The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
113
|
sequence length |
392
|
structure length |
375
|
Chain Sequence |
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb |
| molecule keywords |
IAA-amino acid hydrolase ILR1-like 2
|
| molecule tags |
Hydrolase
|
| source organism |
Arabidopsis thaliana
|
| total genus |
113
|
| structure length |
375
|
| sequence length |
392
|
| ec nomenclature |
ec
3.5.1.-: |
| pdb deposition date | 2007-05-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01546 | Peptidase_M20 | Peptidase family M20/M25/M40 |
| A | PF07687 | M20_dimer | Peptidase dimerisation domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Aminopeptidase | Zn peptidases |
