2Q43A

Ensemble refinement of the protein crystal structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IAA-amino acid hydrolase ILR1-like 2
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 113
structure length 375
sequence length 392
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q43A01
1CPXA 1YLOA 4IAVA 3RBUA 3PFEA 3T8WA 5F09A 2NYQA 4ZYQA 2RB7A 1BPMA 4MRIA 3KR5A 4MHPA 4UEEA 2XEJA 4UEFA 4MCPA 4ONWA 4NGMA 4P4IA 3SJFA 1HDUA 5K8PA 4NGPA 4ZI6A 2ZEGA 3DGVA 1VIXA 2O53A 7CPAA 4F9VA 4UF4A 4LQGA 3IO1A 4R76A 2ZENA 2IMOA 4H2KA 3BHXA 5LYIA 4EWTA 3SJEA 4DJLA 3TC8A 2EWBA 2I3CA 4ZY0A 4OC2A 3PEIA 1Y7EA 1LFWA 2BCOA 4P4JA 3IJ3A 3KL9A 2PJ7A 2CIJA 3NA6A 4P10A 1BLLE 2PRQA 4KSIA 2ZEEA 2ANPA 2HC9A 3WC7A 2V8VA 2PIZA 3MN8A 2F8HA 3RZAA 2F7VA 3NH8A 2V8DA 3SI1A 5IB9A 3B3CA 4NGNA 3KHXA 5LYLA 4MCQA 3PRTA 1ARMA 3KASA 2RFHA 4PXEA 4OC5A 4MXUA 3K9TA 3D7DA 4FAIA 3NFZA 2JBKA 2CTBA 3FX6A 4UEZA 4NJRA 1DE4C 1XMBA 4F9UA 1LANA 3ISZA 4PXDA 1LAMA 3B3VA 4P4FA 3B3TA 4OC4A 4OMEA 3KHZA 3FMCA 3D66A 3IWWA 3IFEA 3GLJA 3BI0A 1TF8A 5DS0A 4RUHA 2QJ8A 1R43A 2AFUA 3KQXA 2JBJA 4FBEA 2C6GA 2EK8A 2ZEFA 3D67A 4PXCA 3PB8X 2PJ8A 2WZNA 4A94A 5CBMA 5J1QA 3WT4A 2AFOA 2EK9A 4R8FA 1CX8A 3ISXA 4P45A 3CT9A 1ZG7A 3H8FA 2PVWA 1GYTA 1ELLP 3D4UA 4MCSA 5I4MA 2ZELA 2AFZA 3LWUA 4NGTA 1XRYA 2C1CA 2AFMA 1TKHA 1ZLHA 3FEDA 4JYWA 2HB6A 3PB7X 2Q4ZA 4DYOA 3FECA 1ELMP 3VH9A 2PE3A 1H8LA 4NGQA 4OC3A 3D68A 4IK2A 3KR4A 2CF4A 1HDQA 1CBXA 3LMSA 1PYTB 3CPXA 2GLJA 3IC1A 1F2PA 2QVPA 1LAPA 2ZEDA 4BD9A 2PJ1A 1XBUA 3RAMA 2O4HA 4OIWA 1Q7LA 3SJGA 3D7HA 4ZX9A 3TX8A 3PFOA 1QMUA 3MRUA 5CPAA 1FNOA 2PJAA 6CPAA 5LYFA 3FVLA 2PVVA 3K2KA 2C6PA 3BI1A 2CTCA 2XEIA 3KZWA 3WABA 1ARLA 1TKJA 4YU9A 1XJOA 4G1PA 5JH9A 3IIBA 2IQ6A 5LRKA 3L2NA 2FVGA 4FUUA 2PJ9A 1ZG9A 2Q43A 3PB9X 5HXDA 3B2YA 2DEAA 1AYEA 4NGRA 3H8GA 3FEEA 8CPAA 4R7MA 3D7GA 1TXRA 2PJ0A 2C6CA 3FF3A 1CP7A 2PJ6A 1F57A 4UIBA 1YW6A 4X3RA 1VGYA 1Y0RA 3S9LA 3KGQA 2GU2A 1NSAA 3BXMA 5LRJA 3D7FA 3VATA 3SJXA 1CG2A 2G9DA 3B35A 3PBBA 4MHYA 1Z2LA 4UIAA 3IEHA 2WYRA 3V38A 1QQ9A 3NH4A 2ZEOA 1FT7A 5D29A 3VARA 3I1UA 2PCUA 3SI0A 1CP6A 4B6ZA 5D8NA 3PB4X 1CPSA 2V77A 4DUKA 4IHMA 4MMOA 3HLPA 1Z8LA 1ZLIA 4TWEA 4CPAA 2POKA 4A37A 4P4DA 2NSMA 5JGFA 3GB0A 4PXBA 2GLFA 2JEWA 1R3NA 4FWUA 1Y0YA 5K8MA 2ABZA 4Z65A 1JQGA 4ZY2A 5THWA 5HVHA 4EMEA 4JZ0A 2AFXA 1DTDA 1XFOA 1KWMA 1AMPA 2XEFA 3PBEA 2PJ5A 1ZG8A 5LRGA 2OR4A 2OOTA 2IJZA 1OBRA 4X2TA 2GREA 4O23A 2BOAA 4GM5A 1F2OA 4OKOA 1LCPA 1M4LA 2XEGA 1RTQA 2V8GA 3JRUA 4Q7AA 4WJBA 3S9NA 2PJ2A 5JM6A 3QNVA 3KQZA 4WWVA 3PB6X 2QYVA 4R6TA 4NGSA 4MCRA 3SI2A 4MHNA 2PJ4A 4A38A 2ZOFA 4W9YA 2AFWA 4MHZA 4K3NA 1LOKA 1YSJA 4PQAA 2PJ3A 1BPNA 2J9AA 4ZX8A 2ZEHA 2ZEPA 1EE3P 2ZOGA 1BAVA 1HEEA 5ELYA 3B7IA 3KI9A 5LYDA 1UWYA 3H8EA 1PCAA 4AXVA 3N5FA 3S9MA 1YW4A 4P4EA 2PJBA 4A39A 4X8IA 3WC5A 1VHEA 3B3WA 3CPAA 4NJQA 3WC6A 4YWYA 4PPZA 5HVFA 4OIDA 4TNUA 1Z5RA 4P6YA 1TF9A 2PJCA 2AFSA 2VL1A 5K8OA 3GUXA 1VHOA 4P44A 5HVGA 2ZEMA 3NH5A 3CDXA 3HUVA 3V7ZA 4NFRA 1TKFA 4OC0A 4ZY1A 2V8HA 4OC1A 3B3SA 3FJUA 4F8ZA 3FH4A 2BO9A 5K8NA 4OP4A 1YMEA 4P4BA 4EFDA 1IY7A 1IGBA 2PIYA 3DLJA 2Q51A
chains in the Genus database with same CATH superfamily
4RPFA 1Z4RA 4IAVA 3Q86A 3GFHA 1YBAA 4RU2A 4JWPA 4ZS6A 4ES1A 2B56A 2QJ3A 1N5SA 1HI0P 1Q7LB 5K8PA 1VDHA 2DNKA 1WHWA 2YKMA 5KFMA 2BQRA 4RR5A 1KQFB 4UA3A 1JLGA 1XR5A 4DFKA 1UW4A 3KFWX 3P2FA 3LP1A 3OSPA 2NZCA 4RI1A 4NSQA 2YNHA 4A8WA 1YKWA 2PFDA 3DSBA 4DR2J 1ZM2A 2FVSA 1C4CA 4HT7A 2KTQA 2FVRA 2GZOA 4ONUA 3SDEA 4KSIA 1UA1A 1H74A 2XS2A 3KLEB 4A8YA 5C7PA 1IBMJ 2DH9A 4B12A 4NI2B 3I4HX 4CQ1A 1RISA 1T02A 3G6YA 3MMBB 4WTOB 1B0PA 1FDAA 2MHEA 2VXKA 4J9OA 2AJ6A 1L5UA 3CW2C 5H9FJ 3GG0A 1XNRF 4F9UA 1FX4A 2EBGA 1LANA 3HXMA 4XNHC 3ISZA 2VA3A 4F4XA 4BWJA 3M6XA 5GMEA 2BYCA 5KTAA 1F9HA 3H42A 4UY85 3BLNA 1FE4A 1DBDA 2QLXA 4KTQA 3IWWA 2BJ3A 4YHHJ 1NBEB 1R0AA 3QAHA 2QMXA 2ASJA 3BGLA 3FEZA 4R8FA 1HI1A 1HYSB 5F41A 3EDRB 3ZZZA 3QT7A 2LMIA 1I21A 4WFXA 3UNYA 1P9QC 1YHQS 2Q1LA 3W66A 3FEDA 4JYWA 1PSDA 3UR0A 3VWSA 2HS4A 2PE3A 4NL5A 1C0UB 4AL7A 1QSLA 4HHHA 2FC9A 5J2PA 3QT6A 4GS4A 4LF6J 1NUEA 1PKUA 1KONA 3AT1B 1UEUA 2CF4A 2A10A 4UOHA 4UTGA 3C16B 1CPZA 1Q1KA 4CAWA 3MTJA 2GLJA 1QAYA 3B4DA 3NAIA 2V4RA 3G4SS 2KCWA 3L3CA 2ZEDA 2DNZA 2NXEA 3OTDA 3RAMA 4OZNA 5BYQA 4QW9A 4DSLA 3ENQA 1FJGF 1WEZA 4O0NA 4MHDA 1E6YA 2BEIA 5LYFA 4URSA 5LSRA 3V81B 1RXTA 3D9BA 1R8CA 4TYBA 5I3UB 2M8HA 1K4JA 2AJFE 1HBNB 2HNYB 1DARA 5L1IA 3PGPA 3LTOA 2B3UA 4FYYB 1O51A 3H7HB 1BGXT 4QWCA 4QIFA 1RI7A 3CD5A 4U8YA 4KLWA 2JVRA 2CRLA 4O3OA 2ZKUA 1CP7A 2PJ6A 2ODFA 1U6ZA 2XLJA 2RE1A 2E66A 2AYGA 1JB0C 3GIRA 1JJHA 3DU5A 1FDBA 3DMJA 5AXLA 3BGRA 3VATA 3TANA 1CG2A 4MHYA 4I6AA 1N6QA 2RS2A 2AWZA 3NY0A 2H48B 3VARA 3OXFA 3FKBA 4HYKA 1CPSA 4QB9A 2WOMB 4W98A 4RW8A 4DX7A 4F3MA 1PO6A 2YKMB 3C8YA 1EETB 1JLGB 5FJ4A 4KS9A 4J9KA 3LAMA 2DO0A 3JAMU 2AYMA 2AFXA 4OZ3A 3QZ8A 2H1YA 2QE5A 3B78A 5IFMA 2COLA 1RWOB 1WEXA 5D4PA 1PYTA 3S6HA 4ED1A 3U02A 3GJSB 3K9UA 4KO0A 1UVIA 4Q7AA 1VQ4S 2D3O1 2W7PA 4DL5A 1L3VA 1H38A 5JVHQ 2I2YA 1XR6A 2B3VA 2N82B 1VQMS 2ZZMA 3SCIE 4G1IA 4K5SA 1UVNA 2K3IA 2Z2LA 4AXJA 5DQIA 5F48A 3VWDA 4W9YA 3K5LA 2AFWA 3DDKA 5KFNA 1TL4A 1T0TV 4RNHA 3PACA 3AAWB 3EXYA 1MWQA 3OFFA 4HKFA 1YLEA 2JH3A 4FBUA 3FXTA 2OU2A 2M9KA 3OW2R 5LYDA 3MEDB 4KYZA 3FBBA 4ZPVR 1IOFA 1VQOS 1R0AB 3HHLB 2IA6A 1FRMA 4IG3A 2XS7A 2ZH8A 1NK7A 4FYXB 3BR9A 4PG6A 4CLWA 2FIWA 3WC6A 2EI5A 1Q0NA 2KT3A 2JRSA 2IIHA 4LFAF 4OHZA 3MPUB 2B9XA 2MY7A 3GUXA 2CNKB 1CJTA 2G3TA 4ILLA 5J2PB 3NGKA 4OC1A 4TLRA 3WIUA 2WCXA 2CXEA 2R8GA 4G65A 1M5SA 2WHOA 2FHKA 1LK5A 2JOQA 1EB0A 3GY9A 4NYPA 3A4TA 1VQ7S 2P5VA 2J76E 8RUCA 4C0BA 3TO7A 4HACA 4C11B 4Y6IA 2O53A 5AG7A 1XEBA 1EKSA 3DOKA 4CWBA 4TU7A 4CYOA 3A13A 2UUTA 2YQ3A 3T5LA 2WB4A 4NX9A 1GTEA 3W9IA 2HVHA 1FHTA 1LWFB 3P2HA 4KJIA 2OMLA 2BXJA 3B8HA 4P4JA 3AOAA 1AXQA 1EIYB 3CWJA 1JWWA 4ZLJA 5IZHA 1F9FA 1FA0A 2N4CA 2F7VA 4NLVA 2ZBPA 2VFRA 2XY7A 2L08A 1IQZA 3R9LA 2EG2A 1ARMA 2RFHA 4MIBA 4A8FA 3FCVA 3J7YI 3OUYB 5H9EK 1KC8T 2R9LA 2AE6A 2VG5A 3DMJB 4NLTA 3HSDA 1FKAF 4NCBA 2ZJQQ 2OH2A 1SIWB 2MZRA 3OL8A 2ZJPQ 1JLBB 1B70B 3KLIA 3H5UA 3FBCA 2JLGA 3HKZD 3DNCA 4B3SF 4QIVA 2ZH1A 4RW8B 3ILLA 5L38A 1CQMA 2VBQA 4P45A 2ZH7A 3DR6A 2PI5A 2Y0MA 3DRYA 3M8ZA 1K1SA 1ELLP 4WYWA 1F2GA 5I4MA 2BJEA 4FKXA 5C24A 4JI5F 2XC9A 4PQUA 1XIXA 2RD5C 2QMLA 4DU7A 4IH7A 2Z0GA 1NK0A 1UZHA 3RU0A 2JWNA 3EY5A 4LF8F 3A3PB 4CO0A 1IKWA 3E01A 2A6MA 4F26A 4PWWA 3E0KA 1PYTB 2KFNA 3DRXA 4M5DA 1FFWB 2QZ8A 1F3FA 3PO4A 4JI2F 1H2TZ 3CD7A 3MD3A 3W62A 1EAYC 3HJVA 2VZ9A 2HGNA 2CNTA 1TVRA 3KHGA 3IWLA 2UUCF 3K2KA 2O3DA 2R4FA 4DQIA 4M85A 1S76D 1TL5A 3MOZA 2QRRA 4PUOB 1GMUA 3IR5B 4IG3B 1BQMA 2QLBB 4N7TA 2V9KA 4FUUA 3ETMA 3EZUA 3UD3P 2B8PA 4I2PA 3S8SA 2HQCA 2P6FA 2EWHA 1VI7A 4ZP9A 3CCJS 4XPDC 3D7GA 2WSFC 1UL3A 1N36J 3TAPA 2WONA 1F57A 1YW6A 2KG1A 3U27A 4DV2J 3I5CA 1RWVB 3R7NB 5A28A 2IM0A 3GV7B 3NGRA 4C3KA 1KQGB 3T3FA 3UCZP 1NH8A 2V2VA 2PQ8A 1U49A 1O6XA 5HQLA 2JEGA 3ZC4A 3HLPA 4RUBA 5T14A 4HACB 1ON0A 2Q4VA 4TWEA 1S12A 3BJ7A 4B3OB 4CDIA 5GAHU 3DOKB 4OMFG 5A6WA 2ZBQA 4X84A 2JEWA 3CCMS 4X62F 2C2ZB 3CCVS 3I55S 5A2QY 1XERA 5KFGA 2XYPB 3R6LB 1JJ2R 1XFOA 3U1LA 1XTZA 4LBIA 5AG6A 1LFPA 5DZ6A 2HBRB 3FNCA 2CQ2A 1WG1A 4X4UA 4GM5A 4QPTA 3A1YG 3KUEA 5HI7A 3R1LA 2XEGA 3BYPA 2R3VA 2ZWPA 4ICLB 1FTCA 1T94A 2IJFA 5HMZA 4F4WA 2R2RA 1HPZA 3RBEA 1M1DA 2HVDA 3MMAA 4RLEA 3T1YJ 1Q82T 4QBJA 1YSJA 5HP1A 4H4OB 5KFPA 2AF6A 1FEHA 4X65F 1UWYA 2OD6A 3CCTA 1RXOB 1BY9A 2V2QA 2ATLA 4X8IA 3RYOA 1VHEA 3HVRA 4YWYA 2RU9A 1T3OA 4J37A 4F8RA 4IF5A 2YXLA 5C24B 1TUWA 1VQ9S 3AD7C 3BSNA 3SIPB 5K8OA 3MXHP 5M2PA 2P0WA 4U95A 3V4MA 4K2XA 3T6JA 2F4FA 2IDLA 2BR0A 1TUVA 4R5PB 2PIYA 3E01B 1Q2YA 1T11A 3I56S 3DLEB 3QATA 1YLOA 5F09A 3CXQA 2P6GA 3JSYA 1CJVB 4HH1A 1JWQA 1TL7A 1RABB 4CP5A 1S0OA 1YJ9S 1QSOA 1N56A 3TO9A 1GMWD 2QC3A 1VS3A 2NSBA 4RUCA 4U7UD 4LQGA 3PHEA 1IJFB 3M2VA 4K8RA 1GX5A 1TAQA 1SQFA 4DN0A 2VQFF 4PYDA 1LFWA 4ZOSA 2BCOA 1T03A 1YRTA 1Y7RA 4X4SA 4QZVB 2Q0YA 1WD6A 2M2BA 2ZEEA 2BL1A 1BQMB 1S7FA 1NU4A 2PIZA 4ZJLA 5IB9A 1TKTA 2HZVA 3EPGA 1QSTA 1Y9WA 3QB8A 2ZNYA 3KJVA 3GIKA 5B0CA 3ZZRA 1N54B 2WONB 2IVFB 4EBEA 3DRPB 1I1GA 3MM6B 4NJRA 1RT2A 1V3ZA 2Y1LB 3RB6A 1X0PA 5T7LA 3H98A 2DNOA 2VQEJ 1PC5A 1U2RA 1HHQA 2Y3YA 5KFCA 2FY8A 3EICA 1RYSA 2UU9J 1RT3B 3IFEA 4ER8A 4Y2AA 4X64F 3SSSA 5C25B 2LDIA 4C6AA 4DPWA 4AQYJ 3N5BA 3UI3A 5I3PA 2I1RA 1PBUA 4CLZA 1GYTA 3D4UA 2AFZA 3H59A 1FO1A 2DYAA 4DL6A 2ZD1A 2Q4ZA 1ELMP 2V69A 3TTHA 4F36A 1TK0A 5ETLA 1FWPA 4R3KA 1DAXA 3LGNA 3EPIA 1YRUA 2F9JA 3PX4A 2IFXA 1DTQB 3CPXA 2GMLA 5CABA 4IG0B 4QW8A 3PYEA 4KVME 2LEAA 2ZOMA 4BD9A 2F4VF 4JUZA 2HHWA 1VR6A 3DCAA 3D7HA 3CUNA 3LWLA 4PWUA 5E33A 4CT9A 4GMKA 5H9FK 2J8NA 1SH3A 2ATCB 2P2CB 5HP1B 1WHVA 2J0WA 3T5JA 2FCKA 1ZAVA 3TOQA 2RU3A 4FXDA 1R57A 4DUZJ 2QECA 1HWKA 4KFBA 4JI0F 4K30A 3JQJA 1KD1T 3ISND 2ASDA 1B99A 2EVZA 4LF7J 4BBYA 5K20B 3T1HJ 4OX7A 4MFBB 3IGRA 2RDJA 4NF1A 2PJ0A 5G0RA 4WU3A 2GU2A 3W3SA 2BJ9A 1B6BA 1HD1A 3AA9A 1RT4A 3BSOA 2Y0BB 5KG3A 4ES3A 3LP0A 4OADA 4F25A 3BKTA 2FD2A 4B17A 2REFA 2C2DA 1U6FA 3PKYA 2AX1A 5D0RA 5F47A 2PCUA 3G71S 3VAIA 1S48A 1UVMA 4B3TJ 1EARA 1U1RA 3ISNC 2BW2A 1OZPA 4K4XA 4UFVA 2LQBA 1X12A 4P4DA 3H2UB 2UXBF 2OEMA 2NSMA 3M2VB 2XY6A 5BYRA 4FS2A 2HV2A 1QSSA 3MI7X 2GLFA 3MPYA 2DEIA 1DHMA 3CCES 1Q53A 2FJBB 3OT9A 2XSFA 5THWA 4EMEA 3FZ2A 5F9LA 2IRYA 2FZGB 4ZVPB 2OOTA 3PYFA 1VRQC 1P27B 1SB6A 1APSA 2UXCJ 1TKTB 4JI3F 2XBPA 1R7IA 4CIOA 3UE2A 1T8EA 2DR5A 3TUPA 4DR7F 3FSXA 2IY5B 1NSLA 2PJ2A 1ZO0A 1ROFA 1ZOTA 1RT2B 4JYAF 1F5CA 4USWA 1F9EB 1GX6A 4DCPB 4NGSA 3FYNA 1CC8A 1JIHA 3VZIA 5T7LB 3M32A 2C22A 3KK1A 3QQCD 3THTA 1LOKA 3GR0A 4LSLA 3TUZC 2HFNA 5ETPA 3Q22A 3KG0A 1VLYA 4NMXA 1CJUB 5LMNF 1RU1A 3KMSA 1Q4RA 4IO9Q 1SL1A 2K2PA 3A12A 4OV6A 2QN6B 2VOOA 2CQDA 2B3TB 4A39A 2ZBRA 2C2RA 4CAFA 4GVLA 2CNOB 3M6UA 2WPWA 1Q8KA 2R7XA 1P8GA 1JLFA 1P1LA 2LA4A 2EBJA 2W9CB 2PJCA 1FRHA 2UP1A 4OZ5A 3TYTA 1QUVA 2K7KA 2GIQA 3ENWA 5I42A 3MD1A 2PC1A 2ZD1B 1YJNS 2ZVIA 3V7ZA 4HTIA 1MSWD 4JXQA 1RCOB 2VIHA 3NE8A 2MKHA 2V8HA 3TA2A 3FJUA 5ETVA 4N76A 1U1PA 2D4OA 1I51B 2W24A 4GKKJ 4RWXA 5EC4A 3IGVA 4K50A 3DU6A 1F6TA 4MCPA 2YNIA 3AFGA 3O44A 3W6XA 2L9NA 1GQEA 3SMZA 2WRMA 4YUDA 5SUHA 3MAAA 4LUAA 4KLVA 3BHXA 3HDSA 3GJTB 4YR2A 3MWBA 3RG6A 4OX8A 3DOMA 2R8JA 3NA6A 4LBHA 1BC6A 3D6FB 4P10A 4N56A 2EC2A 3W1YC 2CVIA 2HC9A 5J2NA 5L1JA 2BUEA 4KFBB 1FF2A 2VZYA 4HHUA 4MFZA 4RZRA 2W7OA 4O3SA 1R0CB 4PG4A 2XS5A 3DOLA 4JV5J 2HVZA 4PXEA 1M44A 1E6VA 2MQMA 1WNEA 5BJRA 1RT5B 5G0RB 2OZGA 5DG9A 4PXDA 1RT4B 3PW0A 2RUSA 3LP0B 1FFSB 1AUSL 3D4JA 3JXOA 1C4AA 5LJ3Y 2B7BB 5KT4A 3E3XA 4LF6F 3R8YA 3VR1A 1J5OA 2V68A 2HFOA 1EZZB 3GCXP 1N33F 3TO6A 1NRKA 4KVOE 3G6VA 4B9VA 3GYXB 1TKHA 1FNMA 2MSTA 5HL7Q 2BANA 4OLPA 4I6YA 3CJKA 1H8LA 3PYDA 1T9YA 4OC3A 4USTA 3H5YA 1WG5A 1S4FA 3MECA 4IOCQ 5IS2A 5EHHA 2HHQA 1JLAA 3TWZA 3UN2A 2JFDA 3DI6B 3PDNA 3NE7A 3SQGA 2VG6A 5D0HA 3TX8A 3UD4P 4NASA 1XQIA 2BDPA 2YWEA 1J27A 3POTA 1WG4A 4B3MF 2D9PA 3KK1B 4NLUA 2CTCA 4LSLB 4DR4J 2ZH2A 3WABA 4HVZA 1A7GE 3VGTA 3OV7A 3HP6A 1NPKA 1O8BA 3OR2A 1YGYA 1U2FA 1VK3A 2PR1A 1S77D 3RRKA 3P49B 2EFVA 4G1QA 4C8LA 1ZG9A 2CNMA 1NH7A 1ZZNA 4K2JA 4UOCA 1NK6A 1JLFB 1X0FA 2LKZA 2B6AB 4UUXA 1TXRA 5I42B 2OUGA 1ZTTA 1RKJA 3KGQA 5DDQC 2VG7B 1NHKL 2KXHA 3D7FA 1S6PB 4PKDB 3B35A 1RHJB 3HSZA 2MGZA 3IU2A 1OSDA 2OPPA 2XTJP 5B0DA 4NOHA 3NGSA 3J7Z5 1K9MT 3HVAA 3ZTOA 2ZEOA 3C15B 2J0XA 2DGOA 2BKPA 4CNYA 1DTTB 3VAFA 1CULB 4MKYA 2YNIB 2QEXS 1WC1A 1IKYA 1UMJA 3MAHA 1IICA 2WAQD 4C2ZA 4KGVB 2QLJB 2QSFA 3M05A 2HG4A 2FHOB 3CMES 1KVKA 5J2QB 3QT5A 4F4YA 4NLGA 2W8KA 3DOMB 1AA1B 2LA6A 1WKJA 1V9OA 4UCMA 4M5HA 2NR0A 4XPEA 4EK2A 4KSFA 2CPHA 3DLHA 1RTZA 2MY8A 3CULA 2MZ1A 3L7OA 4H6UA 2HWTA 2C42A 4UOFA 2UVUA 4OL8A 2R42A 3DOLB 3HT0A 5H86A 1E6VB 1WEYA 3EE3A 3S6KA 3TVKA 3I4PA 2AKWB 3QNVA 1VISA 3ONQA 3FSYA 1HHTP 1LEOA 1S7IA 5F8JA 3T9YA 5GADU 3N4WA 3HSGA 3FBFA 1G2EA 4MKAA 1F0XA 1NPPA 1NNDA 1H98A 1V5VA 4ZX8A 2ZEHA 2AD9A 1VQYA 3F0NA 1IBLF 2FJAB 4DI6A 3MR6A 4DR5F 4H4KA 4CH7A 2QL5B 1KOHA 1RLCL 3IRWP 4CYNA 4ED5A 2PJBA 4ECZA 2OJ3A 4Y49C 1YJRA 1HNIA 1H7XA 2O1PA 4OHXA 1HW9A 1FWKA 2YVSA 3ENVA 2FGCA 1H2UX 1ZS6A 1WELA 1KLMA 2W01A 3FNNA 2EO8A 5DO2A 2JHEA 4ATNA 3VGUA 4JI8J 2IHR1 5ETRA 4FF3A 3CJKB 2JC0A 2IM2A 1XNRJ 4DV6F 2H9ZA 4B13A 4EFDA 1J4JA 5HMXA 3TAMA 1W2BR 1FJEB 3C2PA 4ENOA 5I3QA 4C8OA 5J1EA 3GYNA 2XI2A 3VAJA 2V4QA 4ED0A 2C1EB 1JLAB 1NKEA 4F50A 2FVPA 3TZXA 3D3BJ 2VG6B 3C66A 4ZITA 1TL3B 2ZEGA 1JKHA 3POTB 1FD8A 1W26A 2ZENA 5IC4B 4L6V3 4DJLA 3C14A 4ZY0A 2UUBF 2BACA 4TU8A 2CXAA 2XMVA 2I6WA 2B8QA 1VRTA 2YX7A 1LK7A 2OPRA 2KVQE 1WACA 3BF4A 3HHDA 1BLLE 2V5HG 1IUJA 3B54A 3BN7A 4MK9A 2E44A 1XMQJ 3EMTA 1M0SA 4MCQA 3BV8A 3N6MA 3OL9A 2JBKA 3CVKA 3FX6A 4UEZA 1FJGJ 4B9SA 2VKRA 3UN3A 2V4JB 2ZKTA 2RRNA 5GAHI 2PDOA 4YR3A 1K0TA 2MGZB 5E41A 2OPPB 2XY5A 5KFVA 2VUGA 3FSIA 3RBZA 4MYTA 3KQXA 2YTCA 4A94A 5CBMA 2RKIA 4QWBA 5F9NA 4N41A 4RUAA 1REGX 1ZG7A 1IKYB 1SKSA 4MCSA 4F7VA 1MG7A 1WKLA 4DSJA 3MEEA 3N6NA 1C1CA 3H4BA 1QE1A 3FFIB 4DU8A 4L75A 1ZAXA 1SJQA 3MCOA 3BDEA 2GJIA 3EWGA 1HHSA 1AUDA 2CQGA 1KZFA 3QSIA 1VJQA 3PIOQ 1RCXB 4CYUA 1F2PA 1VC0A 2J8MA 1RA7A 5B09A 4XIUA 4DUTA 3DYAA 1N0UA 1SQHA 2H4WB 2NZ4A 2LFVA 3K8WA 1YDLA 3FCWA 2RILA 4KOVA 4NLXA 4LQ6A 3NNAA 4AFFA 3BQ0A 3QJLA 1T9XA 1S3ZA 4B08A 2PEBA 2LDYA 5KG2A 3IIBA 2KZZA 4N77A 4MK7A 1IKVB 5A8RA 1HNIB 2R8IA 4M5IA 4R25A 1KR4A 2ZJRQ 3O1LA 3SXNA 1KLMB 1S60A 3TA1A 2D69A 3GQCA 1G1XA 2FQQB 4CI0B 4Q44A 1MNEA 2HFUA 5LRJA 2E5JA 2O28A 3K0JA 3R9GA 1NEEA 2BRLA 3K57A 4USHA 1Z2LA 1VFJA 3H4QA 1X4HA 5J1EB 3BREA 2OPSB 5D8NA 3PB4X 4I49A 1RTHB 4DUKA 5KFSA 4F2RA 1Y9OA 2P6EA 5B0EA 2GO8A 2HFSA 1M5VC 1JKHB 3V5RA 1PAUB 4LFAJ 5EX0A 3OFHA 2CQPA 1WHYA 2HRTA 1K0VA 4Y2KA 4QWAA 4QJVA 4JZ0A 4FD7A 3BSAA 1RGVA 2G2OA 1JLQA 2OPRB 3KWMA 4J7CA 1YREA 2OR4A 2CPZA 3T1YF 3TCVA 3CO0P 4DWIA 2LLZA 2GAHC 3KUGA 3MR5A 2XYGB 1R89A 4WCEQ 4C4WA 4PWDA 3TZYA 1UP1A 1SL0A 3TARA 1K8AT 3CCUS 5F3TA 4ALZA 2MKJA 2K7JA 4X4NA 3G82B 2OMOA 4K3NA 2F5IA 3W8PA 1B4SA 3JYTB 4OZ1A 4R3LA 4OX9F 5LXRA 1BPNA 2OZHA 2J9AA 2JNJA 4JJXA 2AJ4A 3KLGB 1MROA 3AD9C 1VCTA 4KIAA 2HWHA 1NZ8A 3R9FA 3TP2A 1T9VA 4C48A 2H3EB 4NJQA 1UZDA 3OTEA 2VPYB 2DITA 2P9EA 3M8PA 6AT1B 2PIIA 4USIA 1T7PA 5HJYA 1UKUA 4Q36A 1CQNA 3AOBA 4YGOA 4LR9A 4U7CA 1NDCA 2VI7A 1NE9A 3DLLQ 4F8ZA 2ACYA 4CM2A 3TA0A 1TFYA 3RBUA 1WC5A 1WWZA 3FVYA 3BBFA 3SCKE 4AE5A 3HPOA 4B3SJ 3SJFA 3H8YA 1S9GA 2CIMA 4KBIA 4H2KA 3B6BA 2OGUA 4EWTA 3SJEA 1M90T 1FVQA 3ZTQA 4JI5J 3GYGA 1Y7EA 1TR0A 2XYHB 4MH8A 3IJ3A 4MK8A 1WWHA 2VBZA 1U25A 5CCMA 1Q8LA 3Q83A 3EVMA 1VQLS 4F4KA 4DV7F 3W5XA 1UVKA 1PC4A 4LF8J 3AJ1A 1KUVA 1N32F 4HNWB 5A8RB 2QA4G 2RT3A 1R8BA 3DM2B 4NGNA 2Y1IA 1OYDA 3KHXA 2A3JA 2E5GA 3N6LA 3TOBA 5JUMA 4U8VA 3D7DA 2B4DA 1JLEA 3UQSA 4HPSA 2RHSB 3W91A 1YX0A 4YMEA 3AD8C 2HQFA 2UUCJ 4IFYA 3EVWA 1OJ4A 1Q7YT 2IM1A 4I6WA 3NNHA 1CJKA 4TY8A 3D66A 1RHMB 2HSEB 1I1DA 1QY7A 2H4YB 1R43A 1L3KA 2H5MA 1UA0A 1HNZF 1NPRA 5A8KA 2FHJD 2EK8A 1RWPB 3H25A 2GFQA 3D67A 1S1XA 3BPSP 3ULHA 2BUNA 1AZSA 3KK2A 2O66A 2CJAA 1SC3B 4MFKA 1RTIA 1J5EF 3HHLC 4K4SA 1WDTA 2RUGA 3F5BA 1XOVA 3N0VA 1GNKA 3WX8A 3PW2A 3DRSA 2ZHOA 1QSRA 1Q81T 5GAEU 3FECA 4FD5A 5L1LA 5IC6B 1FNXH 1X5OA 4IRDA 1JLQB 2Q6CA 3MM8A 2EKNA 3A9LA 4I0WA 1NJZA 1RP5A 3LMSA 5KTDA 5E7OB 4HI2A 4KE5A 4ANCA 1G3OA 2DRAA 3G9CA 1F1BB 4MY0A 4PWDB 2HIQA 1TKZA 3FRZA 3VAHA 5HROA 1KQSR 2Z3MA 4FYWB 2G3AA 2IPOB 3SJGA 4DUZF 3VAKA 1C0TA 2Z10A 3MRUA 3PO5A 3AB4B 4C97A 2PJAA 1Z4EA 1R6YA 1FCAA 2BJ1A 3US5A 4DL0C 3T1HF 2C6PA 3M9OB 3GV8B 1N0VC 5ETKA 3J81U 2MKSA 4CS0B 3DGPA 4X62J 3I5AA 2BEFA 2RJZA 3TEHB 2DRDA 2D3ZA 2Q6BA 1MROB 2OH1A 2HHUA 1X4CA 2V50A 5CYQA 2PJ9A 4QWEA 3V6DA 5J1PA 2DEAA 1KN6A 4OYXA 5FDLA 4KOTA 3PY8A 3M8PB 2DR6A 2DNYA 3HFVA 3FF3A 4FF1A 4QIWD 2CQ0A 3KHLA 2DF5A 4FD6A 4ECXA 2DPJA 2Z30B 4HDGA 5KFAA 2B4PA 2RDIA 1TK5A 2Y8WA 1HKAA 1HWIA 1KUXA 3V38A 1FT7A 2GVZA 4LFCJ 3MM5A 2NCKL 3GWCA 4DR1F 2GHPA 1O5JA 2U2FA 1SUQB 3NMAA 1DQ9A 3BKFA 3K58A 2UXCF 3DFEA 4RU9A 3NMRA 1U1NA 4DBQA 4KHMA 2G2YA 1RBAA 1S1WB 2ABZA 3OL7A 4OZ2A 2AHOB 4LSNB 4Q43A 5KFQA 4OYAA 4Y65A 1R6VA 5LRGA 3ET6B 4HH0A 4UQGA 2FJXA 4J9MA 3E51A 3L9ZA 5B08A 5E3AA 5A6PA 4UT4A 4OKOA 3ZTSA 3DN9A 1EKRA 1X5PA 3OXGA 3BGOP 3D0IE 3CZXA 3CE8A 4ZA1A 2REEA 2EFNA 2DGSA 2B4DB 1JLEB 4O4RA 1Y3JA 2FLLA 4NCZA 5CZXA 4KH1B 4E98A 1MMDA 1QD1A 5HMYA 4LRDA 4IFYB 4IKAA 1CJKB 4ZPTR 4TY8B 4IUFA 2QYGA 1PUAA 4QU6A 5C42A 3RB3A 3ZZOA 3WIVA 5A8KB 2VOPA 1FX2A 4LF1A 5J2MA 3UDLA 1AZSB 1FK9A 1GXLA 1OQ6A 2HRUA 3KK2B 2BQ3A 4P4EA 2R98A 2XNQA 5KTCA 4FD4A 2ZFHA 2GJ2A 5D4NA 2HHSA 1REVA 1FXRA 3X3UA 1KS2A 2PN6A 2FJDB 3CJ8A 3MMCA 1FRIA 1XN9A 1U47A 1UPPA 1Y3KA 3W60A 4JI7F 1Q86T 3MM8B 4P4BA 5K8NA 1YMEA 1NB7A 3LANA 2DXDA 1YX2A 4RKUC 3CDWA 3QIPB 3Q8UA 2K06A 2XNRA 4AXIA 2X3DA 1TKZB 1WC0A 2ILZA 5AJ3F 3IR6B 2R7VA 2ZZTA 3HFZB 3VAGA 1C0TB 7CPAA 1JNRB 1VIXA 2HEKA 2X51A 1YG0A 5IWAF 4NLWA 2VH7A 2W2OP 1QVFR 3N01A 3K59A 5LYIA 4J9LA 2WBMA 2PEHA 4OYPA 1I6JA 3QRQA 3K5NA 4JOUA 2N4DA 5D78A 4OHYA 2JDDA 3RNZA 1U48A 3Q8PB 4LREA 3I82A 2Q66A 5CYQB 3WR7A 1CS4B 4KKOA 3V6DB 2Q04A 3P3DA 4LR8A 1FXDA 1I94F 1OS5A 5ETTA 4ZLPA 5FDLB 4DUYJ 2F4VJ 3GU0A 2UUAF 1HLWA 3PRDA 2KH9A 2KT2A 3AODA 3KLEA 4EO8A 3GSIA 1YJUA 3CNQP 2ROPA 4U7UK 3M2RB 2FDNA 4CAXA 1M5KC 1QM9A 1SC4B 1TP7A 4CGLA 3MMBA 2QJ8A 3DLGA 2YNCC 4DX6A 3MM5B 2VBXA 3LGHA 1IKXA 1IBCB 4DEZA 3W5ZA 2EKYA 1FVSA 1CX8A 5G4DA 2RDDA 4JI0J 1L0CA 3GSDA 4WZQA 1S0NA 1Y00A 3BSCA 1WF2A 1SL2A 4LX9A 3OFGA 2Z0ZA 3TE4A 2W8LA 1WF0A 4DQQA 2RHQB 4TY9A 1NZAA 1OMSA 3NXZA 2DRBA 4HR2A 4GO7X 2D3UA 2XLIA 3VH9A 1K73T 3LH2S 2ZUGA 3QLHA 4DLGA 1RAHB 5GADI 5E96A 3JAMY 1U1KA 5D6GA 1JK9B 3JQMA 4TU9A 3B82A 3M8QA 4RNNA 3ZNJ1 5DDOC 4EGLA 1IM6A 3KMQA 2FTRA 2HBZB 3GFYA 2I0XA 1YQEA 4ZHRA 3NCRA 2YWHA 2YWFA 4K4ZA 2J5AA 2GV1A 1U6BA 5CPAA 4YY3J 2B4VA 1HNVA 2OAUA 2UXBJ 3GKRA 1A2ZA 3LOUA 4CGNA 4FKYA 3H5ZA 3WBZA 4M94A 5IV4A 1NCLA 3KZWA 1BQXA 3SV4A 5C42B 3N7ZA 4YU9A 3MHYA 3W61A 3CCSS 3AQOA 2HQGA 1NLKL 2RQCA 1FK9B 1TFWA 2LQ8A 4WK1A 3V81A 4J9RA 3UO0A 4FP9A 4JI3J 1G7CB 4F4ZA 3EZOA 1RK8A 4A31A 5D4OA 2IRXA 1REVB 2VFVA 4AVCA 3TOAA 1HBNA 4DR7J 4KHRA 3PW7A 1VGYA 3BGUA 3TJ9A 4WKYA 1NSAA 4JYAJ 1M5PC 4CGPA 2JEFA 1MMNA 2VFTA 3ILOA 4YRHA 5JMNA 4E0DA 4O3RA 3IEHA 3MM7A 2WYRA 3D54A 5DWMA 3CCQS 1RQ0A 5FD1A 4F6AA 4P9SA 4FNHA 9ATCB 5LMNJ 3N9UC 4OIXA 1HQEA 4LR7A 2JL9A 3CJ3A 5AGEA 3GILA 2E5LF 3GFXA 2ZDPA 2OSRA 5IX3A 4USMA 1SV5A 3S1TA 1Y0YA 2WOMA 5DG8A 2UZAA 4MTPA 2MQPA 2R7HA 1D8YA 1Q5VA 3RJMB 2VDIA 3IS9A 3T9ZA 2PJ5A 2OPQB 4M1KA 4A8KA 2QLFB 4J9PA 1EETA 2W4PA 4KKOB 5E3PA 1X9SA 1PYOB 1A6LA 4ZPWR 2L9WA 2LQJA 4ZVRB 5K14B 3AA8A 3NS7B 2QA1A 3D5MA 4RW4A 2QT7A 1VBZA 4MCRA 2CPJA 4MHNA 2HQYA 1D3WA 2RAQA 2J6UA 2CJ9A 3QZ7A 4OJ3A 3TFYA 1KP6A 1ELOA 5CA5A 4PQAA 5LOQA 5L46A 4USJC 5HJXA 3DLGB 1UWBA 4JI8F 3PX6A 2VC1A 3D0HE 1PCAA 1IKXB 1YW4A 3ZTRA 3J7A1 1U4BA 3NCPA 4M6GA 2GIFA 4DV4J 2IYGA 3UCUP 8AT1B 4CRYB 1BO4A 5HVFA 2IVYA 4WBFA 4O3NA 3PXGa 1Z5RA 5IT0A 2V67A 2ZPAA 2H54B 3MEDA 4KORA 4ZIVA 3HHLA 2N7YA 4RBVA 2RS8A 3PEHA 2J9EA 3QLHB 1HR0F 2KB2A 3IWEA 1Y10A 1VRUB 1IGBA 1WC6A 4HL9A 2AT1B 4QVTA 5ETOA 3T8WA 3M8QB 3T90A 2XZTB 2DCLA 4LF4J 4I56A 1S99A 3JTPA 3AOCA 3OTOF 4ERDA 2B5GA 3UFCX 2KYXA 3TEGA 4ZHRB 4ONWA 2LU1A 4FYVB 2KRBA 2VONA 2FHJA 1HNVB 1N33J 2QG9B 1S1VA 2DGWA 3G2XA 5EWGA 2IMOA 3T41A 1U0HA 1XMQF 2DR9A 3TC8A 5KT3A 2C2NA 3PEIA 4ZP8A 4ZVGA 5EMIA 4ETZA 4CGMA 3AB2B 4C11A 3R7SB 2KG0A 4LT6A 4KRWA 1RA6A 3NS6A 3QWUA 2PRQA 1Y11A 2BA9A 5ETSA 4TKTA 4LJMA 1FRKA 2MHNA 3Q2SC 1LWFA 2B9YA 1HARA 2IMWP 4J9NA 2IM3A 4E8OA 1LV5A 4M5KA 4NXYA 1RACB 3I32A 4B3MJ 3IWXA 2GO9A 3KHZA 5HANA 1MW7A 1DQ8A 3PCOB 2DGUA 4EVYA 1RAJA 3MM7B 4IFVB 3MGDA 1IYKA 3LODA 3OUYA 4I64A 5KFXA 2FXFA 3RBXA 4PXCA 1HQEB 2OSQA 1HIYA 1Z1ZA 2ZM6F 2ZE2A 1B64A 1HBOA 3O6QA 2LQ5A 3H8FA 2Q3PA 4LF2A 3CJ2A 1FESA 1JLBA 4UZBA 2X7IA 3WZ0A 2YBVA 2V63A 3ZFVA 1ZLHA 4Y0FA 1SV5B 4BDPA 5ISVA 2HB6A 5ETNA 2R8HA 2B9EA 3VF0B 2KJWA 3HD2A 5F8IA 2CUYA 4CYQA 5I0CA 3UDVA 3CPWR 4DCOB 2ZUAA 3IS9B 4EI2A 1MJBA 3P4UB 2GMHA 2VPWB 5LSLA 4YB7A 2A2DA 3OXLA 2JZ5A 4P2FA 3IC1A 1K47A 4CLKA 3D2WA 4YR0A 3FK4A 4PR6A 2QL7B 1IB1E 3Q8YA 4RW4B 3MFIA 3TW0A 1ITPA 2EBEA 2R7SA 3Q24A 3ELHA 1MJ9A 4F0YA 1UWBB 1VQ6S 4PG7A 2YNFB 2MQ8A 4NWBA 4RW6A 3GMGA 1K1QA 3UDCA 3FUYA 5DGBA 2AZ3A 1B3TA 3RRHA 4QCLA 1ZA2B 2ATRA 3GFZA 8CPAA 1MLAA 5CYJA 4PUOA 3FZBA 3Q8RB 4ZGYB 1OY6A 2APOA 4DV3J 3IBCB 2JLMA 2NXUA 2WW8A 3FEXB 2V34A 2DKOB 2FT0A 4XPLA 2A2CA 2X3GA 4RJVA 3KKFA 3HLUA 2AJQA 3UWTA 2DNMA 3JVNA 3D1HA 5AXNA 4ED6A 2GJFA 2F5GA 3LD2A 2B0GA 3IA0A 1CLFA 3G86A 1IBLJ 4ZJQA 4DR5J 4MMOA 2B5GB 3OVBA 3HZGA 1ZLIA 4M6IA 4DX8H 3D2MA 4Y00A 3IAM9 4FF4A 1S1VB 3W8GA 4ECWA 1T9UA 1U0HB 3NGUA 4KOSA 7FD1A 3G8TA 3MEKA 4QQBA 2B5JA 3CMQA 1MK4A 5K8MA 3N79A 4Q38A 5JPHA 3AJDA 1I5OB 5KAKA 4DV6J 4B3OA 2IDEA 4B9UA 1RHRB 4OI0A 4B9MA 1VBXA 1B0VA 4F4AA 2G0BA 2V0NA 2CQ3A 4PSWA 2IJZA 3RAXA 1SI9A 4W90B 2OELA 1X8DA 4DLEA 3IM9A 3BJYA 2ZH5A 4WJBA 4URQU 5CAAA 2VODA 2MKCA 4F3OA 2EFQA 2XZWA 2ABYA 2ILYA 1WKKA 4MHZA 3RR7A 2IRUA 4KGZB 2UUBJ 4YP3A 2AYEA 4ICLA 5IQQA 5GAEI 3DHXA 4ECVA 4N47A 2BZ2A 3SSQA 3DDIA 4IUSA 1YITS 3N5FA 4OLOA 1FKPA 2HHXA 4EZ6A 3Q2TC 2ZE2B 4M5GA 1HBOB 3L7PA 1GAOA 1LWCA 1D0EA 4NE9C 2YNCA 4H4OA 4NCAA 4UW2A 4WP3A 3T5HA 4MJ8A 4YFUA 3L7UA 1S7NA 3RO0A 3JTNA 1VK8A 1RB0A 2VKZG 2GGPA 3W2VA 2HGLA 5HH1A 3HUVA 1SC6A 2L41A 1S6QB 3KUHA 1TKFA 3D3SA 4ZY1A 1BQNB 2WSCC 2YKNA 1M4GA 3KLHA 4USUA 1S4EA 2UVRA 4ED3A 2JEJA 5IM0B 2AJ0A 2EFGA 3KG4A 4MRIA 3G6ES 3MR7A 1W7WA 3T1AA 1NK8A 4LF9F 4JD6A 3ETOA 4EYHB 3FIXA 4ZI6A 4R5PA 4M5LA 1IR0A 3SYZA 4F9VA 4UF4A 5KG4A 3DLEA 4CLPA 3CF5Q 4UZCA 2WVCA 3NWRA 3P45B 2FZKB 3ZZ0A 3TT2A 1SVDA 1CJVA 2W2PP 2XEXA 2OD4A 4J9UE 1SKRA 4QPXA 3KLFA 1PYSB 1UAWA 3GR1A 5LMUF 2K3KA 1UFKA 4AYBD 1Z9UA 1Z2ZA 2DPTA 2GW8A 1RBOB 4P72A 4AVBA 4RW6B 5D77A 4RNOA 5L9XA 3BS9A 3CCLS 3NH8A 3LP2B 4ED2A 3B3CA 2PT0A 1P9YA 2E5HA 3D6HB 2VDHA 3NAHA 4NXNF 1NMTA 3MCMA 4ED4A 2XMTA 1PU9A 2IJRA 3K9TA 4P6QA 1ICEB 1YRXA 4I69A 5JQ4A 4F0XA 4Y28C 4E2FB 4P4FA 2P6TA 3DDDA 3GIIA 1IBKF 3H40A 3QRPA 4QIEA 1TKXB 1RBLA 2I9SA 3RTVA 2HHHF 3GJRB 3BI0A 3HO1A 1NSKL 4NYOA 4P7VA 2L48A 4DPXA 1BWEA 3DRPA 3MM6A 3I6PA 1YJ7A 2CQHA 2H5EA 3P6YC 1U6MA 5J1QA 3WT4A 4QUSA 5DWNA 1WOPA 3KLVA 2RRBA 2XMKA 1S1UB 5D4LA 2FE7A 1FY7A 1RT3A 4R0EA 1Z8XA 5KFZA 2NMTA 4RW9A 1YJVA 1U24A 2M3DA 2C1CA 3CC2S 5C25A 2KN4A 4EUVA 3MPDA 2B5JB 3VQSA 3K5PA 1IWGA 3VZHA 1LW2A 1VOMA 4X4TA 4MJKA 2P9CA 2YWKA 4H4MA 5E5NA 1JMTA 2GQ2A 4L72B 3ZZUA 1T05A 4ECTA 5D0GA 1JJCB 2R7RA 3UDEA 2F9DA 4KOUA 4NLOA 1L3UA 1YJWS 1ZA1B 3F8KA 4OIWA 1HFEL 4GKJF 1NK5A 1RO5A 3PFOA 1QMUA 3EGZA 2YQ0A 3TVZA 1DTQA 2YWGA 2PVVA 4IG0A 3M30A 2F63A 3BM7A 3BI1A 1YTYA 3WQPA 1YR0A 1N48A 5DLGA 4K4VA 3UPFA 5DG7A 5MLCV 1WTFA 4CO5A 4A47A 4OI4A 1FKPB 3GIJA 1GFWB 1VQ8S 2GQQA 1LWCB 2W9BA 5KT5A 4CH0S 3W6SA 3LQVA 4DMZA 2OHDA 1GT8A 5IQ6A 2YH0A 1YBUA 4LFCF 2SXLA 1S5ZA 2DXEA 4PRFA 5E3CA 5GCNA 1XMTA 4ANEA 2GGPB 3W2VB 3KYLA 5E3QA 5KOXA 3BO4A 2YKNB 3SFGA 3TUIC 1VYAA 4MFBA 3KLHB 2UUWA 2PO4A 3KOAA 3D7SB 5JXSA 5G20A 4OX9J 2FB0A 2ADCA 5T41A 4J91A 2VJUA 2BV3A 2ALZA 3G96A 1UTAA 4A48A 4DSKA 4DL7A 3BH6B 1TMJA 4ZVTB 5DRKA 1Z8LA 1RAIB 2MEWA 3TAQA 2JLEA 2POKA 5A27A 3DRRA 1JLCB 2IJNA 3OR1B 5F49A 1W25A 4CLUA 3GB0A 1LWXA 1SC1B 2CJBA 3W63A 4FWUA 3M7VA 3SCJE 3PV8A 1TIQA 3GYAA 3KLFB 4L3NA 3MMJA 3R27A 1TMMA 1AMPA 2BX6A 2DHAA 2PFFB 4MI4A 4BLGA 4R9MA 1OQ3A 3GG1A 1T9WA 2GREA 4O23A 4KGMA 3F56A 3V8IA 1EJ7L 4MIWA 2KVIA 1FI4A 2FVCA 3BO3A 1RTQA 3DLBA 2V8GA 2HQIA 4GXHA 1S6UA 3OVAA 3K5MA 2GIVA 2G0JA 3OSNA 4CLLA 4GVBA 5DS7A 2HW3A 1X4DA 5E2QA 2Z3LA 3OLBA 4V19J 2R8VA 2YKOA 2J7UA 2VB6A 2ZHBA 2C2EA 1QVGR 4JI4F 1FRLA 4CLYA 2AJ1A 1C1BA 4DV7J 3B8GA 4H4KC 5DQHA 4R8UA 2EUIA 1N32J 2BOPA 3B3WA 2BJ7A 3PW4A 4YB1P 4C8NA 4OYZA 1IVZA 1MJAA 5DETA 2ZH3A 4RW9B 1IXKA 1CJUA 3QFHA 4ID5A 2FLPA 2IL4A 1PAEX 1JXEA 1Q5YA 1VHOA 4P44A 4ZLLA 3AHPA 4C8YA 1LW2B 4NFRA 3TJ8A 2CKWA 1L3TA 4OC0A 4L76A 1KTQA 4H4MB 3CJSA 1LXNA 2XM3A 1VQSA 2QL9B 4LF5J 2GE3A 1T05B 2FZCB 2ROEA 2GS8A 1B7YB 2W9CA 1Y4ZB 3BPDA 3CTRA 3AQPA 5KFRA 1TU0B 4X4PA 2ZW7A 1HNZJ 5BXIA 1WK4A 5MAOA 5F0WA 4YOEA 4LRBA 1J5EJ 2MQNA 3NOCA 3DGVA 1RE1B 2MMYA 3ZTPA 3M30B 5K5MA 3LO3A 3OQ2A 4DUYF 2WZ1A 4I2QB 2DHHA 2ZH6A 4UFXA 3PTWA 2AGQA 3UVJA 3Q8SB 3RZAA 4OZ0A 3ICLA 2HLUA 2W9BB 4J5OA 1B7FA 4ZPBA 1P6TA 3PRTA 5IV0A 1Y0HA 3KASA 5IXUA 4MXUA 1VQNS 3H0PA 3IN5A 3WDOA 4NA2A 1LWEB 2HBYB 3R7BB 1HBUB 4MKBA 1T95A 2CWKA 3R3TA 3GPAA 4DFPA 1U1QA 3FMCA 2HNDA 2MKYA 3OLAA 2CWXA 1V5IB 4DV0J 3RB4A 1RT5A 4FBEA 3DLKB 1M4DA 3CIMA 2B43A 5KG1A 2KKHA 3HHNB 3C6TB 5GMDA 1URNA 3ITHB 1P0HA 3GTYX 5ADZA 3DRRB 1UVLA 4AL6A 1U1OA 4B9NA 1VHFA 1HNXF 4DZ6A 4D3GA 4U9YA 4A8QA 3HKWA 3JUWA 2GFFA 4UOGA 1F5AA 2R1IA 2D1CA 3RGIA 3PNIA 1KVIA 4YY3F 3D68A 4ES2A 3HCXA 3QFWA 2F40A 4IRCA 4JB8B 3MF5A 5B0FA 2D9OA 1IN0A 3M8YA 2DTJA 4DR1J 2DBBA 1X4EA 2E7WA 2PD1A 2PJ1A 3F41A 2XMJA 5B7WA 3X1LB 2EFOA 3BEGB 3MFHA 4GVBB 3ADAC 2JEVA 4J9SA 3KJNB 4BWMA 1R27B 1WC4A 4KHPF 2Y1RI 1KHVA 2C3MA 3W7BA 3DI6A 2HQ3A 5JH9A 1D9DA 3MUTP 2DVIA 1C1BB 2CG8A 4ZN3A 2FVGA 1NHUA 2G2ZA 4R8UB 2R2SA 2DGVA 3TNVA 2ZW6A 2Z57B 2CVEA 2XWXA 2NXJA 2DXQA 3ZZIA 5KTQA 5D15A 1XWLA 2NXNA 4JI1J 5E0OA 4ID5B 1OIAA 2OI2A 1H3DA 4MFQA 2QIFA 2KM8C 5KG7A 5DJBA 4CZCA 2DGXA 2W4DA 1NSQA 1X5SA 3I87A 2DB1A 2G9DA 1VLOA 2JVOA 2YNEA 2KRRA 3RBDA 1D9AA 2B6AA 1UJ6A 4Y34A 3PP9A 1X4FA 1WDDA 1R8PA 2Y1JA 2XB2D 1CP6A 3F73A 2Y0SD 2VG7A 4U6PA 1S6PA 3A3NB 3FEYB 2Z3NA 2RIJA 4HT5A 1KQKA 2IA0A 4O3QA 5ITHA 3NGDA 3VWEA 1LRZA 4EEYA 1H6KX 3TJAA 2VPXB 3C15A 2WSEC 2CYYA 2JX2A 4B3RF 5FVJA 1DTTA 1CULA 3KHHA 4ZY2A 2NPIA 4OJGA 3SZ2A 5HVHA 5KFLA 3I9ZA 4JI7J 1MN9A 4WFNQ 2N3LA 1Y5NB 1GHEA 3BJ8A 3UVJB 2F8MA 4K4TA 4K7QA 5J2QA 2CJXB 5CYMB 1M4LA 4JV2A 1KEKA 5AJ3J 4Z2XA 3C6UA 1PJ6A 2R7QA 4U96A 3CXSA 2DXFA 5IWAJ 1HNWF 4DV4F 4I4BA 3SI2A 3BO2A 2E7VA 4TN2A 4EBDA 4CAEA 4X2BA 2HNDB 2CA9A 3FGVA 2ZOGA 3B7IA 3HMJG 4WIIA 2RC4A 4AXVA 7AT1B 3IBWA 3LACA 1S7KA 3MUMP 3F44A 5IT9U 4LRAA 3WC5A 3G6XA 1KVJA 1I94J 2CADA 3TX0A 1GXTA 4LF4F 3JQKA 4WFBQ 1KSPA 1TF9A 1Y7PA 4C7QA 3H20A 4NPOA 1NDPA 2AFSA 2UUAJ 2ASLA 5KG0A 4DCJB 4UWIA 4YEAA 3D8PA 3WC0A 3OHAA 1P4NA 5AG5A 2C3PA 3NLCA 2WK4A 2E9RX 5BYSA 1IU8A 2NYQA 5KFOA 2DEJA 1IQTA 1BPMA 4L89A 3LP1B 1CEZA 3FRMA 3R2CJ 3SFUA 3QJJA 3UD5A 4ELUA 2BABA 4UEEA 4Z7YA 2YNHB 3QPIA 3GCWP 4CCHA 2OLWA 3L4BC 6FDRA 3SDEB 3ENAA 3QBCA 3P96A 2KHDA 4ED7A 4ZVQB 2I3CA 4ZN1A 4RW7A 4Q5VA 2CIJA 3OTBA 4CO4A 5KFEA 2DJWA 1TL3A 2NLWA 4F2SA 3T6BA 2ANPA 4DZDA 4ILMA 2V8DA 1HWLA 2C2OB 3NKYA 2QMUB 3HD1A 2MKKA 2K8GA 4MBUA 2HIYA 3FB3A 3V6KA 4ZVFA 4ECUA 5KFIA 2HYIB 2HFZA 1DE4C 4OLLA 3NGTA 4N5SA 4K4YA 3WX4A 1LAMA 3B3VA 3IAS9 4OC4A 4M5JA 4WE1A 4OJ1A 4CTAA 3RW7A 5KFTA 3D6TB 5DQGA 2ZBIA 4M63A 5CCLA 3HSJA 5KT2A 2V4JA 1OO0B 4ITSA 3V2UC 2H5IB 1QDUB 3ISXA 4JLYA 3MAQA 1X7VA 1EX8A 4P2MA 4BC7A 3DDNA 3JSRA 1M4IA 2HS3A 4C98A 2AFMA 2DY9A 4IH6A 3M4XA 4DS5A 4ED8A 2HHPA 3DNSA 2OFHX 4DYOA 3MCNA 4V1Ak 5JJBA 4FPIA 2B9WA 4DV1F 1NJXA 3R96A 1VBKA 3KK3A 1YK9A 1MMLA 1FE0A 2OTLS 4ANDA 2EFPA 2HHVA 4ZCMA 1HWUA 1UFWA 1E6YB 4YS2A 2X1FA 2LYVA 2XSJA 4HNYB 3NP5A 1BMQB 2KHCA 2ARHA 3LPYA 3FFIA 2HFVA 4DQSA 1XBUA 3C6UB 1X4AA 4ZX9A 3HZEA 4OYWA 1S7HA 2E5LJ 2ZHAA 4C2MA 3FVLA 3PZJA 2RF2A 4RNMA 2YY3A 4LMZA 5A0YA 1ARLA 3AXMA 1BHNA 1UJ4A 5B0BA 2MZSA 4X5KA 3GE9A 4DS4A 4BHQA 4DV3F 1R0BG 3IG1A 2IQ6A 4RN7A 1AT1B 2VFSA 4PAAA 3CD6S 5HBMA 1BOBA 2MYFA 3ZZYA 1UETA 2DD8S 3BB5A 3R97A 1XMOF 3BGRB 4JV0A 2FSRA 1GMWA 1QSYA 2AGPA 1AYEA 2CPXA 3H8GA 1N6QB 2BE2A 4YN3B 1NKCA 3A8IA 1M5HA 4HLBA 4DSFA 1SJ3P 4X3RA 3FMWA 4DV5F 3QGIA 3QJPA 1RT6A 1IKVA 4WPAA 2CQ4A 2KU7A 3HX9A 1WI6A 1TTHB 2JJ4D 4HEA9 2DIUA 3O2IA 5F46A 2MQQA 4NXMF 2D41A 2RSQA 4C8KA 5KFWA 1VJWA 2QA4S 4ECQA 3MPVA 1U1MA 1OPZA 1HWJA 2ZW5A 4F0HA 3VGSA 5HQMA 1RYRA 1AB8A 4DDFA 3TQEA 4E8UA 4NMLA 2OPSA 1RT7A 4R87A 4DR3F 4DXLA 5KFFA 2FIAA 5DLFA 3MR2A 4DL3A 1RTHA 2R2UA 3W64A 2G0IA 4RW7B 1JQGA 1U8SA 4KO0B 1EP4A 2H65B 1HR0J 4U5YA 2AEFA 2GANA 3PG9A 1F5BA 2E1AA 4PPDA 2A4NA 5HK4A 2GNKA 2VZZA 4JBCA 3OTOJ 1V6HA 2Z2MA 1QTNB 2CPEA 4MFLA 4E0AA 3CGIA 4ZBGA 1QAJA 1TUGB 2Q44A 1N34F 3KJFB 4L3KA 4NA3A 4K0KJ 1PGZA 2LP4A 2Z8QA 3LUYA 2XGQA 4IQMA 4WE1B 1TAUA 2MLXA 2ZXVA 1A0OB 3IBFB 4CTAB 2ZEPA 2EK6A 1XIQA 3H8EA 4OQJA 4CO2A 1CJTB 2AMCB 5G21A 3G82A 2ALYB 2FC8A 1X9WA 3GV5B 3JYTA 3HK2A 2CDQA 3NBPA 3KLGA 3R2DJ 3O5TB 4O4GA 4B5OA 5HO4A 4X4QA 2C3UA 5HVGA 4HHJA 2ZEMA 1Q79A 1TV6A 1LW0A 2YPYA 2WW4A 2DNLA 3NOGA 3KK3B 1HMVA 5L8RC 1ULRA 1IY7A 3BQ2A 3I9V9 3I0SA 4ZVSB 3DLJA 2XMUA 2HUZA 2XSJB 4ETXA 1FWLA 3HHKA 4DQRA 4KOYA 2AU0A 3KR5A 1U8WA 4KZTA 4MHPA 1GEHA 2WUUA 1X60A 1WORA 4UEFA 2ZM6J 4PABA 1IJEB 1HDUA 2C3OA 1J2VA 3BZQA 1W2IA 2BM0A 2H51B 2BKOA 2EK1A 2RF2B 1NJWA 2HVEA 1V3RA 3AY0A 2EWBA 3HI9A 5A0YB 1NJYA 4OX6A 4C0OC 4AUKA 3PX0A 3VGVA 4UCNA 3IG1B 1Y5IB 3J81Y 1N5VA 5HBMB 4C3LA 2V8VA 2GA7A 4CM0A 3OHBA 3PEJA 2VG5B 4F04B 5AXMA 3PKMA 1QAIA 4I68A 2ZZNA 5H84A 1XJWB 2PE8A 2YKPA 2CZ4A 2BE2B 4B11A 5H1SV 4OC5A 1ACMB 3RAQA 3KLIB 1RT6B 2G9OA 4YQWA 2FLNA 1WI8A 1EQMA 1ZM9A 3DM2A 3H2VE 2DK2A 2DNHA 2LQ9A 2E7XA 2I00A 1QLNA 4ZPAA 5HMWA 1TF8A 4KT0C 2OB0A 2JBJA 2C6GA 3QRRA 2LVWA 1XK8A 4PQUB 2MKIA 2AGOA 5EWEA 2EK9A 1DY3A 4Y2MA 5F8HA 5SZTA 1QSMA 3CD0A 4F0MA 2WSAA 1IKWB 4QIGA 2LXUA 1UCNA 2ZELA 1XC9A 1RT7B 1TELA 2HPUA 1I12A 3QMQA 4M5DB 3BBCA 3M9MB 5J8FA 2DNPA 4F67A 2DR8A 4NLPA 3PB7X 2WVDA 3EVOA 2W1BA 3EXCX 1DFDA 4NGQA 1O0PA 3IP0A 1N71A 1EP4B 3Q8VA 1HA1A 3SEOA 4EYIB 3WC2A 4IK2A 4WXOA 1LNQA 4XTTA 1TVRB 4M3SA 4DFJA 4WXWA 2HZAA 2QA2A 2WVBA 4BS2A 2FJVA 3A8EA 2YKAA 5KFHA 2A0FB 5L1KA 4NRTA 1PG5B 3FJ2A 1VQKS 4EZ9A 1CSJA 4Z7CA 4B02A 9RUBA 4ZP6A 3S01A 4DG1A 4IO1A 1VIOA 3LA0A 3PJWA 3MM9A 2MSSA 3HT3A 1R8AA 4UCPA 1OWXA 3CXPA 4FS1A 4I2PB 1JJ4A 3Q23A 4QWDA 2MQLA 3BN4A 1ZPWX 1TKJA 2DGQA 1ZYQA 4G1PA 4IYQA 1S49A 4FN5A 1RDRA 4Q0BA 1XNQF 3N28A 4HNXB 1UPMB 2DNGA 2XI3A 2ERRA 1UEKA 2QTWA 4NGRA 4II9A 3C46A 3NBPB 1KOOA 4OFZA 3FEEA 3GONA 4O4GB 2ZVSA 2E1PA 4WTYA 3CJTA 4LRFA 2DPIA 1RWMB 4NRUA 1DQAA 2CAJA 2HLTA 2B4BA 3UNGC 1TV6B 2J9CA 3MOJB 1LW0B 4U67Q 1HMVB 1AW0A 4G3IA 1FD2A 3I96A 4UQTA 5IOLA 1RWWB 3R5JB 4UIAA 3I0SB 3K8VA 2ACMA 2M4MA 1QQ9A 4LVOP 2C2MB 3I1UA 3SI0A 2R8KA 2ADBA 1WHXA 4C8ZA 2ZH9A 1BWVA 1P1TA 2L3MA 1NMEB 3HULA 1Q8IA 2M70A 4DR6F 2NUUG 3FQLA 2G1DA 1YI2S 4RO0A 4ELVA 4WF9Q 3K2YA 2IBKA 4FZVA 2YNDA 4KAIA 2MJNA 4K59A 4RBUA 4NEYA 1SUQA 4Z65A 2AQ4A 5C2GA 2HHTA 4LFBJ 2R7UA 4DF8A 2UXDF 4KB7A 3P5BP 4NLYA 4FDFA 3SSRA 1HPZB 3KDNA 3DXBA 4Z37A 2BOAA 3MMAB 2U1AA 1F2OA 4I67A 1S1WA 2G0CA 2N7CA 4OZJA 4M6HA 4LSNA 2M52A 2R7WA 4K4WA 4X4RA 3MDFA 4LF9J 5JM6A 5FIIA 1WSRA 3ET6A 4XNHB 2MTLA 3H5SA 3ILIA 1JXVA 2YKQA 3PVXA 2NQPA 2CNNB 4I7FA 1AFIA 2Q4YA 3UW1A 2XQCA 2QX0A 4P2XA 3M8WA 3RW6A 3PJXA 4ZVUB 2KM8B 3QO9A 4X66F 5BR8F 4ORFA 2KZMA 3L95X 5LMUJ 3R5BA 5AT1B 4Y3CA 3B4MA 3I0RA 3KNGA 1XEZA 2J6TA 3HVTA 5LSOA 2A6OA 4LF5F 3CPAA 3F0AA 1X10A 1B0TA 4IDKA 1T3NA 4XPKA 3FMBA 4A8SA 4FBTA 4G6VB 4P6YA 4NXNJ 2GX8A 1RAGB 4LVNP 2VL1A 3OVSA 3CC4S 2VD3A 4LIRA 1T9TA 3CDXA 1TL7B 3VQTA 3JSMA 4KR0B 4NEXA 3RRGA 4H54A 3IU1A 1IBKJ 2V6AA 3U1NA 4OP4A 5C88A 5HMNA 4O44A 2Q51A 4KSAA 2HHHJ 3PFEA 2RB7A 2BSWA 3CDAA 4E2AA 3PHTA 2BVZA 2E5IA 4H6ZA 1KHWA 4IOAQ 3GZ7A 1T03B 4WFAQ 3I31A 1RWXB 5HSPA 2I38A 3R9EA 2MZQA 4WKRA 2V2ZA 4NGPA 2NYHA 2RQMA 4DG1B 3HM9A 5DDRC 1MWZA 3MM9B 4R76A 3SHPA 2HWIA 4Q45A 2EXUA 3QIPA 5A2QU 4NA1A 1ZTWA 1NDLA 4DL2A 1WJ9A 4TXSA 3U7JA 2DGTA 1SQEA 2PJ7A 3NCQA 3KJVB 2CG4A 2PR8A 3ZO7A 2PSZA 1Q16B 2OEKA 4Q0BB 2F8HA 2VASA 2HZCA 1SJRA 8ATCB 3SI1A 5F8NA 1RAOA 2D4PA 4DV0F 2CFXA 3CJ5A 4FAIA 2DY1A 3D28A 4GKJJ 3PZPA 3DC2A 2Q7BA 5A76A 1QJHA 4C0HA 3NWGA 1ZETA 1CS4A 2LXIA 3B3TA 3TQ1A 4QYZJ 2HMIA 4F0KA 3M8SA 3J7ZT 4KV8A 1CC7A 4L73A 5DS0A 4DPUA 4P74A 4XDDA 2DNNA 2ZDOA 5RUBA 3EXNA 4P71A 1DJ0A 2KL8A 4K4UA 4HDHA 3M2RA 4YB5A 3EUNA 3TR5A 3OJSA 2E1CA 3SQOP 1RUSA 2XHWA 5HAOA 2MQOA 3H4DA 5HLFA 1M1KT 3LWUA 4PSXA 4NGTA 1XRYA 2PI4A 4XAKA 4B14A 3ILJA 4NZ0A 4RX6A 4NYZA 2MXYA 1YQHA 2XZDB 4DR2F 2XHCA 4PK2A 2WTFA 4MKVA 4ZCKA 2BE7D 4B9LA 4GC6A 1S97A 2VU5A 3OL6A 1CJWA 1FDDA 4P75A 4C2XA 4P2SA 3CJ4A 1IBMF 1KFDA 1F3VA 1BUXA 4TVAB 1LAPA 1PBAA 3QAYA 3H90A 4DPTA 4WYLA 3M6VA 4A30A 1SXLA 4A33A 1FNOA 1X4GA 2CJQA 3CCWA 4CYPA 4YDDB 3PRBA 4WP8A 4I7FB 2EC0A 4EU0A 4JI1F 4O3PA 1RTDA 3QO9B 5LM7E 4YHHF 1B87A 4U9ZA 2KDOA 4C7HA 4ILRA 3I0RB 5DM6Q 3VALA 4IH5A 1QAXA 3HVTB 4RL1A 2WBRA 3IR7B 2A1BA 1WOSA 5KFBA 2K5TA 1TL1A 3B2YA 1SH0A 4IDKB 3K89A 3D6MB 4CRZB 3S6EA 2BBEA 4OYOA 5KOWA 2NSCA 4C3MA 1BXNA 1CVJA 1UFLA 3VV2B 3EGNA 3UR3C 3JSMB 3SXOA 4PYAA 2FS5A 4DSEA 3PBBA 2BRKA 2FY1A 1Q2DA 4O44B 4JI4J 3NH4A 1IM4A 3BR8A 4B6ZA 2EEYA 4DPOA 1QSNA 4O0IA 4GO5X 2MLYA 2VJVA 3TZZA 5GAGU 2JLFA 1NXIA 1AUGA 4OHVA 2AP6A 4WZMA 1AROP 4QYRA 2F8EX 2BJ8A 1KFSA 1KTVA 1H72C 1SJ1A 2NUHA 2J7KA 4ZVHA 2FIUA 1R3NA 4C2YA 2P9GA 5J1NA 4WFZA 1RADB 4EO6A 3D0GE 3W2WA 3VTIA 5HQ8A 4USVA 1DTDA 2VICA 4IQXA 2FYXA 4ZK7M 2XEFA 3PBEA 1OBRA 5F8LA 4JI6J 1VHSA 5EWFA 1YZ7A 3M32B 1F2HA 2KXNB 3CO9A 1LCPA 2MPUA 4F02A 3LPEA 4WP9A 3T5KA 1RWUA 2XMWA 3UN5A 3NNCA 3THVA 3S9NA 2D3OR 3CC7S 4J9QA 2OPQA 1GTHA 1HL6A 2Z2YB 2PJ4A 2GVDA 1DRZA 2ZOFA 3C3LA 4FVMA 3QT8A 1VBYA 3S7RA 1FJ7A 2HMIB 2HBQB 2PJ3A 4J9VA 4KV8B 1JX4A 4FPRA 5ELYA 3S6GA 3I3GA 3R5GA 4YDXA 1N52B 5K14A 2FLOA 2DNQA 3S9MA 3M9NB 4BBHA 4DF4A 1S7LA 3SV3A 5LL6d 3G3SA 4EFAC 1YVFA 2D74B 1N5QA 4M5MA 5EUHA 1D9FA 4PG8A 1NB2A 3HF5A 2QV6A 3K5OA 3FCHA 3CCRS 3UY5A 5HLFB 2V9WA 1WC3A 3DHWC 4A95A 4CLFA 3NL0A 4OI1A 2LEPA 1Q2CA 2Y9HA 2E9ZA 1OY9A 3NH5A 2B51A 4ZPDA 3NS5A 1A9NB 1NKBA 4BCAA 4JV1A 2PGCA 5KFYA 1ZH5A 3FH4A 1NHVA 3HFKA 5BWAB 1H0HB 4DJBA 3MAAB 1DLOA 5AG4A 2M88A 1MN7A 1WF1A 3W5YA 4MFPA 3PYGA 1SJFA 2XGPA 4P4IA 1VRUA 2XULA 2RNEA 1BE4A 3BKUA 1NJIT 1U02A 4KGXB 5J2NB 2ZNZA 1TZ0A 1HNXJ 1UEVA 2QLWA 5CH7B 4P7TA 2C28A 1RTDB 2W2MP 3QNWB 4TYAA 1H73A 2CJKA 1RHQB 3WC7A 4CRJA 2PMWA 4V19X 4OZLA 3A8KA 1TL1B 1L3SA 4XPDB 5LYLA 2BW7A 3S6FA 4KGKA 1V0CA 2AV5A 4Q2MA 4B10A 2CQBA 1DZ5A 2VA2A 2YPZA 3PM9A 3EJMA 4A46A 1J5OB 4FNIA 5KFUA 2J8AA 2B4OA 1TK8A 1NAQA 4KHPJ 1DURA 2B7CB 3TO8A 4PV6A 1SBRA 3RYLA 2AFUA 1OPIA 3QGHA 4MY3A 4Q8FA 3EZ5A 3PB8X 2BANB 3DR8A 2CJYB 3TUJC 4USKA 5D3GA 1NK9A 4TQSA 5ETQA 3MUVP 3OD2A 2Z11A 4IFVA 2UVVA 3MECB 2EG1A 3M2UA 3BDPA 4W4MA 1VC5A 2DHGA 2JDJA 5CHCB 1SH2A 3W2WB 2W4CA 1N5YA 4ZVOB 3SQGB 2IC3A 1KRPA 1VHIA 2MDAA 1M1GA 1HDQA 2K1RA 2FVQA 5M2UA 1YK3A 2HAIA 4LIWA 3O3LA 2J0SD 4OI2A 3R6GB 1ZM4A 2DHXA 5CNPA 2QVPA 2IBOA 3TZWA 2IAJA 2DPSA 1F60B 3NEKA 2O4HA 3QAUA 1FRXA 1SKUB 3OR2B 4NZ6A 4UWJA 5EBVA 5LT5A 2BKNA 3A3OB 4NZ7A 4G1QB 2GVDB 2YX1A 4X4OA 5EN1A 2VPZB 5G1ZA 4B3RJ 3PJ9A 4OHWA 1U0SA 4D3HA 2YH1A 2L9DA 2WVFA 1RWNB 1ZPVA 1XJOA 4ZCIA 2HS0A 1RWKB 3VAMA 3J80Y 5KFDA 2E29A 1YBTA 2ZC4A 2V94A 4FYDA 4Q2LA 4QR1A 2Q43A 5EX3A 3PB9X 1SKWA 1U2CA 2E1MC 1S1TA 3RR8A 5C5JA 4DFMA 2CQCA 4AL5A 2YWWA 4TQRA 1FEEA 2ASYA 1WOOA 2F3JA 4JXRA 4KY3A 2R7TA 3G87A 2YNFA 4R57A 2J9DE 3S9LA 2XCAA 3ZZPA 3HHEA 1HNWJ 3D3CJ 3SJXA 1H7WA 4KUBA 2OO4A 3E2EA 3Q89A 2DO4A 2VFUA 1WSVA 2GMJA 3NRBA 3PRVA 1DLOB 2KI2A 1LOUA 3SBMA 1D1UA 4ZCLA 4NLQA 1S10A 2V77A 5AXKA 3IWGA 4EMDA 4OYMA 1CBKA 2GAGC 2ZBCA 4CPAA 3OWCA 4TLQA 4IOBA 1RZMA 1WUUA 4FF2A 2QYCA 5JGFA 3OBIA 1JXLA 4MIAA 2GCFA 2AEJA 3R95A 1N88A 3FDSA 3TI0A 1BD6A 2ROGA 2YX4A 1ZG8A 3HJFA 2V8PA 4K0KF 4GC7A 2WPXA 3EYZA 1Y9KA 3UCGA 1S72S 5GMKa 2DCUB 5LJ5Y 2E1RA 3ZXWA 1FERA 3LALA 3Q8QB 2CPYA 4DX5A 1N36F 4P73A 1RTJA 3KKWA 1FRJA 4B5PA 4DV2F 3KQZA 4DL4A 1FXLA 2JEIA 5G22A 3PB6X 2QYVA 3CXCR 4A38A 2A18A 1FT8A 2XMMA 5E3RA 2ZITA 3W9JA 4PCQA 1GMVA 2QSWA 2GC8A 3MR3A 5L9NA 1HEEA 3KI9A 3DKDA 2MJUA 2R7OA 2KJVA 3CJRA 4OJHA 4WK3A 4XO0A 3K7RA 5D3GB 2AZ1A 1KBRA 3M1VA 1XBWA 5KG6A 4TNUA 1RAAB 4CT8A 3IWNC 3TAMB 4LBPA 3M2UB 1D8ZA 1TQLA 4Y2CA 4CNZA 2AYBA 4RBTA 3G8QA 3VCDA 1S6OA 2WB1D 4N8NA 2J9DA 1KDNA 5M2RA 1VC6A 4MFJA 1ZAWA 1N8RT 2Q7SA 1N5YB 4OYBA 5ETMA 3PW5A 5KFKA 2IC3B 2BO9A 1R8HA 2RMLA 4JP8A 3AXKA 2HQDA 4ZP7A 2K1RB 2C27A 3SCLE 2LECA 4XK8C 3V6HA 1EHWA 1U09A 2OEJA 3LAKA 3C14B 1S6QA 2IAJB 3KDOA 2J8RA 1BQNA 1VRTB 4NGMA 4PK3A 3GP9A 3O8WA 2AIRB 2PC6A 3BH7B 5IM0A 1XR7A 4RS2A 1K44A 3CCZA 1YJTA 2RRAA 3QYYA 1PILA 2I8EA 3MEGA 5FLXY 3JS9A 2HVIA 5DDPC 4DV1J 2Z2ZA 3FBUA 2CDRB 4S0MA 3AJ2A 2DH7A 4H89A 4UUWA 2VEZA 2CZ9A 2P8IA 3K17A 2OP5A 1S1TB 2BM1A 2RQKA 4BC9A 4KQZA 1KUYA 3KHRA 1X4BA 5F0UA 2J0QD 1BLUA 2NXCA 2MZTA 2CTBA 3CB4A 3VVUA 2KXFA 3V4IA 2P6SA 1UVJA 3J81j 1FJCA 3LP2A 2VQYA 3C26A 2RKIB 2NREA 1YWXA 4CLTA 2MZJA 2CPDA 4LUBA 2JFKA 3GLJA 5CD4H 3P5TL 3BYRA 2ZEFA 2CZVC 3MEEB 2XG8A 1YZ6A 4OI3A 1C1CB 1QE1B 1XMOJ 1TKXA 3CT9A 2G4BA 2XWYA 1VMBA 3KJQB 2J6SA 1S79A 2LXFA 1Q8BA 3T9NA 5A8WA 4DN9A 4CYUB 2YNGA 4DV5J 4F3QA 4J3GA 2Z3OA 3C19A 4A8MP 1MU2A 2VF3A 1S1UA 1S5KA 2NS1B 5AE3A 3DYAB 2DH8A 3D2PA 2QIRA 3SI8A 2XCPA 1CBXA 4ZKAA 1S0MA 4NXMJ 2IVMA 1YLXA 1ZM3A 1HD0A 3I9SA 2QGFB 3BBBA 2FGOA 5HATA 4C7IA 4ELTA 1QUPA 1GH8A 1RT1A 1RTJB 3G8SA 1OY8A 1FKOA 2FJWA 4U9RA 2Q79A 2YGWA 4B5PB 4K5RA 4OI6A 3OTCA 2FUG9 2CQ1A 3MZIA 1YVOA 2VQEF 3JTOA 5AE1A 1RU2A 3KG1A 3HHLD 2UU9F 2J7WA 3EGVA 4DR3J 1VKCA 2XEIA 4QYZK 1R31A 4JI2J 1LQ9A 4MAKA 3W9HA 5CZVA 5LRKA 4AQYF 1Y5LB 4OAEA 5KT6A 1ZBTA 3GJQB 2B58A 4ZLNA 2Z4PA 2LEBA 2BQUA 3QSYB 3J80U 3M1VB 3QAEA 1RSCA 3R5AA 2M0GB 1RAEB 2C6CA 1G6BA 4UIBA 2EPIA 1N5TA 4L8AA 5DGAA 2O5DA 5IV3A 4DNCA 1N34J 1H2VZ 3KNAA 2KYZA 4TNOA 2J8SA 3U1MA 6FD1A 1HBMA 1KLNA 2OTJS 5D29A 3BQ1A 1AFJA 3CJQA 2PA3A 2KO1A 2F65A 3MCSA 4LFBF 5J8CA 4IHMA 3J7YU 3R1HA 4WFYA 3T19A 4A37A 4A2ZA 1Z8WA 2PA8D 3CSKA 2KFYA 3PR4A 4AVAA 4LQ3A 3WHIA 2ZEJA 2DISA 4NCGA 1V3SA 3MEGB 1MWYA 2UV8G 3JTKA 2VBWA 4CAVA 2I5JA 3CJ0A 3RB0A 5HN0A 2G13A 1JLCA 1KWMA 3OR1A 3EFAA 4A32A 5F8MA 3CDUA 4KUAA 3J7AN 5D8HB 4X2TA 2W7AA 2ZWOA 5U47A 4LF7F 3FRYA 4N8OA 1S57A 3TRGA 4WWSA 4LRCA 2MB0B 2BMBA 1IR1A 2AJ2A 2VC0A 2RVJA 3JRUA 5CXTA 1IOIA 1RAFB 3TVYA 4C9DA 2H5JB 3V4IB 3CIZA 4WWVA 4R6TA 3IM8A 4M95A 2XO7A 2JSXA 1NDKA 3IGNA 1URRA 4OYIA 3MURP 1HQUA 1IYLA 4PEOA 1RLDA 4B9TA 2C2KB 2E9TA 2RQ4A 3LW5C 1X5TA 2O67A 2MLZA 5DM7Q 2VBYA 4B3TF 1FTRA 3SXLA 3E8OA 2AX0A 3D1OA 2Z3PA 1S9EA 4UBRA 2PRBA 2QO3A 4J90A 2FHMA 4PPZA 1X9MA 1RHKB 5H9EJ 5F8GA 1LXJA 2CNSA 4XDCA 2NYIA 5A8WB 2M7SA 3EM1A 3MPWA 4X65J 1NO8A 2YNGB 2CPIA 4XPCA 5K9FA 1UJ5A 4KPYA 3EDQB 1M1HA 1MU2B 4QBUA 2FL4A 5F3ZA 1U26A 4QR0A 4GRSA 4KVXA 4PZVA 1S9GB 2DNRA 1CPXA 4BMHA 4FXWA 1SJ4P 4ZYQA 2W9AA 2YQ1A 4ECSA 2RH3A 2FPHX 2XEJA 1RT1B 3NG8A 3GIMA 4HKQA 2X1AA 1FKOB 1GK8A 4RNFA 4A4JA 1EQ0A 2GHWA 3IO1A 2CNLB 3QIDA 5KFJA 5EDWA 5C2CA 3R5DA 4OC2A 2HNZA 4QOTA 4CO1A 2X7BA 2XO6A 1D09B 3KL9A 1NSPA 4L74A 4KC5A 4Y2IA 2HAFA 2W2NP 2XMAA 2JDCA 1S0VA 1ZZFA 2Y8YA 1PIEA 4CLSA 3MN8A 4EBCA 5FLXU 3PR5B 3IRXA 2DIVA 4WIQA 1RJJA 5CD4A 1KKHA 4R0JA 5AE2A 3JB9k 4I2QA 2VQFJ 4UFWA 1LKZA 5GAGI 2OFGX 4WU2A 1UW9A 3V6JA 1PJ5A 3NFZA 2O01C 3IMQJ 1XMBA 1S1XB 4ECYA 3QWPA 1RTIB 4KH0B 2PMZD 1U45A 4ZMMA 5JVGQ 3IXQA 4OMEA 5DZ7A 3DXSX 2VHGA 5IT4A 4KSEB 1HBMB 1OYEA 1SQGA 3D1QA 3GIUA 1Z8TA 4RUHA 2EW9A 1PJ7A 2HK3A 4ZDNA 4GKKF 3DRSB 1LWEA 3M8RA 2JC1A 1HBUA 4I1TA 1Q78A 1GXUA 4DPYA 2PJ8A 2WZNA 2ZH4A 1OSCA 1Q95G 4NEZA 1VQ5S 2AFOA 2HURA 1M5OC 1XNQJ 4KPCA 1YGHA 4AG9A 4A8OA 2F1FA 4ZIWA 2PVWA 1VQPS 1HI8A 4MYUA 5LXYA 2GQCA 2ZC3A 4BINA 3DLKA 2NPFA 4YB6A 4DSIA 2PMHA 4KOWA 2W25A 4NCGB 2FJEB 3C6TA 4X64J 3A8JA 2UVWA 2I5JB 3ITHA 5HROB 2QFJA 2XLKA 2W2QP 3KR4A 2DT9A 2QFIA 4NLRA 3H5XA 2UV8A 4AG7A 5B0GA 1UWAA 1C2PA 2N3OA 1CM0A 2PSWA 3EO4A 2BJDA 2HGMA 4JV5F 1I3OB 2PDAA 3ZJ0A 4C68A 3R1KA 3DGPB 4QR2A 2Z58B 3THPA 1KNZA 2X1BA 3MGJA 2C3YA 3R5CA 1Q7LA 4DR6J 4DQPA 1XE4A 4AD6A 1SIZA 6CPAA 4M8LA 2R2TA 2M5YA 1U1LA 1HQUB 4DHVA 4HI1A 2GIRA 3LF0A 4P52A 2DR7A 3AH6A 2Z56B 4URGA 4IR1A 2HKEA 3LGMA 3CMAS 2UXDJ 5L39A 3L2NA 4Y49B 4PG5A 4LQ9A 3MTKA 4OV1A 1S9EB 4C8MA 4UY8T 3LWMA 5HXDA 1RHUB 2CY2A 4NI2A 4YFJA 3CDEA 2CPFA 5IT9Y 3FBEA 4R7MA 4X4VA 4M5NA 2OZUA 2GVZB 4A8XA 1FFGB 2AW0A 1Y0RA 1HQ2A 1IIDA 2AEMA 3JSBA 3FC9A 3BXMA 3OPKA 3ZNUA 1XF8A 4W92B 4ID8A 3Q0AA 4X66J 4DOZA 5BR8J 1NM2A 7FDRA 3CDBA 4IRKA 4HTJA 1HYSA 5B0AA 2V2KA 3EC4A 1NK4A 1IWAA 4JI6F 1IR2A 3HVWA 3PIPQ 2X1GA 4PXBA 1FDNA 4FXVA 1X31C 2HK2A 4DR4F 4ECRA 4FVCA 2HNZB 2KFZA 2B4UA 4AT1B 3EX7B 2OKQA 2LU2A 5KT7A 4IR9A 1C0UA 2G1HA 5CQGA 5IB0A 1G4CA 1HW8A 1RKIA 3I5BA 4QC6A 3C16A 1S59A 4ZVEA 1SCJB 2LCWA 1U7LA 3IRXB 2HRYA 4MT1A 2M8DB 3QGPA 2BE9B 4LSZB 3M6WA 2ZW4A 5C82A 2VV5A 1YVKA 1N4LA 3P8BB 2EVNA 4CGOA 1JNZB 3KTQA 2OIHA 3RUBL 2D7SA 3BGFA 5J2MB 4QU7A 2DHSA 3QGGA 1SPBP 4ZJOA 2KT5A 3FQKA 2Z3KA 2WVEA 4NLSA 4NLDA 3CEDA 5CYMA 3OFEA 3VVTA 5I3UA 1EE3P 4KOXA 1BAVA 2CQIA 4CH1A 4ZPCA 3VHQA 2I79A 5EGYA 2HNYA 3KXDA 3ZZTA 3MMCB 3EGWB 1Z4UA 2IYIA 1QTMA 3G8WA 5GVQA 2QMWA