCLE 2Y0SD 4DQIA 4WU3A 1WNEA 4H2KA 1Z1ZA 2KCWA 4I68A 1CJKB 3G8WA 2CDQA 2H4WB 4IK2A 1JLFA 2ANPA 4IH6A 4ZVSB 2IJRA 4AT1B 4F4WA 5U47A 1UKUA 2R8HA 3V6KA 2OH1A 3PP9A 4EWTA 7FDRA 1RU2A 3K5NA 2PR1A 4DCOB 2C42A 1HNIA 1KLMA 1TKFA 1XMBA 4B13A 4WXOA 2IVYA 3R7NB 3RB6A 5HMXA 3FQLA 1UVJA 1T94A 5HK4A 1ROFA 2UUAF 4C98A 3U7JA 1NXIA 2C3PA 5L9NA 4PV6A 5IV3A 1U1NA 3QZ7A 1ZA2B 3V8IA 3N4WA 2ZWPA 4JI4F 1F57A 3MM5B 4IUSA 4N5SA 3D2MA 3FKBA 1ICEB 5GMDA 3I5BA 3DLGA 1LRZA 3B4DA 4AUKA 4J37A 1N8RT 4YU9A 4LRBA 2VBZA 4FWUA 2Q6BA 1U24A 1U6MA 2BKNA 3F41A 4YN3B 2NZ4A 2IAJA 1WEXA 4PAAA 5CBMA 4MJ8A 3TARA 1HD1A 4DV5J 1WKKA 1AZSB 3R2CJ 1Z8WA 1RI7A 1GXTA 2Q4YA 1VQOS 5IT0A 2DGWA 1LW0B 3GLJA 3BO4A 4R8UA 4CO1A 4P4DA 1C0TA 2L48A 1IM6A 1RU1A 3F73A 4NWBA 2B8PA 3UO0A 2PT0A 3CTRA 1Q7YT 4CT8A 2WTFA 2UU9F 2HQ3A 2DPTA 4JZ0A 1UTAA 4CO4A 2VG6B 4KV8A 3TOQA 3RGIA 3NCQA 4A8KA 2CQ3A 2W2OP 1SV5B 4I6YA 3QJLA 4Q8FA 2WONA 2F9JA 4C68A 1NPKA 3ZTSA 4ECXA 2DISA 3L95X 2FJXA 1DAXA 1FO1A 3HHKA 2VD3A 1NSPA 2CF4A 3CCZA 3HO1A 2VG6A 2XI3A 3KLGA 1L3KA 4DJLA 2MQMA 1PCAA 2DH9A 3M9OB 9ATCB 2OZUA 4K8RA 2HLUA 1Y11A 4NLYA 1N6QB 1V5IB 4K4XA 4MAKA 3AB2B 1I94J 4B9VA 1YJWS 1H2TZ 2BRLA 4E0AA 3BDPA 2MPUA 4B12A 1P8GA 3MEKA 3PRTA 2FJBB 3ZZTA 3B3VA 5CD4H 4DL7A 1XERA 4ZPCA 1YLOA 4LSNA 4QR1A 1TL5A 2GMJA 1GTEA 4HHUA 2KG1A 3UQSA 4Y0FA 1GNKA 2O28A 3P45B 1F3FA 2NSMA 3NH5A 3D9BA 5B7WA 2J8SA 1IQZA 5KFWA 5L1IA 1N33F 3SSSA 4RNMA 1RABB 1F9EB 1ZM4A 2J7UA 1Q2DA 1ZOTA 4PG5A 2DBBA 2HS0A 2HV2A 1PYTB 3CVKA 2RFHA 3JQKA 4LUAA 2BE2B 4UOHA 1HR0J 1RTZA 4ZVOB 4TY8A 4FXVA 1HARA 3WHIA 3RB4A 4DV5F 3ZO7A 3GJQB 4OMEA 3EUNA 5A0YA 4J9SA 2FJAB 1BMQB 2LQ8A 1DRZA 2A4NA 4N77A 4X65F 4RBVA 1K47A 2PA8D 4U9ZA 3VATA 4B9NA 2JX2A 5HJXA 4NEXA 5KTCA 1X31C 2Q4VA 1SVDA 3HJFA 2UVWA 4J9VA 4PXEA 4B3OB 2RRAA 2N4DA 2QVPA 2JOQA 5DM6Q 1ZLIA 2ATRA 2MJUA 2WPXA 4OKOA 4ZHRA 5AG5A 4BWMA 3TP2A 3R27A 2C2KB 1RHQB 5GMEA 3R5DA 2DO0A 4M1KA 1N5TA 1FK9A 2G9DA 1G7CB 3OUYB 2W7OA 2RE1A 2RQMA 5DGAA 1ZG8A 2E7XA 5BXIA 2ZDOA 3BYPA 3J7Z5 4Z37A 3D1OA 3QNWB 1R8BA 1MJ9A 3SXOA 2W2MP 4RW9A 3TRGA 4U96A 1RXOB 3OUYA 1CPZA 1SKUB 3AQPA 2VHGA 5GAGI 3KJQB 2MYFA 3W3SA 2KKHA 2ZW7A 4MCSA 1CP6A 3G4SS 4H4MA 1GX6A 2N82B 5GCNA 3HHLD 2PR8A 2IM2A 2DJWA 2RAQA 4A8MP 4CGPA 2Y1IA 1FDBA 2BR0A 5F8NA 1JB0C 4RBUA 4R87A 2UUCF 2Y0MA 4E0DA 1NSKL 2HNZB 1JWQA 2VICA 1XNQJ 1EARA 1HWUA 1YVOA 1JXEA 1VQ6S 1NKEA 3M2UA 3KDNA 1XEBA 2POKA 3QSYB 2V5HG 1UFKA 4USIA 2XO7A 1ARMA 2DNOA 2W7AA 1NDCA 1TAQA 2DGUA 4QYRA 3TO9A 3D8PA 1S9FA 3NE8A 1VQ9S 2P9CA 3ZJ0A 3M8QA 1IVZA 4LFCF 1NSAA 2VJUA 3C6TA 3ZZRA 3EJMA 2FVSA 2FGCA 1LQ9A 5I3PA 1XFOA 4DR7F 1TUWA 1I5OB 3NGKA 1KUYA 3A8IA 3W8PA 2W25A 4ZVFA 1RT5A 4G1QA 2XZWA 3H25A 2GJIA 3OTOJ 1AMPA 2CNMA 3NGDA 1PO6A 1LXNA 4H4MB 1IBCB 1FJ7A 2VFUA 2QMWA 3H7HB 4MH8A 1C1BB 3H42A 3HHLA 5B0DA 2QECA 2CY2A 2IYIA 3KLGB 1U1QA 4PXBA 2Z30B 2PQ8A 2LQBA 3QWUA 2NXCA 4DPWA 4DCPB 5CZVA 3M2RB 4DR2F 3EX7B 1U1KA 1FFWB 3DDKA 3HVAA 1RAOA 2BE7D 3W61A 4IFYA 5KFXA 2QFJA 1TQLA 3IGNA 1RT7A 4CDIA 2DCUB 2KYZA 2HYIB 4UBRA 3L7UA 1C4CA 4B02A 1SQFA 3HHEA 5E3RA 3W62A 2RVJA 1F9FA 2F8HA 1T05B 3BGLA 1FT8A 1FX4A 2YX1A 1S7HA 3AOAA 4RWXA 3FF3A 2DNQA 2KT2A 3IWGA 1NPPA 1TELA 4X8IA 2GHVC 5E7OB 4KZTA 3A3PB 2R2UA 4DX7A 4A8FA 3KUHA 3SDEA 3T9ZA 2XGQA 3F5BA 4JI2F 4ES3A 5F47A 2W2PP 5D0GA 4F02A 2KT3A 3UDVA 4QJVA 1IICA 5A6PA 4O3RA 4PSXA 2GGPA 3P2FA 3VAFA 3OL6A 4OLPA 3SJGA 4M6GA 3IRWP 2Z2MA 1C1BA 3DHXA 1REVB 4HI2A 2AYBA 3CPXA 2YNCA 2VPZB 2KRBA 4A95A 1YBTA 3Q2TC 4NLTA 2BZ2A 4DV3J 2A6OA 2F4VJ 3FMBA 1UVKA 1SPBP 2OELA 4RW8B 3BR9A 1V3ZA 4AG9A 4Y2MA 1U1LA 3UNYA 4L6V3 3IU2A 3EC4A 3H5ZA 3C26A 4I7FA 3DRXA 3T5JA 2VFSA 5DWMA 2P9EA 5AG6A 1UJ6A 2D3OR 3PEIA 4EU0A 1RWXB 2YY3A 1NDLA 2G9OA 4DN0A 2UUWA 2MKJA 3MURP 4AQYJ 2PIIA 3JQMA 3PYEA 3S6FA 3UWTA 4DV4J 4ERDA 4CZCA 1IR0A 3C8YA 4CYQA 1MNEA 5AXLA 4K0KF 2UXCJ 2HIQA 2EK9A 1RCXB 1S7IA 3AXKA 3E3XA 5BR8F 1IYLA 3GJTB 1IGBA 1NBEB 3R7BB 4LF4F 3WC7A 2XEGA 1OBRA 3SFGA 2A6MA 5KFDA 1NJXA 1IBMF 1IKWA 2ZEHA 5KG2A 1FESA 3ENVA 1NHUA 4JYWA 1F9HA 2XHWA 1FWKA 1FRIA 1S1WB 4LF5J 1WG4A 2OPPA 3C66A 1M5OC 5GAEI 4DXLA 2HWIA 4ORFA 1VHOA 1JLQB 4JI7J 3BZQA 5KTAA 2HUZA 4DN9A 3D7GA 5LMUJ 1D9FA 2MZRA 2ZH1A 1K0VA 4EBEA 4NLRA 2LLZA 1FERA 4I2QA 1HYSA 1VC6A 2V67A 4RW6A 5C82A 2G3AA 3FEEA 1VQYA 3T1YF 1U1OA 2IQ6A 4XPDB 2Q51A 5HAOA 4U6PA 2X1BA 1VDHA 3N6NA 3IJ3A 1HBNB 2BMBA 4M94A 4DV2J 2CVEA 1RJJA 1X4GA 2MLZA 1WEYA 4O23A 1RWUA 3H8YA 3GKRA 2MMYA 5HMZA 2AFWA 4NL5A 3GFHA 1BXNA 4GKJF 2R7XA 3CCES 3V6DB 4IQMA 4UT4A 4MFKA 1X5SA 2P2CB 2E5GA 2I8EA 4NEYA 1URNA 3JYTA 1JLBB 3CCLS 1H72C 2K7JA 3D4UA 1ZYQA 4O4GA 3BEGB 3EWGA 5F8GA 2ZM6F 3J7AN 4DX8H 5K20B 3K2KA 2DXEA 3BLNA 4AXJA 2AU0A 4ECUA 2R8JA 4OI6A 4ITSA 2WSFC 3MM8B 4A33A 4FUUA 4K50A 2UXCF 3BYRA 3DOMB 3VQTA 1XBWA 3JYTB 3CSKA 3K5PA 1NNDA 1EP4B 4LFCJ 3JQJA 3CDBA 2NYIA 3U1LA 2QMLA 5ITHA 3EE3A 1O51A 2AE6A 4YDDB 3KLEA 3RYOA 3GQCA 3MEDA 2AJ1A 5BYQA 2QO3A 1YJRA 5IQ6A 3VR1A 4BD9A 1ZM3A 2ZHAA 3KMQA 2ADCA 4UCMA 4IR1A 2BANA 4MRIA 2YKNB 5CYQB 4OLOA 3U1MA 5DLFA 1XMQJ 2HB6A 2HVHA 2DXQA 5KT7A 2BKOA 3CC4S 5F8HA 5K14A 5CYJA 3VAJA 3RBXA 1KEKA 4R0JA 2D9OA 5LMUF 1PILA 4U7CA 5A8WB 4KYZA 2FVQA 1RBLA 5KFVA 3BSOA 2RS8A 4MXUA 3B3SA 3QAEA 4IDKA 2OEJA 2HMIB 3W2WB 2K3KA 1S99A 3FH4A 5L46A 4NI2A 1VIXA 3TAMB 1VQKS 2CUYA 3VZIA 2OJ3A 1B87A 3K5MA 3Q8RB 1LEOA 4U95A 2N4CA 1NM2A 2YKMA 4RW8A 2PMHA 3H5SA 2MQQA 3KK3B 1E6YA 3BSCA 4TQSA 1KLNA 2XMUA 2ZEGA 3BGRB 1F60B 2OMLA 5HVHA 2MB0B 2E29A 4NGNA 5FVJA 4YY3F 4KB7A 3H4QA 4J7CA 2DNRA 5ETKA 4H6ZA 4KVOE 2HHUA 3WR7A 3LQVA 2P6EA 4Y28C 5B08A 5L38A 1HBUB 4P52A 3LODA 1VLOA 2OD6A 2PFDA 1LV5A 1WJ9A 1BUXA 4B3OA 1VJQA 5GAGU 3FFIB 4M5DB 1H7XA 1Y00A 2PD1A 1YZ7A 2P9GA 3W2VB 2XEFA 1E6VA 3IFEA 1RLCL 2DNMA 3CJQA 1A9NB 2BJ3A 4EEYA 2J9CA 4MK9A 4FF3A 4DI6A 2V2VA 2NPFA 5C24B 3KLHA 5KT5A 3OR1A 1TF8A 3KKWA 1JLCA 4ID5A 4HH0A 1TU0B 1FA0A 2F65A 2BRKA 3ULHA 2XLJA 4A94A 4KPYA 3DDIA 4JI1J 2DNYA 2FZCB 1H74A 2FY1A 5J8CA 2MLXA 2J76E 2OHDA 2UUTA 3UI3A 5KG6A 3G86A 3ICLA 1IBKJ 1FDNA 3CE8A 2MXYA 4NYZA 5E3PA 1RUSA 1VOMA 2GC8A 2HHSA 1GH8A 4CAXA 3FZBA 1Z2LA 5B09A 5K8NA 4KOUA 3THPA 5CCLA 2ROEA 1FT7A 3Q8QB 2AF6A 4NYPA 2EWHA 2HK2A 1KKHA 1IN0A 3DFEA 3C6UA 5J8FA 1I6JA 4X66J 2AX0A 3JAMY 1M4DA 3GYXB 4HKFA 1T05A 1AFIA 2EEYA 4EK2A 1R89A 4CGNA 3OQ2A 3HVTA 1ZZFA 1C0TB 2B4VA 4II9A 1NJWA 4Q2LA 1B0PA 3CCVS 4ZP6A 2JLFA 3MWBA 3VGUA 4L76A 3TW0A 1BD6A 1L5UA 4RJVA 1YKWA 2KB2A 2RKIB 3D54A 3L4BC 3N5FA 2AZ3A 2HHQA 3CXSA 3UE2A 2OPRB 1S10A 2IHR1 2KJWA 1PJ7A 2HC9A 4KBIA 2RQKA 1C0UB 3OR2A 4DF4A 8RUCA 4OJ1A 4A8YA 4I2PB 3FUYA 1CBKA 2ASJA 2M5YA 2BJ8A 2CPYA 3EPIA 1IY7A 1JWWA 5L9XA 2QT7A 3GU0A 1CLFA 2FD2A 4CTAA 3C16A 4YR3A 4B3SJ 4W92B 2VG5A 3ZZIA 1IUJA 2M0GB 3AJ1A 4PYDA 2VF3A 4CLPA 1XK8A 1S79A 1HKAA 4U7UK 1OSDA 1KVJA 4MFJA 1O8BA 4L74A 2OZGA 4WFAQ 2X7IA 1LFWA 4JYAF 2F5IA 3CIMA 1X10A 3OPKA 3F0AA 2I38A 3OVAA 4MHDA 1RTQA 4ZPTR 3NA6A 5A8RA 1Y7RA 2W4DA 1TVRA 1SQHA 2C1EB 1HDQA 4AG7A 5L1JA 4FXDA 4CLYA 2XHCA 1REGX 4K59A 2C1CA 2GIVA 2BO9A 5D3GB 2F8EX 2B4PA 1I51B 1S3ZA 3IIBA 4ED1A 5KAKA 3HLPA 3JSYA 4IFVA 2FYXA 2F1FA 3TC8A 1C1CA 1ZAVA 4N8NA 1TKZB 1TV6B 3I82A 1KZFA 3A8JA 4FF4A 4C2ZA 1XTZA 2JEWA 2AMCB 2L9DA 3I32A 3X3UA 3HZEA 3MD1A 2CJYB 4ZX8A 2MGZB 4KSAA 3R5GA 4ECQA 3PB8X 1YW6A 2I9SA 5DGBA 2M3DA 1XE4A 4XPDC 4X3RA 2RF2B 3CPAA 1Q95G 3G8SA 3IU1A 4NE9C 4ZPDA 2CJ9A 4CS0B 4OYBA 5B0AA 1WHXA 1FK9B 4YGOA 1B7YB 1SC3B 1S1TA 2G0CA 3NWGA 3ELHA 3JSBA 1VBYA 3FVLA 4QWEA 2QG9B 4A8WA 1ZZNA 2MY8A 3TOAA 4NF1A 2OSQA 3TZZA 3HMJG 4LF9F 2BJDA 3I9V9 5LYFA 4BBYA 2W01A 2RC4A 3NKYA 1XMOJ 3CDAA 3GY9A 1N32F 2QMUB 4O3SA 1V3RA 4ZPWR 5JQ4A 3IR6B 3BKFA 2XZTB 5AG4A 3ZNUA 2PE8A 4ELUA 2WRMA 3T9YA 4EBDA 2W9BB 4Q45A 2HHPA 2BOAA 1QD1A 2XYGB 2ZHOA 2DHAA 4LR9A 2DB1A 2ERRA 2VQFF 3A12A 3P4UB 2VQEF 2EC2A 5IT9U 4IYQA 1FEHA 4KVME 3BH6B 4LR7A 2Q0YA 1NEEA 1FVSA 3MHYA 2QTWA 4PK2A 1VI7A 1HQEA 2KXHA 5J2QA 2F4FA 3DLGB 1U8WA 4KOWA 5D4PA 3M32A 3IRXA 4WK1A 1X4DA 2PJ3A 4G65A 2QN6B 3R95A 2ZZTA 2G2ZA 4QZVB 4YHHJ 4KQZA 4IH7A 5ETNA 5CPAA 4FNHA 1WWZA 2H51B 1BY9A 4DZ6A 4L89A 3OHBA 4MBUA 2W7PA 5I0CA 4TLRA 4WYLA 4DV1F 2GLFA 3PX4A 1NMEB 4X64J 1R3NA 3PW7A 2M7SA 1UVIA 2ZH2A 3B6BA 4DLGA 3DNCA 3EGNA 5IZHA 2QLFB 2OH2A 2ILYA 5KFQA 3G9CA 2OU2A 1Y0RA 2LECA 1X60A 4KGKA 4QBUA 3W60A 1K9MT 1SUQA 3OLBA 1L0CA 2WHOA 2J9EA 2H48B 3F56A 1N54B 4ZI6A 2PC6A 3SJXA 2GANA 2IRXA 3CJ8A 4QU7A 3BBFA 2C22A 4F8ZA 4X4NA 4ZP8A 2HRUA 1K44A 3WZ0A 3RAQA 4ZMMA 3A1YG 2RSQA 3VQSA 2ASYA 4CH7A 1WKJA 1MWZA 1RT3A 2E1AA 2QYVA 4CLSA 3SJFA 4A31A 4FBEA 5A27A 4ECSA 1FTRA 4DV7J 4I64A 1TKDA 2RUSA 4BMHA 3RRGA 5K8PA 3M6XA 1TFWA 2PEHA 2CPZA 1RT5B 4G1QB 2V4JA 4JBCA 4X4RA 2ROGA 2PJ4A 2J7KA 3N79A 1RO5A 3UN2A 2JLMA 2MQLA 4P4FA 4YRHA 2WOMB 3CIZA 4YWYA 1VCTA 2ARHA 1CJKA 4ILMA 2Z0ZA 4J9MA 2YWWA 5A6WA 2EBEA 3X1LB 3PRDA 4ZS6A 3EZUA 5EHHA 5DZ6A 3MM6A 1E6YB 3WT4A 3QLHA 1S5ZA 1EX8A 4ZLJA 1V0CA 4P4EA 3L9ZA 4RU9A 4GKKJ 1KD1T 1SC6A 1RWVB 1S6UA 3OJUA 4C97A 1RAJA 2HGMA 2W4PA 1KQKA 4ZVGA 3FBBA 2ZEOA 4JI7F 2MGZA 4XNHB 5K8OA 4PUOB 1LOKA 4JV5J 2E5LF 2RU9A 2Y8YA 1RA7A 4UQGA 3RU0A 4KJIA 3TA0A 4J9KA 2SXLA 4ELTA 1I21A 1I12A 3QT7A 4LFAF 2WK4A 1HNWJ 4QWCA 4TN2A 2I1RA 1UVMA 2J9DE 5T41A 4RW6B 5LYLA 2AYEA 2HFOA 3UR3C 4OX6A 4OI3A 2DIUA 3DMJB 4B9SA 1Z4UA 2PMZD 1UW4A 3BGUA 4USTA 3MPDA 4PUOA 2DGTA 4U67Q 3W9HA 1GMVA 3PVXA 4FBTA 1CJVA 4NLDA 3ZNJ1 3D2WA 1WI6A 4OADA 5CA5A 4G1IA 1R7IA 1UJ5A 3CJRA 1VC5A 3D7SB 2I5JB 1KHWA 1WTBA 2G2YA 3CDXA 2QL7B 1FKOB 4F0MA 3IBWA 1R6VA 3PTWA 4G6VB 2AJFE 3D3SA 4DL5A 2B3TB 4KLWA 1HEEA 1J4JA 2PN6A 3CEDA 5D0EA 2RJZA 2G0BA 2DNHA 3UFCX 3HHDA 2PI4A 4NXMJ 1RTIA 2C3MA 4ZVEA 1RP5A 4FF1A 5EX0A 4MFBB 1RE1B 1ON0A 1CQMA 1UEKA 1XNRF 1ITPA 1RZMA 4CGLA 5BJRA 4RX6A 3I3GA 2A2CA 3LP2A 1JLAA 4M5LA 5IV4A 2Z58B 2VPYB 4ZVRB 1IKYA 3VVUA 3OV7A 2ZH6A 3MR5A 4OI0A 4HEA9 3NMAA 2DR9A 4PSWA 4CLKA 1SJRA 1JLQA 3SXLA 3HM9A 1IJFB 2H9ZA 5KG5A 3UD5A 2MY7A 3PX0A 1ZAWA 4MKBA 1VR6A 2YWKA 4U8VA 4DQPA 4OC4A 4CAEA 3DLKA 4ZCMA 1JXLA 3QMQA 3DLBA 4OIXA 5B0EA 3EGZA 1G4CA 5KFZA 1Q79A 4UY85 1Q7LB 3IR5B 2DO4A 1RAHB 3BSNA 4NLOA 3C16B 3CJ0A 1N88A 5CABA 1O6XA 1RKIA 5J2PB 3D5MA 2H5EA 4F9UA 3PRBA 2Z11A 2ZH3A 4YMEA 4JXRA 1FD8A 5DDPC 3GIMA 1RB0A 3A13A 3FRYA 4NEZA 4X84A 1LW2A 4A37A 2FDNA 4TLQA 2JFDA 1LWXA 4K4WA 3H2VE 3GFZA 2CG4A 4LBHA 4B5PB 5IWAF 3GSDA 2PE3A 1S12A 2A1BA 2R4FA 2FY8A 3J7YU 3LF0A 3KK2A 3PIOQ 1NHKL 4XDCA 3FMCA 4NJQA 1VRTA 3OJSA 5KG1A 1ZETA 4YQWA 2HS3A 4R6TA 2HQFA 2XI2A 4WE1A 3MTKA 4ZBGA 3E0KA 2ZJQQ 1EHWA 1QUPA 4ELVA 2VH7A 2G1HA 1NMTA 4N76A 5JPHA 3MF5A 4K5SA 3NGSA 2JHEA 1KVIA 4QWAA 3SIPB 1NKCA 4OAEA 1TTHB 4DPYA 1IQTA 4WIQA 1EKRA 2R2SA 4H4KA 1VS3A 1F2HA 4ZP9A 2RILA 5J1EB 3O8WA 4NOHA 2IVFB 1WDDA 5IX3A 2XGPA 3JAMU 4R9MA 1FWPA 3TAMA 4C7QA 3T8WA 5KFLA 1S0MA 3M7VA 1NDPA 1KUVA 1HNVA 1D1UA 2YKMB 5C24A 3KLHB 4MIWA 2FJVA 3C15B 3HSDA 1IOFA 1AUDA 1FJCA 3UVJA 1Q8LA 2WSAA 4HL9A 1VQ4S 2CNTA 3IG1B 2C2NA 4B08A 2HMIA 3UN5A 1RAFB 1AFJA 4LF9J 3IN5A 2ZVSA 1Y0YA 2HS4A 4EMEA 5LM7E 2DNZA 3BM7A 3PV8A 4KC5A 4TNUA 1SBRA 3DLLQ 4DR2J 2KL8A 3MR6A 1H2UX 2KT5A 2CPXA 3IMQJ 3VARA 3G6ES 5B0GA 2LA6A 3N01A 3RW6A 4PRFA 2ILZA 4CO2A 2ABZA 2F3JA 1MWQA 3C3LA 1GMWA 4XO0A 3EVOA 4FF2A 2AW0A 1HNIB 3CDEA 2QSWA 4LFAJ 1TL1A 3CO0P 3LA0A 3PW4A 4RWWA 5I3UB 2MEWA 5DQHA 2B6AB 4GVLA 2YGWA 2ZXVA 2GVZA 2YPYA 4UEEA 3VHQA 2YWFA 4ER8A 5HQMA 4DUZJ 4KOTA 4MFZA 3SI1A 2PRQA 3AFGA 5H86A 2FIUA 1LNQA 2PRBA 2V2ZA 1PKUA 4DR5J 2YWHA 4QIGA 3GYAA 3NRBA 5C7PA 3DOLA 4CGOA 3K59A 3GZ7A 1PC5A 4EFDA 1T9VA 4DQQA 1I3OB 2RMLA 3AD8C 4NJRA 3VAGA 1GFWB 5KG7A 3FEDA 1UW9A 2K1RB 3DR6A 1M5HA 3H4BA 3EDQB 1FKOA 2CNOB 2VIHA 1IBLF 2E7VA 3QGGA 4C6AA 4I6AA 4EBCA 3P5BP 2DNGA 3LH2S 1GMWD 1WTFA 2YNFB 1SKRA 1JX4A 3NFZA 4UFVA 1Z8TA 1R8PA 2O01C 3ET6A 3JRUA 1HNZJ 1Y5NB 5KFPA 2PJ1A 2MKSA 2RB7A 4K5RA 3GIRA 4K4UA 4DPTA 5CH7B 4IAVA 4K2XA 2I3CA 5D8NA 4L8AA 4FKYA 4PPDA 2WCXA 2MHNA 4MKYA 1L3TA 3AA9A 3MR3A 3ZZYA 5HANA 2PA3A 2NXJA 3M8WA 4OJGA 4DG1A 4CH1A 4NZ0A 3KI9A 1NK4A 2YBVA 2XSJA 4LIRA 4L72B 1NJIT 4EYHB 3FRZA 2PJ7A 1U1MA 2HWTA 3RW7A 4F3MA 3CCUS 3TUJC 4WP9A 2BVZA 1REVA 3C46A 1A0OB 1S48A 4R76A 1KQFB 3DGPA 2D7SA 1RSCA 4KO0A 4B3RJ 2VU5A 3BQ2A 2MTLA 1NHVA 4GKJJ 1D9AA 1OSCA 4RNHA 3K57A 2D74B 2DYAA 4ICLA 4AFFA 2E66A 4ZVQB 1SH3A 5F41A 4NGTA 1RDRA 2DR8A 3DHWC 2F5GA 2OUGA 4KH0B 1UETA 1RHKB 4B3TF 4DSEA 2M4MA 5DQIA 2PI5A 3ZTQA 4PPZA 2CQGA 4C8YA 2IJFA 3DLJA 1RK8A 2MZJA 4OHWA 1DLOB 3RUBL 4CAVA 1TK0A 3S9MA 4A46A 2R7OA 2IBKA 3I9SA 4LIWA 2ZEDA 1FF2A 1JKHA 5DG7A 1ZBTA 2E1MC 1D8YA 3PKMA 1RTHB 1CULA 1XRYA 3J7YI 2OGUA 2UVVA 4LRFA 3S7RA 2GNKA 5HATA 3QWPA 1U25A 3TJAA 3BJ8A 4J90A 1KOHA 1SC1B 1SKWA 1TAUA 3SMZA 2DEJA 2BDPA 1M4GA 2YNHB 2VC0A 2G1DA 4TU8A 4R57A 2P6SA 4EMDA 3BN4A 4UUWA 3CJKB 2VQEJ 4DJBA 2DNLA 2QEXS 5L8RC 4XPLA 4GVBB 3MRUA 2EFQA 2V8GA 2BL1A 1X9WA 2YVSA 1N36J 2DEIA 3FYNA 5FDLA 4NPOA 5A8KA 5EWEA 3CJ4A 1VRQC 2LDYA 3MEEB 2YQ0A 5KFCA 2EVZA 1TUGB 3HHNB 3BV8A 2Y1JA 4ZCIA 4P9SA 1WUUA 2ZOMA 2DH8A 3FB3A 1X4FA 2ZWOA 4PWWA 3DSBA 1Q8KA 4DV1J 4KGVB 5E0OA 2J8MA 2GAGC 1BQNB 1NO8A 3KHHA 4DQRA 1QDUB 2B9EA 3G6VA 3M8RA 2IL4A 2OEMA 1FRXA 3BGRA 1IKVB 4NCBA 1SIZA 4GRSA 2UU9J 4WXWA 4ECWA 2JSXA 3AD7C 2XS7A 2KM8B 1U0SA 2CTCA 1QTMA 1NZAA 4A8QA 4ZVTB 2J0SD 3R96A 1R0BG 4ZVHA 2IIHA 3NAHA 3WX4A 4LSZB 5DWNA 5LXRA 1OMSA 2RRBA 3SI2A 4NMLA 3M8ZA 4LT6A 4UZBA 1X0PA 5F3ZA 1KP6A 3DM2B 4NXNJ 5DJBA 3I0SB 1HBUA 2WW8A 5ETPA 4OHYA 1F0XA 3SCIE 2IMOA 4P73A 3O5TB 1D8ZA 2HHWA 4F3QA 5DG9A 3KHLA 3ITHB 4H4OB 1GTHA 5BWAB 2GV1A 1N5VA 1RWNB 4OZ0A 2YKQA 3US5A 1VQ7S 4JWPA 1S7KA 5AJ3J 4QIFA 2AFUA 4TXSA 3I0RB 1LW2B 3TI0A 1XQIA 3BI1A 3NCPA 2ZH8A 2UVRA 3MR2A 1BPNA 3C6TB 2FLLA 4NGSA 4NFRA 2XSJB 1FKAF 4LRCA 1ZM2A 2K3IA 5E3CA 4FVMA 4OZ5A 3LP0B 2AGPA 4DMZA 2Z57B 3HHLC 4URSA 2GZOA 2HHHF 2CFXA 2HPUA 3GJRB 1N36F 3R5AA 4YFUA 2DRAA 5CNPA 4C11A 1ZAXA 4NI2B 1EETB 3GYNA 1X5PA 3H8FA 4ZA1A 1HR0F 5J1QA 2BSWA 4IF5A 1FVQA 4ZKAA 3AXMA 4O3NA 3FBFA 4Q7AA 1KUXA 3O2IA 3SYZA 2NPIA 4M8LA 3POTB 4ZY0A 4Y65A 3MM8A 2RQ4A 3DXBA 3I9ZA 5J2MA 1WC0A 1NJYA 2ZVIA 4OC1A 4ECZA 4FBUA 2EG1A 4DCJB 2DHHA 4RUCA 3M1VA 2CQ0A 1R31A 2AWZA 1MMLA 3D67A 5CYMA 4I1TA 3MM6B 4X62F 4ED5A 3SQOP 2HFUA 1Y3JA 5IC4B 1J5EJ 2XNQA 1H2VZ 1UEVA 3HD1A 2CG8A 2Q44A 4HACB 1QJHA 2M8HA 4HYKA 1X4AA 1WACA 3B3WA 2WB1D 3N9UC 2DTJA 4CYUB 4ECTA 5D3GA 1Q81T 1MN9A 3MCNA 3GG1A 1ACMB 2RUGA 1WSVA 2OPSA 4P2SA 3PCOB 1R0AB 2CJXB 3GCXP 3B3TA 3OFGA 3DOKB 4UY8T 4CLUA 3QJPA 1Q4RA 2E5HA 3PIPQ 1HFEL 3KJFB 3W9IA 3OTOF 2K1RA 4X4PA 4AVCA 4J9OA 2APOA 2R2TA 1IB1E 1DQ8A 2AFXA 2PGCA 2E9ZA 1T9UA 3TAPA 1VQPS 1HQUA 1U1RA 1FRLA 1HNXF 4KKOA 2XY7A 3HJVA 3BB5A 1S57A 1M5PC 1LCPA 4DFMA 3T5HA 4MCQA 2R2RA 2XNRA 1YJ9S 3RR8A 2CNNB 3PNIA 1MU2B 3UDEA 2REFA 4CNYA 1QQ9A 2RDIA 3NOCA 2KFNA 5F8IA 3VAHA 1XOVA 2OPPB 3E8OA 4DR3J 5EMIA 3PG9A 2BW7A 4ZDNA 2EPIA 3TANA 3Q23A 2QLWA 3MEGB 2DEAA 2H1YA 2FUG9 2DGSA 4ZPVR 3MN8A 2ZH5A 1LOUA 4JI3F 5J2PA 5L1KA 4X4SA 2FVCA 4DFKA 3KJVB 4NLXA 3NCRA 4FDFA 2M2BA 3GFXA 4C3MA 1FEEA 3RZAA 1MWYA 4NLQA 3LALA 3THVA 1APSA 2O67A 4QIWD 1ULRA 1P1LA 3M4XA 1HQEB 1M5SA 1RAEB 2MQOA 2VG7B 4Y2IA 1N32J 2P6FA 3TA1A 5AT1B 1NCLA 3UY5A 2EK6A 2ZHBA 1MU2A 3S9LA 3GV5B 1XEZA 5G4DA 4I56A 4DFJA 4PQUA 3NGTA 5G21A 4MFPA 2R7RA 3QJJA 3IGRA 1C4AA 1XR6A 3R9FA 1KSPA 3EO4A 1JLEA 3AB4B 3TQEA 4OLLA 1X12A 4CLLA 1SV5A 3HFZB 3OTCA 2FJEB 2EKNA 4AL6A 1P27B 5F0WA 3BBCA 1MJAA 1LKZA 2O53A 1HDUA 3H5UA 3CC2S 4UZCA 1YSJA 1X4CA 2DNPA 5ETLA 4MFQA 4FP9A 4AVAA 2BBEA 1F2OA 2XB2D 2Q1LA 3EXNA 3MECA 3BPSP 3TO7A 1ELLP 4EI2A 3RYLA 3R1KA 2HAFA 4F26A 1I94F 4NX9A 1T8EA 3W63A 3FGVA 3I4HX 4DEZA 1PBUA 2AJ6A 3K89A 3CWJA 2DHSA 3NY0A 3H90A 1BHNA 4P74A 4RUBA 2RU3A 3QB8A 3FVYA 4B5PA 3T3FA 2HQDA 3L09A 2MKYA 3R97A 4MHPA 5F09A 4O44B 2KI2A 8AT1B 2UV8G 4USKA 1RT7B 4HPSA 4DR1F 4QPTA 3EICA 4PR6A 4XIUA 2UUCJ 3UNGC 4JI3J 1YZ6A 5DG8A 3W9JA 5KFMA 1VISA 2HZCA 3T90A 2AEMA 2OFHX 1EP4A 2F9DA 3N0VA 4M5KA 2LU1A 3E01B 5H9EJ 2OPQB 2NUHA 3FNNA 4IDKB 3CCQS 2CZVC 4JI5J 2OTLS 3OFHA 2JEFA 2Z0GA 1N52B 3FSYA 1DARA 1KDNA 4IOCQ 1YJ7A 5B0BA 2UUBF 2GREA 2HBYB 4RW9B 1YIJS 4UA3A 1F6TA 3DU5A 4NCGB 3R7SB 2ZH9A 1NK9A 5H1SV 3OL9A 3M30A 4DR5F 2DF5A 2I0XA 2YNGA 4PWUA 2OP5A 5GADU 4CYPA 1H7WA 1Y3KA 4C3LA 2FHJA 4LBPA 3J81U 5JMNA 1CVJA 3NH8A 3HFKA 1DJ0A 3F44A 2UXBF 1X4HA 1YJVA 2OB0A 4MY0A 2Z3LA 1U26A 1PU9A 1VK8A 3PBEA 1M4LA 1A2ZA 3NNAA 3KJNB 1DTTA 1FNXH 3LWMA 2A3JA 2X3GA 1Z8LA 4R5PB 3RB3A 4ED3A 4GC7A 1S1TB 5IV0A 3EZ5A 5KFTA 2R7QA 5ISVA 3FNCA 4ETZA 3PB6X 4XPEA 4RU2A 3MTJA 1HLWA 2V9WA 4LMZA 3ZTRA 5RUBA 3ZTOA 2LMIA 1F5CA 2LYVA 2LDIA 2M88A 4JI8J 3ITHA 4H4OA 1SQEA 5M2PA 4OL8A 2Z56B 2HW3A 3PRVA 2C28A 1TKTA 4ZPBA 2LXUA 3L7OA 2WYRA 1RT4B 3OWCA 3AJDA 3SV4A 3K8VA 4B5OA 1FRHA 4I69A 3RAXA 4WTYA 2QIFA 2MZ1A 3I0RA 3OD2A 3QIPB 4OYOA 1SJ3P 1YLEA 2V2QA 3IC1A 2B8QA 2C27A 1R0CB 4B9MA 3PX6A 2CNKB 2Q79A 3QT8A 3OTBA 4M85A 4ED0A 4Q38A 2O5DA 3L2NA 2DPJA 3LAMA 6FD1A 1YI2S 1BLLE 2HHXA 3PO4A 3UR0A 2HVZA 2V4JB 1VQLS 2ZELA 4KPCA 5I42B 3G96A 5T7LB 1Z4RA 4C8OA 1A7GE 2ZFHA 3HKZD 2ZEMA 1D0EA 1S7FA 3LPYA 2D4OA 2EFNA 4ED7A 4ONWA 4AB7A 2B4DA 5D0HA 5E33A 1FNOA 3MFHA 4R7MA 2PO4A 2C3YA 1H38A 4HHHA 4JI0J 2WVEA 3FJ2A 3CXPA 4Q2MA 1N71A 1Q2YA 3IWXA 1P0HA 2FGOA 1VQSA 3AQOA 5HL7Q 2QLBB 5IOLA 2BEFA 4B3SF 1FCAA 3ET6B 1S4FA 4OYAA 3D28A 2ZBIA 3KR4A 4CLFA 3SQGB 4F0YA 1YG0A 1B64A 2OSRA 3KL9A 4WFZA 1RT2A 4F3OA 1AROP 2KZMA 4I67A 4Z65A 3H20A 1QTNB 2DXDA 3W64A 1PSDA 4KUAA 5KTDA 2RHSB 2KM8C 4B9LA 1N6QA 1PYOB 3HVWA 1AA1B 1NK7A 4A2ZA 2VBYA 1TF9A 4CWBA 1U49A 2GVDA 4M5GA 3OVBA 2CZ4A 4TWEA 3A3NB 2HK3A 5D15A 2VFTA 3K17A 4YB7A 3QT6A 5FDLB 3LP1A 2CWKA 1T3NA 4IOAQ 4TNOA 3HX9A 4M6IA 1S49A 4KHPF 5F48A 1Q1KA 4KO0B 1CBXA 3IP0A 3DI6A 1SL0A 4OZNA 5F8MA 3M2VB 2MKHA 4MTPA 1JNZB 4DV2F 4LRAA 1YWXA 4Y49C 2OOTA 1NZ8A 3ILOA 4HNXB 2VPXB 3G8TA 3MAQA 2C2EA 1C1CB 4J91A 3Q83A 1CPSA 4E8OA 4URQU 3LD2A 2NXUA 3LGMA 4FYVB 1OS5A 1XMQF 4RPFA