2Q43A

Ensemble refinement of the protein crystal structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IAA-amino acid hydrolase ILR1-like 2
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 113
structure length 375
sequence length 392
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q43A01
4AXVA 4P10A 4ZY1A 2PE3A 1NSAA 4X2TA 3IWWA 4P4BA 1DTDA 2ZEGA 5HVHA 4FAIA 4G1PA 1CPXA 2BCOA 5LYFA 3GLJA 3NA6A 4R8FA 5K8OA 3D7GA 4NJRA 3SI0A 1VGYA 3KGQA 3KZWA 4OC0A 2PJBA 4YU9A 3FEDA 3GB0A 1CX8A 4P45A 3FEEA 2ZEEA 4NGTA 4ZX8A 1LAMA 3FH4A 4LQGA 1HDQA 3FVLA 2PVVA 1ARMA 3PRTA 4ZY0A 1JQGA 3H8FA 3SJXA 1ELLP 5CBMA 3D7DA 3B2YA 3DGVA 4ONWA 1VHOA 1Z2LA 5JM6A 3VH9A 1XMBA 3PB9X 4YWYA 4ZI6A 3IFEA 2VL1A 3S9NA 4GM5A 2IJZA 4ZY2A 1YLOA 3KL9A 4P4IA 4X8IA 3B3CA 1FNOA 3HLPA 4UEFA 2GLFA 4MCQA 4R7MA 4IAVA 1BPMA 1TF9A 4NGPA 4P4FA 4TNUA 4K3NA 3SI1A 1R3NA 1Y7EA 1TKFA 2AFZA 3KR4A 4UEEA 3QNVA 5I4MA 2Q51A 4OC3A 3H8GA 1VIXA 4O23A 2AFOA 5K8MA 1PYTB 5DS0A 3BI1A 2QVPA 2EK9A 3GUXA 4OKOA 3RBUA 3PB8X 5LRGA 4NJQA 3SJFA 3KQXA 4OC1A 4NGNA 3WC6A 4WWVA 4DJLA 4X3RA 3B35A 3IIBA 4NGMA 4NGQA 1Y0YA 1PCAA 1Z5RA 2JBJA 3PFOA 4ZYQA 3IEHA 4MHZA 1IGBA 1ELMP 2ZEPA 3KR5A 3SI2A 3D66A 4H2KA 4IHMA 3T8WA 3PBBA 4FBEA 2BO9A 4PXDA 4MCSA 1LFWA 3D68A 4NFRA 3KI9A 4DYOA 5CPAA 5J1QA 4MHNA 1AMPA 3IC1A 3FF3A 2XEGA 4UIBA 2WYRA 2HB6A 4JZ0A 7CPAA 3CT9A 2ANPA 1XJOA 3K2KA 2HC9A 3MN8A 2POKA 2DEAA 1ZLIA 4TWEA 2PJ2A 2C6PA 3D7FA 2AFSA 3WC7A 1DE4C 3KASA 3LWUA 1KWMA 4Z65A 3IJ3A 1CP7A 3FECA 1RTQA 3V38A 4A37A 4UIAA 5D29A 1CP6A 4MXUA 2ZOFA 2RB7A 2ZOGA 4FWUA 1BLLE 2WZNA 2C6GA 4FUUA 2F7VA 4W9YA 2BOAA 4F8ZA 4NGSA 3JRUA 3PB6X 3MRUA 1EE3P 2PJ9A 2PJAA 2ZEHA 5K8NA 1M4LA 2GREA 1QMUA 2ZELA 3ISXA 2O4HA 2PIZA 5JH9A 3DLJA 4MMOA 2GLJA 3FJUA 2F8HA 5HVGA 2JBKA 1LAPA 3B3SA 5LYIA 4UEZA 3TX8A 1YMEA 1UWYA 1XRYA 2AFUA 2PJ4A 4ZX9A 3RAMA 4OIWA 2EK8A 3D67A 4PXEA 2V8HA 2QJ8A 2AFXA 2PRQA 4IK2A 4R76A 3NFZA 1LOKA 2AFWA 3BI0A 3NH5A 2IQ6A 1OBRA 2ZEMA 1Y0RA 2CIJA 4KSIA 1IY7A 2CTBA 3S9MA 3NH8A 2CTCA 3KQZA 6CPAA 4P6YA 4P4EA 2I3CA 1CPSA 3CDXA 4UF4A 1HDUA 4F9UA 3RZAA 5LYDA 1XFOA 2XEFA 2PJ6A 2Q4ZA 4PQAA 2Q43A 3B3VA 2ZENA 2IMOA 3ISZA 4JYWA 1ZG7A 3VATA 4DUKA 1GYTA 2PCUA 2V77A 1LANA 5F09A 4MCRA 1ZG8A 1HEEA 4B6ZA 1ZG9A 3KHZA 4EFDA 2CF4A 2PJ8A 1YSJA 1ARLA 2XEJA 2OOTA 4A39A 4OC5A 1TF8A 5JGFA 5D8NA 2PJ0A 1F2PA 4WJBA 2FVGA 1Z8LA 3CPXA 3H8EA 3BXMA 2O53A 3HUVA 3FX6A 2EWBA 1BAVA 3FMCA 4MHPA 4MCPA 3BHXA 3N5FA 2RFHA 2OR4A 4F9VA 2PJCA 4A94A 3SJEA 4RUHA 3WABA 4PXCA 3B7IA 4R6TA 2PJ3A 1YW4A 5HXDA 2AFMA 5LRJA 2ZEDA 1CBXA 3SJGA 3D4UA 1F2OA 4MHYA 3L2NA 4OC2A 1XBUA 2V8GA 2PJ1A 3WC5A 4PXBA 3PEIA 2ZEOA 4MRIA 1H8LA 2G9DA 3I1UA 2J9AA 3NH4A 2PJ5A 2ABZA 5IB9A 3B3TA 4Q7AA 4BD9A 2JEWA 1F57A 4OIDA 3V7ZA 3CPAA 4P44A 4OP4A 3VARA 4P4JA 3S9LA 4OC4A 5HVFA 3PBEA 3WT4A 4PPZA 2C1CA 2PIYA 1Q7LA 2NYQA 5LYLA 4OMEA 4A38A 1AYEA 3LMSA 1ZLHA 1LCPA 2GU2A 1FT7A 3IO1A 2NSMA 1QQ9A 2PVWA 3D7HA 3PFEA 2QYVA 4NGRA 4EWTA 5ELYA 4P4DA 4CPAA 5LRKA 3B3WA 3K9TA 2V8DA 2PJ7A 1VHEA 4EMEA 1TXRA 2C6CA 1TKJA 2XEIA 3TC8A 3PB7X 3PB4X 3KHXA 2V8VA 1YW6A 1R43A 1TKHA 2ZEFA 5K8PA 1BPNA 8CPAA 1CG2A 5THWA
chains in the Genus database with same CATH superfamily
4YN3B 3J80U 2JLMA 2JLEA 2FC8A 3GYGA 2YX7A 1KEKA 5C2GA 3C2PA 4P4BA 5DGBA 2MY8A 5IS2A 1CPXA 1Y11A 3PZPA 3NA6A 3GONA 1ZYQA 2C2DA 3D7GA 4AL5A 1HA1A 4O4GB 5FLXY 4DPUA 1RTIB 2J8MA 3ITHA 1S6PB 1TKXB 1TL5A 4JI8F 1IVZA 5I42B 4CYOA 2YKMA 3SDEB 4ZX8A 1WACA 1IM6A 4R8UA 2OTJS 4C8OA 3SJXA 5CBMA 2D3ZA 3EXYA 2QLBB 2WONB 1KVIA 2H5MA 4MTPA 1DTTB 2BJ8A 3PW7A 3PB9X 4WKRA 3M4XA 2MKKA 2LU1A 4C8YA 4PWUA 3QAHA 4X8IA 1LW2A 4CAXA 2WBRA 4A8KA 1YLEA 4M5IA 2VPZB 4B3SF 4NGPA 1RLDA 2MQ8A 4PYAA 5HJYA 3CJSA 1XF8A 1BE4A 3MTJA 2HFSA 5GADU 2GQQA 2JVOA 2GQCA 2B3UA 4PWDA 1KUXA 4IRDA 3FSXA 3ETOA 2WOMB 1TR0A 3M2RA 1NH7A 2QMLA 1VS3A 3JQKA 4NJQA 4XIUA 4NCGB 1T02A 4Y49C 2ROEA 4JI7J 3GIKA 3T5KA 2VDIA 4ZKAA 1S1TB 3P6YC 1S6QB 1SJ3P 2QLFB 3D6FB 4O3PA 3CNQP 5JJBA 4FBTA 4ID5B 3D66A 1HR0J 3VCDA 1JJ2R 1UMJA 2H48B 4ZOSA 1Q1KA 4P6QA 1LFWA 1N36J 1CQMA 3KK3A 2GJFA 5C7PA 4MBUA 4OHVA 1I1DA 2K1RB 4XPEA 4NA1A 1RT6A 3KLGA 1HI1A 2BABA 4JYAF 2Z3MA 4UIBA 5J2PB 4PG5A 3K2KA 3MR7A 1J27A 1MMNA 1YITS 4YGOA 2W4PA 2GVDB 1NPPA 2P9CA 1XWLA 1SC4B 3K2YA 1R8HA 1UZDA 3GMGA 2DXEA 2FHKA 4J9PA 4LRCA 4AXIA 3CCES 3ENVA 4BBYA 2F7VA 2BOAA 2W9BA 4B10A 1VQYA 2F4VJ 2G0IA 3IR7B 4O3OA 1RT2A 4P52A 4AT1B 2KB2A 2LXFA 2HHPA 1TL1B 1RWPB 3LQVA 4MJKA 3TAMB 1Q53A 1CJUA 1X4AA 3IRXB 3NMAA 1UETA 3DM2A 4LRFA 3R5AA 4OIWA 1R0AA 2PIIA 3D67A 2QYGA 4B13A 4P2XA 1VQMS 5RUBA 1MJBA 4NYPA 1X7VA 3BR8A 3UDCA 2JSXA 3MM7A 2UVRA 3G87A 3BH6B 5CQGA 1FO1A 2RQ4A 2M8HA 4IDKA 4FVCA 2W9CB 2FVPA 2HNYA 2YNFB 2CQCA 3FK4A 1PC4A 3G8WA 4A31A 2MZRA 3D1OA 4ELTA 2GAHC 3N6MA 2Q43A 1S60A 3EC4A 1JNRB 2PCUA 3WR7A 1JJCB 1U4BA 3E2EA 1HEEA 1NJWA 3W3SA 2OPPB 2C3OA 4OC5A 4F04B 4DR5F 2JH3A 2UXBF 4QIVA 2Y1RI 1B0PA 1TL3B 4J9NA 3FKBA 4WKYA 3UD5A 3EVMA 1U1OA 1IM4A 3F44A 3PEJA 4G65A 4CWBA 2VQYA 1KS2A 2DBBA 4TQSA 1HQEA 4KIAA 3I55S 2N7CA 1HW9A 4KBIA 1YW4A 4RWXA 1X9WA 3QMQA 2GW8A 4TY8A 3B8HA 2CQBA 2P6SA 3A8JA 4XDCA 1U1NA 1T05A 1OYDA 1S1VA 4LREA 3KLHA 3D4JA 2FL4A 3UR0A 1VQ7S 2FCKA 1Z4UA 1IOIA 2G9DA 4O0IA 2MKYA 2AMCB 4MAKA 4M8LA 2AX0A 3KMQA 1MU2A 5D3GB 3IMQJ 2YXLA 4OIDA 1X4BA 3R1HA 4OP4A 3P96A 2PEBA 4B9TA 1RHKB 3FFIB 3W64A 3K57A 5LYLA 2XTJP 3K5NA 1ZLHA 2C3MA 2VONA 4KY3A 2YX4A 4USIA 3SYZA 1P9YA 3UR3C 2R2TA 2H3EB 4K50A 3MEEB 1DHMA 4OJGA 1GAOA 1TL7A 1YVOA 1Z9UA 3LUYA 1GT8A 2BJ3A 4ORFA 4CGPA 5JPHA 1GMWA 3ZNJ1 4CLSA 3IR5B 3AOAA 3DKDA 4CYPA 2A18A 4FAIA 4ICLB 3NNAA 2BCOA 1KKHA 4HNXB 1FFWB 4USTA 2MHEA 3D2WA 3NLCA 4A95A 3SI0A 2HQDA 1FDDA 3H5ZA 3KZWA 2PJBA 1LFPA 3TCVA 1QTMA 2QMXA 1WC3A 4F67A 1FF2A 2PSZA 4ES3A 1HNVA 1HDQA 1S7FA 4DV0J 5HBMB 3TOQA 5HP1B 5LOQA 4NLQA 1ELLP 2UVWA 2D41A 1U1LA 5E0OA 4QIWD 4E0DA 3NS6A 5FIIA 5EX3A 1QSYA 1GXUA 1ZM3A 2JLGA 2X7BA 2VL1A 4KSAA 4OHWA 4ZY2A 1I12A 3H2LA 4KOWA 1UVNA 4DZDA 5A8RB 1PIEA 4C11B 4FVMA 4O44B 1S0OA 2B0GA 1IYKA 2FIUA 1UVIA 3T5LA 3N5BA 4ZLJA 4K4ZA 2KL8A 4DSEA 2CQ1A 1TU0B 2WVFA 4ID8A 4RPFA 1M90T 2DR8A 2A3JA 2QVPA 3ILIA 2HAIA 3DI6B 5T41A 1C1CA 3LD2A 3RG6A 3R7BB 2HRTA 3LPYA 3TUIC 4X4PA 2Z58B 1ZZNA 4ZYQA 4DMZA 4I67A 3PDNA 2FGCA 2IA6A 4IO9Q 2LMIA 2CPXA 1VLOA 1N33F 4B5PB 3PX6A 2DJWA 5DM6Q 3CJKB 1BY9A 3MOZA 1FXLA 1UL3A 1V5VA 4LF4J 2Q3PA 4OHZA 2V6AA 2VKZG 4CLWA 3E3XA 2KVQE 1M1DA 1B7YB 1YI2S 1IB1E 5A8WA 4JI2F 1SUQB 3JYTA 5BYQA 4USWA 2OPSB 2VC0A 4FF4A 1YX2A 2WZ1A 1NSPA 4JB8B 2G0CA 1S99A 4Y2MA 4LT6A 1QE1B 4C98A 4Y0FA 4J7CA 4FS1A 4KTQA 4MT1A 4ZVRB 4NLWA 4LFCJ 1QLNA 4DOZA 4MXUA 4DV6J 2M88A 2XGQA 3OVAA 5L38A 1N71A 1WKKA 3JAMU 2DPSA 2EC2A 2HHHJ 3KXDA 4F8ZA 1SBRA 3M6VA 3Q86A 1V3SA 3M30A 4OYXA 3TO8A 5AE2A 5J2NA 1MMLA 1ZS6A 3TNVA 4X65J 4F36A 2JNJA 2CVEA 3NBPB 2E1AA 5DDOC 2E9ZA 2RT3A 4YR3A 2G2ZA 1U1PA 1F9EB 3AXMA 3L9ZA 2JBKA 1LAPA 3N4WA 2NXJA 4DUYF 3K0JA 1V6HA 4CP5A 1JXLA 2CG8A 4ALZA 4LF9F 2CPHA 4RW8A 2GV1A 2R7TA 3TEHB 4H89A 1WG1A 3JQMA 5HL7Q 3W5ZA 2BXJA 1N5QA 2B5GB 1HI8A 4EGLA 2HHQA 5KG0A 4QJVA 3HLUA 1HYSB 2UU9F 5LMUJ 3RAXA 4DV4F 1WF1A 2QGFB 3CDXA 2RQCA 2BW7A 3M8ZA 3EO4A 3FQLA 2Z2ZA 3VGUA 1I3OB 3C6TB 2O28A 1T7PA 2BJDA 2FZKB 2ZC4A 2Q79A 1RCOB 3TO6A 4JYWA 4DG1A 4F3OA 2DNPA 1JLEA 4RW9B 4ZVFA 2VDHA 3UN3A 1OY8A 3A1YG 5A0YA 1Y0HA 2E5LF 2DGSA 1U25A 4HACB 1H6KX 1P9QC 3CPXA 3TTHA 4A8XA 4DV7J 3HUVA 1S9FA 1XE4A 3N6NA 4ECYA 1RO5A 2LA6A 1X8DA 1ZAVA 3NKYA 2PC6A 3KTQA 2IVYA 2FSRA 2JFDA 4RBVA 2QN6B 2VG7B 4IH6A 3W60A 5BWAB 5C5JA 4NPOA 2Z0GA 1CBXA 2VZZA 1A7GE 3W5YA 4OYMA 2L9WA 4ANCA 1RISA 4CAFA 3NGUA 4P74A 3D5MA 1NDLA 4Y2KA 2MKIA 2WSAA 1IKYB 5KT7A 2E7XA 2N3LA 5KFDA 1FTRA 2AZ1A 2ZJPQ 1PKUA 3W9IA 2Y1IA 3KUGA 1Q7LB 1RHJB 3R5GA 3VARA 3D7SB 3IA0A 2D7SA 1OSCA 2P8IA 3OR1A 1MWYA 3E0KA 2QE5A 2AZ3A 3S6GA 3KJNB 1U8WA 4LF5J 1X60A 1WK4A 3IAM9 4XNHC 2U1AA 1NZ8A 5GAHI 3C6UA 4FYVB 2YY3A 4WYWA 4NXNJ 2C6CA 1WNEA 5KFKA 1IJFB 3TC8A 1K1SA 1UWAA 4KZTA 4X62J 2W8LA 4IG0B 4QBUA 4M5DB 1X31C 4X66J 5DS7A 1CG2A 1M4DA 1QJHA 4FP9A 2ZD1A 3FCHA 3PRDA 5D0GA 4X2TA 1EAYC 4IFVB 3HHLC 3FSIA 1DTDA 2ZXVA 1XMQF 5HAOA 3PJ9A 3LOUA 3W65A 1RT3B 2F5GA 3CCZA 3R1KA 1MJAA 2O67A 2ODFA 2EG2A 3DLLQ 4C9DA 3OV7A 4UCMA 4CDIA 1NK0A 3R7NB 2W9AA 3AQPA 3CCUS 1VQKS 2EEYA 4ZPVR 4TU7A 3D2PA 3DGVA 3GV8B 4MFBA 4KVME 3UN5A 1NUEA 1JLFA 4LSNB 4O4RA 1KDNA 3GV5B 2IBOA 4IQXA 2HWHA 3TAPA 1VBYA 2PI5A 3ZO7A 2V4QA 4R7MA 3EXNA 4M5LA 3PRVA 2FY8A 4K3NA 1VIOA 1TFYA 2R7OA 1RCXB 1RBLA 1EQ0A 2AE6A 1GK8A 3UNYA 3HO1A 4YFJA 3BO3A 2L9NA 1T9VA 4J9RA 4DV5F 3H42A 4WTYA 1NK6A 4DSKA 4L73A 2DNRA 3KUEA 2OPRB 1U0HB 2NYHA 4NGMA 4GO5X 1D9AA 4KGKA 2L9DA 5H9EK 2NUUG 4N8OA 5IT4A 1C1BA 3WHIA 5HLFB 3AH6A 3SCJE 1D1UA 1JJ4A 4Y2AA 1RAOA 1J5EF 3KJFB 2BO9A 2XBPA 1Q8BA 3M8PA 1IKXB 4OI6A 1WG5A 2LVWA 3GKRA 1P8GA 2OTLS 3D1QA 1B87A 5GAGI 1VR6A 2BACA 5IOLA 3ONQA 3MN8A 4OLLA 5G20A 2G0JA 1F6TA 3DR6A 3EGVA 3ZTOA 4F3MA 2AFSA 4CYNA 3DRXA 3ENQA 2BANB 4USUA 1LWCA 5ISVA 3HHLA 2FT0A 3FRYA 2QSFA 3LP0B 2DNNA 4DR6J 4KB7A 3TOBA 2OU2A 4LF6F 3T1YJ 3R9FA 3CJ0A 1X4HA 4DPXA 1M4LA 1C4CA 4UZCA 2HVZA 3BH7B 4ZJOA 1TK8A 4ED4A 4U9RA 2YWWA 1RTJB 5KOWA 4R25A 4WE1B 1FRLA 1DZ5A 2ZZNA 2F8HA 5B0GA 4U95A 1XIQA 1K9MT 4YMEA 4TQRA 3M2UB 3FVYA 2ZH5A 2HGMA 3LP2A 3KG0A 2M0GB 2Z57B 2B9YA 2PRBA 2OPQA 2EO8A 4HPSA 2EK8A 4EI2A 3BQ0A 3ISNC 3G9CA 2QJ8A 1KBRA 5KFFA 4B02A 2AFWA 1Y9KA 1ZBTA 2KO1A 5ETOA 5KG4A 1UCNA 2ZEMA 1XK8A 4B9LA 1TUGB 2Z3LA 4DZ6A 3CD6S 3R5CA 5KFOA 5J8FA 4M5JA 1TMJA 4IRCA 5MLCV 1FEEA 4NMXA 2VOOA 2FB0A 1Y3JA 4DL7A 3CJ8A 2Q4ZA 4DR7J 4Z7CA 2DHXA 4OI3A 3TUZC 2OFGX 4DL4A 2B9EA 2Z56B 1WORA 4HYKA 1S59A 1NSKL 1RU2A 2CQ2A 2ASJA 5G21A 2HHSA 1WHWA 3AAWB 3PZJA 1URNA 2FVGA 4FD6A 3CIMA 2ASYA 3BGFA 3M2VA 2BQRA 2OMOA 1XTZA 3MEDB 2G3TA 2R7XA 2R7SA 2EFPA 4NLTA 5KFNA 4F9VA 2PJCA 1RTIA 4P75A 2P6TA 1S6PA 3VQSA 3BGOP 3EGWB 4ERDA 5CYMA 5I42A 2H65B 2HQYA 3R95A 4W90B 4NLYA 5KTAA 4WF9Q 3TVYA 4LF1A 2UZAA 3DGPB 4PV6A 3QSYB 4X4SA 1HBMB 2KT5A 2PR8A 2WONA 4DFPA 2QT7A 3I1UA 3FXTA 1KD1T 3HD2A 5CD4A 4BD9A 3QPIA 4NXMF 3DOKB 3MGDA 2V2QA 2JDJA 5IT0A 4C3MA 2RQMA 1FCAA 3LMSA 4LUAA 1S7KA 2KCWA 2N3OA 3RU0A 4R87A 1IR2A 5F46A 2GCFA 2WOMA 4AXJA 1D8YA 4WPAA 2KHDA 2IAJA 3MCSA 4JUZA 2IA0A 4NLDA 2CJQA 5H1SV 3V2UC 1TKJA 4EZ9A 5D78A 2BSWA 1RHUB 1YW6A 2MZQA 3NGDA 4ID5A 1WHXA 3KK2A 3JAMY 4LQ3A 1G3OA 2J8NA 4B9UA 2P6FA 2ROPA 3ADAC 4J9LA 2K1RA 4HNWB 1REVA 4CAVA 4LF7J 3MPDA 2MDAA 2BBEA 5J2PA 2QIFA 5IC6B 1UJ6A 2Z3PA 3MAAB 3H40A 4P7VA 3F0NA 3OVSA 4U96A 4EUVA 7FD1A 1HPZB 2YGWA 3Q83A 5F47A 1R8BA 4ONWA 4LBIA 4DCOB 4YQWA 2BYCA 3I31A 3S9NA 2IJZA 3VAMA 2FTRA 1VC6A 2B8PA 2NPFA 4B3OB 1TTHB 3T1AA 4ZIVA 4GO7X 3I4PA 2J6SA 5KG6A 2AFZA 3VWEA 4F4ZA 1T3NA 4RZRA 2YQ3A 3EDQB 3TYTA 4KGMA 2MKCA 2RF2B 3I9SA 3P5TL 2MQNA 3KNGA 3CMAS 1DFDA 3O6QA 6AT1B 2XMJA 4OKOA 2LQJA 4NLRA 3TAMA 1V5IB 5L1IA 2DH8A 1ICEB 3D54A 3UCGA 3OTCA 3SSSA 1UJ5A 3WX4A 2CZ9A 3PFOA 2BW2A 4OFZA 1Z8TA 2HIQA 3BSAA 1U8SA 4LFAJ 4ECTA 1V0CA 2VBWA 1UFKA 3QIDA 4X4NA 3DDKA 3D3CJ 2EI5A 1ELMP 1PUAA 3SI2A 3PY8A 2BE9B 3CJRA 2YNHB 3EUNA 4I6AA 3CD0A 3WC2A 4IQMA 3H20A 1YJRA 3GSIA 4NLXA 2ZE2A 2HQCA 1S1XB 4ZPAA 2NREA 3G6YA 4K2XA 3CT9A 1IR0A 1ZLIA 3GFHA 1IU8A 2PJ2A 3HMJG 1YK3A 3J7YU 2W2OP 3HVRA 4LQ9A 3F41A 1ON0A 4F0YA 3FBUA 1S1UA 2CDRB 3KJVB 3R8YA 2OPPA 4PRFA 3GZ7A 3K58A 2RUGA 3FBBA 1YZ7A 4ZLLA 4DU8A 2IC3A 1B3TA 4PG8A 2BJ9A 2KDOA 3JSMA 1E6YB 2JJ4D 1FX4A 2ZZTA 4DUZJ 1VRQC 5DETA 5DGAA 1T03A 3KDNA 1LKZA 2R9LA 2LEAA 4PYDA 5H84A 1IN0A 5GMKa 1RT1A 4G1QB 3CE8A 4X64F 3BQ2A 2AEMA 1I94F 4Q8FA 2E5IA 1H0HB 4KSFA 4C4WA 4M85A 4H4MB 5E41A 5GADI 2FJEB 2I00A 5D3GA 2VODA 1QSNA 3TW0A 2XSFA 1RAJA 2G2OA 4QC6A 1TUVA 4ZMMA 2ZKTA 2WVDA 3H2UB 2IQ6A 4OI0A 4B9MA 1VQSA 2KZZA 3ZZZA 1S9EA 4HHJA 3O44A 2BUEA 5M2UA 3TA1A 2ZWOA 3LALA 4J9KA 3SXNA 1VC0A 2UV8A 4DX8H 1D09B 4ECRA 1AFJA 1WHYA 4DF4A 2E7VA 4LMZA 4QYRA 4OHXA 5J1EA 1N34F 4PQAA 2EBGA 4C68A 3ISZA 4IYQA 3VATA 2VFUA 1LANA 3KLEB 1SJQA 3TO7A 1OSDA 1I21A 2GMLA 1ARLA 3H5SA 4P2SA 3CO0P 4FXWA 3LANA 3T19A 4Y00A 4QB9A 3KKWA 5C25A 1M5PC 3MPVA 3WIVA 3CJTA 3OWCA 2O53A 2N82B 3UDEA 4UWIA 1QTNB 3MEKA 2D3OR 2M3DA 3I5AA 3ZC4A 2ZVIA 2K8GA 5SZTA 3GJRB 4B3SJ 3MMAB 4WFXA 2PJ3A 4BWJA 4CT9A 4F3QA 2XB2D 3BR9A 3P5BP 3AHPA 2M9KA 1WC1A 5HP1A 1XBUA 2JX2A 3RYOA 1UPMB 4A8SA 4MRIA 1VRTB 1RHQB 2ACYA 3D8PA 2DO0A 2M7SA 4WFZA 1RTHB 4P2MA 2MPUA 1JLQA 3ZZOA 3OSNA 2QA4S 2HHVA 2QO3A 3HHNB 3P4UB 2C1CA 3I0SA 3CTRA 2OEJA 4X5KA 3J81j 5B0BA 2XCPA 4F0MA 1CEZA 1FT7A 1XERA 2R8VA 4DEZA 3W2WB 1APSA 3NXZA 4USHA 2OSRA 3GFXA 3MMBB 4FNHA 2DXDA 3KMSA 2LCWA 3CDUA 2UXDF 4JYAJ 2ZZMA 2PJ7A 4N41A 1M5VC 1U1QA 1Z1ZA 3DXBA 1Y7RA 2W7OA 4W4MA 4HDGA 1U24A 3KHXA 1K1QA 5AE1A 8CPAA 1TELA 1RWNB 2EBEA 3HZEA 5D77A 4B5PA 2CDQA 3FEYB 3GJQB 3CWJA 3DXSX 2OD4A 1RT7B 3ILLA 3N79A 2KN4A 1HWIA 4MK8A 1N56A 4J3GA 2OGUA 3L95X 1GTHA 7FDRA 1LW0B 2YKMB 1M5OC 2V63A 1GXLA 4EEYA 5FVJA 2B4VA 2WUUA 4KHRA 4C7QA 3OTOF 2VQEF 1JQGA 2HLTA 2WSCC 5D4LA 3B2YA 4F0XA 4YY3F 5K5MA 1Z2LA 4OI4A 2XNRA 4NOHA 4QIEA 1LW2B 1DBDA 4YWYA 2QFIA 4KV8A 3TWZA 4CI0B 2R7WA 4ECXA 3HSJA 1NKBA 3B54A 1ZTWA 1NK9A 2WW8A 4TNUA 4PWDB 2GGPA 1VHIA 2MQOA 4P73A 1SV5B 3NBPA 3TUPA 3BJYA 3M2RB 2BRKA 2BKNA 4NI2A 2FQQB 4O23A 1IBMJ 3BI1A 4AVCA 3FBFA 2VEZA 3VTIA 4DDFA 2EK9A 2EKNA 5LXYA 3I0RB 3TQ1A 5F8HA 4R5PB 3AODA 2ASDA 4EBEA 3BM7A 4GKKF 1YRXA 3V4IB 1MWZA 1HWKA 3VALA 2HPUA 2PA8D 3MPYA 1M4GA 2CZVC 3KK3B 1MWQA 2X51A 4U9YA 1RT4A 2CNMA 1Q2YA 2UXBJ 2BM0A 1RAEB 1RT6B 3KI9A 2BKOA 3I87A 1HYSA 2Z10A 2VBZA 4GC6A 3VWSA 2ZM6J 1FRJA 4MFKA 3N01A 1MLAA 3X3UA 1AMPA 1AT1B 2DNMA 2AJ6A 2X1GA 2PA3A 3N9UC 1FE0A 4JZ0A 1VQNS 3C6TA 4G6VB 2POKA 1TKTA 3PJWA 4EBDA 3CC4S 2JDDA 1K0TA 4FNIA 4RW9A 2UUAJ 5AJ3F 3K5LA 2J7UA 2BE2A 1RB0A 4ED2A 4A37A 1FDAA 1O0PA 4KS9A 4ZVUB 3HCXA 2W9BB 3S8SA 3MD3A 5DQGA 1CJVB 2PD1A 2Y3YA 1S7HA 4JI6F 3DLEB 2Q66A 3DRRA 3T1HF 1RK8A 3R2DJ 2RJZA 2QG9B 3PRBA 1RT2B 2FHMA 1NRKA 4IH7A 3KHHA 2V69A 4UWJA 1CJUB 1F2HA 2HGNA 4ZPDA 5I0CA 4DPYA 3DM2B 5B0DA 3PO4A 1UTAA 3BGUA 2AT1B 3OQ2A 2FLPA 2WPXA 1R0AB 1U45A 4MJ8A 2HWTA 2R8IA 5D4NA 2YX1A 2AQ4A 2QSWA 4UOGA 3BYRA 3DRYA 3TJAA 5KFSA 2O66A 5IQQA 4UUWA 4J90A 3BO2A 5EUHA 1YJ9S 3MM7B 4WK1A 4OJHA 1B0VA 4IDKB 4K4YA 1Y0RA 2HNYB 3MCOA 1Y4ZB 3SI8A 1T95A 4Y49B 1FVQA 4P6YA 2OH2A 3I82A 4O3NA 3H59A 4FYWB 1IBLJ 4UF4A 1XJWB 1VI7A 4AL6A 4AVAA 3W91A 1PILA 3BJ8A 4X4VA 2N4CA 2G1HA 4PAAA 2VPYB 4MCRA 1M1HA 3SQGA 1NHKL 5HO4A 2ILYA 3ZXWA 1WF0A 4IG0A 2CF4A 2W2QP 2VJUA 5IX3A 1OPIA 1S3ZA 2QLXA 1F2PA 4KKOA 2IBKA 4WJBA 4ED8A 1RWOB 2CYYA 1HNZF 2H9ZA 4X84A 1RLCL 4CGMA 1HQEB 2W4DA 4Y34A 1PYSB 2E5HA 3FUYA 4A30A 4TY8B 3S6EA 1KRPA 2GANA 1YLXA 1LRZA 4PXCA 3G8SA 4ZPWR 1Q79A 3IAS9 1T05B 1S1VB 2J0SD 3KLHB 3OUYA 1EB0A 4D3HA 3MMCB 4I2QB 5KFYA 4PG4A 1QAJA 3F5BA 4KOYA 5LT5A 2BEIA 3EMTA 4C3KA 1R31A 4QW8A 1N8RT 2JEGA 1FKOA 2QLWA 2DIUA 2MYFA 2VPWB 4OYIA 4EMDA 3K17A 5DZ7A 2HLUA 1S0MA 1YR0A 3S9LA 5HVFA 5DDPC 1N52B 3MPUB 2ZBCA 1KONA 3FMWA 1N33J 2NSMA 3FRMA 5KFVA 1FT8A 3N0VA 3K5PA 2J9CA 3HHKA 1TL7B 4LVNP 1RDRA 3H7HB 5KFLA 4F4WA 4JI2J 3K9TA 2V8DA 4N5SA 1U0HA 2A4NA 3T9NA 4J9MA 3HXMA 4DX6A 4RKUC 4P10A 4AQYF 1RU1A 4YDDB 1DARA 2R8JA 2PE3A 5B7WA 5D4OA 5KAKA 1KQKA 5BXIA 1IKXA 3GLJA 2LFVA 3GPAA 4OHYA 1NSLA 4F4YA 2KKHA 3CULA 4RN7A 3B6BA 2MQMA 2OI2A 4OYOA 4P45A 2KXFA 3OXLA 2B6AB 2XO6A 2ZEEA 1ZA2B 2Q4VA 1AZSB 2B51A 1X10A 2EFQA 2ZH3A 4MIAA 2FJVA 3RB0A 5F9NA 3O8WA 4I6YA 5D0HA 3OFEA 4DUYJ 3QJPA 4QWBA 4TLQA 2EKYA 2L08A 3QGGA 1RWVB 1RXOB 4Q44A 2RAQA 5H86A 2Q1LA 2E66A 1XEBA 4PK2A 3KR4A 4UEEA 3M6WA 1RTJA 3CCVS 4OJ3A 3B4DA 1H2TZ 2M4MA 2V2VA 3W5XA 4TYBA 2AYBA 1VOMA 3FQKA 2UU9J 2HBRB 4TY9A 2KZMA 1X9SA 4ZVOB 4DV4J 3GU0A 3PB8X 4PABA 1N32F 1H7XA 4P2FA 1WJ9A 2RS8A 1QVGR 1FWPA 1X0FA 3KG1A 2JBJA 4DWIA 3THVA 3GIRA 1N6QB 2MZTA 4K4UA 3SCLE 2ZEPA 1HNWF 3RB3A 2DGVA 2YPZA 2ZHAA 5GMDA 1N88A 4NEZA 4KOSA 2B7BB 2A2DA 3BZQA 1HNIA 4OYZA 3JYTB 1PC5A 1WWZA 4U6PA 2COLA 4NLPA 3I4HX 2V0NA 3EZ5A 2DHHA 2ANPA 1M5KC 4JV5J 3MXHP 4FDFA 2CJKA 3LP1A 3UFCX 1WC6A 1V3RA 5HQMA 3OFFA 3GV7B 2I1RA 3DRSA 3NGRA 4FN5A 1TZ0A 3Q2SC 2R1IA 2F9DA 1KWMA 3F0AA 3TZXA 3I32A 5DM7Q 3S6FA 2IM3A 1KHWA 4WIQA 1HQ2A 2CJBA 3M8WA 2P2CB 4UZBA 1U0SA 4QR1A 3OFGA 4UOCA 2XMUA 2V9KA 2GHVC 4C2YA 3P3DA 2FIWA 3MECA 4CO0A 3R96A 3LH2S 1F0XA 5A6WA 2PIZA 3CUNA 2O1PA 1X9MA 1ZO0A 2IJFA 4QOTA 5IWAF 2CQ0A 4M5MA 2YKPA 2EFNA 2SXLA 4ETZA 3DGPA 3AD9C 3FJUA 4U8YA 4MHDA 1HBMA 1S1WB 2DNLA 2FVCA 2OFHX 3VWDA 4RW8B 3K89A 3G82A 1HNXF 2W24A 2IJRA 5BR8J 5CHCB 4QVTA 1A9NB 3JXOA 4YUDA 2VZYA 5ETTA 4LJMA 3IRWP 1LOKA 1BOBA 3BKFA 1OBRA 2HVDA 1FRMA 5CYQB 1FD8A 5B08A 3HDSA 3QFWA 1AROP 1UVKA 3S9MA 2KHCA 1SJ4P 4L3NA 4DL0C 1UA1A 4LR9A 4IF5A 2EFGA 5L8RC 2W7AA 1WC4A 3LTOA 4DG1B 1JLEB 4XPDB 3BDEA 1SIWB 2IMOA 2XS7A 4PSWA 1ZG7A 1J5OA 3MR5A 5A0YB 4DUKA 2P6GA 4B3RF 1R0CB 4OI1A 3W9JA 4PPDA 1TF8A 2V94A 4JI1J 1F3VA 3UPFA 2VJVA 5KFJA 2VI7A 3HSDA 2Q04A 1FY7A 4TYAA 4QR2A 4WWSA 4PG6A 3EPGA 3FGVA 2C1EB 3D28A 1KLMA 4LFBF 4MCPA 1U1KA 4OX7A 2BEFA 4GC7A 4ES1A 5B0CA 5C2CA 3N6LA 2RDDA 2ACMA 2FDNA 5HXDA 2R8HA 2NYIA 1FXRA 1OQ6A 1X5OA 2R4FA 1YDLA 4USVA 4UT4A 4ELVA 3MM5B 2BDPA 4UCPA 2DGTA 2OEMA 1PO6A 3UCUP 4DV5J 4KSEB 1U2CA 2A1BA 3V81A 2ABZA 3QGHA 1ELOA 1UW9A 2HSEB 4Q7AA 1I5OB 4ZJQA 3OR1B 4ELUA 2EVZA 2Z3NA 2ZBPA 4E2FB 2DRDA 4QZVB 4K8RA 2NYQA 4Z37A 5L46A 1R57A 1TK5A 1ZETA 3UW1A 2AW0A 4R9MA 1J5EJ 3PW2A 1GXTA 2Y1LB 3BN7A 2AF6A 2ZVSA 2PDAA 4DLGA 5KG5A 1ROFA 2DISA 2XEXA 2F5IA 1DLOA 3TRGA 1DQ9A 1AUSL 1UJ4A 2ZD1B 3LW5C 2DNGA 2MKSA 3G8TA 1R43A 1XNQF 3FMBA 2WTFA 1KZFA 5E3PA 2R7QA 1JLCA 3OJUA 1HR0F 3OD2A 3BPDA 5DLGA 3NS5A 2QX0A 2HK3A 1N5SA 2XG8A 1OMSA 4BWMA 2XHCA 1IJEB 3CVKA 1S1XA 4CLFA 5L9NA 2WB1D 1FRKA 1ZTTA 2HRYA 3G6VA 3R9LA 1SC1B 3IM8A 3EFAA 3E8OA 4MH8A 1TKDA 3FEEA 5LMNJ 1YBTA 2EW9A 1RYRA 1QSOA 3PRTA 4MFBB 2ZNYA 5KFCA 1JLFB 3BLNA 4CGLA 3AOCA 5F41A 1S4FA 4OYPA 4LRDA 1S5ZA 2AJ2A 3C19A 2MLZA 4J9SA 4XPCA 1LNQA 1GMVA 2ZW4A 2GLFA 2XS5A 4HHUA 2BQ3A 1VCTA 3NGKA 4AYBD 2G2YA 4O3SA 4A8QA 1T3OA 3NNCA 4OC3A 2LXUA 2V9WA 1Y9WA 1XNRJ 2VG6A 1JXEA 4UTGA 3SV3A 4F4AA 2Z30B 4KUAA 2NS1B 4V1Ak 4RNHA 3GE9A 3FCVA 3VAKA 1HBUA 4K5SA 4EFAC 4NGQA 4H4MA 2HHXA 4A47A 3G4SS 1ZOTA 3T8WA 4H2KA 3S1TA 1MG7A 2XMWA 3L09A 2RILA 3GILA 4Z7YA 3UWTA 4XNHB 2CQPA 4MCSA 2W01A 3MM6A 1YRUA 2V67A 5ETNA 2AGQA 3PACA 4HH0A 2JRSA 2XSJB 3HVAA 2J0WA 3L3CA 4E0AA 1XMTA 1YKWA 1AB8A 4OYBA 1JLBB 3ZZPA 3V6DB 1LWCB 1ULRA 5F8IA 3HHLB 2MZ1A 3KASA 1H74A 5KFAA 1NKCA 2NUHA 3DMJA 2H4YB 2RKIB 2PMZD 4DV1J 2K3IA 3NP5A 4NCBA 2AJ0A 3M8YA 1VQ6S 1BLLE 4KO0B 2C6GA 5DWNA 3HJVA 4GXHA 3H4QA 4FXVA 3JRUA 1SKSA 3I5CA 2MLYA 1UFHA 1MROA 1RKJA 2PR1A 4ZVTB 2O4HA 2HMIA 2R7HA 1T94A 2J7WA 3TQEA 2FJAB 4HI2A 4MMOA 3MWBA 3LP2B 5HVGA 4JI0F 4ZGYB 5F0UA 2D3O1 1Q5YA 2OPQB 4EYIB 4DV3F 5LYIA 2HEKA 3TX8A 2ZH2A 2X1BA 1FRHA 2PJ4A 3MI7X 3DRPA 4M5KA 3S01A 3W1YC 4C6AA 2V8HA 3PO5A 5D15A 4EYHB 4ZP6A 2HWIA 2CXEA 2WHOA 1GFWB 3ULHA 3FC9A 5J8CA 2DTJA 4L75A 3HFVA 5LSLA 3EY5A 3OL6A 1LQ9A 5I3QA 3WBZA 1IY7A 3PIPQ 4JI5J 2WRMA 6CPAA 1WWHA 1HD0A 4OZ5A 2I3CA 5DRKA 1BHNA 3Q8QB 4DX5A 3MMBA 2Z2YB 5E7OB 2OAUA 2F63A 4CYUA 1HL6A 1GYTA 2R8GA 1SH0A 3CMES 4OV6A 2XZTB 3QT5A 4KT0C 1U6FA 3G96A 3M2VB 4C2ZA 4ZCLA 1J4JA 5HQ8A 3BEGB 4ZN1A 3RBDA 2W25A 3OR2A 4CT8A 3Q8RB 1YQHA 2K06A 3ZZRA 2DK2A 1RT7A 3FMCA 2GA7A 5LSRA 2DH7A 4ZLPA 4X4UA 2CPZA 3HFZB 3GG0A 2OR4A 5CYMB 5G0RA 3J7YI 1LW0A 2IJNA 4JV0A 1MK4A 3MCNA 8RUCA 1I1GA 3M1VA 3NCQA 1F2OA 4OC2A 4DV0F 2V8GA 4WYLA 3HHDA 4DJBA 3CCSS 2MJNA 1XIXA 2ZEOA 1JJHA 3E51A 4IH5A 4KHMA 4HNYB 3KWMA 1IR1A 2J9AA 3NL0A 5ETPA 4GMKA 3DYAA 2PEHA 1VYAA 3I3GA 3V7ZA 2XHWA 2CY2A 1RHRB 4PZVA 3PBEA 1U1RA 6FD1A 2KRRA 4OZJA 3IR6B 1MMDA 5ADZA 2RC4A 4OMEA 1FKAF 1SV5A 1NAQA 3MUMP 4C48A 2KM8B 1LCPA 3IO1A 3M8QA 3NGSA 2NMTA 4NL5A 1WI8A 1H72C 2IAJB 2IRXA 4PUOA 1TIQA 3I0RA 2WBMA 4R5PA 1VHEA 2B8QA 4BMHA 4EMEA 2V2KA 1RKIA 4TLRA 1F5CA 1UA0A 3LPEA 1H3DA 3KK2B 1VQ8S 3V4IA 5G1ZA 1BPNA 2HFZA 4M6IA 5D6GA 4JI4F 5ETKA 1REVB 3T6BA 4ZPTR 1KQGB 4ECQA 1FRXA 4R8FA 2WVBA 3D0HE 2EK1A 4BDPA 4LF4F 5DJBA 3MM8B 1Z8WA 5IV4A 4E8OA 1XR5A 1JKHA 3KGQA 1BQNA 1JXVA 2IVMA 2NXUA 3WC0A 3UDLA 1VBZA 4LR8A 1NDCA 3CC7S 1SKRA 4DL6A 4NGTA 4YOEA 3NE8A 2RU3A 2PVVA 5HH1A 3PKYA 5JVHQ 5E3AA 2GFFA 3QB8A 4X64J 4OZ1A 4DX7A 2F65A 1I94J 2NLWA 4LX9A 2HFUA 2JZ5A 1IYLA 2IL4A 2DNKA 1Q81T 4RW6B 4LRBA 5LJ5Y 4DL5A 4LFCF 2KI2A 2CNLB 1KNZA 2R8KA 4DV6F 3IXQA 1FJEB 1CJVA 3B3CA 2HHHF 4RW4A 3DLEA 4CO1A 2M2BA 5DQIA 1YIJS 2K3KA 4URQU 4UY85 4A33A 1T8EA 1W2IA 2VFVA 2APOA 1BLUA 3GFYA 3RW7A 4X65F 2JLFA 3QNVA 3THPA 3Q89A 3H90A 4OZ0A 4XK8C 3RBEA 2KYXA 3SXLA 3G8QA 1C2PA 4QQBA 2UP1A 3LACA 1R7IA 5JVGQ 2E9TA 2HHTA 1S79A 4ZA1A 1SH2A 1S49A 2F9JA 5A8KA 5KG7A 1B64A 5C42A 3ZNUA 1S6OA 1QVFR 1SQGA 4CCHA 1N54B 5DDRC 2KJWA 5G4DA 2ZE2B 4M5HA 2VASA 2FVRA 2DR6A 3K5MA 3DU5A 2OMLA 4OV1A 3IC1A 5CCMA 4BLGA 2B5JA 3JSYA 2MGZA 1M1GA 2YWEA 4L8AA 2DR5A 2DD8S 2AEJA 2LQ5A 1WOPA 2HC9A 3CDEA 2YWFA 4NZ6A 1S1UB 3JSBA 3BREA 4I49A 1DJ0A 1ZA1B 1UFWA 1RA6A 3SQOP 4ED7A 2ATRA 2LECA 2C2NA 4YB7A 3B82A 1CP7A 2IC3B 4O3QA 2AJQA 4UOHA 3VR1A 2YPYA 4PCQA 3JSMB 2UUBJ 2VXKA 2VA3A 5MAOA 1T03B 3A3NB 2ATCB 1YBUA 3L7UA 1EARA 1RAFB 4ILRA 1S48A 1ZH5A 1RT1B 3QLHA 1VQPS 3KHGA 1VQ5S 5L9XA 2NCKL 2VH7A 2HNDA 4QCLA 1UEUA 4FF3A 5JH9A 2CJ9A 3ET6A 5IT9Y 4S0MA 3FSYA 2GO9A 3MMCA 3KDOA 4I2QA 3GYXB 3M05A 4V19J 2XULA 2UXDJ 3C16A 4URGA 4TN2A 2RH3A 1EP4B 3J7A1 4BS2A 3RAQA 2ALZA 3LF0A 1S9EB 1CQNA 2QL5B 2DEJA 1IQZA 5IV0A 3R6LB 3NFZA 3BI0A 4OL8A 2DT9A 3EPIA 1PYOB 1N0UA 5IM0B 2FLOA 3QRPA 4P4EA 5J1EB 2GAGC 4LF5F 3NEKA 3W2VA 3D3SA 3M7VA 1D0EA 1ZZFA 1Y5LB 1XFOA 2DGUA 4J37A 4MY3A 1EETA 4RNOA 2YNEA 5B0EA 2ZENA 4MKBA 1RBOB 2HAFA 3C15B 5ETSA 2V77A 2ZW7A 4L6V3 5AE3A 3HVWA 5C25B 1BQMA 2VQEJ 4CH7A 2PJ8A 5F9LA 4X62F 4WU2A 1W26A 4X66F 5KFTA 3CD7A 4YY3J 4AG9A 3O5TB 3FDSA 2GHPA 3IWEA 3ZTRA 4MHPA 4M94A 2QV6A 3WQPA 2CPFA 1KSPA 3MDFA 1OO0B 2IVFB 1F2GA 2ARHA 3IP0A 5HROA 4R57A 1F5AA 1E6VB 4RX6A 2B6AA 1NJYA 1P1TA 3TZWA 5FLXU 4HLBA 3SJGA 1AZSA 1Q95G 4F6AA 3L2NA 4DR3F 2JEIA 2OIHA 2HHWA 1LWEA 1SKUB 1FE4A 3DOMA 4UFVA 1N5YA 2B4DA 4AD6A 1JLQB 4ECSA 4TU8A 3M6XA 5F8MA 2VUGA 1UVJA 4GKKJ 3C14A 3I0SB 5L39A 2YQ0A 2X1AA 4B17A 4NYOA 2ZH9A 5F48A 1KFDA 3J81Y 3DN9A 4LIRA 3PW4A 1X5SA 4JXRA 3DLKA 3QFHA 4RL1A 4B3MF 1WUUA 4OJ1A 5ELYA 4Y65A 3UE2A 3UO0A 3GG1A 8AT1B 5IQ6A 4P4DA 1YGYA 2AU0A 3R9EA 4I68A 1VMBA 4XPDC 3MM9A 1QM9A 2UUTA 5IB0A 1R6VA 1FEHA 4ZITA 2MHNA 1N6QA 2XMAA 2ZEFA 2QA2A 4WFNQ 5AJ3J 2UV8G 3TZZA 2EUIA 2OHDA 2OZHA 2XWYA 5F3ZA 4U67Q 3I9ZA 2DO4A 2YWHA 1VC5A 2EC0A 2RHQB 3MOJB 3PTWA 5M2RA 4Q2MA 4YU9A 2QYCA 3FEDA 1VISA 4ZBGA 3FVLA 2G3AA 4KJIA 4KFBA 2CPDA 3GR1A 4IUFA 1Q8LA 4KV8B 4UUXA 2BZ2A 4R0EA 3VGTA 1YJNS 5IZHA 1VRUB 1VQLS 4AG7A 4N8NA 2R7VA 2DHAA 3BJ7A 4QWEA 1P4NA 1HHQA 1IBKF 4UCNA 1PBAA 1Y7PA 2ZOMA 3HLPA 2VBXA 4DR6F 4ECUA 2GGPB 3G3SA 4MCQA 2IIHA 2I79A 5AXKA 4TNOA 5J2MA 4O3RA 1CS4A 4NI2B 3CJ3A 3FRZA 3AB4B 1VDHA 3SEOA 1M4IA 1SCJB 2DB1A 3DLHA 1OYEA 1YVFA 1FRIA 1Z4RA 1EIYB 2FGOA 3B4MA 3GUXA 2QA1A 1S1WA 5B09A 3SJFA 3HF5A 4Z2XA 5DG9A 3RGIA 4A8FA 3J80Y 3NNHA 2XZWA 4IG3A 1VQOS 2HS0A 5L1KA 1VQ4S 4DHVA 3IEHA 1Q4RA 1RT4B 1WI6A 4P72A 4P71A 2V34A 3EVWA 3VQTA 2GZOA 3TO9A 2AYMA 3V6KA 5AGEA 2VD3A 4PXDA 5CYQA 5HMXA 2FJWA 2F8MA 2CPJA 3O1LA 1HNZJ 5HANA 3U1MA 1L3TA 1C0TA 1SL1A 4MHNA 4RO0A 2YVSA 1VHSA 1H73A 3MD1A 1TKTB 2B4BA 1SJFA 2ZH1A 1RP5A 4YHHJ 3KHLA 4NCAA 2FE7A 3RTVA 3E01A 3WZ0A 2BE2B 5KFWA 3BBCA 1HWJA 5KFBA 2EK6A 3UD4P 1RTQA 4RNFA 2AJ1A 3HSGA 2ZOFA 3OPKA 5KG3A 3DRRB 4K4WA 5IFMA 2WZNA 2J76E 4JI3F 2G1DA 3VAIA 3UY5A 2RSQA 4DR4J 2CNTA 2UXCJ 3PB6X 3K9UA 3MRUA 1JIHA 3MCMA 1AW0A 4IKAA 2ZEHA 1RWKB 2NSCA 2Z8QA 5IC4B 1NMEB 2HZCA 4UW2A 5JUMA 1WC0A 5F8LA 3MM5A 4DQIA 3W66A 4ZS6A 4PQUA 4M6HA 2R3VA 3CZXA 2J0QD 2Z2MA 4NE9C 2OSQA 2J5AA 3CW2C 1HBNA 2I8EA 3OXGA 1Q78A 2XLJA 2PRQA 4PKDB 2G13A 1JLAA 5LJ3Y 2BMBA 4DU7A 2ZDOA 3PHEA 4DLEA 1FTCA 2CKWA 1SVDA 4YB6A 2Y8YA 1M5SA 1QD1A 3ZZ0A 2DRBA 4HH1A 4MK7A 3EVOA 2CQHA 4FPIA 3SFGA 1U47A 3RR7A 3RZAA 5LYDA 2MSTA 4L3KA 2PJ6A 2X3DA 1CJKA 1YVKA 3SQGB 2VZ9A 1F9HA 3VF0B 4ES2A 2PN6A 4JWPA 4FF1A 2PDOA 4KKOB 4ONUA 2BKPA 1URRA 4B6ZA 2V2ZA 4I4BA 4GS4A 3IU2A 3W63A 2DVIA 3NAIA 4CLUA 3EDRB 4WFBQ 3OFHA 3H8EA 2A6OA 2V68A 2EWBA 4PK3A 4CQ1A 2DNHA 2OZUA 2DKOB 4CAWA 3GQCA 3QYYA 3DOLA 4KVXA 4DQQA 5BYRA 1H38A 1K44A 3QT6A 3SJEA 3ZTQA 1PJ7A 3OUYB 1S76D 5FD1A 4FPRA 4NF1A 2I38A 2RUSA 1FERA 4MK9A 2L48A 1H7WA 1IKWB 4EK2A 3PJXA 5M2PA 3M6UA 3FZ2A 4PXBA 1FKOB 5JMNA 1NCLA 1H2UX 4DPWA 4ZHRA 4J91A 3W8PA 5KFXA 3T9YA 2IM2A 4ED3A 3R5BA 5K14A 4H4OA 3GIUA 4OAEA 2NPIA 4FYYB 3VAJA 2XY6A 1QSRA 3ZZUA 3SZ2A 1WOSA 3IBFB 3CCMS 4LF2A 2I6WA 3G71S 1FWLA 4NASA 1D9FA 4RWWA 1B6BA 1QQ9A 5EWFA 4KGXB 4JD6A 2AJFE 5KT3A 1CPZA 4DR2J 3NGTA 2ABYA 2DH9A 2CQGA 2J9DA 5LRKA 3DLGA 1TVRB 5FDLA 4LRAA 1FK9A 3D6MB 4CLYA 2DGWA 1B7FA 2MKJA 3FNNA 1TMMA 5THWA 2UUCF 2KG1A 4CH0S 1XBWA 4BCAA 2KRBA 1NSAA 4E8UA 4Y2IA 2Q0YA 1O51A 4G1PA 3H5YA 2B9WA 2H4WB 3BBBA 3BSNA 2GIFA 2FHJD 5K8OA 3R6GB 2LEPA 1Q0NA 2FS5A 3EM1A 2XSJA 2AD9A 1MNEA 3D3BJ 3MUTP 4NLUA 4Y6IA 3K7RA 1JLBA 4ZCKA 3GYAA 3V6DA 1HBOA 3R9GA 4ZY0A 2YKNA 5IWAJ 2LDIA 2B43A 4BBHA 4DV2J 4USJC 4Q38A 2EPIA 4G3IA 3MFHA 2RKIA 1BUXA 2NZCA 4KO0A 5LL6d 1UKUA 1VBXA 2XYPB 4P9SA 4P4FA 2ZBQA 1R3NA 1HLWA 3IN5A 3MTKA 2KVIA 2M8DB 2PQ8A 4UOFA 1TK0A 4RBTA 4K30A 2KM8C 3AA9A 4OC1A 1NZAA 3WC6A 2CADA 1G2EA 4WWVA 1NB7A 3CC2S 1ZPVA 1PCAA 1KQFB 1KOOA 4C0OC 3OTDA 4DQPA 4X2BA 3O2IA 2E1CA 4WXOA 4OZLA 4RW7A 4IHMA 2NSBA 4FBEA 4KHPJ 1HNIB 1D8ZA 1W25A 2RNEA 1FFSB 2YNGA 2KFYA 3R2CJ 4RI1A 4B08A 4FD7A 5J1QA 1WC5A 3D0IE 3OSPA 3S6HA 4LFBJ 3OJSA 4A8OA 3AD7C 2R42A 3LP1B 4B3TF 2CQDA 3M9NB 7CPAA 4L74A 1FJGJ 3DRSB 4JOUA 2HBQB 3OW2R 4FD4A 2C6PA 4ZCMA 3D7FA 1T9XA 2ZHOA 1DE4C 1YQEA 4ZCIA 1DY3A 4CRYB 2IPOB 1IKVA 3RYLA 1WKLA 3V38A 4NEYA 4RLEA 4FS2A 4BC9A 3US5A 2QL9B 1A6LA 2ZOGA 3NE7A 4FUUA 5CAAA 3MECB 4DN9A 2DHSA 2BOPA 5GAEU 2V4JB 2I2YA 4MFJA 4GVBA 2C3YA 3H25A 4DPTA 3CGIA 5DG8A 4DQRA 5HMWA 2VBYA 2LYVA 3HT3A 4OX9F 4LF8J 3H5XA 2JEVA 4WFAQ 1GH8A 2K7KA 3G82B 4R3LA 5F3TA 5EX0A 3WIUA 3CJQA 1G4CA 3NWGA 1UWYA 1XRYA 4NRTA 4LR7A 2P6EA 1BQXA 1T0TV 1KHVA 4KH0B 1S12A 2J6TA 2ZWPA 5KFHA 3ENWA 5E5NA 5KG1A 4C8LA 2P9EA 1XNQJ 1NNDA 1KVJA 3LGMA 3SSRA 2IMWP 2DPJA 3NH5A 2Q7BA 1YGHA 2XGPA 3VAFA 1EZZB 1WEZA 2XYHB 2RRNA 2CTCA 1W7WA 1CPSA 1BGXT 2GX8A 1JWQA 1HQUB 1DRZA 5CABA 2WAQD 2KH9A 2X7IA 2BM1A 4ED5A 1J5OB 1AUDA 3CB4A 4NLGA 3CDAA 5E3QA 2NXNA 4RS2A 5A2QU 3CCLS 1S10A 4EFDA 2XEJA 3JSRA 2OB0A 4H4KC 4YR2A 1KLMB 3D1HA 2Z2LA 4Q36A 5KT2A 3AFGA 4DS4A 1OS5A 3BO4A 2XY7A 1HI0P 4HEA9 1B0TA 4F26A 1NJZA 4NXYA 1LOUA 1DURA 3MM8A 1U7LA 2DHGA 4EZ6A 3B7IA 3GY9A 1VLYA 2CJYB 3HZGA 5LRJA 2XMVA 4F0HA 4CIOA 4CGOA 3CCWA 4FXDA 3PW5A 3LWLA 4F4KA 3T90A 3PEIA 3ILJA 4C8NA 3V81B 4QUSA 3FYNA 5CD4H 4RW6A 1JB0C 3PEHA 2ZNZA 2B4OA 5DG7A 4WCEQ 4A8MP 1GNKA 3RRHA 3FCWA 3PIOQ 4KQZA 3B3TA 1SC6A 2VQFJ 1X4GA 4CO3A 3T41A 4DSJA 2JDCA 3JQJA 5J1PA 4OMFG 2DXFA 3F56A 1IBCB 1HMVA 5H9FK 4C3LA 2XLIA 3PFEA 2QYVA 1IBMF 1LK7A 1WDTA 1DLOB 4M95A 3A4TA 4LBPA 3QJJA 1RT5A 2KYZA 1UAWA 1VK8A 1A0OB 1PJ5A 4L89A 4CAEA 3M8RA 1JLCB 3H4DA 3CF5Q 2E1RA 2CZ4A 3OTEA 3EGNA 1VQ9S 2BVZA 2YKOA 1X5TA 1KUVA 4QW9A 1UWBA 4ENOA 2WCXA 2ADCA 4DSLA 1NLKL 2Q6CA 1RTDA 3PVXA 2MQQA 2ZM6F 3KFWX 2G9OA 1R6YA 1VGYA 1OZPA 1JLGA 1GTEA 3GB0A 2R2UA 2HVEA 3H0PA 3IS9B 2QA4G 1L3KA 1JK9B 2UUAF 3D7DA 2XI3A 3AA8A 3KJQB 3KLIA 5CCLA 4H4KA 3TI0A 4JI0J 2D3UA 1QSSA 1FNMA 2IM1A 5H9FJ 4DV3J 1RYSA 4GM5A 1JMTA 3PW0A 4DFMA 2ZC3A 2JHEA 4UEFA 2ALYB 3QQCD 2DNZA 1BPMA 2QECA 3W61A 1RGVA 3GP9A 3QGIA 3MR6A 3I56S 1SQEA 2VG6B 3W7BA 4UQTA 5B0FA 1NM2A 1PYTB 3RB6A 1HBUB 2CPIA 3QIPA 5LRGA 1TV6A 1NO8A 3JTPA 2R2RA 3BQ1A 1REGX 3VVTA 9ATCB 1EKSA 3AY0A 1X0PA 1EP4A 2DR9A 4B12A 2N4DA 4RUBA 2ZHBA 1S72S 3MM6B 3W9HA 2WSEC 4KOTA 1OWXA 2B58A 4ECZA 3AOBA 1LEOA 3D68A 2Z11A 3LO3A 2OD6A 5IM0A 4OZNA 4JI8J 1S7NA 2HB6A 1IBLF 2AKWB 2MTLA 2DEAA 3BGRB 1B70B 1ZAXA 3SSQA 2C22A 4JLYA 4C8KA 3QATA 4UFWA 4R3KA 1NMTA 3DMJB 3C15A 3LWUA 2IFXA 3G86A 1YJUA 1FKPA 3U1LA 2EVNA 1U6MA 4CLTA 4UIAA 2RDJA 2J8AA 1QAXA 4N76A 2W2PP 4KLWA 2UVVA 4LIWA 1MROB 3CXPA 1G6BA 1T11A 2HMIB 2VKRA 1EE3P 2PJAA 5HMZA 2ZBRA 4KAIA 3KK1A 1E6VA 2HQGA 3DLJA 4WFYA 5CYJA 3BF4A 2XCAA 1U02A 2J9DE 2EFVA 1RABB 4ZVGA 3KLFB 4ZP8A 3DRPB 4RUCA 2C2MB 4HKQA 4J9OA 4UEZA 1WSVA 1YMEA 1LXNA 5EWEA 5ETQA 3V6JA 2ZUAA 3PHTA 4GKJF 4Q8EA 2AWZA 5EWGA 2I9SA 2MSSA 5KT6A 5HK4A 3K8WA 2ZBIA 1RSCA 4NLVA 1HIYA 2KU7A 2W2NP 2Z0ZA 1A2ZA 2RIJA 3W62A 4JI4J 2IHR1 3KQZA 1NH8A 1AUGA 4NA2A 1HKAA 5A27A 2ERRA 3HT0A 4C8MA 1NK5A 3QAEA 4CYUB 1HDUA 3ELHA 3JB9k 4I7FB 3IGRA 3FEZA 3B3VA 4JP8A 1YJVA 2EG1A 1S4EA 1YZ6A 2BA9A 3FNCA 3OR2B 1R27B 4USKA 4CNZA 5DLFA 2OOTA 1YSJA 4A39A 3HI9A 1FJ7A 4H6ZA 2DNYA 3UVJA 1RE1B 2ZUGA 3BXMA 5G0RB 2F3JA 3FZBA 5KFEA 1P6TA 2E9RX 2FZGB 2YWGA 2XMTA 2CWXA 3TVZA 2REEA 1S77D 3BGLA 1OJ4A 2PFFB 4B14A 3M1VB 2CQIA 4KC5A 1YJWS 2VB6A 2GE3A 3BPSP 1WHVA 1G1XA 4C2XA 2B7CB 2ZH7A 1RZMA 3M9MB 1QAYA 3C66A 2D1CA 1X4EA 3KLVA 2PI4A 4LQ6A 5AG7A 1VRUA 2LXIA 3DYAB 3POTA 1Z8XA 2K7JA 2H54B 1IWAA 1XR6A 4WZMA 3GFZA 3OL9A 4Y28C 4ED1A 4EU0A 1RAAB 1ZPWX 3M8QB 2NZ4A 1MSWD 4PUOB 4ZN3A 3HVTA 2VG5A 2C2EA 1VBKA 4F8RA 3ZTPA 1PBUA 2PE8A 1X4FA 2XYGB 5KFQA 4IOCQ 5KTCA 2F8EX 2PMHA 1KLNA 3PX0A 1WDDA 1TXRA 4YB5A 2XEIA 2XZDB 2YH0A 2F4FA 2GFQA 4U7CA 3PB7X 3PB4X 1FJCA 1PAUB 2EWHA 3C46A 4A4JA 2HNZB 4DR5J 3I96A 4CO2A 5KFIA 3LAMA 3QO9A 5KTDA 2YTCA 1L3UA 4IOBA 1JKHB 1BQNB 1WTBA 2V4RA 4ED6A 2KT3A 3GIJA 1XMOF 4KPCA 4OC0A 2R98A 2NXEA 3OHAA 4Q2LA 4JV5F 3V5RA 1KR4A 5EDWA 3GYNA 1P27B 1WTFA 3CD5A 3Q22A 4W92B 1VHOA 2HQFA 5KT5A 2HIYA 4B9SA 4PG7A 4ZI6A 3K5OA 2EFOA 4RW4B 4LBHA 3LGNA 3GTYX 3G2XA 4EBCA 4CGNA 5F49A 1HHSA 2F1FA 1TF9A 3GJTB 2Z3KA 2DGQA 2MQPA 1TKFA 2H5EA 4UA3A 4TXSA 3D0GE 3NY0A 2D4OA 4WIIA 5GVQA 3PYFA 2GC8A 2O3DA 1OY6A 4MKVA 3CXQA 1CC8A 3RBUA 4R0JA 3QWUA 3ICLA 4DJLA 5A8KB 4X3RA 5C42B 5A2QY 2E29A 2MY7A 4CO5A 4ZPCA 4MHZA 3B8GA 5BR8F 1XEZA 3BB5A 4AFFA 4U8VA 3PBBA 2I5JB 2Y0SD 3H98A 3HSZA 3QAYA 3RW6A 4ZJLA 2XC9A 1TFWA 2B5JB 5T7LA 3PCOB 3BSOA 2MGZB 1BXNA 1R8PA 2U2FA 2D9OA 1QUVA 2GNKA 2CG4A 2DF5A 4MFQA 2LDYA 4WXWA 4NRUA 4CNYA 1U48A 2HRUA 4MFZA 3WC7A 2E1MC 4FKYA 2LA4A 3MR2A 1UEVA 2YKQA 3QGPA 2FPHX 4DR3J 4Q0BB 4FF2A 2C2KB 5EMIA 2RDIA 4JI1F 3FBEA 3QNWB 4XPLA 4CH1A 1C0UB 3QLHB 4W98A 4W9YA 1N48A 2CNKB 3UN2A 2B3VA 3FB3A 3SCKE 3TFYA 2HNDB 2KG0A 2PJ9A 3ET6B 2IYGA 4UQGA 3ISXA 1Q5VA 1TUWA 2E5JA 3R1LA 2YWKA 1U2RA 1SH3A 1SI9A 4X4RA 3BS9A 1IKWA 3GJSB 3TJ9A 2YNIA 1GQEA 3NMRA 3C16B 2L3MA 4B3MJ 5AG4A 2XWXA 3OLBA 3VVUA 1RA7A 3CPWR 3T9ZA 5J1NA 3IBCB 4IK2A 2CNNB 2D9PA 3MHYA 2BX6A 1U49A 3MPWA 3CCJS 1NPRA 2J0XA 1P0HA 4WTOB 4KSIA 3W2VB 2CTBA 4NZ7A 3CIZA 2HYIB 1U6BA 3PV8A 4FBUA 4N47A 1WOOA 4MIBA 2VA2A 5A76A 1EETB 4F7VA 2HKEA 1QDUB 1TVRA 1Q8IA 3MF5A 1CULA 1UPPA 1BQMB 2ZH4A 1UW4A 3DC2A 3H5UA 4BHQA 2VOPA 1MW7A 4MYTA 1Q8KA 1Y3KA 5D8NA 2FVSA 2LQ8A 1EJ7L 2HV2A 5LXRA 1FNXH 1BAVA 5A6PA 1IBKJ 1VKCA 3MEGB 3GR0A 1HFEL 3KYLA 5HROB 1L3SA 2DIVA 4A94A 5B0AA 1PU9A 4C97A 4CM2A 3HKZD 2BL1A 3VAHA 2GJ2A 1UVMA 4DSFA 2ZEDA 1LWEB 4LSLA 3D4UA 2GIQA 3DOMB 5LMNF 5H9EJ 4YP3A 4F2RA 4II9A 2FZCB 2PJ1A 1N5YB 4OIXA 2B4DB 5U47A 4I0WA 1Y5NB 1HHTP 3Q8PB 2RMLA 3EJMA 4LF9J 1FDBA 4CTAA 4K0KF 1PG5B 5KFRA 3C14B 5CZVA 3L7OA 2PJ5A 2XY5A 4L76A 1LWFA 4DBQA 2JEWA 2M52A 4UFXA 1BC6A 4WZQA 3U02A 9RUBA 2W2MP 4K4VA 1RI7A 2JEJA 4YDXA 3V6HA 3DLKB 4KE5A 2J8SA 2PIYA 5LM7E 1S7LA 5JXSA 1SC3B 2FJBB 1AYEA 3IM9A 2GVZA 1KTQA 4V19X 2Y0MA 2ZKUA 4NGRA 1NEEA 3W8GA 1XNRF 3QZ7A 3MM9B 5I3UA 4HTIA 2QC3A 3KUHA 1IICA 4HKFA 3P2HA 2HS4A 1SKWA 2OZGA 2V50A 4DR1F 1GX6A 3IU1A 2V8VA 1TKHA 4K2JA 5T14A 2E5LJ 1OIAA 3DDDA 2DR7A 4WP9A 1JX4A 2MMYA 4IFYA 1JWWA 2G4BA 4PEOA 3ZZYA 5ETLA 1O6XA 2R2SA 4KYZA 5ITHA 4JI3J 1O5JA 4O4GA 1RHMB 3CMQA 2DEIA 2BUNA 4KFBB 1CJTB 2RE1A 1J2VA 1Y00A 1TKXA 1EQMA 2J8RA 4U5YA 4ZVQB 4DL2A 1DTQB 2C2OB 3SDEA 4ILMA 2D4PA 2AJ4A 3S7RA 4K4XA 2OLWA 3R27A 1RUSA 1M1KT 4DV1F 1U09A 4P4IA 5J2MB 1DTTA 4OI2A 3UNGC 1CS4B 4KVOE 1NU4A 4Y2CA 3Q8UA 4HR2A 5HQLA 3PM9A 3BSCA 1S9GB 3DLBA 4ZVSB 2V4JA 2CA9A 1WSRA 4NWBA 1Q2DA 4ETXA 4I2PB 2FLLA 1G7CB 3TT2A 4QYZK 4RNMA 3JVNA 4I1TA 4F0KA 3BKUA 4IG3B 3EX7B 3OVBA 3VZHA 5EGYA 5J2QB 1Y0YA 1Z5RA 5F0WA 4NCGA 2QFJA 3J7AN 5CA5A 4ZK7M 3KHRA 4YR0A 2CRLA 1S1TA 3VZIA 1S6QA 1RXTA 3A9LA 3RRKA 1XMQJ 2VBQA 3KKFA 1C0TB 1CJWA 1MN9A 3NOCA 2A0FB 3A12A 5AT1B 1ZM9A 3M8SA 3H4BA 4KORA 4NFRA 2ZEJA 2QTWA 1SQFA 2JC1A 3DHXA 5CPAA 1TKZB 4JI5F 3FF3A 4J9UE 4DFKA 1NK4A 1HQUA 4OYWA 2L41A 3E01B 4ZVPB 1XJOA 4RU9A 1K47A 4XDDA 3MMJA 1L3VA 1GMWD 2WPWA 4LSZB 3IG1B 3JS9A 1Q86T 2GVDA 1MJ9A 1YBAA 3M32B 4QYZJ 2D74B 3T6JA 5AXNA 4TVAB 3AB2B 3SCIE 1OY9A 3HD1A 3KG4A 3IWLA 3BN4A 4DN0A 3N28A 4JV2A 5K8NA 4TU9A 2GREA 2EBJA 2HW3A 3HULA 1QMUA 2M70A 4ANDA 2CJAA 2GLJA 4PQUB 4DI6A 1YG0A 1SJ1A 2HS3A 5AXMA 2XNQA 2M5YA 3L7PA 1HBNB 1TL1A 1KTVA 2CQ3A 3ILOA 2HFNA 1NJXA 5F8JA 1I6JA 3IRXA 1JLAB 1CSJA 2AIRB 1UVLA 2CJXB 3ENAA 4L72B 3ETMA 3OBIA 4B5OA 5BJRA 4R76A 2KT2A 2UUCJ 1K4JA 4H6UA 1Z4EA 4MIWA 4K59A 2CIJA 5EC4A 2CUYA 2OUGA 2DY9A 4B11A 2C42A 4RJVA 1N0VC 4HL9A 1CJKB 2A2CA 2B9XA 4JI7F 3HJFA 3BKTA 4CLPA 2W9CA 1CM0A 1X4DA 4RUAA 4PWWA 2YNFA 3J7Z5 3X1LB 2HBYB 4ZLNA 3DDIA 3GCWP 2DXQA 3K8VA 1HWLA 1ZG9A 1DQ8A 3A3PB 1N36F 2IRYA 1Z8LA 2HBZB 5CH7B 2P5VA 3DOLB 3GIMA 2DPIA 1VJWA 4KOVA 2OO4A 3G6XA 4LF6J 1R8AA 1R8CA 1TL3A 2RFHA 1L0CA 3EYZA 4RNNA 4RUHA 3A8EA 3TR5A 1YRTA 4A8YA 3PNIA 2GHWA 3VV2B 4ZHRB 3IS9A 1WD6A 2HG4A 1NJIT 1HWUA 2B4PA 3P8BB 2CNSA 5K14B 5GAEI 1H8LA 4H4OB 3RO0A 2FD2A 1NHVA 1T9WA 2F4VF 1S7IA 2ZPAA 3DCAA 5DQHA 2BRLA 1QSLA 1CBKA 1RBAA 4HHHA 4I6WA 1FD2A 4F4XA 2OP5A 3I9V9 3Q24A 3FFIA 2PVWA 3P2FA 1PYTA 4QPTA 4AL7A 2LQBA 3D7HA 3F8KA 3DLGB 4DNCA 5FDLB 2PFDA 4J9QA 2FLNA 1FK9B 2AGOA 1U1MA 4B3TJ 2ZJRQ 1KQSR 1RACB 4NYZA 2F40A 2QMWA 3NAHA 1LV5A 4Y3CA 4NLSA 4NZ0A 1T9UA 3MEEA 4QPXA 3TX0A 1HD1A 4HI1A 2VV5A 2R7RA 5D4PA 4BINA 4AE5A 4A32A 1WEXA 4MFLA 4HT5A 3IWXA 5HSPA 4QIFA 1VJQA 1H98A 1YK9A 4CS0B 4U7UD 4JXQA 1RTZA 1S5KA 1RAGB 3G6ES 3F73A 3PXGa 1Q82T 4ICLA 2QJ3A 3NG8A 4QWAA 1V3ZA 1HBOB 1X5PA 2WVEA 2YKNB 3BGRA 1RWWB 3CJ2A 1LAMA 5CXTA 3LAKA 4EO8A 1SXLA 2GO8A 4OX9J 3ZJ0A 1KUYA 5HBMA 2DCUB 3IFEA 2Q6BA 2UUBF 4NEXA 4NXMJ 1YLOA 5HMYA 5CNPA 1FNOA 1LXJA 4I69A 4FZVA 5DO2A 2KJVA 4IR1A 2FJDB 4XO0A 2J6UA 4IAVA 2GQ2A 5SUHA 3U1NA 4A48A 2V8PA 2JWNA 3QZ8A 1SL2A 5A8RA 1CVJA 3QRQA 4C11A 2AEFA 2C27A 4O44A 4QIGA 2DNQA 4RR5A 2Q51A 3MGJA 1IIDA 5ETRA 4ZVHA 3H8GA 1VIXA 2XLKA 2YQ1A 2MKHA 1BO4A 2RU9A 3KLFA 1K0VA 1BMQB 3KQXA 5EBVA 4O0NA 2MB0B 5C24B 4NX9A 4M1KA 2W4CA 3MZIA 3B35A 4AUKA 2QEXS 3DI6A 4OX6A 3RNZA 2GS8A 4RW7B 1FXDA 4WP8A 4K7QA 1NDPA 2WK4A 5K20B 2LQ9A 2H5IB 1M44A 2YNGB 2DYAA 4DSIA 3DFEA 4NA3A 3Q8YA 5EHHA 3T3FA 3CJKA 4KOXA 2XEGA 3ITHB 2PO4A 5HN0A 2WYRA 1RWXB 2ROGA 3P49B 4I7FA 1SL0A 4TWEA 1SUQA 4CLZA 1IKVB 3IGNA 2OPSA 4R8UB 5F8GA 2MJUA 2UUWA 2XO7A 2HK2A 3QT8A 3BBFA 2XMKA 3NS7B 2DNOA 3C8YA 5C82A 3TA2A 3FECA 2OELA 4B9VA 2JEFA 1QE1A 3RUBL 2DY1A 1SIZA 3DDNA 1M0SA 4OZ2A 4FWUA 4OX8A 3A8KA 2QRRA 1GX5A 4GVBB 2HZVA 4NGSA 4BC7A 3H8YA 3SV4A 1VFJA 2QMUB 2IDLA 5CZXA 2WSFC 3PGPA 3UQSA 2AV5A 4ER8A 4NCZA 2NXCA 4N7TA 3DNCA 2FIAA 3GWCA 2DITA 4DF8A 1NKEA 1ITPA 4KUBA 1UZHA 5KOXA 1QUPA 1F1BB 2HVIA 1UP1A 1QSMA 2XQCA 1T9YA 1PAEX 2AFXA 4HT7A 4N56A 3A3OB 1AXQA 2CQ4A 3CO9A 3CDWA 6FDRA 4U9ZA 1L5UA 2ATLA 2Q4YA 1D3WA 3ZZTA 4WP3A 2RS2A 1IQTA 1KVKA 3QBCA 4USMA 2CFXA 2B5GA 4MFPA 3T5HA 1RQ0A 4PR6A 4JV1A 3KLGB 4F9UA 2FHJA 4D3GA 2XEFA 1ACMB 5L1LA 2Y8WA 3RBXA 1S97A 5F09A 1ZG8A 2CNOB 3JUWA 2H5JB 2ILZA 4C8ZA 4CRJA 4FYDA 3KHZA 3QJLA 3CSKA 2HNZA 3RRGA 1CLFA 4ZPBA 1TP7A 2E1PA 2Q44A 2X3GA 1Q7YT 4K5RA 2B4UA 2QLJB 1U2FA 1KC8T 3JTNA 3HKWA 3TARA 4HACA 2VFSA 3N7ZA 3Q8VA 1NE9A 1TAQA 2VIHA 1NSQA 1Q16B 5KG2A 3WABA 2VFTA 3RR8A 2LEBA 1NBEB 1V9OA 2J9EA 2AFMA 3MFIA 3PR4A 3HHLD 5ETVA 2VG7A 3AQOA 3WC5A 3OTBA 1NDKA 4JJXA 2E5GA 1YJTA 2QL7B 4DCPB 3RBZA 2FXFA 2FUG9 3ZTSA 3QRRA 1IKYA 2PC1A 4OC4A 3LODA 3WT4A 4XPKA 3TJ8A 4KPYA 1Q7LA 1HMVB 3DU6A 2K5TA 3NRBA 1JNZB 4DS5A 1B99A 4WBFA 4CLKA 3D9BA 2VU5A 1RT5B 3MURP 3PKMA 3TVKA 2V5HG 4EWTA 4AB7A 2N7YA 1N34J 1Y9OA 4C7HA 1KN6A 4F50A 1DQAA 1RWMB 2I0XA 2WVCA 1KFSA 2O01C 2GMHA 1NHUA 1FX2A 3R3TA 1FA0A 4MKYA 4OLOA 3OLAA 5K8PA 1UWBB 4YB1P 4A2ZA 4AXVA 2GIRA 3IWGA 1RWUA 2I5JA 1WEYA 4M5DA 3TZYA 1RTDB 2ZEGA 5HVHA 2FC9A 3I5BA 5LMUF 3GCXP 4IFVA 2KTQA 2WB4A 3JTKA 1JLGB 4RBUA 4NJRA 1RT3A 5HMNA 2OEKA 1YJ7A 2RD5C 1HARA 2CAJA 3M9OB 5A28A 5F8NA 4PSXA 4OQJA 2W8KA 4YHHF 2Y0BB 3KLIB 1ARMA 4CYQA 3IBWA 4WU3A 3R97A 2HUZA 4Q0BA 2HQIA 5JM6A 5G22A 1XMBA 2JL9A 4DV7F 3QWPA 5KFUA 3K59A 3V8IA 2QZ8A 1C0UA 2HFVA 3KL9A 1MU2B 1IOFA 2PSWA 3I6PA 4LSNA 2Y9HA 2E44A 4DR4F 4GKJJ 1QSTA 3B78A 2UXCF 1I51B 4Q5VA 1N4LA 2FHOB 2MZJA 1XOVA 2Z3OA 1GHEA 5I4MA 2ADBA 3CCRS 1QY7A 3QIPB 1TV6B 1Q2CA 1QAIA 3W6SA 4C7IA 1S57A 1S0NA 4NGNA 4YFUA 1TL4A 2DRAA 3IIBA 1FWKA 1N5TA 2W7PA 2KXNB 1SPBP 2OPRA 2DGXA 2DGOA 4MYUA 1IGBA 2AP6A 3TOAA 2PGCA 3J7ZT 4QU6A 5HLFA 2GIVA 2HHUA 3HX9A 2ZW6A 3TP2A 5KFMA 2IY5B 4DYOA 4QU7A 1K73T 4XAKA 2BV3A 4NXNF 3ISND 5E3CA 2BJEA 1HNVB 3OTOJ 1FKPB 1RAHB 2ZW5A 3PYEA 4NLOA 5DWMA 4H54A 3PP9A 3IJ3A 1Y10A 3SXOA 1FI4A 3LWMA 1RADB 5D29A 2BANA 3EXCX 4KR0B 1RJJA 4KGZB 2C28A 2CWKA 4J9VA 2XS2A 3MEGA 4F02A 3ZFVA 3LP0A 2KXHA 2MZSA 4FKXA 2BE7D 3KK1B 4QWDA 2ZELA 4N77A 2ZH8A 5BYSA 4LUBA 1UEKA 4KRWA 3P45B 2MQLA 4X4QA 1C1CB 1EHWA 3Q2TC 4WE1A 2IRUA 3B3SA 3R5JB 4WK3A 2GMJA 3SIPB 4IO1A 8ATCB 2AFUA 1YX0A 1M5HA 4MI4A 2LU2A 2LP4A 3RAMA 3A8IA 2KFNA 3M2UA 4ANEA 1S6UA 5GAHU 1FFGB 2CPEA 4PXEA 4ATNA 2KFZA 5JQ4A 4ZP9A 1HW8A 5DDQC 2RRBA 3EGZA 3BV8A 2BQUA 2JOQA 3CCQS 5D8HB 2YNDA 3AJ1A 4U7UK 4UBRA 5E2QA 2O5DA 4QBJA 1FDNA 5A8WB 4C0HA 4YS2A 4DR2F 4ZDNA 4HVZA 1XMOJ 1U26A 2G0BA 5GMEA 4NSQA 1KP6A 4X4OA 2H51B 5KFPA 3SBMA 3D6TB 2REFA 5HJXA 3UVJB 2P0WA 5FJ4A 4KOUA 5JGFA 2PJ0A 4M5NA 4OLPA 3HPOA 2UVUA 3PYDA 3DSBA 4A8WA 2RHSB 3FX6A 4JI6J 3A13A 5I3PA 3T1HJ 2Z4PA 2YNCC 3LA0A 3N5FA 3BHXA 3AJDA 3M30B 2A10A 2OH1A 5J2NB 2P9GA 2HURA 3MEDA 2BJ1A 3UI3A 3RB4A 2PT0A 3OT9A 3Q8SB 5IXUA 1KOHA 3FBCA 1CJTA 3WX8A 1PJ6A 5KTQA 2AYGA 1DTQA 1XQIA 1TQLA 3FIXA 3POTB 2X1FA 3HFKA 3TA0A 2QIRA 2YKAA 1WF2A 4DV2F 4I64A 3V4MA 1EKRA 5C88A 3TEGA 4ILLA 3NH4A 2NQPA 5IB9A 1T9TA 1F57A 3C26A 3KOAA 3T1YF 4M5GA 4P4JA 1S9GA 7AT1B 2JVRA 3NWRA 3VGVA 3HVTB 2MLXA 2VG5B 4QR0A 3DOKA 4I2PA 4J5OA 1O8BA 3NOGA 2DCLA 2ZITA 3WDOA 1X4CA 1XR7A 3TUJC 4X4TA 1NXIA 4URSA 4FD5A 2HZAA 1R0BG 3U27A 3VGSA 4CPAA 4GVLA 4DCJB 3B3WA 5HATA 5J2QA 4CLLA 3GIIA 4CO4A 4OYAA 5E33A 2VHGA 2C3UA 5GAGU 5IV3A 4ZVEA 2PMWA 3QO9B 4ZIWA 1YHQS 4ITSA 4ZY1A 3IWWA 3NCPA 4C0BA 1MN7A 4KHPF 4YRHA 1N5VA 2RRAA 5LYFA 2FYXA 4AVBA 4CRZB 1TKZA 1GEHA 3OL8A 3LGHA 1S0VA 1LWXA 3MAHA 3CEDA 4DR7F 3AD8C 3O3LA 3THTA 1IUJA 1CX8A 2XMMA 1W2BR 1FJGF 3FH4A 4LQGA 4ECVA 5GCNA 5EN1A 3MAAA 4MY0A 2B3TB 3AT1B 3H8FA 3IG1A 4KGVB 1BD6A 1WKJA 4E2AA 1HPZA 3M32A 3VH9A 3S6KA 4RU2A 2BR0A 2YNCA 4CM0A 3KNAA 1XC9A 3VHQA 2OJ3A 3SI1A 4M63A 4KLVA 1Y7EA 2Y1JA 3IWNC 1F60B 4DL3A 4B3OA 2ZJQQ 4IR9A 3MUVP 1BWVA 1NK7A 2AFOA 5K8MA 5DS0A 3EZOA 4K4TA 1YWXA 3EE3A 4DPOA 4CZCA 3C6UB 4LF8F 1U6ZA 2RF2A 4MKAA 3UDVA 1PGZA 4EO6A 2CVIA 5IT9U 2MXYA 2RQKA 2VF3A 3EICA 4AQYJ 3CDBA 3KR5A 3D6HB 2J7KA 2VPXB 3EWGA 4NMLA 3R5DA 5T7LB 4B9NA 3PX4A 2FY1A 3OL7A 1OPZA 3T5JA 4ZP7A 2DPTA 2YNHA 1NB2A 3RJMB 2HVHA 3W6XA 3MAQA 2C3PA 2AHOB 1Z2ZA 1B4SA 3CCTA 3PG9A 5E3RA 2IDEA 3QSIA 5KFGA 2FVQA 3SFUA 2ZH6A 5HI7A 1GMUA 2ASLA 2ZFHA 1FESA 3L4BC 2LKZA 4EVYA 4Z65A 1TAUA 2HQ3A 4F25A 2AYEA 1CP6A 4E98A 2MEWA 3KJVA 2JFKA 3DR8A 2RB7A 2JC0A 1SB6A 3FJ2A 5AXLA 3H2VE 4K0KJ 1UFLA 4TKTA 2AGPA 4IRKA 4LF7F 1NK8A 3AXKA 3DHWC 2HGLA 2CXAA 3IGVA 2D69A 3BYPA 4F2SA 1VK3A 1F3FA 3JTOA 2C2RA 1E6YA 1PSDA 4DFJA 3CJ5A 5DZ6A 3DNSA 2EXUA 3SMZA 1F9FA 5K9FA 1IXKA 4UY8T 2YNIB 4HTJA 2B56A 2IYIA 4JBCA 4G1QA 3D2MA 1N32J 1WG4A 1P1LA 1K8AT 2CIMA 1OQ3A 2A6MA 3Q0AA 3NCRA 1VHFA 2YBVA 4ZX9A 2VFRA 1R89A 1SJRA 3R7SB 1C1BB 2C2ZB 1EX8A 1HNWJ 1YREA 4DR1J 3QT7A 4ED0A 2VQFF 3HM9A 1WELA 1D9DA 4ECWA 2CPYA 1ZM2A 4GRSA 1NPKA 3HP6A 2K2PA 5LSOA 2GJIA 3M8PB 3NH8A 4G1IA 3PYGA 2VC1A 3TANA 4Q43A 1CULB 5ETMA 3VAGA 4DXLA 3J81U 4YEAA 1ZM4A 1SQHA 4LFAF 4Q45A 2FJXA 3GSDA 4XTTA 4M3SA 2W1BA 3TE4A 2HFOA 1X12A 2E7WA 4M6GA 1CC7A 1F5BA 4FYXB 3U7JA 3OXFA 3KLEA 1H2VZ 4P7TA 3HHEA 2RVJA 3UCZP 2H1YA 5D0RA 2ZDPA 1BWEA 3AJ2A 2OKQA 3QAUA 5D0EA 3MR3A 3FEXB 4LSLB 3UD3P 4R6TA 4IOAQ 2R7UA 1DAXA 3Q23A 5AG6A 4DUTA 3MMAA 5L1JA 4IUSA 4MHYA 1RAIB 3CJ4A 1AFIA 4CTAB 2Q7SA 5KT4A 4A46A 1HNXJ 1LWFB 2LLZA 3HK2A 4HDHA 1Y5IB 4OADA 5KFZA 4OZ3A 4DUZF 1VRTA 1ZAWA 3CPAA 4P44A 3ZZIA 3CXSA 4QWCA 1RTHA 4PPZA 2GVZB 1YTYA 4KH1B 3TAQA 3EZUA 3BDPA 5AG5A 3SHPA 4A38A 2YH1A 2GU2A 1FVSA 5I3UB 1AA1B 2XI2A 4I56A 1IWGA 3C3LA 3OHBA 2NR0A 3W2WA 1FHTA 2WW4A