2Q43A

Ensemble refinement of the protein crystal structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
375
Chain Sequence
b'KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IAA-amino acid hydrolase ILR1-like 2
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 113
structure length 375
sequence length 392
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q43A01
3NH4A 4EFDA 1ZG9A 1Z2LA 1VHOA 2G9DA 4DJLA 3D7HA 5J1QA 1Y7EA 1YSJA 4PXDA 1ZLHA 4UEFA 4MCQA 2XEGA 4F9UA 2F8HA 1PCAA 4Q7AA 3CPAA 1Z5RA 2AFMA 2V8VA 1M4LA 4BD9A 4CPAA 3FMCA 3B35A 4IK2A 2ZEGA 4K3NA 4OKOA 1R43A 1RTQA 4O23A 2XEJA 3RAMA 1BPMA 3V38A 3H8EA 3KR4A 2AFOA 3B7IA 3PBEA 1Z8LA 1NSAA 4A94A 2J9AA 4OP4A 3PB7X 2ZEEA 1R3NA 2GU2A 3TC8A 3ISZA 2O53A 4P44A 5CBMA 3BHXA 5D8NA 5HVGA 2NSMA 2PJ3A 2GLFA 2WYRA 3I1UA 5LYFA 5HVHA 1TKJA 1Y0YA 2V77A 4TWEA 2XEFA 2PJBA 3S9LA 3IIBA 3WC5A 2PCUA 2ZEFA 1ELMP 1KWMA 3H8FA 3K9TA 2JBKA 1VGYA 1TF8A 2HB6A 3VARA 2HC9A 4F9VA 2AFWA 1GYTA 4P4BA 2POKA 2XEIA 3DGVA 2BCOA 5K8OA 2PIZA 4P4DA 1AMPA 3PFOA 3B2YA 3PB9X 1ZG7A 3PB4X 2PJCA 1YW6A 2C6GA 5LYDA 3VATA 3GB0A 4R7MA 4H2KA 3KQXA 1DTDA 4MHZA 4P6YA 3BXMA 2PJ8A 5JGFA 3FEDA 2V8DA 3FF3A 4ZI6A 4MMOA 1PYTB 1ZLIA 4PQAA 2ZENA 1FT7A 3B3WA 1BLLE 2OOTA 2JBJA 2PVWA 3GUXA 3KZWA 3FJUA 5DS0A 2PE3A 2IQ6A 4AXVA 4MHYA 4MCRA 4FAIA 3WT4A 1LCPA 4OC2A 4PXEA 3SI2A 4MHNA 4UF4A 4DUKA 1ARLA 4ZY1A 1JQGA 3RBUA 2QJ8A 2VL1A 4OC4A 1LAPA 2WZNA 2ZEPA 4NGTA 1XMBA 2RB7A 1TXRA 3B3SA 1YLOA 1F2PA 4MXUA 3K2KA 2ZELA 4FUUA 2PJAA 3IFEA 3HUVA 3T8WA 1CBXA 4FWUA 3QNVA 1CG2A 5JM6A 4OMEA 1IY7A 1TKFA 2DEAA 2PJ0A 5LRJA 3ISXA 3PRTA 2C6PA 3B3CA 3S9NA 3BI1A 3SJEA 2ZOGA 3HLPA 5JH9A 3D7FA 4ZX9A 5CPAA 2I3CA 3H8GA 3NFZA 2Q43A 1LFWA 5LYLA 4UIBA 3WC7A 2IMOA 1BAVA 4ZX8A 3WABA 2PJ1A 4KSIA 1LOKA 4A39A 4NGMA 4B6ZA 2CTCA 1HEEA 2QVPA 1Y0RA 4UEEA 2EK9A 4W9YA 2AFZA 4GM5A 2Q4ZA 4R8FA 4FBEA 4X2TA 4IHMA 1ELLP 2PRQA 3KHZA 4OC0A 8CPAA 4JYWA 3KI9A 5I4MA 5HVFA 1HDUA 3TX8A 1TF9A 3KASA 4OIWA 7CPAA 2QYVA 3D4UA 1CPXA 4MRIA 5D29A 2EWBA 5ELYA 2ZEHA 2ZEOA 4A37A 1FNOA 2ZEMA 4P45A 1H8LA 3VH9A 5LRKA 3BI0A 3IC1A 2PIYA 4EWTA 1IGBA 1YW4A 4P4IA 3FVLA 3IEHA 4UIAA 5K8MA 2ANPA 5THWA 2O4HA 1AYEA 1EE3P 4MCPA 4P10A 3D7DA 2AFSA 2BOAA 3LMSA 3FECA 2ABZA 3D7GA 3V7ZA 3NA6A 3GLJA 1XBUA 5LYIA 3KQZA 3SI0A 4IAVA 1Q7LA 4ZY0A 3KGQA 4LQGA 2PJ5A 5F09A 2PJ9A 4G1PA 1CX8A 3MRUA 4NGQA 3JRUA 4NGNA 2FVGA 3CT9A 2PJ7A 3FH4A 2CTBA 2GLJA 2ZOFA 3PEIA 3D66A 2F7VA 5K8PA 2EK8A 4NGRA 4MHPA 3KHXA 1F57A 1CPSA 3B3TA 1ARMA 1OBRA 4P4FA 4F8ZA 5LRGA 5IB9A 1XJOA 3CDXA 3SJGA 3KR5A 3D68A 4UEZA 1ZG8A 3PB8X 4A38A 1VHEA 4OC3A 1LAMA 1BPNA 2PVVA 4PXBA 1QMUA 4P4EA 4NJRA 2JEWA 4NFRA 3FEEA 1DE4C 3WC6A 2GREA 3KL9A 4MCSA 2RFHA 4R76A 4JZ0A 1XRYA 2PJ6A 4X8IA 1XFOA 1VIXA 2OR4A 3PBBA 1YMEA 2V8GA 1CP6A 1UWYA 3MN8A 2BO9A 4Z65A 1QQ9A 3PFEA 4OIDA 3L2NA 2CF4A 2IJZA 4EMEA 3IWWA 3NH5A 4YU9A 2PJ2A 3DLJA 4ONWA 1CP7A 3SI1A 1LANA 3RZAA 3LWUA 4OC5A 3SJFA 2V8HA 2Q51A 3NH8A 4PPZA 3FX6A 2ZEDA 2CIJA 4P4JA 3S9MA 3IO1A 4NGPA 4NGSA 5K8NA 4YWYA 4TNUA 2AFUA 6CPAA 4R6TA 4WWVA 1TKHA 3N5FA 2PJ4A 3IJ3A 4WJBA 4ZY2A 2AFXA 3D67A 1HDQA 4NJQA 4PXCA 4ZYQA 2NYQA 4RUHA 2C1CA 4OC1A 3CPXA 4X3RA 1F2OA 3B3VA 3PB6X 5HXDA 4DYOA 2C6CA 3SJXA
chains in the Genus database with same CATH superfamily
3FCWA 3KK2B 4FF2A 4PQUA 4UOGA 2IYIA 3H59A 1TMMA 3H20A 3CPAA 3D1OA 1YRUA 2V8VA 1RTHB 4NLQA 4YB7A 4NSQA 4BD9A 2AV5A 4NMXA 4J90A 4YMEA 3C2PA 1TK0A 3BR9A 4DL0C 4ANDA 2PFDA 5AE2A 3OR1A 2JEGA 1NJZA 1NDKA 4OI0A 4JI4F 4EK2A 2MLXA 5D8NA 5K14B 4OZ5A 4OHXA 2ARHA 4LSLA 2BDPA 1Y9KA 1U8SA 1YX2A 1ELMP 2ZBCA 2ZZMA 2G3TA 4FYWB 2WSAA 1JLBB 3CIZA 1RE1B 1PGZA 4ILLA 2WOMA 5KFWA 2B4BA 3H5YA 2IAJB 1H7WA 2GX8A 2F4VF 4UBRA 4J9SA 4WU3A 4AVCA 2DGTA 2VIHA 5EC4A 4YDDB 1DRZA 2Q7BA 1DQ9A 4M5MA 1PYTA 1T05B 4RUAA 5DM7Q 4MHZA 2MKCA 4P6YA 3ZZOA 1TAQA 3K57A 2YNHB 1ZLIA 3VAFA 5IT9U 3QT8A 4IOBA 3D54A 4Y2KA 3DOMB 1K4JA 4ZITA 3SV4A 2ZJRQ 3GUXA 1M44A 1NHKL 5DZ6A 3HULA 4MY0A 4X66F 3WT4A 3J80Y 2MY7A 1H98A 2FS5A 1ICEB 4R0JA 1WKLA 2DNKA 2HBYB 3SHPA 2F9DA 1E6YA 2AMCB 2LA6A 3EVMA 4IG3B 3HSJA 1DY3A 4ED2A 1WKJA 2H65B 1U24A 1WC4A 4UW2A 3OLBA 2HFUA 1PJ5A 4C0OC 5T7LA 2L9WA 2HS4A 3CCTA 2DEAA 3K8VA 3S9NA 5DG7A 2RNEA 1TELA 2EPIA 4J9RA 4J9LA 4N8NA 3EXCX 2HGNA 4DR3J 3HHLA 3MEKA 2FVRA 3BYRA 2XYGB 1KC8T 2DRBA 4B6ZA 1YGHA 2CTCA 1HEEA 4B5PB 2XMAA 3M9MB 1T9TA 4ZIWA 3F0NA 5KG1A 2UUAJ 2HNYB 1M1HA 5F0UA 1RT2B 4ZDNA 5C2GA 3RAQA 4OX7A 4USKA 3PDNA 1QSMA 2B7BB 3CCES 4YFUA 3BH7B 3CJKB 4B3SF 1I21A 3UD4P 3A3PB 5D29A 4KOUA 4A37A 5D4NA 3H2VE 4ZOSA 3VAJA 2QA4G 3IC1A 3PYFA 3KUHA 1XNQJ 2CZ9A 3OLAA 4XPKA 2X7BA 1RKIA 2FPHX 4ZA1A 1OWXA 2VG5A 2QEXS 4CRJA 1Y3JA 4GXHA 2IC3A 5HL7Q 2PDOA 5KFQA 3GWCA 4QJVA 4E0DA 2KDOA 2B6AA 3TCVA 1RT3B 4DV7J 3H4QA 4JI2F 2ZKTA 1WEXA 3SI0A 4BMHA 3VV2B 2C2EA 4G3IA 2CPYA 2ZVIA 1PILA 2GMHA 1B0TA 4QQBA 2YKMA 5GAEU 4JI8F 2G4BA 3Q83A 3ISND 1WWHA 1FI4A 4IO9Q 2AD9A 1VC0A 5EX3A 3TWZA 3B3TA 1S9FA 1HHQA 2W25A 4YHHJ 1NK9A 1F3VA 3PZPA 4Q44A 4W92B 2WVEA 2Y8YA 4Z7YA 4LF8J 4N77A 5AG6A 2KM8B 2I6WA 5LJ3Y 4KZTA 1FRLA 4NLGA 4HTIA 6FDRA 3ZZRA 1VIXA 1V3ZA 3TJ9A 2QL5B 5B0AA 5G1ZA 3R6GB 1LW2B 1CJVA 5DETA 4X65J 2LVWA 3DNCA 2CF4A 5FD1A 3OVBA 1LXJA 3OTOF 3FSXA 3PEHA 1NU4A 4M5DA 1XQIA 1B0VA 3W62A 4HH0A 1LANA 2LLZA 4MYTA 2AYBA 3LWUA 3T9NA 1I1GA 4P4JA 2DEIA 3AJDA 3HJFA 2AFUA 4I7FB 1CS4A 3W9IA 3THVA 3US5A 1IKWA 4LSNB 2R7SA 5I42B 5G22A 3KK2A 2NYQA 2YNCA 4WF9Q 1IBKJ 3DDDA 3BDPA 4RU9A 1X4CA 3SJXA 4F3OA 3UE2A 4KR0B 3OD2A 1RA6A 5J1QA 3KG1A 1T95A 1RTHA 2WVBA 1VQOS 2R7UA 4J7CA 1Z4UA 2F8HA 1M5OC 2RQKA 3MR2A 4CGNA 4NRUA 3I0SB 4U6PA 4IDKA 2AFMA 2W24A 4YB1P 4C8ZA 1S0VA 2AYMA 4OYPA 3IN5A 4HKFA 2O3DA 2ALYB 1HI1A 4CO0A 4WFXA 3QIDA 2JEIA 2Y0BB 4K3NA 5MLCV 1R43A 1HNVB 5A28A 2GW8A 1BPMA 2EVNA 5K14A 2DXDA 2KRRA 2GVZB 2GFQA 1DTQB 2DNQA 4AXIA 3BHXA 3D0HE 5GADU 4ONUA 2NSMA 2PJ3A 2ZC3A 4ZVGA 3Q23A 2DNRA 3NGUA 2XEFA 1JLBA 3TA2A 1CM0A 2OU2A 3K0JA 3CC4S 4O3SA 4P2MA 5GAHU 1VJQA 1TF8A 1S1UB 4FF4A 2XZDB 2IAJA 5J1PA 3CD0A 3GJRB 1T05A 1U6BA 4YOEA 3HMJG 1FNXH 1GNKA 1ZG7A 5DDRC 1EB0A 1JXLA 2R7VA 2YNHA 4K4WA 4JI0J 3WC0A 2XI3A 3UN5A 1JWWA 3DOMA 2DNYA 5JGFA 2M4MA 4GKKF 4NLRA 4JXRA 5DGAA 2J8AA 3GSIA 5ETPA 1VC5A 4DHVA 1UPPA 1Q8KA 3P45B 2IRUA 3HHLD 4DR1J 1Q95G 3CJRA 1HW8A 2ASYA 4B9VA 4QBJA 2C2MB 2FVCA 5J2NB 4DUKA 2IM2A 2ZH7A 4ZLLA 4K0KF 1AUGA 1IJFB 2RKIB 4IG3A 3RBZA 2V4JA 5H86A 3QGIA 4KT0C 1NE9A 4OHZA 3OL9A 4NX9A 2BANA 2CVIA 2OTLS 1KZFA 1U7LA 2GJ2A 3AODA 2H4WB 4ZP8A 4QW9A 1NK4A 1GX6A 2EFQA 3D2MA 1MK4A 3IR7B 4PAAA 8RUCA 2DJWA 3PRTA 4NOHA 2LA4A 4Y00A 2J76E 4FBUA 3AA9A 3ENVA 3PR4A 3I3GA 2V8PA 3PIPQ 3KK1B 3CW2C 1I6JA 3WC7A 2IMOA 4B5PA 3RR7A 1BAVA 3WABA 1PG5B 3U02A 2DD8S 1I12A 5A27A 2VG6B 2HNYA 1RT2A 2OSQA 2Q0YA 3CJKA 5CABA 3FJ2A 2E1PA 1GFWB 4KORA 3J7A1 4OIWA 2YNFB 2DR9A 1UMJA 1TAUA 3M32B 2PSWA 2J5AA 4MRIA 3GONA 3AB4B 3DCAA 2V63A 3M1VB 2R8KA 3TVYA 2EFOA 2DHGA 2NSCA 2DH8A 2HV2A 5DRKA 1X5PA 2AX1A 2DYAA 4P4IA 5EHHA 2VBQA 1RT3A 3KUEA 1AYEA 2NREA 1X4AA 2OMLA 4FNIA 3NS6A 2QJ3A 2W7OA 1Y5IB 2YWFA 3DSBA 1RADB 2HNZB 3AOCA 4TVAB 2VFSA 4LREA 4TYAA 4Y2CA 2YH0A 2FJVA 1AA1B 2JLFA 2MB0B 4ANCA 3AHPA 3D66A 1F57A 4ED0A 4NXMJ 4ED8A 5LRGA 2DO0A 3GFYA 2FC8A 3RTVA 4IG0B 5L1KA 1U4BA 1GH8A 3H5SA 1NLKL 1T9UA 3MMBB 3SXNA 4OX8A 1GK8A 2ZNYA 2OEKA 4NXYA 2YH1A 4KHPF 1LW2A 4JI5J 4R76A 2PJ6A 2NZ4A 1J27A 3KUGA 1KQFB 5LMNF 1KFSA 4FD6A 2JC1A 5ISVA 4AXJA 4A8OA 3UCUP 1IN0A 4PYDA 3UR3C 3BGOP 3IS9B 1QQ9A 3L7PA 4ECSA 4YP3A 1X4EA 2XYPB 3W65A 3BZQA 4KSEB 3FDSA 2CNMA 1RXOB 4Q43A 4F4YA 1SH3A 3D6HB 1KEKA 4B9SA 1JLFB 3FRMA 2GANA 2B9XA 3KLVA 4JUZA 3MCNA 4OC5A 1ULRA 4I7FA 3JB9k 4B13A 4DL2A 1RAFB 4M5NA 3EVWA 3TEHB 2IM0A 1K8AT 4LSNA 1UVJA 3R9FA 3K5OA 6CPAA 1C2PA 2EK6A 1HHSA 1MW7A 4KUBA 2ZZNA 5I42A 1Z8XA 3LANA 4B3TF 3RUBL 2RDJA 1HDQA 1RTJA 4ECXA 1FKPB 5G0RA 2XLKA 3KOAA 1W2IA 1WJ9A 3M8PB 3T5JA 3B3VA 4HDGA 3KG4A 1T11A 3DYAB 3MDFA 2WTFA 3I0SA 4A8SA 2DGQA 5IWAF 2QFIA 5GMDA 3UDLA 2FJXA 1NJWA 4MCQA 4OFZA 3P6YC 1WHVA 4EUVA 2CQDA 2F65A 3DU6A 4O3PA 1HNVA 2MZ1A 2XI2A 1BY9A 2GVZA 3HT0A 4OKOA 4J9PA 3TZZA 4EBCA 1DTQA 3B8HA 4K5RA 5AXKA 5LSOA 1H7XA 3K5PA 1HNZF 3BGUA 5AT1B 2I38A 2W4DA 2YY3A 2VA3A 4DV3J 2HHHJ 1R3NA 2GU2A 3MR6A 1IOIA 5J1EB 4DV0J 5CBMA 3BGLA 1RZMA 1YR0A 3FBUA 3DNSA 3ZC4A 5HVHA 3V6DB 1S1UA 5KFXA 3MECB 3C3LA 3OJSA 1UCNA 2ZEFA 4USTA 3CC7S 3ZZZA 2VONA 1KNZA 2J7KA 1MSWD 1VHFA 4TU7A 3VWDA 4MHDA 1FJGJ 2LDIA 4ZPTR 3H7HB 3DRXA 4P4DA 2QYGA 2KRBA 1JMTA 4RS2A 2W8LA 2BSWA 1T9XA 1C1BB 1NZ8A 3HD1A 2Q6CA 3TT2A 4ETXA 1X0FA 3Q86A 2O28A 4QWAA 4KPCA 1HYSB 5JVHQ 3IMQJ 1N32J 2E1MC 4ERDA 1RLCL 2P6SA 1RWOB 1TKZB 4QIWD 2B0GA 3LP2B 1YQHA 1WF2A 1TKTB 1ZAWA 1LEOA 3W8GA 5J2NA 1WHYA 2RKIA 4C8KA 4CYUB 4ATNA 4U9YA 1R27B 2J6SA 3BN4A 4ZY1A 2HKEA 1ZM2A 2GAHC 1IBLF 4PEOA 4DV1J 2NS1B 3MR7A 3QRRA 1Q78A 5IV0A 1XEZA 4OYMA 3UW1A 2PJAA 4ILMA 4QZVB 5D6GA 4DZDA 2PE8A 2G2ZA 1K0TA 1HKAA 2WBRA 1IY7A 2VICA 1VRUB 3R2DJ 4B11A 4NI2B 1WI8A 5CHCB 2DNNA 4TQSA 3KK1A 2C6PA 2GIFA 1IU8A 3J81U 3QLHB 3D8PA 3HKWA 4FPRA 2GHPA 3MEDB 3CSKA 2VG6A 2PC1A 5ETOA 2PT0A 1LOKA 2YKAA 4ZPDA 1HBNB 1LWFB 2B4UA 4I67A 3NBPB 2Z2ZA 2CQPA 1D09B 2ACMA 2V5HG 4LFBJ 1FD8A 2GFFA 4JD6A 1ELLP 5KAKA 2YNFA 1OYDA 1U1OA 4GKJF 3M32A 3CJ0A 4UCNA 4WFAQ 4Z37A 5KG5A 3AOAA 1P1TA 2X1GA 3M1VA 7CPAA 2I5JB 3GFHA 4MH8A 2LU1A 1RWXB 3K2YA 3KMSA 1FNOA 3BGFA 3NGKA 3HFZB 3L7UA 4P45A 2ZBPA 4CTAB 3TA0A 4PRFA 4I1TA 3N6LA 2ZW6A 1YBTA 4I6AA 2XS2A 4QOTA 4GO7X 2H51B 5HH1A 3U27A 1X60A 2QRRA 2AFSA 5F3ZA 2HNZA 1RLDA 4LMZA 2G1HA 4CLLA 2O67A 3PM9A 2VOOA 3WR7A 3T5KA 3TRGA 5L1JA 1T3OA 1S12A 2IJFA 1YJUA 5HSPA 3GKRA 1Z4RA 3NRBA 4IKAA 1DTTB 2LQJA 1J5EJ 1CX8A 4OX6A 1K47A 2M88A 2KXNB 4IG0A 1VQ4S 3CIMA 1AXQA 5FDLB 1RTIB 3MMBA 4OHWA 2EXUA 3O5TB 4F36A 1QTMA 3R27A 5B08A 1G4CA 2YKQA 2ZBRA 4F0HA 4UWJA 5D3GB 1JXEA 3NNAA 3CMQA 1BUXA 1RCXB 1BQMB 2WVCA 3IS9A 3FXTA 2GHVC 4ZP6A 4GS4A 3DDIA 1IM4A 1HNWF 1RHKB 3FIXA 1NO8A 2VKRA 3MN8A 2GIRA 2IMWP 3M05A 1SQGA 4PG8A 3NS5A 4KHRA 4AL5A 4DV2J 1PKUA 1FXDA 3PR5B 1JLFA 2AGOA 3D0IE 5B09A 2HZCA 1NKCA 2E5IA 1OSCA 3HX9A 1AUSL 1BQXA 3GR1A 4RW7B 3GY9A 3W1YC 3R5CA 4FXWA 3PW0A 3TQEA 4PV6A 3FYNA 4DV6J 4DSKA 1QUVA 3R5GA 3S9MA 4NGPA 2HWHA 4OZ3A 4FPIA 4NLSA 4CLYA 2VODA 2QECA 1TK5A 1VMBA 5C82A 3SZ2A 4ZVHA 1FKPA 2QFJA 4WYLA 4X4PA 1SC4B 4KFBB 4PUOB 3M8PA 1FRIA 1MMLA 4NF1A 3BJ7A 3DYAA 2VQEJ 4RUHA 3KLHB 4FD5A 3V2UC 2DR8A 1S48A 1T8EA 5HXDA 5KTQA 1A9NB 1SC3B 5HATA 3VZIA 3LWLA 4OZ1A 3J7AN 4HNYB 1Y7EA 4USWA 3T5HA 1U48A 1N5VA 2CNOB 2BEIA 1XR7A 1S77D 4Q7AA 4PG7A 3PJXA 1TL5A 4J9OA 4IQMA 3B35A 4TKTA 4S0MA 3IWLA 4O23A 2GIVA 2UXDF 3RAMA 5J1EA 2DGOA 3HSGA 2DIVA 3KR4A 4DR4J 3GIKA 3EZ5A 3DOKB 4DOZA 3PB7X 3KDNA 3MECA 3VVTA 1JLAB 3CJSA 4DV4F 4JOUA 2J9DA 4IRDA 5LYFA 2DISA 2GGPB 2GS8A 2PJBA 4NYPA 2QMLA 3WC5A 2UUCF 5A76A 1BXNA 2HQFA 4CLKA 2KJVA 3LAKA 2R7OA 2ADBA 4C3LA 4JI3J 4CAVA 1FRHA 3IGVA 1C1BA 5BJRA 2OHDA 4X4RA 1FJEB 4M94A 2FJDB 3E51A 2WVDA 4HPSA 2RJZA 1DFDA 3MZIA 1HYSA 4FYYB 5F9LA 1N34J 3IU1A 2PJCA 1TKZA 4MFKA 3NCQA 3LP2A 3M8QB 4H2KA 2VG7B 2DB1A 2OMOA 1S1VB 1TKTA 1XK8A 4K8RA 1WDDA 2OPQB 4WU2A 3CDAA 3EMTA 1YHQS 4CYUA 4XIUA 2FJAB 1SJFA 3FZ2A 5L1IA 2MLYA 4HI2A 2Z3KA 4W4MA 4F4XA 1T03B 5CZXA 1WNEA 2IQ6A 4DX7A 4LF5F 1Y4ZB 2NXUA 5IC6B 3RRGA 1ARLA 1TKXB 3GG0A 2FZCB 2HHPA 3CULA 4R57A 5LMUJ 1N5QA 1KFDA 4HHHA 4P7TA 2Z3OA 3IA0A 2F5IA 2DHAA 4OQJA 4DF8A 1TXRA 3B3SA 3SXOA 5CYQB 1VRUA 2XY7A 4NI2A 5KG0A 3D2WA 2VC1A 4FUUA 3H2UB 4YR0A 2DTJA 4I4BA 3IFEA 2CG8A 3JS9A 5JM6A 2QGFB 3QLHA 1G6BA 3MEDA 2AT1B 5C25B 3AFGA 3ISXA 3M7VA 2CPZA 2CJQA 4IH7A 4A2ZA 4LFAJ 2J0WA 1JJHA 4EBDA 3ETMA 1HBNA 2XHCA 2G3AA 1LWFA 3NBPA 1PUAA 2BL1A 1TIQA 3FEYB 2QA4S 4Y49B 3CJQA 5GVQA 1N71A 3VWEA 4R8FA 2CPIA 3EZUA 5J1NA 4X2TA 2WZ1A 2KTQA 2W2MP 4F4KA 2AZ3A 4KH1B 4OL8A 2I5JA 1D0EA 5F8JA 4OI4A 1JLEB 4X84A 2IA6A 2HWTA 1BMQB 1D8YA 3IXQA 1B7YB 4CTAA 1Q79A 2AJ6A 2EWBA 4KOTA 5ELYA 3T1HF 2ZKUA 4ES1A 2VJUA 1JX4A 1NPKA 4C3KA 4RBUA 1S6OA 1RT7B 4ZCLA 5F8HA 3IRXB 3QYYA 3BSOA 3R96A 1ZO0A 4LBHA 2CJKA 1GAOA 3PCOB 4QW8A 4JI4J 3HZGA 3VGUA 3OFHA 2VASA 1IR1A 5CH7B 1ZH5A 3KG0A 4OLOA 3P8BB 4URSA 3NA6A 4OZNA 1DTTA 1YJNS 2Q44A 1XBUA 5KG7A 2EI5A 3KHHA 1DZ5A 1H2UX 4KRWA 3P3DA 3WDOA 3ZZYA 5KFOA 3J7YU 2F4FA 5FDLA 1RTIA 3G87A 3NNCA 2AP6A 2W7PA 2K3KA 4NCGB 3BKTA 2JRSA 4NA1A 3MOJB 2ZOFA 4LF9F 2CPEA 1OIAA 4DPYA 3QSYB 4V1Ak 2LEPA 4RNNA 2F4VJ 3P49B 1IBCB 1YIJS 1ZG8A 1S99A 1FK9B 1WG1A 1WACA 5D3GA 1Y9OA 2CPHA 1IYLA 1XNQF 1QMUA 4ZJLA 1BQMA 4M5HA 5DLFA 4F02A 4NCAA 4ENOA 3WC6A 1BQNB 3G96A 3N6MA 3M9OB 3ZNJ1 3F44A 3V6HA 1XFOA 1Q7YT 2FHMA 3GJSB 3DM2B 4JYAF 3CJ4A 3RBXA 4UFVA 1RWVB 1I94F 5M2RA 4X66J 1KS2A 1N33J 3OFEA 4OJ1A 3CDWA 4RW7A 1L3UA 1KDNA 1LV5A 4X62J 2W01A 3I55S 2OZGA 2C2KB 1AUDA 4ZK7M 2P6FA 4WZMA 2PJ2A 3DLJA 5KG3A 4LRDA 2QV6A 4AL6A 2COLA 4DUZJ 2KVIA 3N6NA 1YBUA 4AUKA 2P9CA 4YHHF 1KVIA 5EWFA 1VBZA 4KFBA 4PUOA 5EN1A 4IQXA 4EMDA 3T1YF 3HLUA 2BJEA 3FEXB 4WWVA 5H9FK 4QPTA 3FNCA 2RAQA 3MCMA 2BE2B 3KLHA 4J3GA 2MMYA 2MSTA 3HI9A 2VFUA 4R3LA 2EUIA 5JVGQ 1WTFA 4WBFA 3JSBA 2HMIB 4X3RA 1Z9UA 1RT5B 3VVUA 3MPVA 3EPIA 1RBOB 2YQ0A 3DN9A 2CQ3A 2GA7A 3K7RA 2W8KA 4X4QA 5B0CA 5KOXA 4RO0A 1U1PA 3LO3A 4QU6A 3CE8A 4CPAA 3RNZA 1GMUA 5AG7A 2D3O1 1RQ0A 4YB5A 1GMVA 3DOKA 4B3SJ 1PYSB 1WC6A 1JLAA 4ECWA 4DS4A 3MAQA 3D3BJ 2DPIA 4XK8C 1DQAA 3MPDA 4OV6A 2GGPA 4A8FA 3DMJB 2GLFA 1RAHB 2HHUA 2WYRA 1RAOA 2V77A 1VISA 1VKCA 1NPRA 4F0KA 3TR5A 2V94A 5M2PA 3ZFVA 4DUTA 1NKEA 4DN9A 1S0NA 4ZVSB 2HB6A 1PAUB 1YQEA 1VQYA 2BACA 4P4BA 2POKA 3EO4A 3N0VA 4P6QA 1WC5A 4JI2J 4Y49C 3EY5A 2IBOA 5K8OA 4DNCA 4CLFA 3TVKA 3K5MA 3M8QA 2VG7A 5E5NA 1S1VA 2HQDA 5AGEA 4CO1A 3VATA 1RACB 2YWGA 2OPQA 2HQIA 3Q0AA 2M70A 4CAEA 1XMQF 3BXMA 2PJ8A 3CD7A 3FEDA 1R8BA 4EGLA 3LF0A 4ZI6A 1B70B 1T03A 4J9VA 1GX5A 2ROGA 3C26A 2KI2A 4E0AA 1UVNA 1TKXA 3QPIA 1ROFA 3C66A 1J4JA 2BW7A 2XS7A 4LF7F 1SV5B 3IGRA 2EG2A 2ZH9A 5CYQA 2DT9A 2LFVA 4Z2XA 1LWEB 4WK1A 3W7BA 4KOVA 2FCKA 4NLXA 1FKOB 2R3VA 1F2PA 3K2KA 2ZXVA 3KHGA 2HAFA 5IS2A 5C25A 4CH0S 1KTVA 4FN5A 3W91A 4FXVA 2PN6A 3CPWR 2CQ1A 3CTRA 2ZWOA 4NA2A 1HLWA 1KOOA 2CNLB 3AT1B 5A8KB 4DQIA 2VPYB 3A3OB 4ZVFA 3W66A 3DLKB 3OV7A 1M4GA 1F5CA 1U2RA 2K8GA 3A8IA 3C14B 1VQ7S 2HVHA 1PYOB 1Y5LB 4CM0A 2JH3A 2CQBA 3LAMA 1QE1B 1M5HA 4WZQA 4X4OA 4DR1F 1NSPA 2DR6A 4O0NA 2HVEA 1XIQA 2B3TB 3IRWP 5IQQA 2ZWPA 2BQRA 2XG8A 1LOUA 1VQNS 2AFZA 4IUSA 2DR5A 1X4FA 2QL9B 4P7VA 4WXWA 4YGOA 3C16B 1JLEA 3HFKA 1FEEA 5HMWA 1UJ4A 3PXGa 3MUMP 5IV3A 2ZH5A 4LX9A 4LIWA 1RT7A 3IRXA 2A2CA 5J2MB 4B9NA 3SYZA 4KAIA 4BHQA 4AB7A 2V0NA 1H73A 2CPFA 4G1QA 2QLFB 5HLFB 4I6YA 3BR8A 4OZJA 4F6AA 2ASJA 2IRYA 2BX6A 4Y28C 2UV8A 4WE1B 1NK6A 5H1SV 2ZITA 4PWWA 4XPEA 3X1LB 2ASDA 3NCRA 3D7GA 4ECYA 1RCOB 2LKZA 3O3LA 4OYBA 1FVSA 4NCGA 3IBWA 4UY85 1NJIT 3C8YA 4LBIA 1PJ6A 3MRUA 2FVGA 3IBCB 3PHTA 4KGKA 2CTBA 3THTA 1K9MT 2LQ5A 1FK9A 3UD3P 1IUJA 2MLZA 3S1TA 2K2PA 2KG1A 2Y1LB 3HHKA 4XDDA 5FLXY 3DRPB 1S60A 1H0HB 4A38A 1S49A 3AQPA 1RT1B 2OPRA 2B5JB 1BQNA 1Q2CA 2MQQA 5A6WA 1S1TB 4CLTA 3C15B 1OY8A 3IM8A 4NFRA 1S5ZA 4QIEA 3DM2A 4GKKJ 4ZPVR 2EFVA 2WSEC 2BZ2A 3ZZTA 2MZQA 4U7CA 3VAGA 4C4WA 2HHVA 3UN2A 1WEZA 4ZCMA 3O6QA 3M6VA 1NB2A 4Z7CA 3B6BA 1VRTB 3IAM9 4K0KJ 4RPFA 3EVOA 3TAMA 1OSDA 2W9BB 3CCJS 1FDNA 2WVFA 2D3OR 1WOPA 3M2RB 4RUBA 3OFGA 3EZOA 1LNQA 4TN2A 1FFGB 2V8HA 3QT6A 1C4CA 3PO4A 4NXNJ 2BE2A 2HGLA 1FDBA 4RW9B 1V9OA 1Y3KA 4OZ0A 1SH0A 2R7XA 2R8JA 5AE3A 5CAAA 2HMIA 4OI3A 2ZC4A 2YKOA 3MPYA 1RT5A 3VGTA 4OC1A 4J37A 1WHWA 4W90B 1MU2B 3VAIA 1B0PA 2FB0A 4EFDA 1ZG9A 3G6YA 3HKZD 2G9DA 4DJLA 3FK4A 2GZOA 4ES3A 2XULA 2HQ3A 4I6WA 4DG1B 3Q2SC 1S3ZA 3B4DA 1TUWA 2P0WA 3HXMA 3VQTA 1YBAA 2UUTA 2DHSA 3DOLB 1L3SA 4TLRA 3IBFB 3HHDA 3QT7A 3IWXA 5F8NA 2K1RB 4GO5X 1RTQA 5EWEA 3V38A 3FCHA 4ZJOA 3T5LA 1KR4A 3DMJA 2J0XA 2J9AA 4LRBA 4ZVRB 3TC8A 2DR7A 5IM0B 1R89A 4DLEA 3BSCA 5FJ4A 4JV5F 1G1XA 1MN9A 1S9GB 2YVSA 1MNEA 4M8LA 2N7CA 2ZW7A 3UD5A 1HL6A 1KWMA 2BOPA 4KOSA 2ZH2A 3VAMA 3VARA 4JI7F 4X4UA 2L08A 3H40A 4ED3A 4CLUA 2VKZG 1XERA 4K2JA 3D6FB 5J8CA 2C2ZB 3HVTB 1TUVA 3D28A 3NAIA 2OO4A 5KFEA 3NWRA 2RU9A 4LBPA 5T14A 4H6ZA 3P2FA 2E1CA 5LYDA 4OI6A 2YQ3A 3I31A 3UI3A 2ROPA 4H4MB 3ZTOA 4CRYB 1NNDA 4A4JA 3CUNA 5ETMA 2HLUA 2RILA 1G7CB 3GV8B 4PQAA 2CNKB 2XYHB 1RAIB 1WKKA 1SV5A 3A9LA 3J7ZT 5E3AA 4FAIA 4WTYA 1LWEA 1FKOA 4F3MA 5LXYA 3BBCA 2IVYA 3M2UB 4JBCA 5BR8F 5HMXA 3H4DA 2GMLA 3NWGA 1IB1E 1FJGF 1XMBA 1YLOA 2ODFA 1X4GA 5DG8A 5A8KA 2XNQA 2DNPA 2BKOA 5F8GA 2DIUA 3NE8A 3DLKA 3PHEA 1PBUA 3TI0A 3C14A 5LRJA 4KOXA 4AL7A 1S10A 3OBIA 1QE1A 2BR0A 4DFMA 2VFTA 2CQ0A 2FVPA 3H25A 1RDRA 4NZ7A 3EM1A 4XNHC 4B17A 4UTGA 2KB2A 4DR6F 1FRXA 5SUHA 1HD1A 3V6KA 4DCOB 1WC0A 3C16A 1X9SA 4B3TJ 1BE4A 5H9EK 2H4YB 2B3VA 2HQYA 3SCJE 4FBEA 4ZJQA 1VQSA 3W5ZA 4GMKA 4HNWB 3KHZA 2Z11A 3BJYA 4K4YA 3TOAA 3KI9A 1R0AB 5J2MA 1N5TA 1HDUA 1TL4A 4PKDB 5IWAJ 3HK2A 1RAGB 2HEKA 3R5JB 4CYNA 3E0KA 3GIJA 1YLXA 3FEZA 2EFPA 2ZEHA 3AJ1A 1X5OA 5HLFA 2VZ9A 3I6PA 2ZEMA 2X3GA 3W9JA 2BUEA 1YJ7A 2Z30B 4WE1A 5U47A 3DDNA 2MKHA 4KGXB 4E2FB 1HNZJ 3ONQA 1K73T 1YG0A 2GC8A 1IKYB 1C4AA 2R1IA 1B3TA 1SC1B 5H9EJ 4CLZA 4UCPA 4HACB 3O8WA 4LFBF 5LYIA 1S4FA 4DS5A 2HZVA 3OTDA 4X4TA 4ZVEA 1ACMB 5EGYA 1FDAA 4BWMA 3BKFA 2I0XA 1NDPA 3DRPA 3RRKA 2DH9A 3Q22A 1S7KA 2REEA 2CA9A 1A6LA 1RT1A 4MHPA 2B5JA 2W4PA 5F48A 5LXRA 3PY8A 3ET6B 4NLYA 1S1TA 3C15A 3PG9A 3CNQP 4YY3F 4DF4A 5T41A 3J7Z5 2GHWA 1F1BB 2RMLA 2GJFA 4BC7A 4ED5A 1TL1A 2KYXA 4O44B 2C1EB 1VRTA 4FYXB 2MY8A 1YMEA 1FRKA 1HD0A 1SJRA 2EW9A 3G8SA 3PTWA 2W9BA 4JI1F 1PIEA 3W2WB 4U7UD 3L2NA 3BH6B 4ZN1A 1J5EF 3M2RA 1IBLJ 1S1XB 2DBBA 4HLBA 2IIHA 1CJUB 1RGVA 4RW9A 2C2DA 2Q6BA 4M5LA 2HHQA 2DY1A 4ED4A 3PW5A 5C42B 3H5XA 4NGSA 4DJBA 4RBTA 5KFLA 5LJ5Y 1TKHA 3VF0B 4USUA 5IX3A 2CDRB 3IJ3A 2NXJA 1MU2A 2AE6A 1K1SA 2O5DA 4C8YA 3JAMY 4HVZA 4XAKA 4KVME 1T9WA 2R7WA 4OYWA 1M5VC 4OIXA 3CWJA 3OXLA 2OTJS 4DG1A 2CNSA 2VZZA 3WC2A 3DOLA 2V34A 1WOSA 2N82B 4F9UA 2IRXA 4GKJJ 3CJTA 2K1RA 3P5TL 3PW2A 2JDJA 2G1DA 1UL3A 4MK8A 3FMCA 1PSDA 1IBMF 3IAS9 3G8TA 4ZPCA 3MMAB 2HVZA 2R7QA 5IM0A 1MJBA 2G0BA 4W98A 2B4DB 2B9EA 1S9GA 2ZEEA 3PACA 4PYAA 2O53A 5ETTA 3UDVA 4MFQA 3LPEA 3N79A 3K5LA 1M4DA 1FTCA 2F40A 3OFFA 3R7BB 4Y2MA 2PMZD 1H74A 2VQEF 3S9LA 1RBLA 3MGJA 2BYCA 3DGPB 4ZVOB 2NPIA 3HVTA 3M6WA 4H54A 4B3MF 3GTYX 1CJTB 4K50A 1YJRA 1UTAA 4UOCA 2GCFA 3U7JA 4NLDA 1VBXA 4BWJA 4H4MA 4HHJA 2F8EX 3HF5A 3QZ7A 1UPMB 3KKFA 4BLGA 4JI6F 1I51B 2BRKA 5L38A 1YLEA 1U09A 1NCLA 2V8DA 4PSXA 1TKDA 5KG6A 1JJCB 3H98A 1U02A 4ZLPA 1OPZA 4AVAA 2JBJA 4QYZK 1U6ZA 1P1LA 3M2UA 4KE5A 3TTHA 4PXEA 2AWZA 4AQYF 1QDUB 1R0BG 5KFMA 2NMTA 5DQGA 2CAJA 1HNWJ 1W7WA 1UEKA 2Q66A 2JVRA 5D0RA 1OYEA 4WYWA 2Z58B 1VDHA 2NXCA 3RR8A 2E1RA 4RLEA 1KHVA 4MT1A 5IT0A 4XPDB 3H5ZA 3DLGB 3FRYA 3TO9A 1YREA 4ECVA 3FBCA 3HHEA 3SQGB 3BJ8A 2B51A 1NMEB 4H4KC 3MMCB 1NRKA 2VC0A 4WP3A 3QMQA 2Z3LA 5EMIA 1SXLA 5HQLA 4QWEA 3BGRB 4NLOA 1U1QA 1NUEA 5HMZA 3QBCA 4JV2A 3W64A 2B4VA 2KT2A 3WIUA 3CO9A 1WDTA 4QYZJ 4L3NA 3ENQA 4I64A 4ED6A 1T02A 4ILRA 3Q8UA 4BCAA 4C3MA 1R0AA 1F2HA 3O44A 4QPXA 3R6LB 2FTRA 2FD2A 3UNGC 1SI9A 2IVMA 3V4IB 2DPSA 3OL7A 4EBEA 3ZXWA 4IUFA 2HK3A 2XSFA 2C2OB 1XTZA 1RWWB 2R9LA 4P2FA 3A8KA 2HGMA 2QLJB 3BV8A 2D4OA 5DWNA 1KKHA 4DV5F 2GV1A 4BDPA 2Q4YA 4LFAF 4DUYF 1RHQB 4P2SA 2WSCC 4LVNP 1IKYA 2UXDJ 4MKBA 3TOQA 4BBYA 3JTNA 2ZHBA 2C27A 4X5KA 1V5VA 4AT1B 3KYLA 2AW0A 1WSVA 3MXHP 4MKAA 4RJVA 2ATLA 2Y0SD 2ABZA 3GLJA 3VALA 2FZKB 2HAIA 2ZHOA 3TJAA 3A13A 2Z3PA 7FD1A 3GJQB 4QCLA 4J91A 3ET6A 4WTOB 3FB3A 2MZTA 2B3UA 1FFWB 2J7UA 3MCSA 1N48A 3Q8VA 4O4GB 2RS8A 2F7VA 1N5SA 3EDQB 3QGPA 4PWDB 4C8NA 3IGNA 2JNJA 3MHYA 2XCAA 4IDKB 1BPNA 1WUUA 3E2EA 4O44A 4PXBA 3VWSA 2DGWA 1RAJA 3H42A 3D4JA 2QTWA 3D1HA 1S7FA 4IF5A 4A32A 4UWIA 1RABB 4F4AA 4F04B 2JDDA 2DGXA 3W2WA 1PAEX 2V8GA 4M63A 2PI5A 1X0PA 3PKYA 4LF5J 2ZH6A 1M1KT 1S1XA 2JEJA 4FKYA 3HFVA 1YVKA 2WB1D 1CJUA 4KY3A 5IC4B 3GILA 2HFNA 1WELA 5GAEI 2EEYA 1V0CA 2J0QD 2OPPB 3NE7A 5C42A 1IKVB 1RISA 5CXTA 3SI1A 2BJ3A 3TO8A 1Y11A 3SCKE 4M85A 3SJFA 4C11B 3Q2TC 2RQMA 5K8NA 4XDCA 2Q4VA 2C22A 5CQGA 4X64F 4YR2A 1KUVA 4EO6A 2Q04A 4WFBQ 3NAHA 4NMLA 4ZY2A 2R2UA 4CNYA 1GQEA 2CPXA 2AHOB 4HR2A 2EBGA 3GCWP 4ZYQA 2PGCA 5G4DA 4DYOA 3CF5Q 4B08A 1N33F 4O0IA 2MKYA 1NPPA 5HO4A 1CJWA 1C0UB 2MKSA 4X62F 2R7TA 2WW8A 3TZXA 2LECA 3MMAA 2V4JB 3F73A 3D1QA 4DUZF 2B4DA 2Y1JA 2O1PA 3OL8A 3LW5C 2BANB 1FESA 3OHAA 3T1HJ 1RBAA 4MBUA 3H8EA 5ADZA 3PBEA 2ATRA 1D9FA 1IQTA 3O1LA 2OFHX 5ETLA 1XWLA 4D3GA 4XPDC 1BGXT 1S9EB 2K7JA 3DGPA 3I1UA 1RSCA 4GVBB 3QAEA 5C7PA 4TWEA 3SFGA 1CJTA 1X7VA 1T9VA 3UO0A 1T94A 3LALA 3G71S 3R3TA 2KT5A 3R7NB 5KFUA 4EYHB 1FDDA 2BCOA 5KFZA 1U47A 3A1YG 5KFRA 3KXDA 3B2YA 4DDFA 2NUUG 3PVXA 2EBEA 2GJIA 5IV4A 1FJCA 1CLFA 4OHYA 2Z2MA 5CYMB 3CXSA 1BO4A 4LF9J 5AJ3F 3QJPA 1CC8A 4OZLA 4MMOA 2V50A 5KFBA 5GADI 1FT7A 4PR6A 2WW4A 3GYGA 1M1GA 1FO1A 3NGSA 2C42A 1LCPA 3DXBA 3PV8A 5GAHI 1SL1A 3VTIA 5KFFA 2QJ8A 5HK4A 1XEBA 1VQ6S 4JYAJ 2ZEPA 1QM9A 1TP7A 1I94J 2RB7A 4LQ6A 3KJNB 3P96A 4ITSA 4Q8EA 2JZ5A 5LL6d 3DLGA 3SSQA 2RDDA 2R98A 1UW4A 1IVZA 3QNVA 3SQGA 1CEZA 3DLHA 3N28A 1UZHA 3MMCA 4U5YA 3HM9A 3UDCA 3BGRA 3MM6B 2CY2A 2C2RA 4B9UA 4G1IA 4KC5A 5IB0A 3HVAA 3FMBA 3M6XA 2JC0A 3FBEA 3SJEA 5A8WB 5KFJA 1XR5A 2KVQE 5DLGA 2I3CA 1GTEA 5ETSA 1ITPA 3T1YJ 1SJ1A 4MFJA 5GAGU 2VD3A 1YK3A 5E41A 4N41A 4C68A 3U1MA 2KFYA 2BJ7A 5ITHA 1U1LA 2CQ4A 2JLMA 3V4IA 2LXIA 2CQIA 2KCWA 1O5JA 2E7XA 3QFWA 3BO3A 5AG5A 2EFGA 3POTB 1L5UA 4A47A 2CJAA 3HD2A 1O0PA 2QE5A 4NEYA 2YWHA 3D3SA 3DLBA 1QSYA 1NJXA 2HRUA 2ZEOA 2CIMA 2OD6A 4HHUA 4KV8B 1MWZA 2DRDA 3HT3A 5LM7E 1WEYA 5J2PB 5LRKA 9RUBA 1B99A 1UFLA 4C2XA 3FVLA 2OIHA 5K8MA 2DITA 1YZ6A 2O4HA 4CH1A 3EJMA 2B7CB 2K7KA 1JNRB 4R0EA 4NCZA 1EAYC 1UETA 1CPZA 5L9XA 1QSTA 1Q2DA 5B0FA 5KT2A 4RW4B 2G13A 3ITHB 3BLNA 3FBBA 2BJ9A 1RTJB 1RWKB 4O4GA 5G0RB 1RYRA 1L0CA 2XY5A 2PJ9A 2XLJA 1LQ9A 2MKKA 4PWDA 4NGQA 3I0RB 4LUBA 4UOFA 4BS2A 4LR9A 2QSFA 3AD8C 1ARMA 1OBRA 1HWIA 1S0MA 5IB9A 2RF2B 3HSZA 1DLOB 5HMYA 4P9SA 1XMQJ 3JUWA 1N56A 5KFDA 2R8HA 4J9QA 4U67Q 1DE4C 2XLIA 3T9YA 4CO3A 2EWHA 3E01B 4NRTA 2RFHA 2DXQA 3K9UA 2CKWA 2YKNB 3IP0A 4ES2A 2ZM6F 3TNVA 2M5YA 4OYIA 5I3UB 2OPPA 4LF7J 4OIDA 5L39A 4ORFA 1IKVA 1F9FA 1URNA 4L74A 3OL6A 2AZ1A 5KT5A 2JFKA 2JVOA 5KG4A 3VAKA 2ZW5A 4L3KA 4C11A 4OX9F 4EEYA 4OHVA 4DXLA 2MHNA 4D3HA 1MROA 2MZRA 4LR8A 3GYXB 1H38A 5L46A 5C2CA 2ZEDA 2ZNZA 1N8RT 4B3OB 3LOUA 1QVGR 4XPLA 2DKOB 4KH0B 1SUQB 4KGMA 3G9CA 3QSIA 2OJ3A 3UN3A 4F25A 3W3SA 1NKBA 4PXCA 1PU9A 4KSAA 4FVCA 5F8IA 1S6QB 3CPXA 1C0UA 2DH7A 1NZAA 5JMNA 4H6UA 3PB6X 2YX1A 3D0GE 3D7HA 1UEUA 2L48A 3FZBA 2JOQA 4PXDA 3KK3B 2UU9F 2LQ8A 2H5MA 3BF4A 3MM9B 4FYVB 4IH6A 2KT3A 1RUSA 2FVQA 2V67A 1R0CB 4IK2A 3FSYA 1Y9WA 1UVIA 3MEEB 2BJDA 1KQSR 2BMBA 4NXNF 3MGDA 1QD1A 1S59A 1S9EA 4RNFA 2E7VA 4QWBA 1XF8A 3BQ0A 2V2ZA 4GVBA 2V68A 4Q2LA 2FZGB 1REGX 3EPGA 4Y34A 1Y0YA 2EK1A 3CXQA 3KLIB 3CO0P 3PW4A 2J8SA 2HPUA 2P6EA 3G8WA 4TU8A 5E96A 3SQOP 1Y00A 1VJWA 2WUUA 2Y1IA 3AJ2A 2E44A 5CYMA 3CZXA 3AY0A 4IFVB 1HFEL 1Y10A 3F0AA 4L8AA 2GQQA 1REVB 3CJ8A 4XPCA 4KBIA 1A7GE 3NOCA 1ELOA 3MEGB 3FVYA 1S97A 1QAXA 3IWGA 3Q8PB 2ZPAA 3FFIB 2WRMA 1VK8A 1C0TB 1R7IA 3PZJA 1D9DA 2RIJA 2WB4A 1FF2A 3QQCD 4TU9A 3W2VB 3B78A 5C5JA 2KHDA 1FRJA 2VPWB 4OMFG 4MHYA 1X9WA 4CGPA 1KN6A 4Y6IA 3W63A 1VK3A 2VBXA 4IH5A 2BVZA 2VL1A 3SCIE 3OPKA 4QIFA 3MM7B 4NGTA 4MI4A 2H5JB 2DVIA 2CQHA 3DKDA 3BREA 2AJFE 4C8MA 2XM3A 2WAQD 1RAAB 3MM6A 1XMOJ 2BEFA 1CG2A 5D4OA 5MAOA 1GXLA 4ZPAA 1HR0F 2K3IA 5A8WA 2FJWA 4TNOA 3I56S 2XCPA 1QSLA 3B3CA 1VQ9S 2B9WA 3CB4A 3CCZA 5JH9A 4CS0B 5LYLA 2HRTA 4F4ZA 4PWUA 4LFCJ 2LXFA 1UWBB 2IYGA 5GMEA 1RWPB 2MXYA 5E3RA 3QFHA 1VQPS 4CQ1A 3POTA 2AU0A 4QYRA 1P27B 3OQ2A 5D0HA 4OI1A 1CJKB 4IR9A 4RUCA 4KV8A 2L41A 2FGCA 4CGMA 4JJXA 4BINA 1DBDA 4MJ8A 1FEHA 4N47A 2J9EA 4K5SA 4U96A 5J2PA 3QAYA 4MFLA 2YWWA 4K4ZA 3UQSA 2FT0A 2YKPA 3CVKA 3TAPA 3MOZA 3NEKA 1RT4B 1YITS 1XR6A 3OTEA 4RW4A 3ITHA 4JV5J 4ID8A 1BWEA 4C8LA 1FT8A 1B64A 3LQVA 1VHSA 2NPFA 4BC9A 4I68A 3PX6A 3FQLA 3I0RA 4Q2MA 1A0OB 1Y5NB 2CZVC 1YGYA 3TOBA 2VF3A 1UA0A 2QLBB 3IM9A 2Z10A 2E5JA 4JI7J 4RL1A 1J5OB 4EVYA 2RF2A 2Y9HA 2VHGA 1DLOA 1WI6A 2XS5A 4PSWA 4X4SA 2SXLA 1EKRA 2ZBIA 1KLNA 3QGHA 5BXIA 3CDXA 2IJRA 5FLXU 4PG5A 4AFFA 4MFZA 4HT7A 2OD4A 3E01A 4QUSA 2NUHA 1Q81T 2OUGA 3LGNA 2YKNA 5CYJA 2GREA 2X1FA 3AA8A 2BXJA 4B10A 2R8GA 1UKUA 3I5AA 5K20B 1TTHB 5KT4A 5I3UA 2B4OA 1EIYB 1E6VB 1TZ0A 2W2PP 2DNLA 2XZTB 3W5YA 2YX7A 4CLPA 4IFYB 3QT5A 3S7RA 1KRPA 2IJZA 4KLWA 5BR8J 1X5TA 4ZCKA 2D69A 3B54A 3CD6S 4B3OA 4NWBA 3R5BA 3LGMA 1K44A 4YUDA 1Q16B 1SUQA 3T6JA 4HTJA 3R95A 4AE5A 1MWYA 3AXKA 3W9HA 4CGOA 3L3CA 4YWYA 4P71A 3ILIA 3RRHA 1ZAXA 4B9MA 3ISNC 1TUGB 3TW0A 1S7HA 3N5FA 2Y8WA 1F6TA 1S6QA 2D3ZA 3TO7A 2DGSA 4RWWA 2MTLA 5HQ8A 4U9ZA 4DR6J 1FHTA 2DGUA 3KK3A 2R2RA 2DEJA 3RAXA 2HK2A 3MM9A 2AYGA 2C6CA 3G6ES 4K4XA 3KWMA 5JQ4A 3CMES 4OYAA 2Y1RI 4ZP9A 1YRXA 5DO2A 2LXUA 3MEEA 4C2ZA 2HHSA 1RWMB 4F0MA 3W8PA 2MZSA 1JLCB 1VI7A 1JKHB 3T90A 2QIFA 1BHNA 3DRSB 4WP9A 4RU2A 2EFNA 3RB0A 1NSAA 3QRQA 3R1LA 4KKOB 5JPHA 3MM8B 1KLMB 3BPDA 4URGA 3G4SS 3KLIA 2XZWA 4DN0A 2PIIA 1TKJA 3Q8YA 6AT1B 2FIWA 3JSYA 1VYAA 2RT3A 3H8FA 3PGPA 2BKPA 2OEJA 2JBKA 2JDCA 3P2HA 1DHMA 4IFVA 1GYTA 4B9LA 2QSWA 4MJKA 2FE7A 4DX5A 1REVA 3A3NB 3DDKA 4AYBD 3KDOA 3MEGA 3KLFB 1TFYA 1UAWA 3PB9X 4ZVQB 3LD2A 5C88A 3FFIA 5J8FA 1C0TA 3QO9B 3SSRA 5CCMA 4KYZA 3HSDA 1FTRA 3MUVP 3JTKA 4OJGA 1NSQA 3S01A 5EDWA 3W2VA 5CA5A 1FFSB 1G3OA 4YY3J 2ZENA 2MQPA 3NGDA 2F1FA 2VDHA 3KZWA 1WC3A 4NLVA 4ETZA 4MCRA 3WBZA 3MM7A 3SI2A 1IWAA 1SL2A 5KFKA 3M8YA 2MYFA 1VQKS 2WZNA 2K06A 2IVFB 3FCVA 4JI1J 5KFHA 2QLXA 3CEDA 3ILLA 2ZELA 2P9GA 4M6GA 2Z0ZA 2EC2A 1HWKA 1HQEB 4UZBA 3GQCA 1SQFA 1R57A 2XMMA 1IWGA 1OY6A 4J9NA 4M6HA 4CT9A 1P6TA 4CM2A 2NQPA 3F41A 5IOLA 4ZS6A 2HFZA 3C6UB 4EO8A 4K7QA 3HLPA 4ZX9A 2VQYA 3CCUS 5DDQC 1UWBA 5KTCA 3BS9A 4DX6A 2DNZA 4P73A 3L4BC 2VZYA 4E8OA 5E3PA 4Q45A 2ZE2B 4PK3A 1S72S 2XY6A 4Y65A 1RWNB 1S5KA 3MR3A 5B0EA 1BC6A 1FVQA 1CJKA 1OQ6A 1RWUA 2FLLA 5DQHA 2GE3A 1EHWA 1D9AA 3H2LA 2KJWA 1S76D 1NH8A 1KD1T 3HHLC 3PRVA 4U7UK 1P0HA 4DPWA 3OT9A 4LRFA 4MK7A 4UFWA 4LQ9A 2C2NA 2ZH1A 3BB5A 3ZZIA 1YX0A 1RU1A 1IBMJ 4YRHA 2AJ4A 4P52A 1JB0C 1H8LA 1XMTA 1BWVA 4PZVA 3QAHA 1RT4A 3PP9A 1Z8WA 4UT4A 1H2TZ 5D4PA 2EG1A 2LDYA 5IT4A 3VQSA 3L7OA 2C3MA 2YNDA 2UUWA 2BOAA 3KFWX 1SCJB 2LU2A 2KZZA 1EKSA 1SH2A 3KQZA 4R5PB 3KHLA 2PA3A 2O01C 4QIVA 2H48B 1J5OA 3GE9A 3S6KA 3TA1A 2CNTA 4F4WA 3UVJB 2PJ5A 3FKBA 4B3MJ 2RS2A 2XMTA 3GIMA 2AX0A 2JHEA 4MTPA 1FCAA 2ZOMA 3PEIA 4OAEA 4MFBB 3GV7B 3JTOA 2J8RA 3M8WA 4P4FA 3PNIA 1TFWA 1XJOA 4JI6J 1XNRF 1CULB 3VAHA 1VHEA 4JXQA 4C2MA 2BM0A 2XMVA 1SIWB 3CXPA 4FF3A 3OXFA 5E7OB 2QO3A 2NYHA 3I32A 1E6VA 4MCSA 4NEXA 2J0SD 1Y7PA 4M95A 5F8LA 4Q5VA 1Q82T 2APOA 4CAXA 1UW9A 2YPYA 2DPJA 4IFYA 2FGOA 1FXRA 4A33A 4HYKA 1Q4RA 3R1HA 5A0YB 4AQYJ 2Q3PA 5KFNA 2HBRB 3J7YI 1IR2A 3B4MA 2YQ1A 1U6MA 4A95A 3NH5A 2JWNA 2PR8A 4C7HA 3NP5A 1RTDB 2VXKA 3LWMA 2G0CA 3ZZPA 3NOGA 4TQRA 2Q51A 2CQ2A 4URQU 2AYEA 1OZPA 2E1AA 3CGIA 2KHCA 4R6TA 4FZVA 4JV1A 1NDCA 1EZZB 5B0DA 2ZUAA 5BYSA 2WCXA 3D67A 3H0PA 4RBVA 2FXFA 4C0BA 1Q8LA 3JAMU 4L75A 3I9V9 2CADA 1TQLA 2PI4A 3RG6A 3NH4A 2CNNB 1N5YB 2OB0A 1Q1KA 3D6TB 4GRSA 1ZLHA 2CWKA 4ZMMA 4HKQA 1JLCA 1QAJA 2PMWA 1JKHA 3DXSX 2RU3A 5D4LA 3OTCA 2QN6B 2AKWB 2UVRA 3DRSA 1M4LA 2YNCC 4ZBGA 4LF1A 3KLGB 4KKOA 4MY3A 3RU0A 2V6AA 2MJUA 4NA3A 2I9SA 9ATCB 4A8YA 3MM8A 2XEJA 5EX0A 1X4DA 1KLMA 5HBMB 3B7IA 4DV5J 2DCUB 2UVUA 1P9YA 4DUYJ 3PX4A 4P44A 4M6IA 1GT8A 5HMNA 3MI7X 5AXLA 3BEGB 1JLGB 4MIAA 1N0VC 4U8VA 3NS7B 1W26A 1CSJA 1TR0A 3R7SB 1VGYA 4FS1A 3CCMS 1P4NA 4PPDA 2HC9A 3KLFA 2QC3A 2CYYA 3MM5B 4R87A 4KUAA 1QY7A 4KB7A 2D41A 3BQ1A 3QO9A 3EE3A 3RBEA 4C0HA 3SIPB 3W60A 4DR2F 1YW6A 1OS5A 5KFCA 1MN7A 1HWUA 2ZH3A 3IWNC 3KQXA 5ETRA 4LF6F 2M3DA 3R1KA 5KFTA 4QWDA 2J9DE 1VQ5S 1XIXA 4TLQA 4TY9A 4P74A 1VIOA 1SKRA 2L9NA 3CCVS 3I4HX 2DPTA 4WKYA 1Z2ZA 3X3UA 4AXVA 4G1QB 4WCEQ 2OELA 2BM1A 2A10A 3TO6A 3K89A 3WHIA 4CGLA 2MHEA 4ELTA 4TY8B 4A46A 3QIPB 3OVAA 3RBUA 2IHR1 1LAPA 3HPOA 4DZ6A 2R4FA 3UWTA 1HQEA 4HEA9 1CBKA 3AOBA 2DF5A 2IFXA 1RP5A 1OMSA 4XO0A 5CZVA 5HQMA 5K5MA 3C6UA 2R2TA 2RQ4A 2V4QA 1LK7A 1Y7RA 4B02A 1DURA 2J6TA 3Q89A 4ZPBA 2ZE2A 5CPAA 1LFWA 3DHXA 4Y0FA 2V9WA 4UIBA 4KVXA 2IM1A 1QSNA 2VEZA 3DLEB 4X64J 2VFRA 3MPUB 1FWKA 2OPRB 5E3QA 2R42A 2LCWA 4DCPB 1XOVA 4OLPA 1N6QB 4FYDA 1FE4A 2RRAA 2PEBA 2B4PA 2KN4A 2KFNA 2PRQA 1YVFA 1DAXA 3OUYB 8CPAA 3QB8A 2IM3A 3TX8A 3T19A 1EQ0A 2QYVA 4RZRA 1U2FA 1RB0A 2VPZB 1RTZA 4Q38A 3V6JA 2NXNA 3TAMB 5F41A 4KQZA 7AT1B 2AGPA 1HARA 2XBPA 4CYPA 3S6EA 3Q8SB 1KSPA 3T1AA 5KFAA 2J6UA 2RE1A 2IJNA 4F0YA 3PKMA 2U1AA 1DJ0A 4MCPA 4R5PA 1S57A 2BA9A 2VV5A 5GMKa 4DU7A 2I1RA 3UVJA 2CPDA 2PSZA 1S4EA 4CI0B 3K59A 2LMIA 4WKRA 5F09A 4MFBA 1KUXA 4G1PA 1U1KA 3JRUA 5KFVA 3DC2A 2HUZA 1KTQA 1F9EB 2PJ7A 3FH4A 2N3LA 2RD5C 1PBAA 2GNKA 1HPZB 1CULA 5K8PA 2W2QP 1CPSA 2OH1A 4CO4A 2Z2YB 4JV0A 1P9QC 3MTJA 3R5AA 1SKSA 3PB8X 3SCLE 3NGRA 5AJ3J 4C98A 1R8PA 4UUWA 4RNMA 4B5OA 3G82B 2CWXA 2BQ3A 3S6GA 1JNZB 2FIUA 2C3PA 2ADCA 1VQLS 4M5IA 2M8HA 3KL9A 3SSSA 3BO2A 4ED1A 5A0YA 2KM8C 2OR4A 2FUG9 3V4MA 2XGPA 2PD1A 3CCLS 3MFIA 2BO9A 1KHWA 1F0XA 1GXTA 4Z65A 4QWCA 3PFEA 5AXMA 3OTBA 1RTDA 5C24B 4K4SA 3THPA 2A6MA 1TL7B 1L3VA 3TFYA 4CLSA 1WTBA 2EBJA 4OV1A 3GR0A 2UXCF 4UY8T 2FDNA 2HZAA 4NCBA 1KOHA 3MAHA 2YTCA 1TU0B 3IO1A 2KXFA 3EGZA 1N52B 2D9OA 2JEFA 3ZTQA 4USJC 2YNEA 4WFYA 5L8RC 1FJ7A 3CDBA 1FKAF 4RW6B 2MGZB 3G86A 2OZUA 2P5VA 4R25A 1N5YA 3QATA 2R8VA 1HNIB 3LPYA 4NZ6A 3G6VA 4QB9A 1Q2YA 3N4WA 1Q86T 2KKHA 3T41A 2E9ZA 2C3UA 4PCQA 5DDOC 1UJ5A 2DNOA 4UEFA 1OQ3A 5F9NA 5L1LA 3IWEA 3KLGA 2AGQA 4E98A 1HBUB 1MG7A 2AEMA 3K17A 4OYXA 5HBMA 1VC6A 1JLQB 2ZEGA 3HVRA 3CCWA 3KTQA 2V2KA 2J7WA 2DHXA 1APSA 4CWBA 2JSXA 2NZCA 3MUTP 2XMKA 2ZJQQ 1JLGA 1WWZA 2E5LF 5HVGA 4II9A 4N76A 1ZA2B 3AH6A 2AJ0A 3MMJA 2D74B 2QA1A 2E66A 3IIBA 4DR7F 3GFZA 3MM5A 3EGWB 4HL9A 3DI6B 2IY5B 4PG4A 2Z56B 5A2QY 3A8JA 3H8YA 4FVMA 3CD5A 2CJYB 3CCSS 3HZEA 3I9SA 3MF5A 1RK8A 2HRYA 5F8MA 5B7WA 1NXIA 1QAIA 2VFVA 2YXLA 4B3RF 1NK0A 2WHOA 5CCLA 1U1RA 1IXKA 4A8QA 5F49A 3T3FA 4A8MP 3B3WA 5KFSA 4ZN3A 3Q8QB 5FVJA 4TY8A 3QIPA 3RBDA 2ZDPA 1KQKA 2ZHAA 3FJUA 1VOMA 3EYZA 5DDPC 1R8AA 2HNDB 2FYXA 3GCXP 4MHNA 3TAQA 4ZVUB 3RYLA 4OC4A 1HMVB 3PW7A 2H3EB 1DARA 2W9CB 2ZM6J 4EU0A 1FY7A 3HUVA 3KLEB 3VZHA 4OMEA 2W4CA 1K1QA 4OX9J 4XNHB 5JXSA 4UA3A 1FE0A 3DLEA 1RO5A 2I2YA 4ECUA 3D7FA 1NHUA 3MFHA 3NFZA 2RRNA 2XEXA 3I87A 2F63A 2DNGA 2RRBA 1N6QA 3MURP 2GQ2A 1Y0RA 4USHA 3OUYA 4GM5A 1D1UA 1XE4A 4DPXA 1AZSB 3TEGA 1YI2S 3C46A 4DL6A 2UXBJ 4WIQA 1TL1B 1TVRB 2E29A 2RHQB 1O51A 1S7IA 5I4MA 4I2PB 7FDRA 3G2XA 4RKUC 1TF9A 2UU9J 4HNXB 1WORA 1XMOF 1HQ2A 2XWYA 4JB8B 3GSDA 5JJBA 2I00A 4Y2AA 3G6XA 3OVSA 3VCDA 4EWTA 2WPXA 4RR5A 2KL8A 2YX4A 2K5TA 1SKWA 2GIQA 4DL7A 2FVSA 4CYQA 4DFKA 4YB6A 5RUBA 2IL4A 3I96A 2ANPA 3L95X 4ICLB 1EE3P 2Z2LA 4P10A 3EC4A 3D7DA 4KGZB 4LFCF 2XO6A 4JP8A 2CPJA 3V7ZA 2ZVSA 3CCRS 4HDHA 1FX2A 4IAVA 2YWEA 4Q8FA 2LYVA 1HPZA 3ZTPA 3K5NA 1AROP 1LW0B 3QJJA 3NNHA 1X9MA 5G20A 4F67A 4IRKA 1PO6A 1TK8A 3NKYA 3G82A 1HI0P 3KMQA 3SJGA 2P6TA 1RHUB 1HHTP 3R97A 2VJVA 4EZ9A 4NJRA 2MQMA 3AQOA 3RGIA 2VDIA 4UUXA 3MR5A 1PC4A 2RUSA 3FQKA 3TP2A 1WF1A 3OR2B 4USIA 1HA1A 4LR7A 1NEEA 4DR5J 1RXTA 3RW7A 4JZ0A 2DY9A 1XRYA 2UVVA 4WWSA 1EJ7L 4LF4F 1AFJA 4DFJA 3PBBA 2EKNA 1VBYA 5C24A 2MQOA 2RVJA 3GZ7A 3LUYA 1TL7A 4KHMA 5IQ6A 2E7WA 5F0WA 3R5DA 2HQGA 2RH3A 4DPTA 4KPYA 4OLLA 2PA8D 3D6MB 2YPZA 1H72C 4YU9A 2D1CA 4A48A 3UR0A 1CP7A 4F2RA 2RSQA 1B4SA 1EQMA 2HG4A 4C2YA 4KVOE 3MD3A 1GMWA 1J2VA 4DPUA 1HR0J 4RW6A 3GP9A 2MGZA 2FLOA 3TUIC 4BBHA 1BD6A 2NXEA 3LP1B 1QSRA 1HNIA 4DPOA 4CRZB 2QG9B 4NJQA 3FRZA 3N5BA 4Q0BB 4U9RA 3UPFA 2ZUGA 2C1CA 1N36J 1G2EA 5ETKA 3LODA 5AE1A 3PYGA 1CVJA 1VHOA 1HBUA 2OFGX 2VH7A 2G2YA 1YSJA 3CMAS 2G0IA 2R2SA 3GFXA 2OLWA 4N5SA 3D2PA 4F3QA 4CT8A 5HP1B 1JLQA 3BYPA 5CNPA 4U95A 3D9BA 4ECRA 2P9EA 2BJ8A 4USMA 2UUBF 3GYNA 5JUMA 1M90T 3J81j 2V69A 5SZTA 2MKIA 5HJYA 2X7IA 3C6TB 4FD4A 2GQCA 4DX8H 4M3SA 3OXGA 1EETB 3DR8A 3DRRB 4UOHA 2HQCA 2XC9A 1YK9A 4I56A 2P2CB 3V5RA 3V81B 3DI6A 3V8IA 3HP6A 5LOQA 2AEJA 1IICA 1NJYA 2NYIA 3K9TA 2RQCA 4LT6A 4LRCA 5DZ7A 4OJ3A 5LSRA 4PABA 2BE7D 1NH7A 2ZJPQ 1IIDA 3I82A 3DGVA 3QRPA 1SB6A 4FDFA 1AW0A 4OJHA 5KOWA 3PFOA 3L9ZA 2GO9A 2OEMA 1SKUB 2H9ZA 4QR2A 4J9UE 1HNXF 3VR1A 4DMZA 1GXUA 5IT9Y 1MJAA 1RU2A 2RDIA 1MLAA 2B5GB 3RO0A 2HNDA 2UP1A 2C3YA 1BLLE 4ZCIA 2Z3MA 2NCKL 3TZWA 2M2BA 4ALZA 1VQMS 1HMVA 1M0SA 4A8KA 4C8OA 2W9CA 1SQHA 1PC5A 1T0TV 1U8WA 2FIAA 4IYQA 2BJ1A 2AJQA 3VGVA 4UQGA 1RJJA 4QR0A 4ZIVA 1SL0A 4QBUA 3KLEA 3PX0A 2FHOB 2FC9A 4ZLJA 2CQGA 2W1BA 1U26A 1CBXA 4FWUA 2UV8G 2FLPA 1HWJA 1S6PB 4AG9A 2B58A 3PRDA 4RX6A 3V6DA 2F9JA 4OYZA 4C9DA 4ZX8A 1UA1A 2D7SA 1AZSA 2MPUA 4A39A 1NM2A 2R7RA 4G65A 1TVRA 2QVPA 2M0GB 3P4UB 2GO8A 4I2PA 2HWIA 4N7TA 5D15A 4OC0A 5DS7A 2HYIB 1F9HA 1U0SA 1KQGB 4KJIA 5HVFA 1F5AA 3M6UA 4K30A 2AF6A 3MWBA 1NMTA 8ATCB 2W7AA 1ZTWA 5ETQA 3D4UA 3LH2S 4A8XA 1CPXA 1N4LA 3PYEA 4K4UA 2BQUA 3TVZA 2H5IB 1YJVA 1I5OB 4DSEA 4WP8A 3N01A 3A12A 4FS2A 4CNZA 3GPAA 3DR6A 2BRLA 1UVLA 1IGBA 4ICLA 4DSJA 4IOCQ 3IEHA 5IXUA 1BLUA 2IPOB 3QAUA 1NK8A 1MJ9A 2H1YA 4CLWA 1RT6B 4DL4A 2VBZA 4DQSA 3FECA 1LW0A 4CIOA 3NXZA 4E2AA 4CO2A 2ZDOA 4LUAA 2PRBA 2E5HA 4CAWA 1LWCB 1B6BA 1CQMA 2CJBA 1Q7LB 3CT9A 2GLJA 2CFXA 3M2VB 3W5XA 1UEVA 4NGRA 3KHXA 4GVLA 2B8QA 1EX8A 1VHIA 4UEZA 1GMWD 3OR2A 2HFVA 3M9NB 4J9MA 2FJBB 2JEWA 2LQ9A 1R6YA 2ZD1B 4LVOP 1I3OB 1FWPA 3DLLQ 3EXYA 1U2CA 2MKJA 2VQFJ 5D0EA 5E2QA 2FSRA 3JQJA 2HSEB 3MD1A 4DSFA 4NPOA 3EUNA 1K0VA 5I0CA 4ZP7A 2X3DA 5KFPA 3I5BA 2BUNA 4R3KA 4O3QA 1OO0B 2XMUA 4QVTA 1NK5A 5B0BA 4ZGYB 3GIUA 2VI7A 4UFXA 3ICLA 4RNHA 1YJ9S 2MZJA 2FJEB 3BN7A 4WFZA 2KU7A 3MAAB 1B7FA 3LP1A 2AJ2A 4DR3F 4Q0BA 1NSLA 3W6XA 2CG4A 2DO4A 2HURA 2MEWA 2RUGA 1FERA 2OSRA 1VCTA 3S8SA 4DQPA 3IU2A 1JJ2R 3BM7A 3PO5A 1F2GA 1YRTA 4B14A 2PC6A 5DGBA 2MSSA 4X2BA 1ZM3A 4X4VA 2UUAF 1F2OA 1HBMB 1HQUB 3CDUA 5HP1A 1RYSA 1EP4B 3FNNA 5HI7A 2UVWA 4Y2IA 2C3OA 1PCAA 3GJTB 3RB4A 3WX8A 1JWQA 3F5BA 4UZCA 3C6TA 4DLGA 1X5SA 3DRYA 3GIRA 1EETA 3DRRA 5LSLA 3BBFA 3CCQS 2GAGC 2FY1A 1WOOA 3V81A 2B56A 3Q24A 2OKQA 4A8WA 2XSJB 3FMWA 2YNGB 1LXNA 4DV7F 1FRMA 4R9MA 1NK7A 4Q36A 3FGVA 4L6V3 1ON0A 4WK3A 2NR0A 5A8RB 3KJQB 4F9VA 3UY5A 2XEIA 3MCOA 1YDLA 4CCHA 1U25A 4J9KA 3QWUA 1AMPA 1V3RA 4NL5A 3PB4X 2C6GA 1HWLA 3R9EA 1LRZA 4NYZA 2B5GA 4LF8F 3I5CA 4X4NA 2WBMA 2N4CA 3FF3A 3TYTA 1XNRJ 2LP4A 4MFPA 3H90A 4CO5A 1TMJA 5HROB 5L9NA 1LFPA 1GEHA 4UCMA 1IQZA 2PVWA 4U8YA 4O3RA 1VFJA 1U49A 2HFOA 2PE3A 5K9FA 2Y3YA 3CXCR 2QMWA 2IDLA 1KP6A 3TQ1A 3QZ8A 3WZ0A 3ILJA 4X65F 4UF4A 4KS9A 3PIOQ 4QIGA 3EXNA 1JQGA 1ZBTA 1YZ7A 2JEVA 4MK9A 4NE9C 2REFA 4H4KA 2YBVA 3JYTB 2M9KA 1VQ8S 4MXUA 1S6PA 4CP5A 1U0HB 4C6AA 4ECQA 1R8CA 2VPXB 1X4BA 2QT7A 4OZ2A 3GYAA 4R8UB 3CC2S 1WD6A 3PJWA 2ILYA 2VB6A 4OADA 5FIIA 5H9FJ 4NLUA 4TYBA 2XWXA 2AQ4A 2P6GA 3M8ZA 2DXEA 2ZOGA 4KOYA 2ASLA 3H8GA 2Q43A 2ROEA 1T9YA 1XN9A 2QMXA 4WXOA 1YTYA 1IBKF 4ELVA 2PJ1A 2HS0A 4DSLA 2CXEA 3BSNA 4UEEA 2EK9A 1H3DA 4AD6A 3JVNA 3BSAA 2Q4ZA 5BYQA 4LSZB 2P8IA 1ZM4A 2VOPA 3HHNB 2DNMA 5DJBA 1IKXB 1V5IB 3MPWA 3R9LA 5KFYA 4JI8J 3SEOA 1EARA 1U45A 2OGUA 4K4VA 1HBOB 2MQNA 5HJXA 1RHMB 3OJUA 3IG1B 3HDSA 2A0FB 2RC4A 1UFHA 2PIYA 4FXDA 1MROB 1HI8A 1RT6A 5GAGI 3TZYA 1U1MA 4LJMA 3EGNA 1UVKA 1DQ8A 1X4HA 5F46A 3LP0B 2V2QA 1ZM9A 2FHJA 2XHWA 3LMSA 3J80U 1IOFA 1LWCA 1S1WB 1S7LA 1Q7LA 4ZY0A 4J5OA 2CXAA 3KGQA 3M2VA 2HVIA 2B9YA 3OTOJ 4I69A 1L3KA 4MIWA 2WONB 2JLGA 1ZYQA 4HH1A 4A30A 1VS3A 1UFKA 4JI0F 2I8EA 3S6HA 2E9RX 4HI1A 3AXMA 2MJNA 2G0JA 3FUYA 1N88A 4DR2J 3KR5A 2ZD1A 3NL0A 1WSRA 1KBRA 3RB3A 1LWXA 4E8UA 3WQPA 2QL7B 4P4EA 2HHXA 4LF6J 2D3UA 2GMJA 4ECTA 1SVDA 2XO7A 4KO0B 3CDEA 3FEEA 1NSKL 4H4OB 3GIIA 3PRBA 4DEZA 1Q5YA 3LA0A 1N54B 3RJMB 2F5GA 3VHQA 1CP6A 4G6VB 3UNYA 4V19J 1LK5A 3UCGA 4LQ3A 4KSFA 1V3SA 5GCNA 1QSSA 5KFIA 3H5UA 1LKZA 4F0XA 3MAAA 2GVDB 2OPSB 4QU7A 2ZW4A 4ONWA 4DL5A 3FSIA 3HVWA 2E5GA 1MWQA 3N7ZA 4JLYA 1B87A 4C7QA 1QAYA 3ZZUA 4M5GA 2LEBA 3NH8A 4IRCA 4CZCA 2DHHA 1GTHA 4Y3CA 4EYIB 2JJ4D 1NAQA 1YVOA 5M2UA 4MKVA 1S7NA 1AB8A 3ETOA 5D77A 5D8HB 4K4TA 1HBMA 3HJVA 5AG4A 1HQUA 1JJ4A 1Z8TA 1PJ7A 3TUZC 1F60B 1XJWB 3A8EA 1YJTA 1ZOTA 1EP4A 2M8DB 4NASA 5CD4A 1Q0NA 5KT6A 2OI2A 1NHVA 3QGGA 2FL4A 1IR0A 2CJ9A 3ADAC 4I2QB 3F56A 2E9TA 3BKUA 3FC9A 2ILZA 3I4PA 1UVMA 2D9PA 3TUJC 4ZLNA 4QC6A 4FBTA 1F3FA 3IR5B 2DXFA 3JXOA 1RKJA 5D78A 2XSJA 3HCXA 4A94A 4RI1A 3ZTRA 2DK2A 3SXLA 4NLTA 2YNGA 4AG7A 2A1BA 2B43A 4M1KA 2MQ8A 4O3OA 4P72A 1O8BA 5A8RA 2A4NA 2PCUA 1FXLA 2C28A 2CQCA 4L73A 4YR3A 3TANA 3I9ZA 1UP1A 5KTAA 3R2CJ 5ETNA 2AFWA 3AAWB 3OW2R 1M4IA 1Q8IA 1OY9A 1OJ4A 1SJ4P 1X31C 4DFPA 3P5BP 2PIZA 2F8MA 2BV3A 3E8OA 4NXMF 3ZTSA 3GB0A 4NLWA 4R7MA 3GG1A 5IZHA 1DTDA 5A6PA 3EFAA 5HROA 1WG4A 4ED7A 1UWAA 3KKWA 1C1CB 4LRAA 2KG0A 1IJEB 1MMDA 2ZEJA 2HHWA 1Z4EA 4JI5F 1ZZNA 2KXHA 5E3CA 5DS0A 2ZH4A 3SV3A 1ZS6A 4OC2A 1YKWA 2IDEA 3JYTA 4KTQA 3QNWB 2KO1A 2BKNA 4CAFA 3FBFA 1U0HA 2BABA 3M30B 4ANEA 1M5SA 1UJ6A 4UQTA 1FX4A 1ZPWX 4R8UA 2IBKA 3NG8A 3EWGA 1KVJA 4ID5B 2Z57B 3JSRA 1X10A 4FD7A 2PJ0A 3J81Y 2UXCJ 1Z1ZA 3QJLA 2M7SA 1VRQC 4CYOA 2FY8A 1WF0A 2OZHA 4L72B 2Y0MA 3D3CJ 3D5MA 3WIVA 2N7YA 1W2BR 3F8KA 3R9GA 2PQ8A 2CRLA 2ALZA 1F5BA 1O6XA 4KSIA 1GHEA 4NGMA 2FHJD 2AIRB 3EX7B 1IKXA 2HBZB 2VU5A 2VA2A 1KONA 2VUGA 3Q8RB 5J2QB 4YQWA 1KVKA 1ZA1B 3U1LA 2OH2A 1HBOA 4RW8B 3RYOA 1U6FA 4K2XA 2AJ1A 2VBWA 1RHJB 2ZZTA 3IG1A 5I3PA 4KGVB 1AT1B 2NSBA 3EDRB 1Q8BA 1NDLA 4DV3F 2HHHF 4FKXA 3VH9A 3S6FA 4DV0F 1ZZFA 2QMUB 3LP0A 4F26A 4WPAA 5DM6Q 1D8ZA 4F50A 2J9CA 4UIAA 3AD7C 1RHRB 3GU0A 1S1WA 5THWA 4KHPJ 2E5LJ 4EZ6A 2FLNA 1SJ3P 3N9UC 4ZHRB 5LMNJ 1ZPVA 3RW6A 2HIYA 2L3MA 2UXBF 5EBVA 3H4BA 1TV6B 2CJXB 4DR7J 2WONA 3PYDA 3JSMB 2G9OA 4I49A 2PR1A 3C19A 4WFNQ 3LGHA 1FNMA 3CJ5A 1VBKA 2A3JA 1SPBP 4TXSA 3ZO7A 1N32F 4FNHA 3ZJ0A 4F8ZA 1QVFR 3PJ9A 1RAEB 3RB6A 3D68A 4K59A 4KO0A 2X1BA 4OC3A 1Y0HA 2XNRA 1N0UA 3KJVB 1ZTTA 3SI8A 4F2SA 4H4OA 2ERRA 4LF2A 4B3RJ 2DGVA 2Z3NA 3NMAA 2FQQB 3UCZP 4DSIA 1VLOA 3G8QA 2A18A 3NY0A 1H6KX 4EFAC 2WK4A 1S0OA 2W2NP 1S6UA 2KYZA 1A2ZA 5DG9A 4DV1F 2PFFB 2CZ4A 1UWYA 2XGQA 2BBEA 4O4RA 1SIZA 3NMRA 2GVDA 2OPSA 2PO4A 2XB2D 2KH9A 2Q7SA 2DCLA 5E0OA 3IWWA 3LTOA 3GMGA 3RZAA 3SBMA 3O2IA 2JX2A 1FA0A 2G2OA 2A6OA 3FX6A 3PEJA 2CIJA 4KIAA 4AVBA 5KTDA 1SJQA 1TL3B 5BYRA 1URRA 4A31A 1WC1A 2PJ4A 1RA7A 1JXVA 2J8MA 1UZDA 4DR5F 1M1DA 2JL9A 1QSOA 1WK4A 2M52A 4DBQA 5DWMA 1IM6A 2YNIB 4M5KA 4ZVTB 2QA2A 5HN0A 3TJ8A 2QZ8A 4YEAA 3ULHA 2DNHA 4I2QA 1Z2LA 2L9DA 5D0GA 4FP9A 1ZAVA 2XEGA 2EVZA 3SDEB 1Z5RA 4PQUB 4I0WA 4NEZA 4P2XA 3KJFB 3CJ3A 2EC0A 1HW9A 4USVA 3LACA 5HAOA 2FHKA 2Z4PA 1R8HA 2HW3A 3D7SB 5ETVA 2AFOA 2QX0A 1Z8LA 3ZZ0A 5G21A 4YDXA 2CUYA 3AB2B 2ACYA 1R6VA 4PK2A 4OP4A 2MQLA 1VLYA 5KG2A 3OR1B 2CDQA 3ISZA 3ENWA 2B8PA 3W6SA 2DRAA 2UZAA 4L76A 2NLWA 2I79A 1N36F 4OI2A 3SFUA 2X1AA 3CJ2A 2N4DA 2YWKA 4LSLB 2EO8A 1SC6A 5KT7A 5F3TA 3A4TA 4ZVPB 4NYOA 4KLVA 1JK9B 1QTNB 4N8OA 8AT1B 1I1DA 5LT5A 5KT3A 5A2QU 2QIRA 1X12A 2HFSA 3TUPA 2AEFA 2U2FA 1AFIA 2R8IA 2ZH8A 2F3JA 4F7VA 1NBEB 4RWXA 3R8YA 2D4PA 2WOMB 1C1CA 5E33A 4B12A 4LIRA 1S79A 2RHSB 3B8GA 2HHTA 3TARA 1WHXA 1PYTB 1SQEA 3KNGA 2XMWA 2OOTA 3WX4A 5B0GA 3BO4A 3OSPA 3K8WA 1M5PC 1RI7A 3ZNUA 3NLCA 3OHBA 3M30A 4DV2F 5H84A 4LF4J 2Q79A 4IO1A 4ZKAA 2W9AA 1M5KC 1QJHA 1JIHA 4NZ0A 3U1NA 2PMHA 2KZMA 2XTJP 2BE9B 4YS2A 4ID5A 3UDEA 1QUPA 4O3NA 3M8RA 1YJWS 2IA0A 4DV6F 2OAUA 3T8WA 3NGTA 2WPWA 4DU8A 1MMNA 1E6YB 4PG6A 3JQKA 1TKFA 5BWAB 2A2DA 3M4XA 5HANA 2PEHA 4DL3A 3BI1A 2LEAA 5T7LB 4P75A 1CC7A 2LQBA 2QLWA 3W61A 5CD4H 2J8NA 3JQMA 1VR6A 4V19X 4DQQA 5EWGA 4RNOA 4B9TA 2HBQB 4KOWA 1ZETA 1FD2A 4W9YA 3HHLB 5J2QA 3SDEA 4MAKA 4MYUA 3MTKA 5I3QA 4IHMA 4RW8A 2W2OP 1HIYA 4RN7A 2WSFC 4JYWA 2OP5A 3TX0A 4YFJA 3KASA 2JLEA 1IYKA 2Q1LA 4C97A 2XMJA 2V4RA 1BOBA 5IFMA 2EKYA 2HIQA 4DR4F 2VBYA 3UFCX 3KNAA 2BW2A 1WG5A 1QLNA 3BI0A 2UUBJ 1T7PA 1YWXA 2PDAA 1YW4A 2N3OA 4HT5A 3EGVA 1D3WA 3HO1A 4ZHRA 2HVDA 3T6BA 3TE4A 1L3TA 2V2VA 1Q53A 4GC6A 4L89A 4C48A 1TV6A 2VG5B 4JI3F 1SBRA 3DHWC 3JSMA 2X51A 4WIIA 1U1NA 4M5JA 3BBBA 2O66A 4OYOA 3JTPA 2IC3B 3B82A 3DU5A 4LQGA 2B6AB 3AD9C 1N34F 4NGNA 5F47A 3T9ZA 4N56A 4DI6A 3G3SA 3BPSP 2ABYA 3EICA 2EK8A 2H54B 3KJVA 1FWLA 3M8SA 2R7HA 2YKMB 3E3XA 3OSNA 2ATCB 1OPIA 3ELHA 1LAMA 4CH7A 5DQIA 2PVVA 4ZPWR 3VGSA 1HNXJ 4DWIA 2V9KA 4ER8A 4MKYA 2HLTA 4ELUA 2QYCA 4IOAQ 2H5EA 2CVEA 2XQCA 4X8IA 1H2VZ 5LMUF 4IR1A 4MIBA 3DFEA 3KHRA 3NCPA 2ZBQA 2KFZA 3BDEA 3QWPA 4FF1A 1V6HA 4ECZA 2MDAA 4F8RA 3GV5B 1R31A 1UFWA 4YN3B 1Q5VA 1X8DA 2YGWA 3OWCA 4EMEA 1CJVB 4CDIA 1XBWA 4NLPA 1CQNA 3ILOA 3SMZA 5KFGA 2Z8QA 4XTTA 3BQ2A 1TL3A 4M5DB 4PPZA 2HS3A 2ZFHA 4TNUA 1W25A 4QR1A 4C7IA 5EUHA 3L09A 4H89A 1NB7A 2JFDA 3K58A 4HACA 2YNIA 4WJBA 2AFXA 4DV4J