2Q43A

Ensemble refinement of the protein crystal structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords IAA-amino acid hydrolase ILR1-like 2
total genus 113
structure length 375
sequence length 392
ec nomenclature ec 3.5.1.-:
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q43A01
5THWA 3FMCA 4OP4A 3SJXA 2PJAA 4JZ0A 4MXUA 1VHEA 3B3CA 4Q7AA 2AFXA 2PJ5A 3D7HA 4P4BA 1HDQA 1ZLIA 3IWWA 2GLFA 4ZX8A 4Z65A 2PJ1A 3S9MA 1GYTA 4MHZA 2QVPA 3RAMA 2OOTA 3IC1A 4CPAA 5HVFA 1TF8A 2NYQA 3KL9A 2PJ6A 4P4FA 2Q43A 4MCPA 4WWVA 2ZEEA 3FH4A 5LYLA 3B3TA 2ZEDA 3PB4X 1BLLE 5JM6A 1YW4A 1ELLP 1LAPA 6CPAA 1UWYA 2ANPA 4EFDA 4NGQA 2V8HA 1XJOA 1LFWA 1XRYA 2O53A 2I3CA 1Z8LA 1CPXA 4PXBA 5HVGA 3PFOA 3FJUA 1Y0RA 3V38A 3IFEA 4PPZA 4OIWA 1YSJA 2JEWA 2GLJA 1PYTB 4P4JA 4OMEA 2PIYA 2ZEMA 2V8GA 3TC8A 2RFHA 3V7ZA 2NSMA 2C6PA 3KGQA 3KI9A 1OBRA 4NGPA 3H8FA 4ZYQA 4FAIA 4ZY0A 2AFMA 4NGSA 3BI0A 2QJ8A 3DGVA 4UIBA 3FEEA 2CIJA 1EE3P 1IGBA 3NA6A 3FECA 5LRJA 3WC7A 3KHZA 2BCOA 3KHXA 3KR5A 2PJ0A 4A39A 5K8NA 4OC4A 1TXRA 3SI1A 2V8VA 3KR4A 2EK9A 2Q4ZA 1IY7A 2CTCA 5LYFA 2BOAA 2PJ2A 4H2KA 2XEIA 4F8ZA 2DEAA 4X2TA 2C1CA 3I1UA 2BO9A 1ZG8A 2OR4A 3PB9X 3GLJA 4UF4A 4GM5A 2J9AA 1Y0YA 2C6GA 3HLPA 4X8IA 1ZLHA 4YWYA 4R6TA 2PVWA 3SI0A 3QNVA 5LRKA 1KWMA 5JH9A 3VARA 7CPAA 1ARMA 2O4HA 4DJLA 1TF9A 5CPAA 4NGRA 4UIAA 5D8NA 3GB0A 1DTDA 3SJFA 2GREA 4R8FA 1Z5RA 3FX6A 2GU2A 3NH4A 2ZEGA 3WC5A 2IMOA 2CF4A 1YLOA 4G1PA 1VHOA 5CBMA 1FNOA 4OIDA 4FWUA 3CPAA 3KZWA 4YU9A 2V8DA 3BHXA 1Y7EA 2G9DA 2PE3A 4OC1A 4P6YA 2EK8A 2V77A 4P4EA 4IAVA 3DLJA 2ZELA 2FVGA 1JQGA 4P4IA 2PCUA 4W9YA 1H8LA 5JGFA 4P10A 3MRUA 1QMUA 4PXCA 3PFEA 4NJRA 2XEGA 4ONWA 3FEDA 5F09A 2AFZA 5HXDA 4MRIA 2XEJA 1CBXA 1HDUA 1VGYA 1NSAA 1CP7A 4MMOA 5K8PA 4WJBA 4DUKA 5LRGA 2PJ9A 5K8OA 1YW6A 2PIZA 5I4MA 4DYOA 2PJ4A 4P44A 2ZENA 3VH9A 4ZI6A 1TKHA 3SJGA 5ELYA 3D7DA 2HB6A 4LQGA 1PCAA 3ISXA 1F57A 3B3SA 1BAVA 4UEFA 1M4LA 3BXMA 4A94A 3PB8X 3LWUA 4JYWA 4A37A 4MHYA 4B6ZA 1XBUA 2PJCA 3KQZA 3WT4A 2C6CA 2ABZA 2ZEFA 3FF3A 5HVHA 2ZEPA 3KASA 3NH5A 4PXDA 1CG2A 8CPAA 3D68A 2PJ8A 5LYIA 3T8WA 2IJZA 1F2OA 1DE4C 5D29A 2EWBA 1AYEA 3B2YA 4RUHA 1AMPA 3IJ3A 4IK2A 2IQ6A 2POKA 3PB6X 3PEIA 4OC5A 3B35A 3KQXA 4F9UA 1LANA 4ZX9A 1R43A 4O23A 2PJBA 5K8MA 1QQ9A 4TWEA 2PJ3A 4K3NA 3B3WA 4UEZA 4PQAA 3PBBA 2ZEHA 1BPMA 4EMEA 5J1QA 2JBKA 1XMBA 4F9VA 3VATA 3SI2A 3S9LA 3CT9A 4UEEA 3PBEA 1XFOA 3WC6A 4PXEA 3HUVA 2ZOFA 1F2PA 1LAMA 3D7FA 1FT7A 4MHPA 2WZNA 3L2NA 2AFSA 4ZY1A 2PRQA 3NFZA 1ARLA 4OC3A 4IHMA 4OKOA 4ZY2A 4TNUA 3H8EA 1ZG7A 2Q51A 2HC9A 2ZOGA 3CPXA 2AFUA 4A38A 1LCPA 3IIBA 1ZG9A 2CTBA 4FBEA 3NH8A 3H8GA 4NJQA 3K9TA 4R7MA 4OC0A 4AXVA 3D67A 3PRTA 2F8HA 4X3RA 1VIXA 3BI1A 3IO1A 3B3VA 4OC2A 4P4DA 3FVLA 3LMSA 2RB7A 4EWTA 4KSIA 3RBUA 3K2KA 1HEEA 4MCRA 3MN8A 3D7GA 2QYVA 2WYRA 3JRUA 3PB7X 3S9NA 3GUXA 3RZAA 1LOKA 4MCSA 2XEFA 3D66A 5IB9A 1R3NA 4FUUA 4P45A 3TX8A 2ZEOA 2F7VA 1TKFA 4NFRA 5DS0A 4NGMA 2PJ7A 3WABA 3N5FA 4MHNA 1Q7LA 5LYDA 3ISZA 1CP6A 1Z2LA 1CX8A 1ELMP 1RTQA 3D4UA 4BD9A 3CDXA 4MCQA 1TKJA 3SJEA 2VL1A 3B7IA 1CPSA 4NGNA 4NGTA 2AFOA 2PVVA 1YMEA 3IEHA 1BPNA 4R76A 2JBJA 2AFWA
chains in the Genus database with same CATH superfamily
4LBHA 3HT3A 2ZW6A 2HNYA 3RBEA 4KVME 1FE0A 2E1MC 2A18A 4Y2KA 3BDEA 3HHKA 1S79A 1AB8A 2XTJP 2QA1A 3BSOA 4YS2A 1IBKF 2PJ6A 1H3DA 2X1FA 4A8MP 4Q44A 1HD0A 2GJIA 4OZ1A 2GW8A 2MTLA 4LSNB 4GMKA 4RW9B 4KC5A 2B6AB 1VBXA 5F46A 1NSQA 2ANPA 2V8HA 3HCXA 3KLFB 2ZH1A 3QIPA 3EC4A 5E3CA 5D4NA 1Z8LA 3Q89A 1N48A 3MCSA 2RDIA 1Y0RA 1TKXA 5EMIA 1FDBA 3A8KA 3MF5A 2XEXA 3V6JA 2IJRA 3QT5A 3AD7C 1Y00A 2BEFA 4ED6A 4RW9A 4WE1B 4J37A 1Z4UA 2C2EA 2FIUA 2KZZA 1M5SA 3GTYX 3W61A 2DPJA 4C0BA 5HROA 4U6PA 5M2UA 1OSCA 2FVQA 5LSOA 1GXLA 3D6HB 1U6BA 2D3UA 4NLRA 1DURA 3GY9A 2DPSA 1H6KX 3AAWB 2HNYB 1NNDA 4F0MA 3NY0A 5AXNA 2AD9A 5CA5A 1DAXA 2G13A 1M4IA 1Q7YT 3BQ0A 1S6OA 1JLGB 1Q8KA 4R87A 4RWXA 3J7ZT 3KHHA 4Q8EA 1S9EB 2OEKA 1RTHB 3TWZA 1GNKA 1Q5YA 1R8HA 4NLOA 4ID8A 2R2SA 2R8KA 4ZP8A 4F7VA 2O5DA 1U6FA 2RQMA 4KOXA 4UFXA 1WKJA 1ZBTA 4I2PA 1FJ7A 3GYXB 2V0NA 4C7QA 4UCNA 2VXKA 2D4PA 2NYHA 4P4EA 2CRLA 5GMKa 2XWXA 1FJGJ 4J9VA 1KTQA 5HAOA 4ATNA 2MQOA 1ZA1B 4RPFA 5IQ6A 1K8AT 4O3RA 3WIUA 5JPHA 1YJRA 5HQMA 4FYYB 1RACB 1LWFA 1RWNB 1KVKA 1WC5A 1HHTP 3W1YC 4ANDA 4UT4A 1CP7A 3VGUA 4OLPA 3SYZA 4QWDA 4HHUA 2CJQA 5LRGA 3VWEA 2PIZA 2DISA 1U1OA 4DYOA 4C8LA 1P9QC 9ATCB 4ZCLA 3BJ8A 1F57A 3EICA 4C2ZA 1FDDA 2FL4A 1QSLA 4ED4A 3QAHA 2ROEA 3A8JA 4OFZA 2PJCA 3EZOA 1SUQA 2XI2A 2RE1A 4CZCA 3MPDA 2ZEFA 2NXCA 5F8MA 2ZEPA 5LM7E 4ECYA 5LMNJ 2F4VJ 1WACA 2G2YA 1F2OA 4MAKA 1VQ8S 3G9CA 5J2PB 1HHSA 5D0GA 5FD1A 4MFBB 2BKNA 3HFKA 2HMIB 4OHZA 4ZJQA 1ULRA 2W1BA 4EK2A 5F8LA 3EYZA 3HULA 4F4KA 5HMYA 4Y34A 1RBOB 1L3VA 5CD4A 5G0RB 5DDOC 4WBFA 3EUNA 2CZ4A 4M5DA 4PYDA 2HSEB 3D1OA 1NKEA 1TP7A 3Q86A 3KK2A 1F2PA 4QZVB 4GVBB 3SHPA 1TK5A 3PTWA 2AFSA 2BEIA 1CJKB 4YP3A 4F2SA 4OX9J 3RYLA 1KTVA 4OI0A 2ILYA 4TNUA 3DLEA 5ETQA 4AL6A 2R42A 4KVOE 3VCDA 1GTHA 2QIFA 2Z58B 3OR1B 5MLCV 3TT2A 4CCHA 5KFUA 4Q5VA 1RT7A 2Y0SD 3W9IA 4A8KA 3PDNA 1D8YA 4UZBA 2AEMA 3J81U 4DU8A 1V3ZA 1UP1A 2UXCJ 4YGOA 2D9OA 3B54A 4IH7A 4X62F 3NS6A 5KFFA 2QYVA 3D7GA 4ANCA 5B0EA 4W4MA 4IFVB 3PB7X 3RZAA 2WOMB 2VBWA 3HVAA 4U95A 1LW0B 3I87A 3IGNA 4KGZB 2H9ZA 1ZZNA 1HD1A 2GHVC 3N5FA 1Z2LA 4ICLB 4FD4A 2RRBA 4FXVA 1YHQS 4V19J 4CP5A 2IAJA 3C2PA 4IFVA 1YREA 4C7HA 3KK1A 3N7ZA 1D0EA 3L4BC 3M2RA 1Q2DA 2KM8B 2DR7A 3FNCA 1YMEA 2DF5A 2QGFB 2J8NA 1BPNA 4DR7F 4LF7J 4F4WA 4ZVPB 3VAMA 4CM0A 4X4UA 1MN9A 1P6TA 3CD5A 3CIMA 4P75A 2HQFA 2KHDA 4FNHA 1RISA 3T5HA 3R5GA 4LFCF 4YB1P 2GJ2A 5DRKA 5F8HA 1V3RA 3IWWA 4EO6A 4C4WA 2QA2A 3BSNA 2OTJS 4F0YA 4KHRA 1RCOB 1GYTA 2DD8S 3ZTRA 2R4FA 3D28A 1T3NA 4ZPCA 3IS9B 3N0VA 2NYQA 2DCLA 4KJIA 3FBBA 4DV7J 1EJ7L 3NAHA 1RWOB 1FRKA 2EFPA 4M5DB 3QAEA 4YR0A 2V2VA 2RUGA 3LD2A 4QB9A 3FMBA 3TEGA 1KQGB 4AQYJ 4UUXA 2ZH6A 2HMIA 3QBCA 4MFBA 3LH2S 3J7YI 1JXLA 1LXNA 5K14B 3K8VA 1T9XA 1TUVA 2HK3A 2PI5A 2C1EB 4CRYB 3I0SA 3M2RB 4C2MA 3KGQA 3UD5A 1ZM3A 4R0JA 3KLGB 4BINA 2VQFF 3DN9A 5E3PA 4ZLLA 4FAIA 2GHWA 3J7YU 5D15A 2EFVA 2AJQA 3BI0A 3IBCB 1WWZA 3OTOJ 4G65A 2CJAA 2M88A 2R7UA 4X4PA 1XN9A 3CCMS 1Q8IA 1FKPB 2KJVA 3I32A 3BPSP 4ZPAA 3VAJA 3VGVA 3N4WA 4H2KA 1WEZA 3DI6B 4CLYA 1VLOA 2EO8A 1P4NA 2D1CA 2HNDA 2BO9A 2DH8A 1U49A 4XPLA 1JK9B 2YPYA 6AT1B 4NWBA 2C6GA 4GC6A 4K4VA 2JZ5A 4Y2MA 1VQMS 2D3OR 1DHMA 4HPSA 1KR4A 4URGA 2V34A 4CTAA 3CE8A 1PJ7A 3IG1A 3RR7A 3OSNA 4K50A 4P6QA 3A8IA 5I3QA 5BWAB 3SXOA 2CNTA 1UZDA 4ZVRB 3W8GA 2Y8WA 2OH2A 2V77A 2C2DA 3V4IB 4IAVA 1R0CB 3NMRA 2N7YA 4J9RA 1HNXJ 4IQXA 4W98A 5A8WA 2BJDA 1DLOB 2AEJA 4TYBA 2CPJA 3TW0A 1M5PC 1WELA 4C2XA 3R8YA 3TANA 4KGXB 3PFEA 4K7QA 2GQCA 3MM6B 1U1PA 3Q8QB 1ZM4A 1UW4A 1QVGR 2FB0A 1VC0A 3CJSA 1QUVA 2LEAA 1J5EJ 4P2FA 5IT9Y 2NPFA 2FY8A 2N4DA 2WW8A 3CVKA 3H2VE 1F9FA 1U0HA 2Q4VA 3SV3A 1J2VA 5A6PA 2Q6BA 2ZENA 4HKFA 3MURP 2BW2A 3MUMP 3MOJB 3KG0A 5ELYA 4PAAA 4A30A 2PN6A 2FQQB 3DYAB 2Z2ZA 2GMJA 3LACA 2NS1B 3BGOP 1HQUB 3TE4A 4X65F 1YKWA 3LWUA 4JI4F 1PSDA 2R2UA 3J81Y 2DXFA 2IVMA 1YJUA 4PXDA 5F0WA 1WC4A 3HSZA 2XSFA 2WPWA 1N5YA 3GG0A 2XY7A 1BQMB 2Y3YA 1DTQA 2XY6A 3N6NA 2W9AA 2HZCA 3D9BA 1SC4B 3EXCX 3QPIA 1VRUB 1OS5A 4AFFA 4KVXA 2JDJA 3UDEA 1S1TB 2U2FA 1WC0A 4DSJA 1WORA 4E8UA 1NSKL 1XMBA 5BYSA 1WWHA 2BX6A 4R3LA 3ILJA 4NXNJ 2LCWA 4BWMA 1UEVA 2YNEA 2XLJA 3TEHB 3Q8VA 4Y28C 4I2PB 3QRRA 2RQ4A 3UNYA 3GONA 3D1HA 2RT3A 1UKUA 2JLMA 4XPDC 3UDVA 2FGOA 4CAVA 3C46A 4AYBD 4XDDA 2JHEA 4KS9A 4E0AA 1YGYA 4NI2A 3QQCD 4CT9A 2CPYA 4DL3A 4OC2A 5B09A 2W9CB 4DR5J 1RWVB 1GTEA 3IM8A 4P4DA 4JB8B 3LMSA 4OYZA 1ZS6A 3M7VA 4LF9F 1DLOA 2HIYA 4FYVB 4C11B 2WYRA 1RK8A 1ON0A 2HFOA 4M5KA 1XMTA 3TTHA 4FP9A 2A3JA 2DNNA 1IKVA 3Q8UA 3KHGA 4C8MA 4LF8F 1RUSA 2LEPA 1SVDA 3CJRA 4MKYA 3LWMA 4CTAB 4YEAA 5AJ3J 4LFCJ 3KLEB 1GMUA 4QWAA 1TFYA 4MCQA 3TJ9A 2PO4A 1CPSA 2J9CA 4NGNA 1MU2A 4B9NA 3CXSA 4YDXA 2X1BA 2FJXA 2GA7A 2HZAA 2YKMA 3IEHA 3P3DA 4PK3A 3J80Y 4QW9A 5RUBA 2HNDB 1UCNA 1NH8A 5JMNA 2CQ0A 2AU0A 2YQ3A 4URSA 1IB1E 4CYOA 1D1UA 3EZUA 3M2VA 3EDQB 3BN7A 2J76E 3M32A 4LSNA 4Z65A 1R27B 5DM7Q 1S3ZA 3HVTB 5LMUF 2VODA 2DNHA 2OOTA 3R2DJ 2M5YA 1YRUA 2LYVA 4WWVA 2OZHA 4HT7A 2UU9F 2HV2A 4KY3A 4BCAA 3CULA 4J9PA 2GANA 3R3TA 4MT1A 4B13A 3H90A 2AW0A 2ROGA 1IQTA 3U1LA 1LWCA 2J7WA 5D0HA 4KV8A 1NKBA 4DN0A 4DV2F 5K14A 3VWDA 2VPXB 4QJVA 2MKHA 3UNGC 2RH3A 1H74A 1RU1A 3V38A 4NYZA 4OIWA 1TL1B 1JLQB 2YWFA 2XO7A 2C22A 4BWJA 4P72A 4MK8A 2B8PA 2W8KA 3OL8A 3C19A 3HD1A 4O4RA 4NRUA 1EX8A 4ORFA 4ECVA 1JNZB 3M8QA 2FJWA 2U1AA 5E41A 4B3TF 4KOUA 4KFBA 1BE4A 2OPSB 4TYAA 2AJ6A 5AT1B 3N79A 5D3GA 1NEEA 2VIHA 3CMES 1U24A 3DXSX 4ECXA 3KR5A 3NGKA 1VRTB 1EKRA 1X9WA 4A8QA 2V68A 3SCKE 4H4MB 3KK3A 2W2QP 3V81A 1P8GA 4N8NA 4NMLA 3QSIA 1VQPS 4QWCA 5IXUA 2HFVA 2CTCA 5J2QB 2PJ2A 3W3SA 2E66A 1TKZB 3PB9X 2OPQA 5C2CA 4RW6B 5BR8F 3T6BA 3QFHA 1Y5LB 4LIRA 2L3MA 4LF1A 2XLIA 3TUPA 2CAJA 3KK1B 1NPKA 1PJ5A 1ARMA 2NUUG 5CPAA 4B5PB 3RB0A 3BEGB 4C6AA 5DGBA 1V6HA 5KFOA 1Z5RA 5EBVA 1NJIT 4CLZA 4QVTA 4ES2A 2ZNZA 1RI7A 2HZVA 4HI2A 2PR8A 3CPAA 3VAFA 4ID5A 1M0SA 2PE3A 1RQ0A 1VDHA 2IM2A 2QV6A 3CXQA 4PQUA 1F5AA 2R98A 2XSJA 4JI3J 2VF3A 3LANA 2R7TA 2XG8A 3AQOA 2L9NA 3P5TL 2YKOA 3S01A 2E44A 4FF2A 5KFNA 1QTNB 2F8MA 4YFUA 1RU2A 1MNEA 4O3QA 3VF0B 4BS2A 1YW6A 3TX0A 1U45A 4OYMA 3DLEB 3LGNA 4FN5A 3P2FA 2QN6B 2R8JA 4F3OA 1JX4A 5KT6A 2MLYA 1TKTA 3WHIA 1XBUA 3EPIA 3GIKA 3RB4A 1N6QB 2H5MA 2H51B 4KOVA 1NJYA 4XTTA 3BREA 3D2WA 1FX4A 3GFXA 1IJEB 1UEUA 4CNZA 5E3QA 4RUHA 5L46A 1CQMA 1OSDA 2EKYA 3V6DB 3UN3A 3MMBB 2HHUA 2OPRA 1EETA 1C1CA 3NWRA 3BH7B 1FCAA 3PBBA 3MR6A 2B4VA 5IC6B 1UL3A 1F2HA 4ZCKA 1WI8A 3ITHA 1WG5A 3S6GA 2WCXA 4DL7A 4PCQA 4GKJF 5LOQA 4NE9C 1HR0J 3OWCA 2G1HA 2PI4A 4HACB 3PBEA 2QLWA 2P2CB 2AGPA 2P8IA 2ZOFA 5C24B 4ELVA 5E3RA 2DITA 2VFVA 3NBPA 1AZSB 2BANB 2QA4G 2LA6A 1ZM2A 4QW8A 4FYWB 2HVZA 1B0TA 1NPPA 3NGTA 2R7SA 5SZTA 2CNSA 2RDDA 4QU6A 3DLLQ 2HC9A 5IV3A 1LCPA 3IIBA 1ZG9A 1CEZA 2UVUA 1IWAA 2UVWA 4NJQA 1J5OB 1MJBA 6FDRA 2FLOA 2RKIB 4S0MA 4OYWA 3B3VA 1XR6A 1IBLJ 1I12A 4KSIA 1U6ZA 2VJVA 1RJJA 2C3PA 3LAMA 4B12A 1UVJA 4CLFA 4K5RA 1RT3A 5A6WA 2I00A 3NGUA 2VPZB 5IB9A 2P6GA 1T0TV 4RNOA 2Y0MA 2WBMA 1TMMA 2F7VA 1JIHA 2RS8A 4ECRA 4ILRA 1VK3A 2A2DA 2VD3A 2JLFA 3M1VA 3ZZYA 2KHCA 2AQ4A 4NLYA 1OPZA 1M4GA 3P8BB 2B58A 3K0JA 3A3NB 4HTJA 4MFKA 1Q4RA 2VHGA 4U67Q 2CA9A 2OSQA 3BDPA 4DQIA 2EW9A 1RXTA 1VI7A 1RTJB 4ED0A 1NBEB 2FYXA 4I56A 2GGPB 1Q86T 3W66A 1U1NA 1T05B 1PGZA 2GNKA 2A6MA 2BR0A 1FHTA 2ZH3A 3WBZA 1QE1B 4CO3A 4K4ZA 4KO0A 4ZPWR 1OZPA 1AT1B 3IC1A 3MAAA 4ECZA 5T14A 3PJ9A 2CWKA 3DRSA 1RTDA 4DFJA 2FC8A 2HQIA 2CPHA 2ZEEA 1SKSA 2DPTA 2A10A 3IM9A 3RB3A 4OLOA 3MMJA 1H98A 3PXGa 1XNQJ 5IX3A 2QE5A 3J7AN 1S99A 2B9WA 2CXAA 1AXQA 1RWMB 1XWLA 2DNQA 3QT7A 1QAJA 2WSAA 4NCGA 1VQLS 3JTKA 4FDFA 4DL2A 1X5OA 3GIRA 2B43A 1K73T 2ZZMA 4KOTA 3S6HA 1S6QB 2R7VA 2W7PA 4L76A 3RRHA 4NYOA 2COLA 3PKMA 2WW4A 2V2KA 4IOBA 1JJ2R 3DR6A 1K0TA 4WZQA 5DG9A 3ETOA 1IYKA 3W65A 2M2BA 4KR0B 4P9SA 1RT6A 4NGSA 4CWBA 4UIBA 2G0BA 1WG1A 2CIJA 3IRXA 2Q79A 1IGBA 4DG1A 1SL2A 4OI2A 1P0HA 3RR8A 4OC4A 4EBCA 1VHIA 3TAMA 4M5IA 3ZC4A 3VAHA 1M5VC 2LU1A 1VJWA 5IT9U 1IVZA 1HWLA 1LXJA 4F8ZA 1HFEL 4IFYB 2BJEA 3ILOA 3OR2A 2VZYA 2FY1A 1U1LA 4ES1A 3OVAA 4ZITA 2DYAA 4NYPA 5A8RA 4DFKA 2LQBA 4B3TJ 5K5MA 1D09B 1W25A 4N76A 1DTDA 2CADA 2P5VA 1ZO0A 3DR8A 4DFMA 2VZZA 4DR7J 4F67A 5GAGI 4FZVA 3DSBA 1RABB 1Y4ZB 1WDDA 2IJFA 2XMTA 4FWUA 1Q79A 2Q44A 2Z57B 1LQ9A 4UY85 4OHXA 2X3GA 2ZBQA 3DLJA 2OPPA 2RD5C 4E2AA 4I68A 3NRBA 5JGFA 4OYXA 3FC9A 1PYSB 3BR8A 3W91A 2B0GA 1BOBA 1VQSA 4FKXA 2KG1A 2KT5A 3OD2A 2GFFA 3P4UB 2IY5B 1UVKA 3PJXA 3G8WA 4UWIA 4UUWA 4NZ7A 4O0NA 3LA0A 1N32J 1HYSB 5GCNA 4JI0J 1ZM9A 3KHRA 1N8RT 2XS7A 3D4JA 1FVQA 3K5OA 2B5JA 4F36A 4KGMA 3GU0A 1XEZA 2FHKA 3PW4A 3FBFA 1M5OC 4NCAA 2ODFA 1X31C 1LV5A 4LFAF 2ERRA 3CCTA 4A8SA 3HVRA 3QRPA 1URRA 4C0OC 2IPOB 2MQ8A 2HK2A 2NXEA 1RTZA 4X66J 3DLKA 1DE4C 4Q38A 4CYUB 4CAEA 3GPAA 1Y11A 1MMNA 2CVIA 4IK2A 3B35A 3LQVA 3GCWP 4GKKF 5EHHA 4AXIA 5KFPA 2OD6A 1CJVA 2GIFA 3NS5A 3MUVP 4U9YA 4L8AA 1S60A 2H5IB 4QBUA 2Z3PA 3EM1A 1KOHA 1NZ8A 3FSXA 4DR3F 3CJ3A 2HVEA 2Z4PA 4CM2A 1FERA 4JI2F 1IBLF 1YDLA 3NGSA 1MW7A 1R7IA 4OC3A 1IKXB 3R9EA 2C3MA 2DGXA 2CZVC 3X3UA 2MZQA 4AB7A 4AQYF 1ZG7A 5HI7A 1BQNA 4MJKA 1JKHB 3FKBA 2UV8G 5IB0A 3SIPB 5HN0A 3M8YA 2B7BB 2N82B 2YKNA 2PEBA 1TL7B 4RLEA 3BI1A 2FSRA 4DV2J 3BSAA 1HQ2A 2QMXA 1S1WA 3SCLE 3GWCA 1KBRA 3M8PA 1DY3A 1KDNA 3JRUA 2D9PA 3CC2S 4LBIA 3ENQA 3LP2A 3SFUA 1HR0F 1Y9OA 3FEXB 1NDPA 3SI8A 1E6VA 1GXUA 3H2UB 3FGVA 4F8RA 2PA8D 2ZE2B 4K4SA 1CP6A 2UXBJ 4J5OA 1UA1A 3V2UC 5KOWA 1XQIA 1ELMP 2VQFJ 2AHOB 1KVIA 4NEZA 2OUGA 3CDAA 4TLRA 3B7IA 3R9LA 4LT6A 2MLZA 2WVFA 4YN3B 3KUEA 5KT5A 2WSCC 1MROB 4A32A 3MECA 4R76A 1JWQA 2DBBA 3FFIB 4NA3A 1CJTB 1YRTA 2ABYA 4FBTA 5E0OA 4AE5A 2MY8A 3CMAS 2PJ5A 3U7JA 1RCXB 3H5UA 3G4SS 4X2BA 1F3VA 4EYIB 2P9EA 3W5XA 1FI4A 4HH1A 2JVOA 1T02A 2BE7D 3ZZPA 2Q43A 4HDHA 4R0EA 2C2RA 1Y9KA 4IO9Q 2HFSA 3DM2A 3QSYB 3GYGA 3K17A 3FRZA 4WK1A 5DDQC 2F9JA 5KFBA 2OEJA 4NXYA 1O8BA 1CJWA 3JSRA 4J9QA 4O44B 4UCMA 1UWAA 3I9V9 2YNGB 3KG1A 3HHLC 4RBTA 1YX2A 2YNFB 4JI0F 3Q8RB 3M6WA 2UUCJ 2PC1A 1WNEA 4HNYB 1D9DA 1PYOB 2J8SA 4X4NA 2UP1A 5FJ4A 3OUYB 3I55S 4F4XA 1B3TA 4A8XA 2UXBF 1LKZA 3SZ2A 3R2CJ 4TN2A 4F0XA 2DO0A 1DQ9A 4KLVA 4KE5A 1RT2A 3NG8A 2HGNA 2MZRA 3G87A 2FVSA 4WP9A 1FFWB 2B7CB 2EK6A 2MJNA 1HNIB 2EUIA 2MKKA 4RR5A 4DX6A 3SDEB 5BYQA 5EX3A 4XAKA 1ZAVA 5L39A 4B02A 4RW7B 1RWPB 4KBIA 4BC9A 3HSDA 4UQTA 2BM1A 1UWBA 3RYOA 4Y00A 4K0KF 3DDKA 4LFBJ 4ZK7M 4OX7A 4DL6A 2KG0A 4H4KC 2OMOA 2HHTA 3NH4A 1DZ5A 2V4JA 1YLOA 4G1PA 2QFIA 4I7FB 1L3TA 4PWWA 3G6YA 1VC5A 1KUYA 2PDOA 1HBNA 2EG2A 3FXTA 5A0YA 4YU9A 2HNZA 4KPYA 1QJHA 4YMEA 2FJAB 5IT4A 4I2QB 1NK8A 2MXYA 2CDQA 3LTOA 3CCWA 4W9YA 1SXLA 1FD8A 4DSIA 1B6BA 3MRUA 3F8KA 5J1PA 1TAQA 1NH7A 4L74A 3FSIA 1ZPWX 5A8KA 1JJHA 4FF4A 4USTA 1V5VA 3JXOA 1SKRA 2MMYA 4JWPA 3TAPA 2Z11A 2KN4A 8AT1B 2M9KA 3QNWB 1FXRA 1U25A 3O5TB 5KG0A 2WK4A 4J9SA 5DDRC 1U1RA 5A27A 3KDNA 3RBXA 3PKYA 1EP4B 3TNVA 3V6HA 5H84A 2ASYA 1XOVA 4A94A 2Z2MA 5DS7A 2LEBA 1QAIA 3POTB 3PJWA 1S6UA 5KFSA 3KQZA 2CNLB 4I0WA 2ABZA 4DUYF 3HVWA 3C14B 1BO4A 1VHSA 3UCZP 1H7XA 4NLGA 3J7A1 4C3LA 2IJZA 2YKQA 3H7HB 4UOHA 5IFMA 2B4DA 3PO5A 2P6EA 1C0UB 3MEGA 2VG7A 3CDBA 1AMPA 3SXLA 2BUEA 4ZVSB 2R8GA 3KQXA 1YI2S 3R7BB 2J8MA 4PEOA 2K5TA 2OHDA 4PQAA 3MR3A 2QC3A 3GIIA 5FDLB 4G1QB 1GX6A 1Y3KA 3MEDB 4QIVA 2DR9A 5CH7B 3UFCX 3JAMU 1BLUA 1AUDA 2UUBJ 5GAEU 1PC4A 2E7XA 2P9CA 4JV0A 1TUGB 5BXIA 5C82A 3HUVA 3QATA 2ADCA 4USKA 1HI1A 3L7UA 4CNYA 2BA9A 2E1CA 4DR4J 3JAMY 4OI6A 3GYAA 2FJDB 2FJVA 1X10A 1S5ZA 4B11A 1S1VB 2D3ZA 5JJBA 1NM2A 1C1BA 4YHHJ 2K06A 3R27A 1MWQA 3I56S 2HHWA 4UZCA 3D67A 3BKTA 2PR1A 3R9GA 3SSRA 5HK4A 5GADU 4F3MA 2VPWB 4RU2A 2J7UA 4X84A 3RBUA 5DG8A 4ECUA 5HLFA 4HNWB 4ZVHA 2CQPA 3DOKA 2H48B 1P27B 1HWUA 4USMA 4NX9A 3KWMA 4CGLA 5ETPA 4NFRA 4JI3F 1I94F 3ISZA 1NSPA 2MQQA 4JD6A 2D3O1 3C26A 3H0PA 3OTCA 3MMCB 4BD9A 3UD3P 1JLFB 2V8PA 1RWKB 4DV0J 1X4FA 2PIIA 4RS2A 2GZOA 4Q36A 2N3OA 5J1EA 3MDFA 4IRKA 2WTFA 5ETVA 4B3OA 4YOEA 4PSWA 1S1XB 4PSXA 3VQTA 4LF7F 3B8HA 2VU5A 5KFYA 3MM7A 4DXLA 2B3TB 4Y65A 1DFDA 3BF4A 3BBFA 3FMCA 1TK0A 1S4FA 4JZ0A 1S7HA 3JSBA 3UI3A 4ZP9A 2PRBA 1VC6A 1NO8A 1MMDA 2NZCA 3RG6A 4ETZA 3MEKA 4FYDA 3CDUA 4UFVA 4IRDA 2E9ZA 2BJ8A 1A9NB 3I9ZA 2W24A 4ZMMA 3BB5A 2YVSA 3W9JA 3F0AA 1X4DA 1H2TZ 2VC1A 3OFGA 2V4RA 4ALZA 3MR2A 2ZEDA 2HWIA 4TU8A 1B64A 1MWYA 4PG4A 3MPWA 1M4DA 2K1RA 4MHDA 5KFLA 1RAGB 3E0KA 1HW9A 2ASDA 4OZLA 2LQJA 5EWEA 3PFOA 3FJUA 2MGZB 4ZLJA 4USJC 4HL9A 2AIRB 4LF6F 1T9UA 1PYTB 1RSCA 4J91A 3K57A 2GS8A 1N4LA 1OIAA 2QO3A 1TAUA 4CT8A 3MTKA 1JLCA 4ZYQA 8ATCB 5L9XA 3R5JB 2CQDA 3PYDA 1XR5A 1FA0A 1RLCL 2IHR1 1DTTB 4CLKA 5CQGA 1CJUA 2ZZNA 2BCOA 2PJ0A 4A39A 4KAIA 4B9LA 1L0CA 3SI1A 2W9BB 4Y6IA 1DRZA 2ATLA 3MD3A 4RL1A 3K58A 4KKOB 4IG3A 4O4GA 4DMZA 1HNVB 1JXEA 2HHSA 3I1UA 1G2EA 1Z8TA 1N5TA 3HFVA 5ETRA 2CJKA 1BWEA 1BWVA 5K9FA 4GS4A 1WF1A 5H9FJ 5E7OB 4DJLA 5A28A 1YJ7A 3IR7B 1SV5A 3UN5A 3T6JA 2E7VA 2GU2A 4A33A 3WC5A 2BE2B 5KFCA 1IIDA 4B9VA 2N7CA 2GIRA 2IMWP 2M0GB 2F4VF 1KS2A 5KTDA 3PY8A 1CBKA 3BHXA 4B14A 1WSVA 3V6KA 2VA3A 2GAHC 4YUDA 4FYXB 2XM3A 1T3OA 2DNPA 4KUBA 2CQCA 3ZZRA 5GVQA 4HTIA 2KXFA 4RUBA 4ED2A 4N56A 3QGIA 3TVKA 4C0HA 4O3OA 4DZDA 4CS0B 4MRIA 3TVZA 3JSMB 1RADB 2K7KA 2QG9B 2Y9HA 4XPKA 3L7OA 2FTRA 2GV1A 4P44A 1OJ4A 4X5KA 3D7DA 3W64A 2JRSA 4AVBA 2DXEA 3VGTA 3RRKA 3C6UB 1SKWA 4CGOA 4FNIA 5EDWA 1T11A 2XZTB 2DHSA 3UY5A 3OL7A 4IO1A 2VOPA 3L9ZA 2ROPA 1QSMA 2EFGA 5J8FA 1UVIA 1LWEA 1X9SA 3W8PA 2DY1A 4MIAA 5GADI 4DNCA 1Q1KA 5HMWA 2G2OA 5L1LA 2BOPA 2P9GA 3CJTA 3FNNA 4ELUA 3CJKA 2E9RX 2J0SD 4USHA 2HBYB 2PJBA 4OZ3A 2H5JB 4Q2MA 3NNCA 5IWAJ 3QWPA 4LF4F 1QTMA 3HSJA 4Q0BA 1NB2A 3G86A 1KFDA 3VATA 4AL5A 1Z9UA 4U7CA 3MZIA 3CSKA 1WK4A 5L1IA 2MQPA 2F4FA 2HG4A 4II9A 4OMFG 4TQSA 3OXGA 1NHVA 2QSFA 4PR6A 1WDTA 3M05A 4IKAA 4A8FA 2AX1A 3I4HX 2Q51A 3CCQS 4ECWA 4A38A 1VJQA 1SC3B 3GP9A 3FEZA 2HQ3A 1VLYA 4KSAA 3MHYA 3PRTA 1WD6A 2F8HA 5C25B 2I5JA 2V94A 3O8WA 5AE2A 1PU9A 3BO3A 3K7RA 2JEGA 3I5CA 1GMWD 1VS3A 3ET6A 4LUAA 5BR8J 4C3MA 3FZ2A 2JSXA 3FIXA 3O3LA 2DO4A 1LOKA 4KKOA 3Q24A 2DNLA 2YNIA 3BBBA 3M8ZA 2DGVA 5F48A 1KVJA 2DNMA 2JFDA 2DVIA 1UVNA 2RRNA 4U8VA 3SSSA 2LLZA 4RW4B 4NCZA 1TR0A 3MM5A 3SCJE 1P9YA 3PO4A 1TL3B 2OJ3A 2VJUA 4NLXA 4CO5A 5CD4H 3JYTB 2KXHA 2MKCA 1UFHA 4N47A 2GCFA 2DHGA 5H9EK 1Y9WA 1YK9A 3QB8A 3HDSA 3HHLD 1HPZB 2YBVA 3M30A 1S5KA 2E5HA 3TZZA 4ILLA 1P1LA 2IM1A 5THWA 3A12A 3R1LA 4PWDB 3HHLA 4LFBF 4WFNQ 1M90T 3PR4A 4X64J 1GT8A 1HDQA 5EX0A 2ASLA 4DL4A 4O3NA 2EFQA 5I3UB 2BABA 5HQ8A 5IWAF 3DMJB 3GE9A 3ENWA 2EBGA 2B5GA 3R96A 5E96A 2G3AA 1PBUA 5KFGA 3HT0A 3ZTQA 2JJ4D 5E2QA 4UOGA 4ZVEA 1RAHB 5G21A 4O0IA 3VTIA 4KGKA 2PD1A 2K3IA 3AOBA 6CPAA 3BJ7A 2KL8A 1KD1T 2OSRA 2WSFC 2PGCA 3D54A 4OLLA 1E6VB 1IBMJ 4ZP6A 1S9GB 4KGVB 2DNYA 4LSLB 4KUAA 3NEKA 2RVJA 3DU5A 3QLHB 8RUCA 5HL7Q 2AZ3A 2GLJA 2PMHA 1ZAWA 4DSEA 2ZITA 1RT5B 4RO0A 7FD1A 3KLHB 1T9VA 2OFGX 4WFBQ 4A8WA 2B9XA 1V3SA 2QZ8A 5KFHA 2EWHA 1R8BA 1MJAA 2A0FB 3C8YA 1EE3P 5F9NA 3MMCA 1H38A 3KDOA 4JI7J 1XEBA 3NA6A 2C2ZB 2I0XA 4XK8C 5G4DA 1YK3A 2I2YA 3D0GE 3H42A 1FTRA 1ACMB 4DHVA 3KR4A 1X4CA 4ZBGA 3PYGA 4EBDA 3KXDA 1M1KT 1PUAA 4N41A 2WONB 1EKSA 3B8GA 1RLDA 2I1RA 3DOKB 3RRGA 2MQLA 3C6TB 2X1AA 4JV5F 4ZPDA 2ZHOA 3UVJB 4DPUA 2OTLS 4OHYA 3VZHA 2J7KA 4C8OA 3GMGA 3NCPA 1H2VZ 4NASA 1T94A 3ZZUA 1FDAA 1O0PA 4ZP7A 1UVMA 4BHQA 2GE3A 2QLFB 4DPYA 2XO6A 4F0HA 3RB6A 2ZEGA 3WX8A 1LOUA 1FNOA 3ZNJ1 3FUYA 4CRJA 3S7RA 3QZ7A 3F41A 5D6GA 4CAFA 3QO9A 2BRKA 4EBEA 5HMNA 4GVLA 3FB3A 3IP0A 3PVXA 3Q23A 3BO4A 4OV1A 2FVGA 5D4OA 1L3SA 5DG7A 4B9TA 1FWPA 1WSRA 4IUSA 1FDNA 4J7CA 4DV5F 4F0KA 2J6TA 2O01C 3DOLB 2BJ7A 5HXDA 1S72S 1VGYA 1NSAA 3WR7A 2L9WA 1H0HB 1RT4B 1VQ7S 3A3PB 2YKAA 1VR6A 5I4MA 5A76A 1S48A 4IOAQ 4UCPA 1GFWB 4LQGA 2ZH8A 2ZUGA 2AJ0A 2BZ2A 3BXMA 3IWGA 2DGQA 2DCUB 1Z4RA 3B78A 5J8CA 3FVYA 3G82A 3M2UA 4WFXA 5CXTA 4DN9A 2B5GB 3H40A 4I4BA 3KUHA 1UETA 1QSYA 1BUXA 3UE2A 2RJZA 3Q83A 4E0DA 3FEYB 5T7LB 2GIVA 3MAQA 4X4RA 1QQ9A 4DFPA 2UUBF 3BKFA 3PZPA 1SJ4P 2R7QA 2C3UA 2RU9A 1GHEA 3SI2A 4XPEA 1TU0B 3NNAA 2B56A 1U47A 1RWUA 1D9FA 4JV1A 1LAMA 4NLWA 1IKWB 2MKSA 2CYYA 4BLGA 3SQGB 2JDDA 2J6SA 2X3DA 2KKHA 5EWFA 3L09A 2DTJA 3NLCA 3K89A 1YITS 3H5YA 3EJMA 2IYGA 3QT6A 1RT1A 3CD6S 3AA9A 3DRPB 2DHAA 3HP6A 2RF2B 3RAXA 4FBEA 2UZAA 1UW9A 2IYIA 1VQ4S 2REFA 4H4OB 3CDWA 4OX9F 2QRRA 3H98A 2KDOA 2B3UA 4EVYA 2ZKUA 2IBOA 1I3OB 2XMWA 4MTPA 2EEYA 1KSPA 1RHUB 5FIIA 3U1MA 1F9HA 4C8NA 5HH1A 2EI5A 4KOWA 1N71A 3FSYA 2FJBB 4FPRA 2HWHA 2ACYA 4XO0A 2FUG9 4Q2LA 1VQKS 4KZTA 4HLBA 4R9MA 1S9FA 4YDDB 3D4UA 1WUUA 4ZVUB 5HP1B 4CGMA 2NREA 4QPTA 1UZHA 4JJXA 2O66A 3FQKA 2MQMA 4D3GA 4R8UA 1JNRB 2PVVA 4A48A 1QE1A 4I6AA 5T41A 3D6FB 3CF5Q 4ZVTB 1I21A 7AT1B 2MY7A 1F60B 1YVKA 1RAOA 4Q0BB 4U5YA 1VQ6S 4DUYJ 3JVNA 4C98A 5A2QY 2DR5A 4FXDA 1UMJA 4QC6A 3CCUS 3FBCA 1I1DA 4OZNA 1RB0A 4OJHA 4IDKA 2QVPA 4JI1F 1ITPA 3RAMA 4K0KJ 3U27A 3LP1A 3C15B 2CFXA 5AXKA 4PUOB 3QYYA 4DU7A 3FH4A 5LYLA 3F44A 2FIAA 1IWGA 1F6TA 3PB4X 2NCKL 4DOZA 5A0YB 1XNQF 1KC8T 3F0NA 1HBNB 3RO0A 4DS5A 4NEYA 4IDKB 4D3HA 4KIAA 5DZ7A 4EFDA 2YNHB 4X4SA 3PEJA 3QGPA 1LFWA 4AVAA 1X60A 2BRLA 1S7FA 1NK9A 4M6IA 1FWLA 2HQDA 4NMXA 3V8IA 1KLNA 4R5PA 2QL5B 4DPXA 3E01B 1Q82T 1S7NA 3E8OA 2PQ8A 1UWBB 2HVDA 3SFGA 4GO7X 2PIYA 2OD4A 3I3GA 2W4DA 1KNZA 4ZJOA 4CGNA 3SBMA 4NXNF 2MEWA 5AJ3F 5H1SV 4R8UB 5AXMA 3KJVB 1H7WA 4MKVA 1NRKA 4M1KA 3DGVA 1BD6A 3GCXP 4DLGA 4CYNA 3IBWA 1YVOA 1WJ9A 5KT2A 4PABA 1E6YA 1ZPVA 4UOFA 3DDIA 3KHXA 2AV5A 3MM9A 4Q8FA 1NJXA 2CQIA 5D78A 4YRHA 3BV8A 3I5BA 2J9EA 2D69A 3NBPB 4ZPTR 1SV5B 1IY7A 3DGPB 4K5SA 4QPXA 2LQ5A 3UVJA 3TI0A 1ZA2B 2R7WA 2CIMA 1Y0YA 1BHNA 3TOBA 1S6PA 3QNVA 2KI2A 2XMJA 1HKAA 1C1CB 2DNRA 3UO0A 4DF8A 1U2FA 1XJWB 5D8NA 3GB0A 1XC9A 1S7IA 1C0TB 1S0NA 2LA4A 1Q7LB 4CRZB 3PW2A 3MCMA 3IWNC 4AG9A 3FCWA 1IR2A 3KLIB 3ZZIA 3FRMA 2KCWA 2V4QA 4IR9A 1TKDA 3JQJA 2G9DA 4OC1A 4P6YA 1N6QA 1YZ7A 1NKCA 3NNHA 1PAUB 2CUYA 4PUOA 3C15A 4DPWA 1H72C 3EMTA 1RGVA 1RTIB 3C6UA 3H4BA 2HHQA 2PFFB 5KG5A 4P73A 4PXCA 3S6KA 3QLHA 2DIVA 4GKJJ 4WXWA 1VQYA 3ZO7A 2NYIA 2AFZA 4JV2A 3P6YC 2VV5A 2XEJA 1CBXA 3RAQA 4OJ3A 4MMOA 3BN4A 4F6AA 2R8VA 2PSZA 3WIVA 4HYKA 2OO4A 3IGRA 4ZI6A 1LRZA 1RAIB 5HJXA 2CKWA 3BH6B 3VGSA 4KTQA 3CW2C 3NP5A 4R3KA 3EY5A 3DLKB 3MPVA 1HNXF 3CCJS 4LF6J 4PQUB 3KJVA 1U48A 4ZVOB 4DWIA 2CNOB 3R97A 2HFZA 5C5JA 5LYIA 2KO1A 2LKZA 2G0CA 2BE2A 4UFWA 2IQ6A 2POKA 3KTQA 4YB5A 1X12A 3LP2B 2NXUA 3N5BA 4ZX9A 1HBOB 2PJ3A 4I64A 2K2PA 5LL6d 3BBCA 1BPMA 4MIWA 2KU7A 1RTIA 3MOZA 4MK7A 4HNXB 1CULB 2HUZA 1YJNS 2VFRA 2XYGB 1VQ9S 3NXZA 2Z2YB 4HEA9 2DEJA 3Q8YA 4Q43A 4GKKJ 3V81B 1AROP 4DX5A 2XZWA 3K2YA 4KOYA 1VMBA 3BR9A 3OQ2A 5D8HB 2EVNA 3H8EA 1NLKL 2HQCA 2ZOGA 3CPXA 4MJ8A 4YB7A 2OU2A 2H4WB 5DO2A 2LQ8A 1EZZB 2RAQA 2MDAA 3QFWA 2JEJA 1IBCB 4NLDA 3PEHA 1S59A 3E51A 3HFZB 3RBZA 2GVDB 3VZIA 1DBDA 2NXNA 1REVA 4EWTA 5LSRA 2CQ2A 2V6AA 3MPUB 3DGPA 1ZTWA 2NZ4A 1YLXA 4TLQA 2MGZA 2P6TA 2XNRA 1FFGB 2RSQA 2E5IA 4CAWA 2DR8A 2YWWA 1Z2ZA 2VDIA 2KFNA 1TZ0A 4CYUA 1Q81T 3CWJA 3VAGA 2XHCA 2ZD1A 3ENAA 4UY8T 3CJ8A 4ES3A 1RTQA 2NXJA 2E1PA 4AVCA 4K4WA 2HAIA 5GAGU 1VISA 2NSBA 2CZ9A 4WTOB 2RHQB 2XBPA 3CCRS 1RT5A 3RU0A 3N28A 4L73A 4C7IA 4C9DA 2CPDA 3R6LB 4KQZA 3PNIA 2IRXA 3T1HJ 4CO1A 3RNZA 3TO7A 2HLUA 3BZQA 4P4BA 1SIZA 4L6V3 1KRPA 2DHXA 3PV8A 1NJWA 2B4DB 1UPMB 2ZH4A 5IS2A 4JI8F 4LR9A 2ZW5A 1HWJA 1CS4B 3LP1B 5KG4A 3P49B 1SL1A 3ULHA 1WEXA 3QJLA 3TUJC 4QR0A 2GMHA 4G1IA 1CPZA 1ELLP 1FNXH 4C8ZA 2UU9J 4MH8A 1IICA 1FF2A 2ZBPA 2O1PA 2HVHA 5I42B 2Q7SA 2CNKB 3N01A 2I6WA 1BGXT 1NSLA 3OW2R 4ZVQB 1FRHA 4PXBA 4K4XA 4DCOB 4ZPVR 3UW1A 1TL5A 2DGTA 5KFKA 4F50A 1S12A 3FCHA 4PPZA 2F9DA 2JEWA 5C88A 1K1QA 3QJJA 3S6EA 1RTJA 4OMEA 3OBIA 2UXCF 3TC8A 3HX9A 3ELHA 4DCJB 2QLJB 2C6PA 3KI9A 4WPAA 1XBWA 4MYUA 4DV6F 2FVPA 4LQ3A 4CYQA 1BXNA 3W6SA 2CQ1A 1SKUB 5HJYA 2KTQA 3MR5A 2QJ8A 5DGAA 3DOMA 4I2QA 5U47A 3GR1A 5KFWA 1Y10A 5BYRA 1F3FA 1S1UA 2JLGA 4OI3A 4RWWA 3VV2B 1XIXA 2UUWA 4DG1B 2CY2A 1SJ1A 3MFIA 2HHHJ 4ANEA 2O28A 2BXJA 4K4UA 4C68A 3EO4A 2AF6A 1KUVA 1OQ3A 1RT3B 3KLHA 3K5MA 3P2HA 4ZA1A 2P6SA 2J9AA 1SCJB 3BLNA 2PVWA 1VBZA 1X0PA 2CJBA 2K8GA 1U7LA 1OYDA 4MFQA 1KWMA 4JUZA 5D0EA 2LXIA 1RKJA 2I5JB 3TYTA 1F9EB 2BDPA 3SDEA 2XCAA 6FD1A 5B0GA 2YWKA 3SJFA 3CPWR 5HSPA 3M6XA 3RW6A 3LOUA 1WOOA 2ZPAA 5DZ6A 2V8DA 4WXOA 1HI8A 4K59A 4A47A 3CXPA 5C24A 4IF5A 1M1GA 3A9LA 2W4CA 3BGRB 4LR8A 2FVCA 3F5BA 2ZHAA 4BC7A 4CLUA 2GVDA 3OJSA 4ONWA 1V5IB 2CG8A 2RNEA 1T05A 4AG7A 1XTZA 4DUKA 1JMTA 5K8OA 5KFEA 3BSCA 2IVYA 4DQSA 4RNNA 2XMAA 2QL7B 3SJGA 3TUIC 2REEA 4ZN1A 4N5SA 1PCAA 1PILA 3CXCR 1FWKA 1BAVA 4UEFA 2ZHBA 1UA0A 4ED8A 5GAHI 1F0XA 1RE1B 2AYEA 4F2RA 2NQPA 4MHYA 1R8PA 4B6ZA 4NLPA 4OV6A 3V4MA 4C2YA 3V4IA 3TUZC 1AFIA 5HVHA 2AX0A 2X7IA 3KASA 2YNDA 3LAKA 2CPXA 4RW4A 3TA2A 3Q2SC 2FHJD 4M5JA 3TOQA 1JB0C 2JX2A 2C3YA 3C66A 3PB6X 1OO0B 1X0FA 5G1ZA 2AZ1A 2E5JA 4O23A 4WCEQ 1C4CA 2AMCB 4K3NA 5KG6A 3QJPA 4DV1J 2VQEF 4DPOA 2HVIA 4LF8J 3DLHA 4EMEA 5J1QA 2VI7A 3MECB 4ZPBA 5KOXA 3TA1A 4YQWA 1VRQC 4IYQA 3KMQA 3M9MB 1ICEB 2Z0GA 2RKIA 2WB1D 5CYJA 2IBKA 4X65J 1J5OA 2ZD1B 3VR1A 3H4QA 1UFKA 3VHQA 2B9EA 3L2NA 1XMOJ 2PRQA 5JVGQ 2YNCA 4C8YA 1EB0A 3TFYA 2UUTA 2ZE2A 5CHCB 4EO8A 1VHFA 1JLEB 1C2PA 5KFXA 1VBYA 2CG4A 3NH8A 5KFJA 2YGWA 2Q1LA 1IXKA 4KORA 3G8QA 4L3NA 2YWGA 3CCLS 1HPZA 2R7RA 1RP5A 2DXQA 3AODA 1ZH5A 3CD0A 4M95A 3EVWA 5C42A 5F8NA 2J5AA 5AG4A 3T1YJ 3CJ0A 3P96A 2PFDA 4LUBA 3PW7A 3MMBA 4WK3A 3CCSS 1HIYA 4OZ2A 2RF2A 3MM5B 2R2RA 1ZAXA 3Q8SB 3KLIA 2PJ7A 3WC0A 2JEIA 2HS0A 3W2VA 4LQ9A 5J2NA 3F73A 2KVIA 1Y5NB 4JYAJ 2A2CA 2BQRA 1KEKA 4I1TA 2B9YA 1NZAA 3KKWA 3BGLA 5HMZA 3SQGA 3SJEA 2F8EX 4OAEA 2BE9B 3D3BJ 2DHHA 1N0UA 1WTBA 2DR6A 4MIBA 4NLSA 5L9NA 3D3SA 4JOUA 3NWGA 3AH6A 3CCES 4LSLA 3G96A 4JI2J 1JLEA 3B3CA 2HQYA 1S7LA 4QOTA 3MM9B 1E6YB 4LJMA 2LXFA 2Z2LA 4GO5X 2PJ1A 2DRDA 4MHZA 2HRTA 4IQMA 4OYOA 3OL9A 2CQ4A 4CPAA 2AGQA 5AE3A 2CXEA 2R7XA 3H2LA 3SMZA 5KAKA 3M2UB 2YNCC 4B3RJ 4CGPA 4WFYA 1YVFA 5H86A 1A6LA 3Q8PB 3WZ0A 1KFSA 2R2TA 1RHJB 4IRCA 2QL9B 1OQ6A 3EVMA 3HHLB 1GEHA 1HYSA 1IR0A 1MN7A 3T1HF 2HPUA 2E1RA 1N36F 1FK9A 2W25A 4B9UA 1GXTA 3T9YA 1AA1B 2DGWA 5AXLA 1CC8A 3W63A 2DRBA 4TKTA 4ED5A 4DCPB 2MPUA 1S4EA 4ECTA 2O3DA 1Q8BA 5DETA 3NS7B 3TVYA 2FPHX 2XNQA 1S77D 1FEEA 4A4JA 2W9BA 3KLEA 1W26A 2E7WA 1YGHA 4DQPA 1BQNB 2YQ1A 3FECA 5KTAA 5D3GB 4P74A 1GAOA 4OJ1A 4CO0A 1NHUA 3N6MA 1TMJA 2FVRA 3B4MA 4GVBA 5LYFA 2BOAA 4RJVA 2Z3NA 3GG1A 2LFVA 1JLCB 1RWXB 2ATRA 2OR4A 1WKKA 3BGRA 3IXQA 2ASJA 4V1Ak 4Y49B 2FCKA 5F8GA 2M70A 3TO8A 2P6FA 4R6TA 1YLEA 4DSLA 2ZWOA 1U09A 4M3SA 3C6TA 2HEKA 5EWGA 4LREA 1K1SA 3IU2A 2HS3A 3KG4A 3GV8B 4UIAA 2LECA 1RT2B 4I6WA 3TO9A 2MQNA 4CH1A 2DK2A 5KFAA 1NK6A 1UTAA 1O6XA 9RUBA 2XGPA 1S1VA 1QAXA 4DV0F 1Y7EA 3IMQJ 1WOSA 3KHLA 2VBXA 2EK8A 2Z3OA 1OY6A 1WG4A 4OZJA 3OHAA 4ITSA 3D6MB 4NJRA 4JLYA 2KB2A 3M2VB 4O44A 5F09A 3GKRA 3CEDA 2WUUA 4B9MA 2KM8C 2ZOMA 4DV7F 4DBQA 1XK8A 3AFGA 3QAYA 2YNHA 4ECQA 1YJTA 3M6UA 2WSEC 1LWEB 3VH9A 5IQQA 1S1UB 1TKHA 2B4PA 4JI6J 4WKRA 5I0CA 1HW8A 1IQZA 1IKWA 1S10A 1YR0A 3ISNC 1YTYA 5E3AA 2CNNB 1A2ZA 1N36J 3POTA 3FF3A 2IM0A 2V5HG 5KFRA 2X51A 3T8WA 4LRAA 2VBYA 4J90A 4TU9A 1M5HA 2FHMA 3BGUA 5D0RA 3IJ3A 2DGSA 3PEIA 1U2CA 4F9UA 5JQ4A 5KG2A 1ZETA 3IAM9 4TWEA 1YBUA 2ZW4A 3AQPA 2CPIA 1N34J 2ZJRQ 2XGQA 4UEEA 2FC9A 3T1YF 2ZVIA 4NLUA 3TA0A 1VK8A 2BM0A 3R5CA 1FY7A 1ROFA 2B8QA 4DV5J 1AW0A 4WF9Q 4ONUA 5ETKA 3DDNA 1XNRF 2UV8A 5L38A 3UR0A 4QYRA 4DSKA 2X7BA 3IG1B 3PM9A 4LF5F 2BBEA 2R7HA 4EZ6A 3HLUA 3K5PA 3DOLA 5G20A 3NCRA 5GAHU 2XCPA 4GRSA 1Q8LA 4H4OA 4B3OB 3K2KA 1HEEA 4MCRA 4OHWA 1P1TA 1EHWA 5C25A 3DI6A 2ZM6J 4PZVA 2KT2A 1N88A 2CNMA 1T9TA 3IU1A 2ZEOA 1RYRA 2Y1IA 5EC4A 4A8OA 3WABA 1L3KA 3LUYA 2Z8QA 5C2GA 4YY3F 4R25A 4DR5F 1HNWJ 3VALA 2PC6A 1I6JA 5F3ZA 4CLPA 2RUSA 2H3EB 1XMQF 2MKYA 3JB9k 3HM9A 3M6VA 1YIJS 5HLFB 5HANA 4RU9A 2LXUA 2VEZA 3GIJA 4MFZA 2R9LA 3ILIA 3HMJG 1IJFB 3ITHB 4XNHB 2FDNA 2GGPA 2A6OA 3GSIA 4MXUA 4LRCA 2DNZA 1EARA 2AJFE 1JWWA 2OZUA 2KH9A 2GLFA 2Y1RI 3R6GB 1SC6A 3THTA 3RUBL 3HPOA 3G82B 3TZWA 4FF1A 4IR1A 3DM2B 3MGDA 4FKYA 4ZVGA 4O3SA 4FVCA 1WF2A 2FLPA 2E5GA 1FJEB 1VCTA 2BKOA 4LQ6A 1CULA 3HSGA 1KKHA 1J27A 2Z56B 2GFQA 4CI0B 1RT4A 4ERDA 1WEYA 4WKYA 1T03A 2CQGA 2UXDF 3R5AA 1FK9B 4OYAA 1YRXA 3OHBA 2ZNYA 3MM7B 3IFEA 4P4JA 1TQLA 3F56A 3K5NA 5DJBA 5HQLA 4PG5A 1S76D 2H1YA 3C14A 1BQXA 2HW3A 2M52A 3OFEA 5E5NA 2YWEA 4F26A 3GZ7A 3QO9B 2YWHA 4XIUA 1HNWF 3IWLA 3O2IA 1NMEB 3EGVA 2HAFA 2G4BA 1R0AB 4M5NA 2WVDA 5KG1A 2J8RA 4A31A 4B5PA 5LMNF 3OUYA 2WAQD 4X2TA 1ZG8A 5CCLA 2RMLA 1DJ0A 4GM5A 4ZOSA 4NLVA 3HLPA 4BMHA 4TQRA 4YWYA 4Y2CA 1HNZF 3SI0A 5JVHQ 1SQEA 5LRKA 1CSJA 4OYPA 3JUWA 3L95X 4KOSA 1N56A 1TL7A 2Z10A 2O4HA 3T9ZA 2YKNB 3QAUA 1S57A 4RW8B 4CYPA 3DHWC 2GO9A 3ENVA 5J2NB 3W2VB 5GMDA 4RZRA 4DR6F 2IMOA 3GFYA 4CH7A 5CBMA 3GFZA 3IRXB 4ED1A 1QLNA 1J5EF 1V9OA 3QT8A 3I9SA 4LVNP 4MFPA 2YNIB 4ZN3A 2E9TA 4K2JA 2ZELA 2QMUB 1JQGA 3M8QB 2JDCA 5KFZA 3MGJA 5C42B 1U8WA 1S6PB 4CO2A 1YZ6A 3KK2B 4KH1B 1GH8A 2BJ3A 2MZ1A 2F1FA 1FNMA 3FZBA 5M2RA 3AOAA 1HBOA 2FLNA 1Y7PA 4CLWA 3CMQA 1QDUB 3ZTPA 1S9GA 3UPFA 2FZKB 5KT4A 3AB4B 3FFIA 5KFDA 1QSTA 3QRQA 2AP6A 2JVRA 5EN1A 1RWWB 4EU0A 2N4CA 3RBDA 2QMLA 2EC2A 4JXQA 1K4JA 4NLQA 3OV7A 5LSLA 2PSWA 1QAYA 2XYPB 2E29A 3CNQP 4KLWA 1EP4A 4ZLPA 3KOAA 1UJ4A 2FZGB 2J0QD 3D7SB 3HVTA 3OVBA 3ZFVA 4X4VA 5D29A 4MKBA 3B2YA 3E01A 4KHMA 3EFAA 4OX6A 4R5PB 5KTCA 3I6PA 3TOAA 2WOMA 3CJKB 4PKDB 3M30B 1APSA 3B3WA 3GILA 4USIA 2HHHF 1LK5A 5D4PA 1PO6A 3S9LA 3CT9A 1FRJA 2YKMB 1K47A 3V5RA 1RYSA 2VBQA 5JUMA 1M1HA 1XFOA 3GQCA 2VBZA 5J1EB 4B3MJ 2VQYA 2KRBA 1B0PA 3VAIA 2OPPB 3TQEA 1SI9A 1JLFA 2AYMA 4F04B 4QQBA 3KJQB 4HHHA 3MTJA 3UCGA 2IA0A 2ADBA 4IHMA 4AD6A 2NSCA 3BS9A 3I4PA 3FYNA 2AFUA 3VVUA 4KFBB 3M8RA 3QMQA 4OQJA 2WHOA 2YQ0A 4AXVA 5F8JA 4KB7A 4U9RA 3ET6B 4P52A 1TIQA 1IOIA 1MROA 5A8RB 1QM9A 3W62A 3TCVA 2FLLA 2QFJA 3JQKA 3LO3A 5K20B 3KJNB 4OL8A 3BQ1A 3MI7X 3R1KA 2QJ3A 2QMWA 2V67A 1N33J 4LBPA 2B4BA 5E33A 2Y1JA 5HATA 5ADZA 4USWA 4K4YA 3TAMB 2GX8A 3B4DA 1VYAA 3PG9A 5LYDA 2PA3A 4H6UA 3GV7B 2M4MA 3KKFA 4U9ZA 1PJ6A 4ZJLA 4HACA 2J9DA 4NGTA 5LT5A 3AJDA 1QVFR 2HGLA 2BL1A 3VAKA 2XI3A 3EWGA 2QECA 1X4EA 1DQAA 2AKWB 2YNGA 4RUAA 1SQFA 2JBJA 2V2ZA 3V6DA 3CJQA 3PW5A 3CD7A 4DS4A 3DRPA 1YG0A 1VHEA 2XS5A 3T90A 2VKRA 3J7Z5 2VG7B 1ZLIA 4M5LA 2QX0A 1C0UA 1WOPA 3QGGA 2RDJA 4B5OA 3DOMB 3D6TB 1WHWA 3NAIA 2BMBA 4DEZA 2NPIA 3HXMA 4JBCA 4JXRA 2OEMA 4L75A 3L7PA 4H6ZA 2HKEA 3S1TA 1LAPA 4W90B 2DIUA 5DWMA 3NMAA 1VQ5S 1XJOA 4C97A 3OXLA 2CQHA 4R57A 3FMWA 4J9LA 4M85A 4KHPJ 1CPXA 1RXOB 2J0XA 5T7LA 4KPCA 5ETOA 2DXDA 5I42A 5DM6Q 2Z3LA 4BBYA 5A8KB 3CCVS 2MZJA 3N9UC 2DKOB 4QYZK 2L08A 1S9EA 3H8FA 3UN2A 5A8WB 4BBHA 1X5SA 1CS4A 3IWXA 4P2MA 2CJYB 3SSQA 5B0AA 2MKIA 2EPIA 2L48A 3EGZA 1YX0A 3JTNA 5SUHA 4USVA 3KHZA 4NA2A 4I7FA 1GMWA 2KYZA 1TXRA 1W2BR 1GQEA 1HQEB 2HHXA 5AE1A 2CVEA 3HD2A 5ISVA 1UJ5A 4ZCMA 1RA6A 2DEAA 1G7CB 3G6ES 4UF4A 2JC1A 2ZZTA 1N0VC 3IA0A 4FVMA 3BM7A 1BY9A 1K0VA 5IT0A 3A4TA 3MUTP 3PX6A 4DV6J 3D1QA 2DNOA 1KLMA 2EVZA 4FPIA 4XDCA 1TF9A 5B0DA 4NGRA 3DKDA 1LFPA 4Z7YA 2GREA 2XQCA 5FVJA 2MJUA 4P2XA 2ZW7A 4M94A 1IKXA 2W7AA 2OPSA 3MWBA 2LU2A 4USUA 2D41A 2FIWA 4NZ6A 3MXHP 4WIQA 2BANA 3AOCA 3N6LA 3ETMA 2ALZA 4UA3A 1CJVB 3MAAB 3BYRA 2WBRA 1REVB 3KFWX 1QMUA 2Q6CA 1SIWB 1H2UX 2YPZA 2MZTA 2X1GA 4CLLA 1LWXA 2K1RB 4WJBA 1NMTA 2IL4A 1HMVA 2KYXA 2OPRB 3AT1B 2OELA 2IIHA 4LF9J 4NLTA 3MM6A 2B3VA 2RC4A 5CZXA 3KNAA 3R7SB 4QIEA 3D0HE 4DR6J 2EK1A 3HHEA 4X64F 2YXLA 2V50A 3HZGA 1J4JA 2B5JB 4Q45A 3DCAA 4KHPF 4WU3A 4MY3A 2ZDPA 3VVTA 3W6XA 1RAEB 2ZXVA 1AFJA 2FZCB 1ZOTA 3W2WA 2M8HA 3ZZTA 2RU3A 4QWEA 5LXRA 1S1XA 2FD2A 3LF0A 3W5YA 2C2OB 2YH0A 2WZ1A 3EGWB 4F3QA 1LEOA 1FX2A 3D7FA 2MSSA 1NDLA 4MHPA 1WC6A 3WQPA 4KO0B 4DDFA 1SH2A 2P0WA 3OLAA 3VWSA 5B0BA 3WDOA 1CLFA 2KT3A 3OTBA 2MHNA 4I69A 4LF2A 2UVVA 2CTBA 2DGUA 3CC4S 4PWDA 3ZTOA 4C11A 3K9TA 4DV4J 2VG5A 2ZUAA 1KN6A 3JS9A 2FS5A 1PC5A 3NGRA 2HURA 4DR4F 2XHWA 4C8KA 2HRYA 1CQNA 3HHDA 3NOGA 4LIWA 2I9SA 2XYHB 1FT8A 1UPPA 2CQ3A 4M5GA 3OTOF 2XEFA 1NDKA 3GJRB 2DB1A 3D66A 3PCOB 1R3NA 2FXFA 4TVAB 5AG5A 3TX8A 1RAFB 4M5MA 3R1HA 2IA6A 4TY9A 2XS2A 1U1KA 3VQSA 1Q7LA 1KP6A 3EE3A 1C0TA 1RT6B 2EKNA 1VKCA 1CX8A 3CJ2A 1V0CA 3CCZA 4NOHA 4ETXA 2OB0A 2EXUA 4MI4A 1X5PA 1TKJA 1X4BA 1N5SA 2ZFHA 4DI6A 4WYLA 2HBRB 3W60A 2BJ9A 3A3OB 3HHNB 4G1QA 5GMEA 1S97A 2JC0A 5DDPC 1S6QA 1G6BA 3DFEA 4F4ZA 2AFWA 2YH1A 2XMKA 1S7KA 4LMZA 1DTQB 3SJXA 2Y0BB 5F0UA 1HLWA 4Q7AA 1FXLA 2QIRA 2XULA 2W7OA 3ISND 4PPDA 2BYCA 4JI6F 3OSPA 4PG8A 1LWCB 1Y7RA 3G8SA 3PRDA 5CABA 3PW0A 1TF8A 3DRSB 1F1BB 4P4FA 1LK7A 2N3LA 1OPIA 2ZWPA 3CZXA 2IC3B 4TXSA 3DMJA 3GSDA 5I3UA 3DC2A 2CPFA 1QSNA 4ICLA 3A13A 5JM6A 4NXMJ 2ZJPQ 2YNFA 1R6YA 4N8OA 4NGQA 2VKZG 2Z0ZA 3ONQA 4B9SA 1XRYA 3M32B 3SXNA 2XWYA 4ZVFA 1RO5A 4YFJA 3AD9C 4UTGA 1KHWA 2I79A 2F3JA 4WP3A 3H5ZA 2VASA 2HQGA 4AT1B 3JQMA 4CAXA 3AD8C 3BKUA 2LMIA 3K8WA 1R57A 2H54B 3FCVA 3H5SA 3TRGA 2W2MP 3V7ZA 1XIQA 1OY9A 4UW2A 4ZDNA 3JYTA 1OBRA 4NGPA 1DQ8A 4DSFA 3PZJA 4ZY0A 5J2QA 2AFMA 1HBMB 1IN0A 3OR1A 3IRWP 3Q2TC 3GJQB 2BV3A 3M1VB 1M1DA 1Z8WA 4OADA 3BYPA 3I5AA 4F4YA 2M8DB 2DNKA 4HT5A 4FS1A 5K8NA 4NSQA 4U8YA 1TFWA 1X4GA 3HZEA 3UCUP 3KLVA 1B99A 1D8ZA 2DGOA 3DU6A 1ZLHA 3MM8B 5HO4A 4HHJA 4ZCIA 3B82A 2W9CA 3IBFB 1XMQJ 3OR2B 1EQ0A 3TO6A 7CPAA 2QYGA 5HP1A 4X62J 1JLGA 4ILMA 4AXJA 2YX7A 2JFKA 3U02A 2G1DA 1VOMA 4R8FA 2KRRA 3J81j 2CF4A 1IM6A 4RBVA 3LGHA 3D8PA 2C3OA 2DH7A 3KYLA 3LODA 3OPKA 4L72B 4WFAQ 3GJTB 5DWNA 4CLTA 3EPGA 2QT7A 4KSEB 3PX4A 1WI6A 1FE4A 2VUGA 4XNHC 2GQ2A 1U02A 3G6XA 3AY0A 1NK7A 4WTYA 1TTHB 4NXMF 1HNVA 1HL6A 4IOCQ 1R6VA 3FEDA 2ZDOA 2VICA 4JI7F 2XMMA 2OFHX 1NXIA 3GJSB 1NAQA 4I67A 5K8PA 2PJ9A 5LJ3Y 2V9KA 1RT1B 1B0VA 1VRTA 2H5EA 5ETLA 1CJUB 2HB6A 4ELTA 4QBJA 1XF8A 1Z8XA 1DTTA 1R89A 1M4LA 4NZ0A 2Q7BA 2HFNA 2NR0A 1UFWA 3B6BA 2BQUA 3WT4A 1I51B 2C6CA 4J9OA 1HQUA 1HI0P 1G1XA 3AA8A 5IV0A 3D68A 1URNA 1AUSL 1PYTA 2OLWA 4J9MA 5DQHA 4JV5J 4DX7A 4RI1A 4DR3J 2W8LA 3JSMA 4JYAF 5ITHA 3NGDA 3MFHA 2KZMA 5J2MA 1LANA 3AXMA 5K8MA 3CJ5A 4B3SJ 5ETTA 3W7BA 2Z30B 1Q0NA 3OTDA 2F40A 3TARA 4HVZA 1VIOA 1SJFA 3MEEA 2RQKA 4XPDB 4G3IA 3D3CJ 3CJ4A 3UQSA 1RZMA 4NPOA 2IAJB 1FTCA 3FDSA 2H65B 3A1YG 1FT7A 2WZNA 1Z1ZA 3NFZA 2VB6A 5KFQA 5H9EJ 3EZ5A 2Z3KA 4FF3A 2YX1A 3G71S 4DQRA 1NPRA 1N5QA 2G0JA 4R7MA 2VG6B 5G22A 2WVCA 4X3RA 4GC7A 2BJ1A 2QA4S 1IU8A 4CO4A 4DR1J 1N5VA 3ZJ0A 1HNZJ 1RT7B 3T5LA 1ELOA 1SH3A 3TP2A 1UJ6A 2VONA 1MJ9A 2EFOA 1FRMA 2MZSA 3H4DA 3KUGA 2E5LJ 3RTVA 4DL0C 4PK2A 2GVZA 1N5YB 4NGMA 3PRVA 3M4XA 3TZYA 3TZXA 5KFMA 3GR0A 4EZ9A 2Y8YA 4DR1F 4UOCA 3ZNUA 4IUFA 4OI1A 3D5MA 2R7OA 5L1KA 3QIDA 4H89A 2D74B 2W01A 3DRYA 3PHTA 1JJCB 5CYMA 2JH3A 2ZBIA 2Q3PA 3TJ8A 4LFAJ 3I0SB 3KNGA 2Y1LB 3GV5B 2WONA 3R95A 1Q2YA 2QLBB 4PYAA 1XMOF 4OP4A 1NK4A 4DZ6A 4WYWA 1S49A 2HFUA 1U1MA 1UFLA 1XR7A 1C1BB 1L3UA 2J6UA 4WFZA 5CYMB 3H25A 2AJ2A 3PP9A 3S9MA 1XE4A 3M8WA 4EFAC 3KL9A 4KT0C 1B70B 4MCPA 4U7UD 2ZBCA 4P7VA 1MK4A 4H54A 4B3SF 2DT9A 2OKQA 1N54B 2C2KB 3T41A 1TKTB 1ZYQA 4LVOP 3I0RA 3IS9A 4YY3J 3D2MA 1YW4A 2I38A 2B4UA 2GVZB 2MSTA 4DUTA 4K4TA 3TQ1A 4DQQA 4ED3A 2ZH5A 2ZJQQ 1S1TA 2B4OA 1UAWA 2I3CA 2H4YB 4P2SA 1Q53A 1CC7A 5B08A 1FD2A 3JTOA 1T8EA 4QR2A 4EGLA 2JLEA 4NCGB 3MEGB 5MAOA 2V69A 1YSJA 1T7PA 2ZEMA 1NU4A 2RFHA 1O5JA 1GMVA 2CPEA 4U96A 1IYLA 5F49A 5F47A 4H4KA 3LGMA 4ENOA 3DXBA 5DLGA 2D4OA 4DX8H 3IWEA 1N32F 3EXYA 3R7NB 4Z7CA 1SC1B 3NKYA 1NDCA 1FO1A 2NLWA 3M9OB 3AXKA 4ZLNA 1LW0A 5H9FK 3X1LB 4G6VB 2Q0YA 1R8CA 2GQQA 2XEIA 2W2OP 4WU2A 1WTFA 4HH0A 3GLJA 5B0CA 3LW5C 2E5LF 4E8OA 4ZIVA 4OI4A 4KRWA 2R8IA 5IM0B 5KT3A 3T5KA 1X5TA 2OPQB 4MYTA 3PIOQ 1TL3A 1I1GA 5KTQA 3FX6A 4DLEA 3SQOP 1S0OA 3UR3C 5FLXU 4DUZJ 3HK2A 2V4JB 5GAEI 2F65A 5A2QU 1EAYC 4NEXA 1B4SA 4PG6A 2HBQB 4UQGA 4OYIA 2WPXA 2IRYA 4RBUA 2RS2A 4DR2J 2PCUA 4KSFA 2AT1B 2R8HA 2CJ9A 1NUEA 3BPDA 4Z2XA 3S6FA 4E98A 4YR3A 1TV6B 4FS2A 4RW7A 3TAQA 4UBRA 3LWLA 1QSRA 4AL7A 1NK0A 2ZBRA 1HDUA 4DUZF 1FFSB 5CCMA 2ATCB 2KFZA 2OP5A 3DDDA 4M63A 3FRYA 2OH1A 4TU7A 1RKIA 1WC1A 4MK9A 5F9LA 3NL0A 4HKQA 5DLFA 1BMQB 4MFJA 1FJCA 3PB8X 3Q0AA 1MWZA 2Q66A 2EBEA 4YB6A 5I3PA 3IGVA 2OMLA 8CPAA 2APOA 3PR5B 4NCBA 3BO2A 2B51A 3PYFA 2LQ9A 3EVOA 5KG7A 2EWBA 3R5DA 3CTRA 3DRRB 1FKOB 1R43A 4QR1A 4DV3F 2RHSB 4IG0B 3NCQA 4EYHB 4JI8J 1H73A 4UEZA 2HS4A 4L3KA 4QWBA 3T1AA 1CVJA 3W5ZA 1FRXA 5F41A 2C28A 3SEOA 1R8AA 2JOQA 4J9KA 2PE8A 4EUVA 3OL6A 1WF0A 2RRAA 1YBAA 4RKUC 4YR2A 4F9VA 2HHVA 1PIEA 3GYNA 4FD6A 2HNZB 3FJ2A 1D9AA 3NE7A 1SB6A 4ZY1A 2ZC3A 5CZVA 3PGPA 1B7FA 2LDYA 1ARLA 2EC0A 4B17A 1RAJA 2WVEA 2BUNA 3C3LA 2AGOA 1CM0A 1M44A 4Y2IA 2C2MB 5AG7A 3H8GA 4RNFA 3ZZ0A 1S0MA 1SJQA 1B7YB 4N7TA 4L89A 1VIXA 1I94J 3J80U 4Y2AA 1PKUA 2OAUA 3H5XA 1JXVA 1MMLA 1UEKA 2RB7A 3T5JA 4JP8A 3OLBA 2VPYB 3E3XA 4OHVA 3HKZD 3NE8A 3MN8A 1R31A 2OGUA 4ED7A 2BVZA 1HNIA 4IG0A 2AYBA 3GUXA 3E2EA 1FKOA 4UWJA 4MCSA 3DRRA 4U7UK 1F2GA 4NI2B 4P45A 1S0VA 2YY3A 1TKFA 4DV1F 2VQEJ 1A7GE 1SPBP 4A95A 1PG5B 1RBAA 5CNPA 2CWXA 3WC2A 2G3TA 5KT7A 3FBEA 5C7PA 4W92B 2UUAF 1SUQB 4B3RF 4A8YA 1IM4A 3SCIE 2XY5A 1SJRA 3MMAB 2PEHA 5HROB 2AFOA 2G0IA 1W2IA 1TUWA 1U26A 2BQ3A 4FD7A 2O67A 1OMSA 4Z37A 1EETB 4IG3B 4O4GB 2V63A 2YKPA 5L8RC 1DARA 3C16B 2PJAA 1M5KC 3R5BA 1VRUA 3D2PA 4RNMA 1EIYB 2AFXA 2XMVA 2UUAJ 1FXDA 5IZHA 2ALYB 3JTPA 1TV6A 5LMUJ 1CJKA 2EBJA 5B0FA 2IRUA 2FJEB 1WC3A 1MG7A 3O44A 3UWTA 2AJ1A 3EDRB 4ZKAA 4ZIWA 2Z3MA 1JLAB 4JI5J 2VFTA 4I6YA 3B3TA 4A46A 1IBKJ 1N52B 2XB2D 1IKYB 2ZH9A 2BW7A 3DYAA 4P7TA 5FLXY 2HHPA 1RBLA 1X4AA 1G4CA 4EI2A 2O53A 2MLXA 1VFJA 1Q2CA 2WRMA 1WKLA 2WVBA 1VQOS 5HMXA 2FGCA 1JLBB 2OI2A 4E2FB 2IDLA 5IM0A 4B10A 3LPEA 2J9DE 3Q22A 2V8GA 3QGHA 3ICLA 1T95A 2VFUA 3TR5A 2MB0B 2VA2A 1HBUB 3LP0A 2ILZA 2C27A 1K44A 4MFLA 5AG6A 5DQGA 3OFHA 4RNHA 4PRFA 1QD1A 4B3MF 4RUCA 1TVRA 5LRJA 3WC7A 4CQ1A 4Y3CA 1SQGA 2ARHA 1NB7A 1TL4A 4LRFA 1KUXA 2NUHA 2NMTA 1HHQA 2Q4ZA 3OXFA 1OY8A 4DJBA 4DV3J 2C1CA 5L1JA 1RAAB 2D7SA 2ZH2A 1QUPA 1GK8A 5ETMA 4GXHA 4ZHRB 1SJ3P 3GIUA 3ZTSA 4WP8A 5JH9A 4HR2A 5JXSA 4QYZJ 4H4MA 3KK3B 3W2WB 3IR6B 1MSWD 2GIQA 4LR7A 2G2ZA 1RHMB 4WWSA 2GMLA 4X4OA 1QY7A 3I96A 1IKVB 2CQBA 2HRUA 2IJNA 4LRBA 1C4AA 1VQNS 4I49A 3I0RB 2DH9A 2JNJA 2F63A 3HKWA 4JI4J 4Y0FA 1RTHA 5G0RA 3QWUA 1KQSR 5IV4A 3LP0B 5CYQA 1O51A 3IR5B 4OJGA 1FRLA 3PIPQ 2DRAA 2XEGA 2PMZD 2LP4A 2IM3A 4LRDA 3CUNA 2HWTA 4IFYA 1OWXA 1PBAA 1HMVB 2G9OA 4B08A 3W9HA 1FJGF 4KV8B 4YHHF 3EXNA 3IAS9 2PJ4A 2I8EA 1RHKB 3MR7A 4XPCA 5J1NA 1KZFA 4HDGA 4O3PA 4QCLA 3ISXA 4MKAA 3B3SA 1WHYA 2YTCA 2AWZA 4KYZA 3M8SA 4JYWA 4A37A 3H59A 1YJVA 2HBZB 2VFSA 1I5OB 1L5UA 2W4PA 4AUKA 4NF1A 4DL5A 2ACMA 1CG2A 3CO9A 4ZGYB 5EUHA 3MEDA 5FDLA 1ZZFA 2PDAA 4IH5A 4J9NA 1AYEA 2KJWA 3WX4A 3R9FA 1YWXA 4ZS6A 3ZZZA 1NE9A 2C2NA 2IDEA 3FBUA 1QSOA 1KLMB 2IVFB 1BQMA 4F02A 3ADAC 3H8YA 2XC9A 4FD5A 4LSZB 2VOOA 2J8AA 4ZHRA 2B6AA 4A2ZA 2DNGA 2L9DA 3HI9A 3O6QA 4CDIA 4K30A 3PHEA 1SBRA 1RTDB 2JL9A 7FDRA 2VG6A 5LJ5Y 3BJYA 3DNSA 1HQEA 1K9MT 2GJFA 2R1IA 1RHQB 2VC0A 2ZEJA 4TY8B 4X4QA 4OZ5A 2DEIA 1TVRB 3M9NB 2MHEA 4DV4F 4M6HA 1JJ4A 2F5GA 1IBMF 4CH0S 4BDPA 3ILLA 4HI1A 4OC0A 3TJAA 1F5CA 3HJVA 2V9WA 3T19A 1MLAA 2KXNB 4FBUA 4ECSA 1YBTA 1HWIA 3I31A 3MM8A 1G3OA 3H20A 3HO1A 2OZGA 3S9NA 3D0IE 1KONA 3CO0P 5J2MB 1KQFB 4OZ0A 4FUUA 3K5LA 3LPYA 3P45B 4FXWA 4LF4J 2VDHA 4NRTA 5DS0A 3OFFA 4WIIA 4MHNA 1T9YA 3DHXA 5HBMB 1U1QA 1D3WA 1U4BA 3AB2B 3CDXA 1NK5A 5D4LA 1UVLA 1F5BA 2VL1A 1HBMA 3DRXA 1NJZA 2LDIA 2A1BA 3HJFA 2VH7A 3UDCA 1SQHA 1TKXB 4M8LA 4X4TA 2RQCA 4J3GA 4PG7A 3OTEA 1X8DA 1BC6A 2RIJA 3C16A 3QIPB 2GHPA 3KLFA 3MCNA 1Q95G 1XERA 2BKPA 1Y3JA 3G3SA 1FKPA 4RN7A 2HIQA 2R3VA 5B7WA 4RX6A 3D7HA 1Q5VA 2V2QA 4K8RA 5J2PA 4ZX8A 2ZVSA 1R0BG 2EG1A 3OJUA 2DY9A 5HVFA 3MMAA 1X9MA 2J0WA 1X7VA 4PV6A 2DPIA 3BQ2A 2IC3A 2ZH7A 3KLGA 3AJ2A 2K7JA 5ETNA 3I82A 2AYGA 2QEXS 1BLLE 1TK8A 4DR2F 1FEHA 3QZ8A 1U0HB 1UWYA 4PWUA 1Y5IB 1YJ9S 3T9NA 4WZMA 1U0SA 4X66F 1QSSA 1T9WA 2MYFA 5HVGA 4MBUA 2ZM6F 5IC4B 4N77A 2UXDJ 4ER8A 4LF5J 5LXYA 3JSYA 1RDRA 5CYQB 2W2NP 4DPTA 3KJFB 1X4HA 4EMDA 2NSMA 2GAGC 3HF5A 4JI5F 3P5BP 1Z4EA 2CPZA 1B87A 1KHVA 2AE6A 1LNQA 4IH6A 2CDRB 3FEEA 3DLGA 2PMWA 3G2XA 1SL0A 1XNRJ 1N34F 3UDLA 2V8VA 4KH0B 3ZZOA 2EK9A 1IR1A 1LW2B 2XLKA 5ETSA 1CJTA 1WHXA 1SH0A 3SV4A 1VBKA 3U1NA 1W7WA 3DLBA 3CIZA 4X8IA 3THPA 3THVA 2XSJB 4QIWD 2F5IA 5IOLA 3L3CA 1WHVA 3FK4A 2CJXB 3VARA 3ZXWA 4TNOA 3G8TA 3K9UA 1REGX 4EEYA 2L41A 4NA1A 2UUCF 2KVQE 2QYCA 1VHOA 1OYEA 5F3TA 2QLXA 5D77A 3MCOA 4OIDA 1AZSA 1U2RA 5F8IA 2VZ9A 3KZWA 3FQLA 1FKAF 1ZTTA 2AJ4A 3NOCA 4V19X 4OYBA 3EGNA 3PRBA 1YQEA 2FT0A 1PAEX 4P4IA 2Q4YA 3M8PB 1H8LA 4P10A 2SXLA 1KQKA 1S1WB 4RW6A 4P71A 4WE1A 1JLBA 1TKZA 5EGYA 2ZKTA 4MY0A 3A8EA 3AJ1A 2QTWA 3BGFA 1FRIA 4CLSA 2LVWA 2KFYA 1JKHA 4NL5A 1IKYA 2AEFA 2W2PP 1IUJA 4J9UE 1A0OB 1RHRB 5KG3A 5BJRA 4M6GA 2XMUA 1JLAA 2FHOB 5M2PA 4K2XA 5HBMA 2UVRA 3NH5A 3DNCA 2PJ8A 3RJMB 1JLQA 1EQMA 2JEVA 1IOFA 1TL1A 4C3KA 3CGIA 2BSWA 1FVSA 2BACA 2JEFA 2M7SA 3KMSA 2QSWA 4OC5A 4RW8A 5DQIA 1KOOA 1AUGA 2GO8A 3CB4A 2Q04A 3G6VA 2ZEHA 3GFHA 1U6MA 1GX5A 2HYIB 2ZC4A 4QIFA 3CDEA 2A4NA 1N33F 3IN5A 2JBKA 3MPYA 1YQHA 1YJWS 2OIHA 3PYEA 1Q16B 2C42A 4F4AA 3WC6A 4C48A 4PXEA 5CAAA 2M3DA 3T3FA 2VG5B 3GIMA 4ID5B 4M5HA 2FHJA 4F25A 1R0AA 2WB4A 3O1LA 3PACA 3S8SA 4OKOA 3MD1A 4ZY2A 5AGEA 4URQU 4TY8A 3K59A 4OIXA 3LALA 3AHPA 4QIGA 3US5A 2HLTA 2E1AA 1HWKA 2IFXA 3UD4P 4QU7A 2RILA 4DF4A 1LWFB 3IO1A 1HARA 4OX8A 3FVLA 4LX9A 2PT0A 1U8SA 2GC8A 1HA1A 1MU2B 3RW7A 1LW2A 2JWNA 3MAHA 4QUSA 3OT9A 1T03B 3DLGB 5KFIA 2HGMA 2MKJA 3RGIA 5KFTA 2EFNA 1FESA 2YX4A 1TELA 1Q78A