2Q46A

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at5g02240
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
253
Chain Sequence
SANLPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGTSTPTKDFKALFSQVTSRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Protein At5g02240
total genus 77
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q46A00
3SBOA 1YVEI 2HQ1A 4I5DA 1DLIA 5A3VA 5JW6A 1PJLA 1A5ZA 3UFXA 3OIGA 5KCZA 2W8ZA 5B4UA 4UUNA 1NVGA 4OYRA 4D3DA 3LT1A 3HB5X 3DR3A 3I9OA 1DC4A 1LDMA 4BO6A 3TOXA 1O9BA 5DZSA 1VL6A 4KTTE 1SBYA 3V2HA 1HDGO 3FBTA 4E30A 4CMHA 2YUTA 4DYVA 3MTJA 1HKUA 3GZNB 3M2TA 1Z74A 3DZKA 4XGIA 5TQVA 2I67A 3WLFA 1UAYA 3C1TA 3PTZA 3PZBA 4R68A 9LDBA 1QSGA 5G0SA 4Q9NA 5ILOA 3DWFA 2PLAA 3W6ZA 2EKLA 4ND4A 4XZ3A 1SOVA 1DOHA 2C2YA 1OI7A 2EW2A 3DAPA 3ICCA 2EGGA 4E4YA 2PTGA 5A1TA 2D0IA 2Q45A 4ROSA 4CPDA 1Y8QA 5IXYA 4GKBA 3KV3O 3P2YA 5TRTA 3PJEA 4TSKA 3Q6IA 2D4AA 2OFPA 1YRLA 2O4CA 4J43A 1P1JA 1ISHA 4D42A 5EIOA 3TZ6A 3GUYA 1E3IA 2PKRA 4CQMA 1G0OA 4NJMA 2H9IA 2VHWA 1K0UA 3LF1A 5DBIA 5L3ZA 2X7HA 3AM5A 5T67A 1B8UA 2IYOA 4ND2A 2Y1FA 3DC2A 1KYQA 1QG6A 4IBOA 3CE6A 3GGOA 4M55A 4JBIA 1EQUA 4A26A 3DXFA 4QECA 2PV7A 1XLTA 1P74A 3O8QB 4RDIA 2NM0A 5C7LO 1HT0A 1Z7EA 1DXYA 2WM3A 1SNYA 4GX5A 1E5QA 4PLVA 1JN0A 1ARZA 4L8VA 3WGOA 1NQ5A 3PZRA 1GYPA 3RAJA 3C3XA 3JQFC 4HFMA 2NV6A 3ANMA 4ALKA 1DC3A 2DFDA 4E5MA 3GVPA 2FZWA 3H3FA 1EVJA 1YE3A 4XIYA 3LZ6A 4BNXA 2E82A 1T2DA 1VJTA 3AY3A 3H6KA 3WGYA 5A04A 1KOLA 4HKTA 2VHYA 3QJ5A 3AM3A 1T26A 4EJ6A 5HM8A 1LLUA 3FNHA 5JYEA 1E1KA 2J8ZA 4EITA 3ULKA 3RFTA 2GDZA 1NWCA 4WUVA 3SXPA 1ZCJA 3ON5A 3PRJA 1L7DA 3PXXA 3H5NA 4JK3A 4O5OA 3WXBA 1E92A 2RCYA 2QW8A 5FI3A 1W4ZA 2GZ2A 4J2OA 2Q2VA 3I6IA 1QLHA 4KQWA 2NVBA 2I99A 4TWRA 2ZQYA 2FHSA 1ZXBA 2AW5A 3I9KA 2IE0A 1DRWA 4WLEA 4DIFA 2NQTA 1ID1A 1O6ZA 4ESOA 2FPGA 2PZMA 1GPDG 5BNTA 2EW8A 4Y9DA 2VRBA 3UCXA 3D7LA 3HE3A 5LDHA 4NBWA 4E2YA 4GX0A 2X9GA 3FD8A 2PGLA 2TMDA 5BNIA 3K31A 3JQCA 2EP5A 4UUPA 4XRGA 1E3SA 1GCOA 2BFPA 4DTIA 1FF9A 2CMDA 1PGOA 1A4UA 3GNTA 5IZCA 1U2GA 2GZ1A 2EP7A 5CHEA 2JAHA 2OP1A 4MDHA 3I4CA 2EG9A 1PJBA 3D3EA 3F4BA 1WLYA 3TL2A 2PKQO 4RJTA 3WGQA 3KXDA 4FJ0A 2ZYGA 3C7CB 3KYDA 3WBBA 4MVJD 3E1KA 4I5EA 4G65A 4UVEA 3JYOA 2ZYAA 4ZRMA 5ES3A 3N58A 2JFGA 3R3JA 5DBGA 3WGHA 2O3SA 1T2FA 3GMDA 1TXGA 4MVJM 1P0CA 3G49A 4LK3A 5G4KA 1XEAA 3QP9A 2P5UA 4W7IA 1WNTA 3I9NA 4YJFA 3QWHA 2JFHA 2VYVD 1OMOA 1VJ0A 2HMTA 2YJZA 1PJSA 1U7HA 3S2GA 1HLPA 3JQ8B 3DOJA 3ADPA 2O3RA 5EESA 1M76A 1TT5A 4IQ8A 4R1SA 5CPBA 2Y0DA 4AJKA 2D1YA 1T2AA 1IHXA 1D7OA 4MKZA 5DCWA 3NKLA 5KVVA 3A4VA 1UDAA 5JNLA 4PN3A 1ISGA 4GAEA 3EGOA 3GN2A 1MGOA 3T7EA 3FCOA 3QA9A 4CV3A 1PGQA 4IINA 1ZEMA 3KEQA 5F21A 3AI3A 4CR8A 4D46A 2Y99A 3L6OO 2H1SA 5I9MA 1FDSA 3ZWVA 1I01A 3P7MA 2ZK7A 1ZSNA 2BFAA 2H6EA 2JHFA 4O63O 5CPFA 2GGSA 1ZEJA 3JD3A 5DDIP 4D0RA 5CDTA 1B8PA 4BNMA 4NJMB 2EIHA 3JQ6A 1LLQA 5KWEA 2ET6A 5JCJA 3DBHA 4NR0A 3CKYA 4QSMA 1GADO 1EFLA 2GN4A 3I83A 3OJ0A 3KO8A 1MV8A 1H93A 1NPDA 5L7YA 3M2PA 4B7UA 4WGGA 1LDYA 1VLLA 3ZHYA 2IXAA 3MZ0A 5DT9A 2E49A 4R9RA 5CG2A 1P1IA 1S7CA 3FBGA 4I08A 1AUPA 1DLJA 3G17A 3DZBA 4QO8A 4F46A 5JSFA 5CDYA 3PWSA 1B3RA 4OIMA 5JBIA 1WPQA 4GI2A 4YWJA 2HSDA 4O0LA 3MJTA 3O9ZA 1HL3A 2D3TA 4BB6A 1HRDA 5DN9A 4INAA 4CV2A 1BXGA 3NJ4A 4IJVA 3O4RA 3I6QA 2YYYA 2YHUA 1NAIA 1P3DA 1AXGA 3AY7A 3MOIA 4XJSA 4DRYA 3PDUA 4RVHA 1BG6A 2RH4A 3QVWA 3QVSA 3ZI0A 5IF3A 4DLAA 4C4OA 2VTEA 4Y8VA 2CDBA 4NFYA 1ZZEA 1PJQA 4RORA 3ONEA 1DJNA 4OQZA 1E3JA 3GN1A 4J3FA 4MO2A 2CVOA 1VL8A 1W8DA 4J1QA 4CL8A 4DBVO 1KEUA 1WVGA 3SC4A 2V7PA 1Y5RA 1IE3A 3MTGA 4WCFC 2WDZA 4YAGA 1HE2A 1R4NA 4K26A 1PWXA 3WGIA 1U1IA 4Q3EA 1I3MA 1U3UA 2NU6A 3E8XA 1XYGA 1YOVA 1PJ2A 3PHLA 3ZWXA 1PL8A 3GEDA 1DIRA 3WX0A 4A5OA 3QVXA 4I9NA 4LVCA 2JD2A 1K6JA 3FWZA 4Y6SA 1PWZA 5BT9A 4RVGA 4BNTA 2FP4A 1O8CA 4D44A 4YXFA 1LLDA 2OBNA 4CJXA 1U28A 1E1LA 5DOVA 2HAEA 3CMCO 1OAAA 1WMAA 4YA6A 4J9VA 1GUFA 3NJ8A 3VDQA 1A9YA 2ZB3A 3RUIA 3VZRA 2C7VA 4ILKA 1HF3A 1H5QA 1R4NB 3BMNA 5JC1A 4RPGA 4RF5A 4UVHA 4IPTA 2AEMA 5T57A 1UXIA 4YACA 5C7OO 3TNLA 2Z1NA 3K96A 1V6AA 4BO8A 3P2OA 4MIYA 3L4SO 2DBRA 2V6GA 5KVQA 1CF2O 4KOAA 1B14A 5KJEA 5JAMA 1H6CA 3K6JA 4NNJA 1RM5A 2BD0A 1X0VA 1R0LA 1BW9A 1J5PA 1BXZA 3FPCA 3MOGA 4JJIA 2PNFA 2PA3A 2VHZA 1KVRA 3PJDA 4PLZA 4E33A 4BL5A 1NHGA 1O95A 3LLVA 3HDJA 4G5HA 1T2CA 1KC3A 3RCBA 2GN8A 4L4XA 4KQXA 1HDCA 2JL1A 2JFFA 3WBFA 3AI1A 1VE9A 4R3WA 4A2CA 4R51A 1SC6A 2QRKA 5TGDA 4IIUA 4XR4A 1NQOA 1WW8A 4RZIA 1A9ZA 3PIDA 2BFMA 2NU7A 3DL2A 4H3VA 3Q11A 2Q50A 4YQYA 1T25A 4IXTA 2PWZA 3GGPA 3L9XA 1HDYA 2PY6A 3HJAA 4RPKA 3ZH2A 4IGEA 4IDCA 4XQCA 2GNAA 5ICSA 2CF5A 1N92A 3VVBA 3KTDA 3AOEA 4XJTA 5EMHA 5I8ZA 4NK4A 5CDUA 4Y98A 1F0YA 2P9EA 5H82A 3TFQA 1D1SA 4YEDA 5F1OA 2DTDA 2BGMA 4RLSA 4YBZA 3BA1A 1JAYA 4IM7A 1U4OA 2D8AA 4FFRA 3S1LA 4RPHA 1ULUA 5JS6A 2JD0A 3B6ZA 2NU9A 1IPFA 1UR5A 4M49A 1C1XB 4PFJA 1XQ6A 4N5MA 4PG5A 3QWBA 3ENNA 2Q3EA 3DBRA 3OA2A 1DIGA 1MC5A 1O94A 4B4OA 1FDUA 2HJSA 2EGHA 2FY8A 2ZTLA 2J5QA 2GRAA 4IJUA 1GZ6A 5MGBA 3QWAA 1HE5A 4RF4A 2DVMA 4YT8A 4TQGA 1LDGA 1IULA 3BHJA 5COAA 4OXYA 3V1UA 4DPKA 3C24A 4PGFA 4JXKA 2UUPA 2R2GA 4WNIA 3ZHZA 4FN4A 4B8ZA 4NPCA 2GN6A 2DLDA 2GO1A 3M1LA 3OH8A 2AQHA 4IUYA 3RUAA 1HDXA 3JQGB 4AICA 1Q7GA 1IPEA 3W8DA 1C14A 5JAQA 3GA0A 1FJHA 3MCVA 1X1TA 3E5MA 1E3LA 4G2NA 3JD2A 4PVCA 3ZV3A 1SPXA 1XSEA 1YKFA 4XRRA 1XG5A 2E6UX 4Q3CA 1CYDA 3I3OA 2OO5A 2XXBA 3U4HA 4BKPA 3GGGA 3DFZA 1SCUA 3UXYA 4Y67A 3EY4A 2DAPA 3AFNA 1UXGA 3PI7A 1BSVA 4ITUA 3BXXA 4BNNA 4R1NA 3Q3CA 1E7RA 3IQDB 3NGLA 1UP6A 1UXKA 3PGJA 5GZ3A 5DNAA 3HADA 4CQLB 2DFVA 4HFRA 1A27A 2VT2A 5L7TA 3FTPA 1R66A 4JP2A 1AXEA 2YHIB 4BNFA 1I3NA 4IY1A 3DBRB 3GOHA 1EUCA 3TN7A 3CZMA 4ALIA 1R15A 3GRPA 1ADGA 1F8FA 4CMIA 3K92A 5EERA 5TX7A 4XDYA 1ZIDA 4CM8B 2ZQZA 2IYPA 1OC4A 3WTBA 1U9JA 3KYCB 4NI5A 5TC4A 5CEJA 4RF2A 4ZU3A 4AVYA 2UDPA 5JCXA 1PJ4A 3LT2A 5B1YA 2IEBA 4WPGA 3B20A 5KKCA 4CM1A 4LRTB 2PR2A 3R1IA 3JQAB 3ONDA 4WOKA 4PLYA 3VH4A 5TLSA 2XF8A 2Y0EA 3ZWPA 2ZCVA 1XIVA 9LDTA 5DF1A 4QT0A 2J3HA 3L0DA 4TVOA 1N1EA 4R1UA 4LRSB 2HK9A 3AUAA 1WDMA 2J3KA 3GY0A 3PQFA 3S2EA 1VSVA 2Z95A 1MXHA 1DC5A 5L4SA 4HY3A 3UCEA 2P9CA 5IZCC 3EVTA 4N54A 1M66A 1WZEA 4XIJA 2B4RO 5DP1A 1MFPA 5HWSA 2IXBA 3UW3A 4OM8A 4Z9YA 2OOSA 4NQZA 3KM0A 2QX7A 4WK6A 2G82A 3HUDA 1LDNA 2HCTA 5JFOA 2HKIA 4W7HA 3SEFA 5KJFA 2D2IA 4GVLA 1XA0A 4CM6A 4J4BA 1GDHA 1LSSA 2FR0A 1QP8A 3DMTA 5G4LA 5KJ6A 5A3JA 1GZ4A 1TA4A 4YAJA 1DIBA 4FCCA 5AQ1A 2IZ0A 3N74A 1K2WA 1ZW1A 4GX2A 3L6EA 4XB2A 1U3WA 3LK7A 3K30A 4ZQEA 4MKRA 4DQVA 5K6AA 1TVEA 4Z3KA 1ZMOA 4U7WA 3KOUA 4R54A 2OL4A 2Q1SA 4YVFA 3DTTA 3GR6A 4YJFB 4CMCA 5B12A 4JX8A 4Y6PA 3UOGA 2FOIA 3CXRA 4UVDA 3ITKA 1MUUA 4EEXA 2B5WA 4PLFA 2FWMX 4XA8A 5JC8A 1DFHA 4IDFA 4FB5A 3FNGA 2B4QA 3PLNA 2DKNA 1GD1O 4AJPA 3AOGA 4UEKA 3DMYA 1GQQA 1N2SA 3RASA 1EVYA 3CUKA 5ICMA 4RGBA 5B4VA 5DULA 4PLHA 4MINA 5JPIA 1NVMB 3E18A 3JQGA 3VVCA 1UZNA 3DDNA 4OSOA 2DBZA 3GQVA 4ZGWA 5GMOA 4CUZA 5FEUA 4EUHA 3INGA 2WE7A 1LTHR 2A35A 4JBGA 3DZIA 5TF4A 1QMGA 3PJFA 4P4NA 5LCXA 5L4NA 1HYGA 3OQBA 5LC1A 4A27A 1XDWA 1E1MA 3H65A 2YFHA 2PZKA 4XQ9A 1PS9A 1YDEA 1ULSA 3IKVA 3MJSA 1I5RA 4M8SA 3GAZA 4CMGA 1BDMA 1C1XA 1J49A 3RSHA 1U4SA 2FR1A 4A10A 1W6UA 2NSDA 5G0WA 4K6FA 2JD1A 4IDDA 4M87A 3KB6A 4M54A 5A9TA 1EQ2A 1FK8A 1VI2A 4MVJG 4CV0A 3FWNA 1R0KA 5THKA 1QORA 4LSMA 3JQ9A 1Y9AA 4EUFA 5T5QA 3PQEA 5K6AC 4XQEA 2WYVA 3F47A 1YL6A 1M75A 2GZ3A 3ASUA 3SJUA 2O2YA 4BNKA 3WQSB 2X58A 3QRWA 2YZ7A 4YRDA 4KTVE 3KYCA 1HDRA 5JO9A 3ZN2A 1BVUA 3DAFA 1BHSA 2PGJA 2VT3A 2DU8A 2NVUA 3TWOA 2A94A 3DOCA 3EUWA 1S6YA 2NLOA 1SAYA 3HQ4O 1EVIA 1WMBA 1X1EA 4O6VA 2HRZA 3IKTA 1H9AA 4KDEA 4ALMA 4ALNA 3PVZA 3NT4A 1HLDA 5JMWA 1DRVA 1U8FO 2P68A 1D3AA 2VRCA 3PP8A 3X2FA 4RCVA 5DCUA 1DHRA 4BB5A 1N1GA 2GSDA 3ASVA 3U62A 4BNLA 1YL5A 3ZU3A 1DDOA 3L9WA 3WNQA 1VRWA 3RU7A 1ADCA 4BV8A 1A7AA 1EEHA 3OIFA 4CQMD 4Q3DA 4TRJA 1B2LA 4WASA 1PGJA 3HN7A 4EDFA 3INTA 3PLRA 5TT0A 4EEZA 5FWNA 3H9JA 4DPLA 1CIVA 3VKUA 1ZO8A 3HSKA 2GD1O 3ORFA 1GPJA 1Z73A 3KSZO 5EPOA 4EUEA 3ROQA 2H63A 1QRRA 1QXSA 2W2LD 3F4LA 1Z6ZA 3H9UA 3JQFA 5JY6A 4FPXA 5KOIA 2ZTUA 4RVSA 5ITWA 2QZZA 5BR7A 3QIVA 3ZW8A 3DFUA 3GZ4A 3UF0A 2W4QA 5F3RA 4DMMA 3HDQA 4LVUA 4QFCA 3WYBA 1HXHA 2O3TA 4J16A 1T1RA 3TDKA 3WFJA 1N9GA 1V9LA 2GPTA 3CSDA 3VZPA 1DFIA 4TKMA 4DMLA 1ZVMA 2ZKLA 4ZJUA 1U5AA 2DPHA 3BTVA 3OJEA 3WDSA 4AJJA 4YJDA 1E6UA 4Z3DA 4RF3A 4R16A 1P9LA 3G1UA 4RQTA 4U5QA 3Q9UA 4CLEA 2O4UX 4YDRA 2AMFA 2X5JO 2Y1DA 4GSKA 3F5QA 5IDWA 4E5YA 1TB4A 3NTOA 1AE1A 4BMNA 3JD1A 2ZCUA 4YAEA 2Y67A 3O03A 1JA9A 4DXHA 4EJMA 1OFGA 1HTBA 1UDBA 4Z0TA 1EBUA 1V35A 4BMSA 4FFLA 1EMDA 2JCYA 1GCUA 4BVAA 3ZWCA 2ZJ1A 5KKAA 4B7XA 2WD7A 4IDEA 1RPNA 4OJNA 4TMFA 2WE8A 4B4UA 1NM5A 3T4EA 3E82A 2WMDA 4J7XA 2CDCA 3GNSA 1QYWA 2W98A 4CUKA 2JKVA 4NHEA 1RYDA 4GMFA 3RROA 4GKVA 1Y8RA 5I7SA 1QYDA 1A4IA 2QQ5A 1C0LA 3BMOA 1VKOA 3M6IA 3ZHBA 2VHXA 4XKJA 5FI5A 3D0OA 2PK3A 4MP3A 4BS9A 4DC0A 2BELA 5JYDA 2DUUA 2Q4BA 3GMSA 1KVUA 4E2ZA 1K5HA 1EK6A 2LDXA 3LU1A 2VQ3A 4YQZA 1BVRA 4XB1A 1E7YA 4FFMA 1H2HA 3RFVA 4CMEA 5IDYA 3EYWA 1YS4A 4XQGA 3GEGA 3CMMA 3ROPA 1F14A 5L4LA 1VPDA 4PZCA 4JGBA 5GZ6A 4N7RA 4YAKA 1LX6A 4D0SA 3RFXA 2X9VA 4CL3A 3RU9A 3KSDO 3DZFA 1EDOA 2VWGA 3A9WA 4MVJH 4MVJI 4OXKA 1QV6A 4CQLA 3I9LA 4FR5A 3W8EA 1P1FA 3FF4A 4WECA 2AE1A 2DM6A 3KSUA 4R01A 1NQAO 1UAGA 4IGFA 2GR9A 4BO5A 3QVTA 4NMHA 3D4OA 1Q0QA 2VYNA 4WEQA 4L76A 5A05A 4XYLA 3IL2A 3DQPA 4NIMA 5IZ4A 5L51A 4CMBA 1GTMA 1ONNA 2PD3A 3WQRA 4BO9A 2HMVA 5JDIA 3ZWWA 2OHXA 1AHHA 5JDCC 3RUEA 1NFQA 3OETA 4BNVA 3UH1A 2WYUA 3B1KA 1U3VA 2FR8A 1NYTA 1YBMA 2JJYA 3D1LA 3ZWOA 2C29D 1ZK1A 3N7UA 3P5SA 1SO8A 4E5NA 4YPOA 1NAHA 2YHIA 3C8MA 3IJRA 3JD4A 5BSHA 2BGKA 2J6IA 4IZHA 2VZ8A 2Q2QA 4FOOA 4YAIA 2O7QA 3GAFA 1IOLA 4R5HA 1G1AA 1TEHA 4E12A 2C59A 2O3JA 1ORRA 2B83A 3AW9A 3ONFA 4D43A 4MVJE 5C3MA 4KDFA 2BMAA 2QYTA 4OHUA 1RYEA 4YT4A 1F17A 3CH6A 5ADHA 1LJ8A 4PRKA 1Z45A 2O48X 5A5EA 2F00A 3U49A 3U9LA 4L73A 4H16A 3H5AA 4PRLA 3PK0A 1UXHA 5JDCA 3FHLA 4IMRA 5KNLA 3D4NA 4KWIA 4C7KA 1R37A 3AUUA 3UVEA 1EK5A 1UDCA 5FF9A 3C1OA 2O3QA 3LLSA 1GUZA 1Y6JA 3OQ6A 5C7IO 1LU9A 1MA0A 1QYVA 2OP0A 5BSGA 1PU2A 3AJRA 3KYDB 3AU9A 1ISFA 4F6LA 4GGOA 2AEJA 3DBVO 4LMRA 1LRLA 3X2EA 3PFWO 1KVSA 4DQXA 2NUAA 4R41A 3LC7O 1YOVB 4AJOA 5G2OA 3OECA 1K89A 2FMUA 3VH3A 2ZTVA 2I9PA 4BNYA 5L7WA 1JWBB 4BGUA 2GERA 2EKPA 3RBZA 3O38A 4TRRA 1LDEA 1X7HA 3QVOA 4QTZA 4CMJA 3RBXA 5BQFA 4DUPA 2VZ9A 4E21A 2VN8A 2HMUA 2OUIA 3AU8A 3LT0A 4TRMA 3JQ9C 4W4TA 1N7GA 3WB9A 2C20A 4PVDA 7ADHA 3D3WB 1RM0A 2J5KA 4FQ8A 5G0TA 1LXCA 2EKQA 4BKQA 4HBGA 5KJ1A 1T24A 3V2UA 1ENZA 4W99A 1BXGB 3KLPX 3WWYA 1I2ZA 2DT5A 2YV1A 1ONOA 2BF7A 1G0NA 3ZWMA 1MXFA 4EJ0A 2GF2A 3UHAA 4TRNA 4W82A 4HUJA 5A9SA 1LSOA 3LVFO 1X15A 2Y1EA 1PS0A 5J23A 3TJRA 2XAAA 1B26A 1K6XA 1Y7TA 3GDOA 2C2XA 3WGZA 3VZSA 1CERA 4CM8A 3BMOB 2AG8A 3GFBA 1OOEA 3GHHA 1CETA 1I0ZA 3WWZA 2DTXA 6ADHA 2O50A 3E6AA 1QR6A 2IEDA 3JQBC 3UAGA 1DIAA 3PEFA 3OBBA 3PHGA 1E77A 4QX6A 1J4AA 1CQIA 4WLOA 3WFIA 1PJ3A 4K6CA 4FOSA 3WMXA 3ITDA 2NNLD 1XHLA 2R6JA 2V6BA 3IAHA 3O8QA 5EQFA 4B3JA 1U2DA 2VZ0A 3RIHA 1ISIA 3G0OA 1P1RA 4J1SA 3WNVA 1B16A 5EJ2A 3ROKA 4E31A 4I9UA 5G0UA 1T2EA 4FJ2A 5CG1A 3TL3A 2FPPA 3E5RA 1PZGA 1T4DA 1UH5A 3PWKA 1E7WA 3GLQA 4KZPA 5T8KC 1V8BA 1Z82A 1E6EA 3PYLA 3OM9A 4AL4A 2HRBA 4RVFA 3JTMA 1LA2A 4BKUA 4KUGA 4E2XA 2HO5A 2AA3A 1EVZA 1VSUA 3VPSA 2C07A 4ZVVA 5JXWA 4E0BA 2V6MA 1UZLA 3VZQA 3V1TC 1TT5B 1AN9A 3V1YA 3RKRA 2P4HX 1PJCA 4NBUA 4IS3A 4AJNA 3JD0A 4GQAA 5IAAA 3LT4A 3HWRA 2X22A 4ND1A 1I24A 4ID9A 4QEDA 2QG4A 2V6FA 2C5EA 3I52A 4RPJA 3F3SA 4W9NA 5IFLA 2PFGA 1P31A 4IJKA 3ADOA 1OC2A 5T8KA 5AXDA 4D45A 1V3TA 4HADA 3P19A 1KY4A 3AWDA 4XGKA 4BNIA 2ZIZA 4MPDA 1KEVA 2B69A 4DL9A 3LF2A 3WOHA 4PG7A 1SEVA 3S55A 1ENOA 3GZNA 1X7DA 3JSAA 3RC7A 3C85A 1R16A 2NADA 4DYDA 3U5TA 1HWYA 3NYWA 5CEEA 2PH5A 3E9QA 3H2SA 3VH1A 3VAZA 4LISA 2PD4A 5CAEA 1EZ4A 4LSWA 4XYMA 3OP4A 1PEDA 3ZNNA 3NGXA 5KVSA 3OJLA 4QFDA 2UAGA 3GG2A 3DHYA 1GY8A 3JCZA 3VC7A 1T1SA 3VDRA 2O2SA 5AVOA 4E5KA 1B15A 2B35A 1KC1A 1LDBA 4FJ1A 4PG4A 4E6PA 1MG5A 3TOZA 2VYVA 1EBFA 3K9QO 4DC1A 4H7PA 4DQUA 4J0EA 3AUSA 5I9LA 5EINA 4BGIA 2NU8A 5LDGA 3ZWBA 3RC2A 1M6WA 3U4CA 4L0QA 3I5MA 2J3IA 3L6DA 2E4AA 1WWKA 1H6BA 1NR1A 1RJWA 8LDHA 3DBHB 5DP2A 4AG3A 3LQFA 1Y9EA 6LDHA 3NUGA 5I7VA 4HFNA 3K5PA 5HTOA 4GL4A 3IUSA 4JN6B 1ZXLA 3CZRA 2BI8A 2CNBA 3GVCA 2CF6A 3JQAA 4BNGA 4NBVA 4DWVA 1RM3A 3L4BA 1TI7A 3FR8A 4AFNA 3DO5A 3RC9A 3C1AA 4D3SA 5I8WA 1WXDA 1MG0A 1XGKA 4DGSA 5ITVA 2I3GA 3ZU5A 3D64A 4IQ0A 1C1DB 1DJQA 1X0XA 3H9QA 1UXJA 3D4PA 1I36A 4DIBA 3JQAD 4D79A 2OXIA 1R4MB 5I7EA 4FW8A 3ETGA 3HHPA 4I8XA 3BMQA 1MC4A 1LRKA 2PGDA 3WGTA 1ZBQA 2VNAA 1JVSA 4FGWA 1DHTA 4I1IA 4EYEA 3GG9A 3HNPA 4TZKA 4J4TA 1PQPA 2F1KA 2VOEA 1IUKA 2VNSA 3JQ8A 2R00A 3R3SA 4GH5A 3BMQB 5FFFA 2IRWA 3WG9A 5JO0A 4BOYA 4DLLA 1R4MA 1B8VA 1D4FA 3PWZA 3S8MA 4R9SA 2D59A 4RQUA 2WTBA 2Q4EA 3ETEA 3GT0A 4JP3A 3L77A 4HP8A 1V3UA 3L07A 1NXQA 3M1AA 1GEGA 2DC1A 2UYYA 2PD6A 4NDNE 4Q39A 4ZQHA 3ZV4A 5A5FA 4RVUA 1KBZA 4BNUA 5A9RA 5CDGA 4MP8A 3W4JA 4OH1A 1FDTA 5EL0A 3AOEC 4KUEA 4UULA 2P2SA 4XGNA 2I6TA 4ZQGA 1C0KA 4PLPA 3ETDA 1WDLA 5KVCA 4FIZA 3H2ZA 1GAEO 4AJHA 3I1JA 3VH2A 2QIOA 1SB9A 3K73O 3FSRA 3LYLA 4LMPA 3WQQA 4LCJA 3GF4A 3QY9A 1RKXA 1DC6A 3INRA 3F46A 4Z9XA 2ZATA 1P45A 5COQA 1ZH8A 2X5OA 4WLVA 4D3FA 1A7KA 4K9DA 3TQHA 2VUUA 3O26A 5L95A 5TT1A 4HNGA 4HNHA 1DB3A 1ZNQO 4H15A 3ZV5A 2X8LA 3QQPA 5ILGA 4DBZA 2G5CA 3OEYA 4CLDA 1DSSG 3H3JA 3S2FA 3GVHA 2PKQP 1YGYA 4L4SA 1GR0A 1KY5A 2EHDA 2DBQA 3OJOA 2C82A 1M67A 1W0CA 1UZMA 3HDHA 2E48A 5HA5A 2JHGA 1VJ1A 3GEMA 4FD3A 4YJHB 4BMVA 4AJLA 1RWBA 1T4BA 2NQ8A 3QW2A 3DZJA 4II3A 4ND5A 2WEKA 1YDWA 4R4JA 5A02A 2Y1CA 3U0BA 1YH3A 4DPMA 1P33A 4WEOA 5B4TA 2UVDA 4YB8A 3BTUA 4F45A 3WSVA 2GCGA 1PZFA 2YV3A 1BDBA 3HFSA 2CVZA 2C5AA 3EMKA 1HEUA 1NR7A 2EXXA 3TPCA 1LSJA 1V3VA 1EUZA 3MJCA 1CJCA 3BMCA 1Z7BA 2G1UA 3LC1O 5H81A 3ANLA 5K0ZA 3S2IA 3ZWAA 1C0PA 4DREA 1LNQA 4Q3NA 2BI7A 3QV1A 2CUKA 2I76A 2Y05A 1DRUA 1CQJA 4XR9A 4GSLA 5F1KA 1ZKMA 4OMUA 4ZD6A 4II2A 3BHMA 3QWIA 2AHRA 3F1LA 3GPIA 5JMPA 3EDMA 1P44A 2EJWA 3TZQA 5JAIA 3CEAA 2ZB7A 4L9RA 5T64A 3ZHXA 4MOWA 4CM9A 2O7SA 5A9SB 4CM4A 2IZ1A 3HN2A 3VHRA 1YB1A 4GPD1 1H2BA 1TT7A 2GN9A 4GX1A 2X86A 3GHYA 4KP7A 3U4IA 1U7TA 5EN4A 5HBRA 3JQ7B 3KETA 4N5LA 1HYEA 4J9UE 2EEZA 1VC2A 2VUSA 3D3WA 1E0DA 5BNFA 2LDBA 3VKVA 1SMKA 2FRDA 3A06A 2YDYA 3WSWA 2Q1WA 2WD8A 4IXWA 1Y1PA 1YB4A 3GDGA 4CMIB 1N8KA 3PYMA 2D5CA 2CZCA 2CSUA 1E1NA 2IDZA 4MP6A 3TZHA 2JCVA 2A4KA 2Y1GA 3VPGA 2NACA 4OKNA 3LDHA 1XELA 3BMNB 1ISMA 3SLKA 4OXNA 2QRJA 1VL0A 3RUCA 2PZJA 1SZJG 3HFGA 1F8GA 3CPSA 4WLNA 3UN1A 3ANNA 3NAQA 3WICA 1QYCA 5ER6A 1PX0A 5A03A 4YTEA 1X13A 4CM4B 3SVTA 1QKIA 4J91A 4S3MA 1AGNA 2AQKA 2YV2A 3UCFA 1YWGO 5HRUA 4PIVA 3WJAA 3NV9A 5THQA 3OA0A 1LBEA 4YR9A 4TVBA 5I7FA 5GZ1A 1I30A 2HLPA 2OZPA 4B7CA 8ADHA 3GVIA 2WYWA 1XKQA 3DHEA 3ROMA 2ILTA 3VPXA 3NDIA 3JYPA 1JTVA 4I5FA 2RHRA 3GRKA 3DMTC 4GLLA 4DIOA 4OAQA 1P1KA 2HK7A 5CFZA 3NT5A 2NTVA 5AOVA 3BHIA 3DZHA 1OBFO 3KUXA 4Z9FA 1ZK4A 1ZJYA 2WWRA 3FPLA 2Q2WA 2RH8A 1E3WB 1DIHA 2X0JA 2W2LA 4GMGA 3RUDA 3K8ZA 1QLJA 1IY8A 1XR3A 1EDZA 2Y68A 4ZRNA 4IDGA 3W4IA 3NDRA 1YB5A 1BRMA 3IP1A 1W73A 3W4KA 1YJQA 1F12A 1JVBA 2Y93A 4WNCA 4IIVA 3MJVA 2QHXA 3BAZA 4QQRA 4J49A 4PLWA 4AJ4A 1E3WA 4B8WA 4BO3A 3NRCA 2BRUA 3VPHA 4O1MA 3OIDA 1GV0A 3DZGA 3IMFA 2EJVA 4GWKA 3B1JA 3ZU2A 4WCFB 2X0RA 4GBJA 4K28A 2E37A 4ZQBA 1JKJA 3CTMA 1JW9B 3HB4X 1ENPA 4JIGA 1D1TA 2W2KA 4WKGA 1DAPA 4J2HA 4UVIA 5TJHA 4FC7A 4CMAA 4EGFA 1I3KA 1LC0A 4CLRB 3OQ1A 4E13A 1PQWA 4XDZA 4ONEA 2WSBA 1A72A 4WLFA 5IDXA 3E9NA 1Q7CA 4NZ9A 4UEJA 1IHYA 3DTYA 3GH3A 1E6WA 1ZUD1 4CLXA 4CM9D 1KETA 1ONPA 2X0NA 3NTRA 4B4WA 1FXSA 1Y5MA 2UUOA 1V0JA 4NU6A 4D41A 2RHCA 1NBOA 4OQYA 5DOZA 2OMEA 4BHTA 1PIWA 4YRAA 3H9EO 3I4FA 4WOJA 4LN1A 4XYEA 3VTZA 4ALLA 5K9ZA 5L40A 2FZEA 1H6DA 5B37A 1I2CA 4FDAA 4U6SA 1SOWA 3JV7A 1M2WA 5CEFA 5HS4A 3Q1LA 4RVDA 5JY1A 1YQGA 1D8AA 4J4HA 2BHLA 4DVJA 2Q99A 1YL7A 4FGSA 1PL7A 1PR3A 1NQTA 2OBYA 2GUGA 2V65A 4P22A 4LW8A 5IXSA 2AQIA 2ZJ0A 4J6FA 3H9GA 4WJZA 5A4DA 3WIEA 2DQ4A 2X6TA 3AFMA 1ZK0A 4FS3A 3HG7A 1L1FA 4FFNA 1AHIA 2OGUA 1UUFA 5L9AA 2I5PO 4MIOA 3T4XA 3OICA 4NFSA 2BH9A 3OEWA 4BGEA 3MJ4A 3OMLA 2CD9A 3B1FA 3U3XA 1NPYA 1YO6A 2AXQA 3IDSA 1C0IA 4WE3A 2CFCA 4PCVA 4PLCA 4QO7A 1BGVA 4YRBA 1GUYA 1UP4A 1UJMA 2NTJA 3NTQA 3Q9NA 3SJ7A 3IOYA 3H4VA 1I2BA 2X0IA 4JCOA 1GV1A 2P91A 4ALJA 1CDOA 4NK5A 4XCVA 2Y0CA 2HUNA 1N9GB 1Q1NA 3EK2A 4BO7A 3L4BC 3KRTA 1LSUA 1YONA 4ZICA 4CLRA 1E7QA 1LQUA 2B4TO 5F5NA 2W2KB 3OFSA 1JAXA 1ML3A 3ZDFA 4UREA 1H94A 3UICA 3ZWYA 2J3JA 1NPTO 4YJHA 1KEWA 1ENYA 2X9NA 3QHAA 2H5LA 1MB4A 3FN4A 3RBVA 5U4QA 4BV9A 5EQDA 3ZNQA 4PG8A 1HE4A 1RM4A 3FRJA 4OOFA 3G79A 2VOJA 4NBRA 3ZCXA 3RKUA 3OSUA 4AJ2A 2D5AA 2NWQA 1IL0A 4B3IA 2AE2A 3BYZA 3DOOA 3RWBA 4A7PA 4P4LA 5BSEA 1Q2XA 4U6QA 2B0JA 5H83A 5KJCA 1OZAA 3SC6A 4DA9A 3HZZA 1HZZA 2GLXA 2IZZA 3FNEA 4JROA 1B7GO 2HMSA 1BMDA 2WJPA 3NT2A 3PYXA 4G81A 3V2GA 2GYYA 1NFRA 4P8RA 4UVGA 4HX5A 3AI2A 3GUCA 1EFKA 4EBFA 3OHSX 4IDBA 5IN5A 1XWFA 5KIAA 2NVUB 3WTCA 2X23A 1K3TA 4R3NA 3V5NA 4BQRA 5KTKA 4Z0PA 4MVJA 4AJ1A 1ADFA 3FI9A 4CM7A 4A0SA 3PJGA 4GWGA 4XWYA 3TZKA 3D5TA 1FMCA 3PHJA 4BIIA 3IIEA 3FTNA 2B5VA 1N5DA 4BNWA 5L45A 2Q1TA 3MJEA 1HZJA 3T7CA 1EUDA 2OORA 1IYZA 2YDXA 3I9MA 4JBHA 3G3EA 3EVNA 2VCYA 1U3TA 4O59O 1PGNA 2EERA 3CIFA 3AM4A 4L75A 1J6UA 4ZA2A 5IDQA 3IC5A 1DFGA 1IB6A 3RUFA 4UUMA 1I3LA 1ISJA 4R5MA 4YT5A 2P9GA 2J5RA 2XPCA 1E3EA 2DTEA 1ZFNA 4JQCA 3EZLA 3RI3A 3GVXA 1K6IA 2XOXA 4PLTA 3GFGA 3UUWA 3K2EA 2G0TA 1BXKA 1LUAA 3QSGA 3DAGA 3LSYA 4RO0A 2CY0A 2HU2A 3ZWNA 1ZMTA 3VPFA 4LGVA 3KBOA 5U1PA 1U5CA 3ICPA 2X4GA 1YXMA 1Y8QB 3WLEA 2VYND 2ZTMA 4FFOA 4ND3A 4W6ZA 1ZK3A 4CLHA 4JJGA 1GU7A 4FC6A 1U8XX 1G6KA 4YJGA 2VWHA 2P5YA 3Q2KA 4RV9A 1GEEA 2B36A 3KVOA 4OSPA 1VKNA 2ZB8A 3WIDA 3JYQA 4JNKA 3KHUA 4P38A 5F1PA 1PZHA 3FNFA 4B79A 1PS8A 2VUTA 4CQMB 3VTFA 3DEYX 4J90A 5DCYA 3F1KA 5JCJD 2Y1OA 3PQDA 4TKLA 1Q0HA 4WLUA 3EZYA 2R00C 1E7MA 4N5NA 4OKIA 4PG6A 3A28A 4XX0A 3KLMX 3TF5A 5TIIA 4GGPA 5CDSA 2DPGA 3VOSA 1YBAA 5IJZA 3WS7A 4U0JA 3C7AA 1HSOA 1QYXA 3ZV6A 3JYNA 1HSZA 3IS3A 4Z0HO 1P77A 4FBGA 3H5RA 4OOEA 2I65A 3JQEA 1VM6A 1KERA 1NX6A 4M86A 4AJIA 1GQ2A 4E32A 3MWEB 1ZSYA 1HDZA 1N7HA 3E9MA 4A73A 4KWHA 3UGKA 4XEHA 2FN7A 1WZIA 1NNUA 1C3VA 2I66A 4BKRA 4JJFA 3Q0EA 2CVQA 2RBEA 1JKIA 4L74A 4MVJP 4DLBA 3RVDA 3ZZNA 1Z75A 4MVJF 4Y6RA 4J1NA 1NASA 3TSCA 1LQTA 5TS3A 3JYLA 2ZYDA 3B70A 4J7CA 3NX4A 5A06A 1ZJZA 3G1TA 4J7UA 4NU5A 4YJGB 2BKAA 1XU7A 4HXYA 3EC7A 4BNJA 4PZEA 1GZ3A 1E7SA 2QYSA 1DPGA 2B37A 3BIOA 3RJ5A 1LRJA 1A71A 3DONA 1DEHA 1UP7A 1R6DA 3IUPA 4CM3A 1H9BA 4QXMA 1L7EA 3TZCA 1KEPA 3PDJA 3W6UA 4FSHA 3IP3A 4Q3BA 5MDHA 5TNXA 3QE3A 1I33A 1HYHA 4BO1A 4BGVA 1P1HA 1PTJA 4UEOA 5JDIC 4BO4A 3AY6A 3E48A 4S1VA 4J1TA 1PR9A 4LCEA 3DHNA 3A14A 2RAFA 4TZTA 4EI2A 1JKFA 1PL6A 3WYEA 5U9CA 3IJPA 1LLCA 3CINA 4URFA 3ZGYA 4RZHA 1TLTA 2JAPA 4B4VA 1YJ8A 1X7GA 1CEQA 1FDWA 2FPIA 1HETA 1M6HA 2PH3A 2RIRA 2W90A 3UKOA 5JE8A 3GC6A 3JQBA 3OF2A 4KUHA 1NP3A 3STHA 4U8GA 2HDHA 4CUJA 4ZQFA 3PFFA 3ST7A 4NG5A 4L4RA 1Y81A 2POQX 4R69A 2A92A 3RUHA 5G0VA 3C7DB 5L53A 4RPLA 3PHIA 3JQDA 5AYVA 4F6CA 1WDKA 4RL6A 5C5IA 4MIEA 1GYRA 2HJRA 3GDFA 3JQ7A 2TMGA 3LC2O 3BTOA 4CMKA 1E5LA 1ADBA 2YQ5A 2VRCD 4M89A 3RD5A 1C1DA 5JAZA 2Q46A 5G4KB 4UAGA 1MX3A 3GNQA 3TFOA 3A1NA 4EW6A 2UV8A 2EF1A 2VWPA 5FYDA 3RQSA 3I23A 4WCFA 5IG2A 4OGWA 3PGXA 3R0IA 2Z5LA 2G76A 2C54A 1KVTA 3WGGA 4FFPA 2G17A 2YQ4A 4RDHA 4EZBA 3PPIA 4OO3A 4E5PA 2FSVA 1Q0LA 2JCXA 3ZU4A 4ZHSA 5I9NA 3RC1A 3MEQA 4X54A 4GLOA 7MDHA 2BFOA 1DBVO 1JLLA 1X14A 4U0KA 4CR7A 3SLGA 1O5IA 4XYGA 4B3HA 2C0CA 1YQXA 3R6DA 5T6BA 4F3YA 4I5GA 1GFSA 1HE3A 3F6YA 2EV9A 2O23A 2P4QA 4IZIA 3W8FA 2NVWA 3NDJA 2SCUA 2NTNA 3E03A 1YQDA 5AXBA 1EE2A 3EAGA 5ENVA 1HDOA 1B3BA 1H0KA 4WCDA 4YYZA 3NEPX 1R0SA 5AXAA 1XCBA 5C37A 5GY7A 1NTOA 4N18A 4TROA 3RJ9A 4NH4A 1WP4A 2AEFA 2GASA 1GL3A 4Q3AA 1QV7A 4R1TA 3HDYA 3KZVA 3U4DA 2I3AA 3ZW9A 4XD2A 4BNHA 1J0XO 1P0FA 1YBVA 3WYCA 4CLOB 5JLAA 3KEOA 4JLWA 1DO8A 4P4GA 4Z6KA 4BNZA 3MWDB 2VTDA 1I32A 1EE9A 3DBLA 1JDJA 4GVXA 4OL9A 3AK4A 4KMSA 3ENKA 5AXCA 5IN4A 1I8TA 4E3ZA 3W1VA 5ER9A 1DAOA 1KVQA 3I9JA 4BUCA 4CODB 2VHVA 3PIIA 1MLDA 1IZ9A 3KYBA 3WMWA 1MP0A 3QLJA 3WJ7A 2C7GA 3EW7A 3ZNOA 1F06A 1XU9A 4RLHA 1MFZA 2BLLA 4IS2A 3H7AA 4NJOA 4D7AA 4HFJA 1GQYA 2QRLA 1B0AA 4PLGA 3K2BA 1O89A 2HMWA 2BGLA 1CWUA 5F5LA 3GK3A 1KIFA 2ZB4A 1JWAB 1NWHA 4MKXA 1NFFA 4IDAA 5ENDA 1PQUA 4YCAA 3D5QA 5TJ9A 4IMPA 4NBTA 3F5SA 3F9IA 2X1HA 2A9FA 1BW9B 4CM5A 3OJFA 4ZN6A 3ABIA 2VWQA 5COBA 4BQPA 2AG5A 1H6AA 3Q2IA 4NFHA 1JQBA 1JU9A 3V8BA 4M1QA 1KS9A 3PHHA 4BO0A 1XQ1A 5BSFA 1BTOA 4MJLA 3TRIA 4K1LA 1GYQA 1ZSVA 2DUWA 1FDVA 1SB8A 4UUOA 2QZ9A 4W9NC 3ZNPA 4BKOA 3U09A 3QWFA 4A03A 2EWMA 2Q1UA 2FSSA 5TSDA 4IJWA 4J0FA 4CV1A 1LC3A 1PSDA 2XXJA 4E2WA 4PZDA 4I9HA 1NVTA 1I10A 3BZUA 1PZEA 3BMCB 3EHEA 1NHWA 3FR7A 4IQGA 1BWSA 4C7JA 1SEPA 4BO2A 2IODA 3WR5A 4AJEA 4HWKA 3DBLB 2O3UA 3DB2A 2X5KO 1CRWG 2YY7A 3BTSA 1PJTA 3GPDG 2CDAA 3SX2A 1LI4A 1Y8RB 1ZK2A 2AQ8A 2HK8A 4QUKA 4CLOA 4YT2A 3AUTA 2Q49A 1PGPA 4HV4A 5DBFA 1IZ0A 4CR6A 5HS6A 2YFQA 5CP8A 4CMEC 1Q7BA 1LEHA 2PZLA 2WD7B 2YW9A 3H8VA 2Z1MA 1R12A 2Y66A 3COSA 2DBVO 4XYBA 1WAMA 1O0SA
chains in the Genus database with same CATH superfamily
3SBOA 4BVEA 4ES6A 5JXJA 5JW6A 1EGAA 1A5ZA 2BFNA 3OIGA 1O6CA 2A3NA 4CIWA 1NVGA 2Z57A 3FSGA 3ZDAA 4KQGA 4TT8A 3DW3X 3UB4A 3DR3A 3I9OA 5JZOA 2C03A 4W5QA 4LXIA 3TOXA 1O97D 1O9BA 2OECA 5KEIA 5ADVA 4WFIA 1C9DB 5E2AA 2P8SA 3CZ9A 4ND8A 3MJDA 3JALB 3CM0A 1RQNA 2WJ4A 2OMKA 2OSVA 1HNWB 5DTEA 1VGQA 2OKCA 2YUTA 4CMHA 1G21A 4DYVA 5TQVA 3M2TA 3WLFA 1DJLA 3AL2A 4XGIA 5F52A 5HQ3A 5KTPA 3N3AC 4WK4B 3IJEB 2RONA 4J76A 4R68A 3ET4A 4YRCA 5G0SA 3PNKA 5J2TA 3GLVA 3I2JA 7MHTA 2K7FA 3FI0A 1XYYA 2F4NA 1TCBA 2B2XA 1L7RA 1NVXQ 1OT5A 3DE6X 2JFPA 3OLZA 4Y18A 2BTQB 1FDOA 1KYZA 5DWDA 3SYMA 1PQ4A 2QTCA 2KBEA 1VE7A 1WZCA 4LVOA 1N6PA 1C7JA 4MS3B 2OK8A 4N65A 1QTQA 4HVTA 2FB9A 3ZJVA 1FFDA 1YUBA 4JYMA 4C0SA 2RAVA 4R2XA 1YDGA 3M89A 1T3ZA 4D9CA 4TVSA 4HBZA 2NUBA 2EOAA 2G5GX 4LIPD 4TSKA 4TZ6A 2D4AA 3SS8A 5EC8A 4ZT7A 2VPYA 1YRLA 1G7CA 5G40A 1P5FA 4JUDX 1ISHA 3TTWA 2WHEA 3PEUA 4WFJA 4EM6A 4YCMA 4BN0A 1NZFA 3GUYA 3N2NA 3UANA 1O0CA 1E3IA 2PKRA 4CQMA 1YZYA 1XZLA 4NRDA 4A6XA 2O2IA 1X9GA 3GARA 1DIOB 5JFTA 4EUSA 1K63A 3M4JA 1ZOSA 1L5HB 4JFRA 1RNLA 2X7HA 1CEXA 5L3ZA 4GO1A 4DA6A 5KCMA 5TQ2B 4LHXA 1NI5A 2QQ0A 3FROA 2Y1FA 3DC2A 4QBFA 2HPVA 1IZ8A 3KKMA 3LXMA 3GRYA 3CE6A 3G5MA 4IBOA 1JFVA 1TVCA 4RU1A 1ORHA 3H87A 3BFXA 5JNUA 3SGLA 1EQUA 4A26A 3DXFA 2UZ1B 2XUFA 3PPVA 4PONA 1Q0ZA 1SIWA 4QECA 5KQMA 1SXPA 4LRYA 5CFMA 3O8QB 3KQTA 2RGAA 4P08A 3L7NA 4EO9A 3D7KA 2J6HA 2JDIA 1WBDA 3DUFA 2V1XA 4TN1A 4TN5A 3N9IA 4V38A 3LY8A 1ZMRA 3STUA 2WTEA 2QZPA 4MHSA 3WGOA 1NQ5A 3PZRA 4JT9A 3C3XA 5LU8A 1XRQA 4XOUA 821PA 1RW4A 4MICA 3KR1A 5E95A 3AFOA 2YKGA 2FRVA 1PX2A 2FZWA 4PW0A 1RWOA 4XIYA 3LZ6A 2FSHA 1PFKA 1T2DA 1ZD9A 2HZBA 3KE8A 3QUTA 3EIXA 3MUNA 4Q9DA 1P60A 2VHYA 4HKTA 3QJ5A 4RHCA 1P7CA 5DV9A 1LLUA 4XXHA 1E1KA 1P8AA 2J8ZA 2ZYUX 2GDZA 1TKCA 1S02A 1F8UA 1XN4A 1U8ZA 1EESA 3PRJA 4JYPA 3S29A 1IXSB 1SQGA 1XZBA 4L5CA 1D2AA 2JFUA 2RCYA 1GG9A 1W4ZA 3NVDA 4J2OA 2IZ7A 3DA8A 5GOZA 2NVBA 2I99A 3V4ZA 2ZQYA 1HE8B 2FHSA 2VP4A 1JILA 1G21E 4HAWA 1XZGA 4ZAWA 4L4UA 2AW5A 1AHPA 4BGDA 2RC6A 5C1BA 1V4VA 2GK4A 3GO4A 3CVJA 1OUMA 2QN2A 2FWPA 1ID1A 4RZQA 1EM8B 1H2YA 2C88A 4ON9A 2FPGA 1GPDG 3A9RA 3CURA 3MMSA 2RSLA 3V4LA 4BB9A 5BNTA 1YTUA 5J2UB 4D0NA 2VRBA 4GP9A 3CNLA 4CF4A 4AMYA 4E2YA 1JIIA 1G5RA 1KFBB 2IP2A 2WNHA 2XI4A 3FD8A 5BNIA 2BHTA 3JQCA 3NHUA 4JBNA 4UUPA 1A69A 4G0OA 3VZDA 421PA 2BFBB 1FLNA 4N12A 4QG3A 3SEZA 2CMDA 1NUPA 3H2YA 5KSWB 3PR2B 4GE3A 1DTWB 5IZCA 1U2GA 4QLOA 1P2TA 4Y30A 3FDFA 5D6NA 2JI7A 5CHEA 2JAHA 4MDHA 2Y6UA 1RFLA 2YWGA 3UXHA 2ZDQA 3V9PA 3PR1A 5HGXA 1P9NA 1EWVA 1U7DA 1QQBA 1CT9A 1KOJA 4BN5A 3PNVA 3NVMB 4C7MA 3UK2A 5DI3A 4KGDA 3TL2A 1YNOA 5E6UB 3O95A 1V8ZA 4WERA 1Y7LA 4OATA 4XWTA 1PKEA 3ZLUA 2I71A 1QQ7A 3C7CB 3V4OA 4TV8B 4QATA 4YJ3B 3SSMA 1XALA 3L7LA 1SULA 3IELA 1TC1A 4FQ7A 1FB5A 4FX5A 3X1ZA 3M8KA 3OM8A 1Z5ZA 1RTTA 2OG2A 2BKUA 2X9LA 2RDMA 4G25A 2A6PA 4EKIA 2JFGA 1OFIA 3BIXA 4LZOA 4MR7B 3JY6A 4KLCA 1TAHA 4N47A 3DVLA 1IM8A 3GMDA 4O5AA 4Y1GA 1P0CA 1E96A 3G49A 4YFYA 3V55A 5CLFA 4LK3A 1JFSA 4LYAA 3IHWA 3AHIA 4W7IA 2ZIFA 1WNTA 2MIIA 2XHEA 3I9NA 4MS1B 3K4PA 3QX7A 2VYVD 5BUCA 5J40A 1UDXA 4BTVA 4DJFC 4YV7A 4IFBA 4D8TA 2Q3BA 1OWMA 1DX9A 1DEXA 2Q2OA 3JQ8B 5HZGA 5JSYA 1TEZA 3EXFA 3X1WA 2HWYA 1M76A 1TT5A 4OGKA 1T6YA 1JTFA 4KQHA 5CPBA 1UBLS 3HXPA 1BGXT 4AJKA 3O0DA 3VR6D 4DOMA 5AVRA 1IHXA 1D7OA 5KVVA 2WFAA 4AROA 1N9KA 3UMVA 3PFCA 3T9FA 3OE1A 8MHTA 1DX4A 3PGLA 2R47A 1R8SA 2QLLA 2FQQA 3M70A 1K7CA 3OPVA 1LW7A 3CRNA 4GAEA 3THYB 3UW3A 1YRBA 1MGOA 4H35A 3N59A 2ODNA 3NEAA 4WW0A 2YNMC 4JZKA 1W36B 4LNUA 3QA9A 4M37A 4CV3A 1G3UA 1CFZA 2WIGA 3PFGA 5DBOA 2ENUA 3PWTA 4WNYA 5F21A 2NT4A 2XCIA 3AI3A 5D6OA 4CR8A 4MRRA 4D46A 3LBAA 5K45A 2ZIXB 5I9MA 1FDSA 2G0NA 3OOEA 3E2PA 5C31A 2ACKA 3NHKA 1VKJA 2P77A 1N2GA 1ZEJA 2C2MA 3JD3A 2B4KA 2V58A 4IW3B 3Q2OA 4V02A 4BNMA 1HZZC 3W8RA 4NJMB 3G5LA 2Q4DA 3JQ6A 3N0WA 1VHWA 5AUPB 4MDFA 3EXAA 1LLQA 5LOVF 3EEIA 3VO2A 2XDQA 2JI4A 3W1WA 2DUNA 1E79D 2PL5A 3CKYA 3LC0A 2Q5EA 2GBCA 3HO1A 3L5KA 3GAAA 3KO8A 3ZJYA 2RG7A 2GSWA 1NPDA 5IS2A 3ZS9A 1OX6A 2DMRA 2JARA 3KZOA 4H7EA 2V7QD 4WGGA 4ER5A 1LDYA 5ARBA 4G6ZA 1KDPA 1R50A 2E49A 3Q15C 1KKLA 3K9NA 3KKNA 3HMKA 2AJBA 4J07A 4PS1A 3TQOA 2IPLA 4YQFA 3ROEA 4NS1A 1BS9A 3GU3A 4MPJA 4X64B 3B9QA 2HLDD 4N7BA 5MFPA 1AUQA 1QOZA 3PC3A 4QEZA 3A6HA 5JBIA 3E15A 1WPQA 4GEGA 1KDYA 1MW9X 3QKSA 5JI2E 2GN2A 2W2QA 1QX3A 3FGZA 2IHVA 2YWEA 4PNPA 1E5TA 3UK6A 3AJAA 3O9ZA 2D3TA 2D62A 2PYDA 1ETHA 1HRDA 1M8KA 3DFFA 1TGVA 1BNCA 1W29A 4INAA 4CV2A 3LI2A 4QBKA 4X1KA 1J06A 3EGXB 2YYYA 2AJDA 3PPYA 1NLMA 3LOUA 2K4MA 1TVKA 1P7WA 4XJSA 1H1TA 4UTRA 1BG6A 3QVWA 1G63A 5KX5F 2NGRA 2H5JA 2VTEA 3V8QA 1LBSA 3R6GA 1CIPA 1JHZA 4NFYA 3PDCA 4JVOA 1QWOA 2R3SA 1GDDA 1SUWA 2P0YA 1AXRA 4REMA 3V4FA 5DK6A 5CFQA 4Q03A 1XRMA 4QYWA 1VL8A 1QE5A 3A6JA 2W6CX 1P7YA 3LE8A 4KL8S 4BX2A 4CL8A 1UBJS 4B82A 1UOEA 1WVGA 1XF1A 2HEIA 5FD8A 2V7PA 3SC4A 1IE3A 1UKYA 2B8TA 2ZI3A 4EB8A 3DS8A 4Z4EA 2LV8A 2NQ2C 5IMBA 4Q02A 5IJXA 3S3TA 2D1TA 2FCAA 3SY8A 3W5IA 3Q1KA 3WGIA 1Z2DA 3WC4A 2V55B 2NU6A 1LKZA 3E8XA 3IH5A 4M0KA 4ZHQB 2DH5A 1XYGA 3PUWA 1FRVA 3RTGA 1PJ2A 3PHLA 4MYRA 1PL8A 3ZWXA 4ZKDA 5IJ9B 4XUCA 4QJBA 1ECFA 1BO6A 3WNDA 2RK6A 3OURA 4PAGA 3T3HA 1NF8A 4I9NA 3Q8MA 3ZYZA 2WJAA 4LVCA 2ZRJA 2DQYA 3O75A 4NENB 4Q9HA 5DGCA 3R6TA 1AQLA 4BNTA 5C8VA 5F2NA 4RFLA 1Z3IX 4DEYA 2C9CA 4ZOQI 4CEJB 5K6RA 4D9JA 5DN6D 2IV3A 3MMZA 2DQZA 1PZNA 1RCUA 1UBMS 1WMAA 4YA6A 3N6VA 3NJ8A 3DO8A 2FPPB 4YLGA 2XZLA 3C3YA 1T34A 1RAIA 1A9YA 2ZB3A 1OKKA 2X9QA 1E1QA 3CF4A 3HCDA 4KXVA 3RUIA 1KAMA 1Q3TA 1KDOA 3WLOA 3ZCPA 1JHQA 1KKMA 4KRYA 3ODGA 4AKSA 1Y5NA 2LIVA 1R4NB 2OKGA 3GEEA 3BMNA 4UBNA 2VJBA 1GG2A 5HIKA 1V6SA 3OMXA 1TTTA 3K8QA 2PWAA 4RPGA 1D09A 2BUBA 1IMJA 2AEMA 1VJRA 1BS2A 1KI7A 3Q72A 4HWTA 5BUSA 1TM3E 3HR4A 4YASA 3TNLA 1G8FA 3R3UA 3OF5A 2W2OA 4Y2RA 1RI3A 2IHNA 1OTXA 1EYZA 3QKUA 4BO8A 5HFJA 1K5GA 2R8ZA 4I1SA 3GLHE 3IPCA 1SIUA 3S2UA 1H85A 3K70B 4WXEA 4KOAA 1HORA 1Q3HA 1AGXA 5KJEA 4HXEB 4K9PA 2IL1A 1RM5A 1WXGA 2QTVB 1J90A 1R0LA 1TZBA 1UEIA 2OV6A 2RFLA 2DHDA 3HO6A 3D3JA 3KPJA 3MOGA 4IMIB 4RGYA 1Z2NX 2H1RA 5FIUA 2NP6A 2D2XA 2PA3A 2X1MA 4TS1A 2OCBA 1NHGA 1O95A 2V4MA 1Z6QA 4N9QA 5L6LB 3FWYA 1ZAYA 1SQ0A 4PX9A 1T9GR 1L7NA 5B58T 4GPTA 3IUYA 5IYZF 5EP2A 5DHQA 2Q8QA 4HZUB 2GNOA 3AUXA 5AJZA 4KHPB 1RR6A 2JL1A 1T2UA 2JFFA 3ID6C 3WBFA 1D9XA 2JFYA 1VE9A 4P36A 4AWBA 4C2BA 2V3WA 4R3WA 4IGIA 4MZDA 1SC6A 3EYAA 3ZIAA 1XAHA 5KB3A 1KOGA 4RZIA 4WOBA 2NU7A 3GRAA 3RRNA 2PAAA 1OAOC 1XZMA 3MB5A 5MN6A 3WLJA 1T25A 2PWZA 3GGPA 3W5DA 4CVNA 1WX1A 1UFKA 1EGMB 4FYPA 3P4XA 5DXAA 1D9ZA 1JR3A 3GAMA 2OHFA 3QF4A 3UBMA 3ZCTA 2GNAA 4Y2VA 2JA2A 3EIEA 5E6SB 3W1EA 1ZC3A 2UVPA 4KK3A 2YS7A 3JAWA 3KTDA 4F92B 4PYKA 2G9QA 4DV3B 5F7ZA 4XJTA 4D8YA 1RKQA 4NK4A 1GQSA 4M8LA 4X00A 4Q66C 5CDUA 1SN7A 4QOEA 3KPVA 1GAJA 2J67A 1NU8A 1YBFA 5AJUA 3U17A 5A0VA 3FA2A 1W5SA 4IVQA 3EXEB 2WM2A 1D1SA 10MHA 3ILVA 1HBJA 1PJRA 2H4FA 3PX3A 4JVSB 2CJYA 1MPTA 4EG7A 4D0GA 1OH5A 3ZD6A 5J5CA 4GPEA 4RHFA 2D8AA 3S1LA 1RLOA 4CWAA 3RPEA 3IGFA 5ULLA 2NU9A 1IPFA 1I51A 3FVTA 4LV8B 4P31A 4P83A 4RIGA 5ED4A 3W2EA 3QG5A 4KQIA 3QWBA 5TGTA 4FU0A 3WGLA 2NXEA 2ZJ5A 5I4CA 3DBRA 5KTOA 1XRSB 3OA2A 4JU8A 4UBIA 5FOSA 1FYDA 2OLJA 4XWGA 3ZH9B 4B4OA 4BQIA 2XEXA 1SUAA 1WD7A 3EGIA 2EGHA 2FY8A 2SCUB 3LZDA 1DDGA 2Z6UA 2GRAA 2PS1A 1GZ6A 4US1R 1UFOA 5TGZA 1H2ZA 2DVMA 4GEKA 4RQBA 2I7VA 3CR8A 1IULA 2OHHA 1YZNA 4AP9A 2ZXFA 2CFOA 3RFCA 4JXKA 3EDOA 3UQZA 4ARSA 2C7OA 2UZ0A 4OP2A 1T1IA 2M6SA 1BQ4A 5U4XA 4CTJA 1B93A 1Q16A 1ZW6A 3ME5A 1UPCA 1CUAA 2A14A 3B9PA 3M1LA 4COOA 3E1SA 2H2FA 4IUYA 3JQGB 1V11B 4PNEA 5EQJB 1KI3A 1Q7GA 2PRIA 3UAWA 4WT7A 1EFVB 1JJBA 4EA8A 1P0QA 1JSLA 3DYVA 3QBVA 2BR3A 1X1TA 1E3LA 4M1KA 3JD2A 4HLUA 3QJGA 1SPXA 1XWIA 5A4FS 4ZI7F 4KLAA 3COVA 1R6VA 3JATB 2VK8A 1O87A 2E6UX 4NH0A 2OT3B 2OO5A 2WOOA 3U4HA 1VTKA 2XKBA 1NNEA 4BKPA 4EITA 4A0FA 3HU1A 4DMGA 5EJ4A 2C3UA 3QZUA 1WSWA 4B81A 2PXAA 1UXGA 3AFNA 3I58A 3K1AA 3PI7A 1CULC 1E6CA 3OCWA 3RRZA 3DE7X 4C0HA 3JU3A 2P9ZA 1H23A 3Q3CA 1E7RA 1G291 3IQDB 3BB3A 3K7EA 1U80A 2FPMA 4ZZ2A 3PGJA 1UXKA 5GZ3A 2C2OA 3K1JA 2JCSA 2RGYA 6PFKA 1E62A 1Y1QA 5ANRB 3HADA 1FZQA 3MMPA 4AECA 2XF2A 2CLLB 2DFVA 3TTTA 5L3QA 4I1VA 5JADA 2O2XA 1R66A 1AXEA 1CD5A 1Y9ZA 4QYIB 2CXXA 2WHRA 2YWDA 1B0ZA 5LQJA 3BIFA 3HFRA 1NVKA 1U8UA 4WBNB 1ZWKA 3WL8A 1R15A 5JTUA 1OLSB 5AFSA 1RC0A 3AR8A 4NU0A 4O4IB 1Y7IA 5EERA 1NMZA 3COWA 4ZREA 4EI9A 2QLJA 1C1YA 2X77A 4RAOA 5K0NA 2QX6A 4MYSA 4OHCA 4RF2A 1PZMA 2OV4A 4ZU3A 1IIBA 2UYCA 1HT2E 3LT2A 2F3RA 4ZDJA 2IEBA 2J4FA 3EIFA 4PXAA 3FLAA 3RSOA 1FYEA 1ZI9A 4QEKA 2AFVA 3ZCQA 3AIOA 4LRTB 2PR2A 4Q19A 1JSRA 4Z0NA 3AJDA 5FQOA 3JQAB 1Z8NA 3NMUF 4WOKA 3VH4A 1EFUA 3QPCA 2CXOA 3U4QB 4NAUA 2ZCVA 1QHNA 1XIVA 4EB3A 3L0DA 2QGZA 4TVOA 3TZBA 1N1EA 5JXHA 4R1UA 3BWMA 3H2IA 4OHXA 3JRXA 4WL0A 2G08A 3PQFA 3TRJA 4DHEA 4X7RA 1VSVA 1USIA 2FVXA 3TG8A 1X1QA 3MXTA 1Y6QA 4TYQA 1RWMA 2XCQA 2FUCA 4O2LA 4RABA 4ROTA 3VR2D 2P9CA 3E3LA 1P73A 4OXXA 4KFUA 3DWGA 2QMYA 4KAXA 4BC1A 2B4RO 2G9RA 4IIBA 2CLKB 3C41J 3DV0A 3G13A 3IVXA 4Q15A 4FYIA 4FN5A 3QA3E 3HJUA 4Z9YA 1CR0A 2WICA 2JVKA 2VJLA 2FX3A 4FDUA 3QVGA 1P9RA 2PIAA 1V1RA 5IVPA 2QX7A 2H2DA 2H29A 4WK6A 4I14A 4IHJB 1X8JA 3HI4A 3HABA 3HUDA 2RMKA 2HCTA 1L5GB 3RS0A 5JFOA 1XP5A 2HKIA 4DZTA 3DLCA 3K9BA 2P35A 1XA0A 1V43A 3ILXA 4F4DA 5KNCA 5G4LA 1QP8A 2B7BA 3JAMA 3LUKA 4DXAA 1KY3A 1PW7A 1TA4A 3FWHA 4RNCA 4FCCA 1P1CA 4J3JA 2IZ0A 4DLSA 2GM9A 1CF9A 1D6MA 3T61A 1YHZA 4LZLA 4LY9A 2O14A 2Y2UA 4Y9SA 5JAUA 1NQXA 2R1TB 3QHPA 5F77A 1EX6A 3L6EA 2JLXA 4XB2A 3MCTA 1BE6A 1YI8A 2QB5A 3GJ5A 3GL9A 1ZC4A 3K30A 3R0ZA 4KPFC 3PXDA 3CVOA 3ZVMA 2OL4A 3O4IA 4YVFA 2ERCA 5DHUA 5KOHA 2VUIB 5CBPB 1GTVA 3ANSA 2R6AA 4HC4A 2QTLA 1XVTA 5B1IA 4QM7A 3ABOB 4DM3A 2FOIA 3NTLA 1KPIA 3CXRA 3O31A 4AX4A 5EP4A 2H52A 1G64A 1YHYA 2VSYA 4HNAB 2EAUA 1KXJA 2G7ZA 1X1RA 2CBGA 3ZBPA 1QV9A 4OHRA 2FWMX 5JC8A 1OXMA 4DDKA 3IBGA 1O96A 1SK9A 3A6FA 3H2KA 3KQYA 3NNDA 2B4QA 3PLNA 4GUDA 4CIVA 1C7FA 1C9MA 3QVUA 1GD1O 3ET5A 4QJ4A 1OJLA 1N2SA 1OLUB 4OFWA 2XCLA 2YX1A 4TUYF 5BWNA 4PLHA 5E7QA 3C5EA 4CEIB 1II9A 3O2QB 1L5YA 2ZBUA 3PGMA 5JPIA 3E18A 2WJ6A 3JR7A 3DDNA 3L6BA 4LHEA 4TTVA 4AURA 2X0EA 2AOTB 4OJKA 4OSOA 1KP9A 2XBUA 4WXHA 1ZJWA 1JG2A 3GQVA 4ZGWA 5M5BA 5JCZA 5FEUA 2ZWVA 2QVLA 1LTHR 4F9TA 4FFDA 3DZIA 5K6TA 4CGYA 5LCXA 3NBXX 5REQB 5SZJA 3ZGXA 4FHCA 1A76A 1EE1A 2GZMA 1BE0A 2YV4A 4A27A 5J4HA 4ZIRA 1E1MA 4G1BA 2YFHA 4BE4A 1NVVQ 2GFQA 3SK0A 4C78A 4XQ9A 1H1LB 5JECA 3AYZB 3IKVA 3MJSA 4BECA 3GAZA 3I05A 1O5OA 3QW4B 1G8MA 3LL7A 1GTJ1 2WNSA 2JLCA 4KNWA 1N2CE 3GPLA 2R11A 3ND6A 3DLHA 5ALHA 2NSDA 3HH8A 3LUHA 3EUEA 5A9TA 1RJGA 4ZQIA 1VI2A 2DECA 3M6FA 4MVJG 5HJ2A 3UK0A 2A1UA 3FWNA 1R0KA 3GWZA 3S4YA 1H0HA 1U2SA 3BREA 4WA8A 3V1NA 1WXXA 2HLDA 3WHKA 3G5TA 1NNLA 1NW6A 1UPFA 2R44A 5BV8A 5KYKA 1CX9B 1ZI6A 1YL6A 2GZ3A 3GUZA 4MUMA 2Q8PA 4P86A 2O2YA 3Q3JB 4IOLA 2O0JA 1T0BA 2C04A 3QBTA 5A03A 4CEHA 1ONBA 4FGUA 2E21A 2VIIA 4KTVE 2C96A 4C0JA 3BB4A 3GLGE 3N6RA 4YRTA 3ICWA 1IQPA 2ECPA 1Y1RA 2PGJA 3LBIA 4MCHA 4KOEC 2DU8A 2HGZA 2O57A 2XMSA 1EGVB 1CUBA 1KMHB 2A78A 3DOCA 5G02A 1S6YA 2NLOA 3KQWA 2ISSD 3K16A 3A1WA 1E4OA 2PFSA 3KVNA 2C9ZA 3UMMA 1WMBA 2B94A 2NIPA 3KB1A 1NNI1 1HA3A 5CURA 5B58C 1INLA 1IH8A 1QGYA 2J9RA 2IW3A 2EW1A 4F3KA 4KDEA 5IULC 3BL8A 1SURA 2XQKA 4QGFA 5DJ5A 2YZMA 2HM7A 4G85A 4ALNA 4AF6A 3RVJA 4CTKA 1M0EA 5JMWA 5IC4A 1U8FO 2VRCA 2Q6KA 3GBVA 3KCNA 2F3UA 5CVCA 1USWA 4YMTA 3U4QA 1TKRA 1DHRA 3U39A 3FCSB 4BB5A 4BP1A 1VHTA 1KNXA 1OY1A 3IAM6 4BNLA 1YL5A 2VK2A 2HTFA 5K4AA 3IE1A 1WUJS 4BV8A 4M0MA 1EEHA 3OIFA 1ZU4A 4LQLA 4X84A 5KBYA 3JX9A 3HN6A 4QXRA 4ZAXA 1T3LA 4TRJA 3H7IA 1XVLA 1Y3IA 5KYXB 3AFGA 5BOSB 3HN7A 4EDFA 3INTA 4TLAA 2LPMA 1XLTC 3RG8A 5TT0A 3KT3A 1HFJA 3WIVA 1T9CA 1FZTA 1AB6A 3MUOA 1I2DA 3CBGA 2EWVA 1OE0A 3H9JA 5MGBA 3IAUA 3I4LA 5BW5A 4WBNA 5FXMA 2AYYA 1ZO8A 4OK3A 1GPJA 1Z73A 2ACVA 2H63A 2WD9A 1T3TA 3WK6A 2P3QA 1SKAA 2H4WA 3H9UA 2G8LA 2WK1A 2PM8A 4H59A 1ND6A 2R8YA 4FPXA 5AH0A 4RVSA 3LJKA 4Q4AB 3C4JA 3U4AA 4PR0A 1UKAA 2W2TA 3I1YA 3K09A 5B1DA 5C8ZA 5JISA 2O8EA 3DFUA 3RF7A 4NECA 4UMDA 5F3RA 4HGNA 3RUPA 3WYBA 4LQDA 1HXHA 2O3TA 2NSLA 3B6JA 1Z4JA 4J16A 5I45A 1N9GA 2GPTA 3I53A 1QQTA 5FPQA 4BYMA 5DMXA 4I4IA 3VPAA 3BXPA 3PUHA 4JJKA 1DFIA 4TKMA 1BDHA 2GM3A 2QLMA 2ZKLA 1EXDA 2X3YA 721PA 2DPHA 3BTVA 3OTWA 1XMPA 1KH3A 3MS7A 1E6UA 1SY7A 4LHWA 5LUAA 3K6SA 3AJEA 3OKCA 1G16A 4X6LA 5E2IA 1YVUA 5C52B 2IQ5A 2NYRA 4M9ZA 4R16A 4U5QA 1IJKA 1GRNA 3FFXA 1PN3A 2DSNA 2F59A 2I4MA 4ZYLA 4XX1A 5GONA 2PUGA 1KFJB 2X5JO 2QX8A 2Y1DA 3F5QA 4GSKA 4WESA 3M4YA 4WZZA 1X8XA 1TM1E 1OI2A 2WU8A 5IDWA 3FNIA 3G9UA 4MPTA 4UFOA 4JI3B 4N3BA 4DFDA 4DDTA 2YRFA 2ZCUA 5CA1A 1NJGA 2PUHA 4I6GA 1C7RA 1G2QA 1OFGA 1ZWLA 3RRBA 4EJMA 3WIOA 3DAHA 4Z9AA 5C51B 4GZMA 4IWXA 1G20A 1V35A 4FFLA 1EMDA 1ESCA 4UU8A 1AGRA 3JVIA 4YAUA 4BVAA 3G68A 4L3OA 3ZWCA 2ZJ1A 3B5IA 4WK0B 3FYUB 3M6UA 1RPNA 1T5BA 1U0EA 2WE8A 4XASA 1QAOA 4Y6OA 1Z2PX 1DBWA 1NM5A 1SKYB 1XMXA 3T4EA 4E5UA 1UK8A 1XRJA 4DM7A 2RAUA 3SHQA 3MWYW 3K53A 2JKVA 3AWIA 4WDQA 4A8JB 4NHEA 4FVTA 5DBHX 1OYVA 3UHJA 3EN0A 2OCGA 2VBCA 3ER8A 2EG5A 4UHEA 3I62A 5EEGA 3IMCA 1H66A 4E4RA 5JAHA 1VKOA 4KXLA 1Z5GA 2VHXA 3O73A 4G9EA 3GROA 1TLFA 3QVGB 2PK3A 4Q1VA 4BS9A 2JGFA 4PBTA 4DC0A 3CFYA 3BM5A 3I61A 3NU1A 4ZDWA 3GMSA 5JYDA 4QDTA 2R7KA 5C1PA 3EXEA 4OLBA 1K5HA 4KH1A 3MWKA 1EK6A 2LDXA 2PUEA 3LU1A 4YQZA 1BVRA 3LPDA 1XAJA 5A3SA 1ATIA 4EX6A 1H2HA 3DM5A 3N0TA 5FNVB 3A4YA 1YS4A 4G8JA 1IG3A 3VR4A 5EQTA 5L4LA 4KLZA 1ZD4A 3UAVA 2IH2A 1L7PA 3AEYA 4D0SA 1XCOA 3KAKA 2O1XA 2IH4A 2FF7A 1QRSA 2X9VA 2VHJA 4GT1A 1U9IC 3KSDO 4OXKA 1H8HD 3A9WA 4MVJI 1YF3A 2OCLA 4MUIA 2A7QA 3FF4A 4WECA 4MUYA 5FNZA 5GP1A 3W5VA 4R01A 1UAGA 3KDAA 4R31A 4URYR 4IGFA 4CDNA 5A05A 4D5GA 3R7FA 4B6FA 1AQYA 1EDEA 4NIMA 4D56A 4GOOD 4V0QA 3SOZA 2EWWA 4EWLA 4L8GA 1ECPA 4YUZA 3R4VA 1ONNA 3WQRA 5B55A 4HDNA 1V16B 1KJ8A 2VJCA 2CMFA 3F8WA 4JLUA 2QG6A 3RLIA 5JDCC 4AQDA 5HPYB 3B2QA 3GLIA 4L0CA 1MO5A 3IQGX 3T3DA 3B1KA 2UYHA 4GD3Q 3HVIA 2FR8A 5I8PA 2JJYA 4LJKA 2LTAA 1DUSA 1ZK1A 2PMBA 5LYJA 4EQ6B 2AOVA 2HN9A 4E5NA 2ZYIA 1LD3A 4XWAA 3VKWA 3C8MA 4G4IA 1KO7A 1DAMA 3LY5A 1PJZA 3IB6A 3WK7A 5BSHA 3UJNA 3T7TA 3QBDA 3FFWA 4ER0A 3EVFA 4E94A 2XSZA 4NYJQ 4Y9UA 3CUUA 1AQIA 4N8DA 4RKEA 2C59A 1J5XA 3SBEA 2B83A 3ONFA 2NPIA 3DOIA 3HB1A 4R8KA 3AXSA 3ASZA 1K7YA 4JYZA 3RIYA 4OHUA 2MSEB 2RHHA 3TD9A 1F17A 3A6LA 4G1CA 3ORQA 5ADHA 1MO2A 2V7TA 2O48X 4PRKA 1Z5PA 4CKEA 1C3OB 4H16A 3PK0A 5JDCA 2WF7A 5JQWA 1VYTA 3D4NA 4C7KA 1U3DA 1R37A 1KAHA 2D2VA 3AUUA 4XCQA 2HDOA 5FF9A 2R2AA 3H8SA 2E0IA 2VT6A 3LLSA 4R84A 4V24A 3OQ6A 3OX2A 2CWWA 4MGZR 3KZCA 3PNSA 1RQLA 4EHAA 5C7IO 3QYAA 4INPA 3KT8A 2PJDA 4O2AB 5GVRA 1SD5A 3KYDB 4WVLA 2C2ZA 4B45A 4BVJA 5KSOA 1BFKA 1ISFA 1ZUNB 2HJHA 4UM8B 4M4SA 1DKLA 1FNBA 3L7AA 2AEJA 1RRGA 2WIKA 3NYRA 3QQ5A 3QX9A 3IO5A 4HX9A 4PTLA 1G9SA 4XLLA 2FWJA 3F49S 3QX3A 1QVRA 2Q4TA 2WAYA 3DBVO 1IATA 1LRLA 4LMRA 3X2EA 3PFWO 4EARA 2FSIA 2YN0A 3BWCA 5KOJB 1ECGA 1WXIA 2Q6VA 2ETXA 2XIQA 3PICA 5CUQA 4BJ6A 3H16A 1K89A 2PX2A 2NU6B 3AF4A 3HBLA 3NR2A 4ZHQA 4OAOA 5IPFA 2G70A 1NVEA 3BE8A 4BNYA 1KZGB 5L7WA 3HI6A 5CVVA 3TW0A 1JWBB 4AY4A 1UOOA 1LK5A 3GJ8A 4EHFA 4BGUA 1BJTA 1PLLA 3O38A 5DM2A 1UOPA 4C14A 3P4UA 5IKEA 1IY9A 2X14A 2WAMA 4FCTA 1S1CA 3RBXA 3WB0A 3WRWA 3MTAA 4NU8X 1Z0JA 4UU1A 5CHYA 4I3HA 3ZE2B 3LT0A 3JQ9C 4UZSA 5TPZD 1W7AA 1ZVJA 3LUPA 4RIIA 2ZS8A 2AN9A 2C20A 3WJ2A 5AW1A 4DV6B 2NU9B 4EAAA 1S3FA 2HDWA 7ADHA 5F9HA 3W3ZB 5KMGB 1QF9A 5CCEA 3D3WB 1RM0A 3UB2A 1IQRA 1TVKB 2QRUA 4HOYA 3OQOA 1CNEA 2EKQA 2YXPX 2JLUA 4EELA 5KSZA 3EGXA 4LWZA 2I7TA 2MWMA 3K1ZA 4UOQA 2GZDA 3WWYA 2YV1A 4K9LA 4AZSA 1TECE 1G0NA 2BF7A 1IXRC 3CTPA 1XKXA 3JZMA 3PPWA 4U7TB 1DZIA 4EJ0A 3CUYA 3UHAA 4HS4A 1GNPA 1E89A 4UUQA 1XTKA 3EODA 1Q17A 2HREA 3LVFO 2OSBA 2PANA 2Y1EA 3R5HA 1AF7A 1B26A 1CQZA 1K6XA 1K8ZB 2MMGA 3VDXA 3ZHRA 1MABA 1MB9A 3LBNA 2C2XA 2ZR7A 4GBED 1V5GA 4NCIA 3WGZA 1CERA 2I6UA 4F04A 2GBGA 4A92A 4CM8A 2Z4SA 5JH7F 1QYIA 3NH9A 2AG8A 1KPGA 1L4NA 1OOEA 1CETA 3EVCA 3EWNA 3GHHA 1WS6A 3WWZA 1ZOIA 1ES9A 1KH1A 1M34B 2Z5GA 2VP0A 2O50A 6ADHA 1IG0A 2VJQA 5C53B 3E6AA 1KOFA 4YP6A 1LPPA 2IEDA 5A5VA 3EX7C 3KEFA 4MKFA 1PR4A 1UMDA 2XE7A 5JBNA 1L4GA 4Z1MD 1DIAA 4ECEA 3IHTA 3VR3A 1J4AA 4WLOA 5D01A 3DMNA 1BGWA 3QEJA 3ITDA 3CX8A 3R77A 4FOSA 4JEUA 1XHLA 4RKYA 4XIFA 2VCEA 3CLKA 1T10A 3I73A 4PO8A 4KXWA 1U2DA 1J99A 3KJIA 3G0OA 1P1RA 3ROKA 4E31A 2ONCA 1SKBA 2I4OA 3HZHA 5LLTA 4HJRA 5B30A 4B9AA 1M74A 1YCDA 2WI8A 4R1MA 2Z04A 5LMZA 3FYTA 1RT9A 4KQKA 5DH9A 1UH5A 2ECFA 1E7WA 3J81k 1XE3A 3UIEA 1V8BA 2A9RA 4LXYA 3TD2A 1TIPA 2V6JA 1NW7A 4G56A 2QUHA 3U7QA 3O0TA 5DW0A 3EIUA 3QEKA 5EZYF 1OLXB 2HRBA 4JLDA 2WSMA 3JTMA 3GNLA 1CZNA 4RVFA 3RJMA 2Y0PA 3G9TA 2YINC 3K15A 3PHCA 5DBEX 3RO7A 2V0NA 2BM0A 3OEHD 4OHZA 3QEMB 3FDJA 1JQDA 1QFSA 2AW3A 4IRUB 5BN1A 5I4BA 1EK2A 4PTZA 3OCVA 1L4YA 4LOLA 4M1WA 1TFUA 2V6MA 2VYFA 3PNBA 4QARA 4DS3A 3ZGNA 2J5BA 1G8KA 3U7HB 3VZQA 3V1TC 2QTNA 1TT5B 3O8BA 5DTIA 4MRPA 1OIVA 4JBWA 4U9IS 4IS3A 3UUFA 3KOYA 4AJNA 3HXMA 4COKA 1FFWA 3K3PA 5ECDA 6REQB 4PZYA 1UBUS 5CB8A 2X22A 1BAPA 2AZMA 4D3YA 3ETJA 1KI8A 2V6FA 1UFQA 3I52A 4RPJA 4Y0AA 1NN0A 1Y8ZA 3CLHA 4IJKA 4N8SA 3V2IA 1FUIA 1JR3D 4R8LA 1JIUA 1C3JA 2Y9MB 3G9XA 4D45A 4XGKA 4MUKA 4BNIA 2O8EB 3NHJA 1D5CA 4MPDA 5FB3A 5EE0A 1X77A 1KWKA 3PRYA 4PG7A 2IXFA 3GZNA 1X7DA 3JSAA 3WGUA 4B6SA 1RVV1 1Z17A 3C85A 3SC3A 4DYDA 1P2FA 3T15A 4NZNA 4UU0A 3QMWA 2AD5A 2RARA 2BP7B 2ORED 4LISA 3FPGA 4ITVA 2OC9A 2CJWB 3OP4A 1PEDA 3GFQA 1EFPA 3NGXA 1O3YA 1GFIA 1N4DA 3E3MA 3OJLA 5KVSA 4OQFA 2IS4A 5FUBA 1S9DA 3IKTA 2Z8YA 4H7JA 3JCZA 2IIQA 3D1JA 4IHKA 1O95D 5BQXA 3R24A 2G7MC 5CGQB 5AVOA 1XXHB 1MAVA 1DRKA 1KC1A 5JNRA 1OIWA 3NM6B 3NO4A 3TOZA 3K9QO 4ZK6A 1BMTA 4NV1A 2BZGA 4QBGB 2QXUA 4DILA 1F5SA 2PS0A 3IPRA 1XCJA 2VBGA 4YAFA 5GAJA 4RTSA 4YI5A 2XUKA 1QC5A 4FFWA 1YASA 2C8LA 1M6WA 1T43A 4WZ6A 1OFUA 1YTLA 2CHEA 3U4CA 4JJ4A 2XWQA 4XM2A 4BMPB 4O4HB 2E4AA 5J1SB 1KO8A 3D6HA 4ENUA 3DBHB 5DP2A 3CR3C 3SZMA 3G2IA 3LQFA 1SG6A 2QT0A 3NUGA 4V3CA 4FFVA 4HFNA 3K5PA 5HTOA 4GL4A 3VAAA 5HX7A 1CRPA 3F7TA 2PS9A 3RTEA 2L82A 1ZQ1A 5AP9A 3C3WA 3GVCA 1W2HA 2CF6A 1NBME 2XUOA 2JF0A 2Y2VA 3EEBA 4XGQA 4JJAA 1MV5A 5IKOA 2F4VB 4XPZA 1XRLA 3DO5A 2WJZB 1ZY2A 2R4UA 3RC9A 2VSOA 3M3HA 3TTXA 4EMUA 3K0SA 1RJ9B 3QUCA 1MG0A 1XTJA 4J0CA 5LB4A 3HBAA 3OCCA 1NXOA 3D64A 3DE4X 1QBGA 3AP1A 2EX0A 1X0XA 1RD4A 1Z4IA 2A9QA 3P0HA 1PBNA 3QITA 1R4MB 1FUKA 3P52A 4G0XA 1EUCB 1GHTA 4EI7A 3ER9A 5K3SA 3FJOA 4G2TA 2QN9A 1UT5A 3BMQA 3PE4A 1LX7A 3WGTA 1X80A 2HPAA 1ECJA 3GJ0A 4FGWA 1KIAA 2VAPA 1DHTA 2JH9A 3CZ5A 5AVZA 1Q1BA 2NO0A 4TZKA 3HNPA 4RELA 2CE2X 1PQPA 1W96A 3ROGA 4LUCA 4KNVA 1H2WA 2WY2D 3UC5A 1X80B 3VNVA 2H1VA 1NVVR 3BMQB 1MA3A 1QH9A 3D4LA 5FFFA 1I5OA 2IRWA 5JO0A 1IAVA 3WY9A 1R4MA 4DLLA 3PWZA 1E9EA 1OFHA 2QK4A 3E22A 3NIDB 1T9DA 3OJXA 4R9SA 4RQUA 3CWQA 2G25A 3I6ZA 2HA4A 3ETEA 5KWJA 3T0GA 4F72A 4JP3A 5LQUA 1Y89A 1E2IA 1M5TA 1V3UA 2ZYRA 2B98A 2HYIC 4YXWD 1Z5UA 5CYOA 3N75A 1RJ9A 1Y42X 4IOKA 4I50F 4DQKA 5DEOA 5HKKA 2GK3A 3DHWC 1F6DA 5M3BA 4BRWA 5EWLB 1UQRA 4HJXA 1ZGGA 3CPHA 3B6KA 4MP8A 4M36A 5TQ2A 5AO9A 5BORA 1NM5C 5EL0A 3HJFA 2GFIA 4YP7A 4GKAA 4UULA 4EG1A 2N42A 1QUEA 2C4KA 2KE5A 2P5TB 4EHBA 1WDLA 4GI5A 2Y3IA 4F5DA 3G2QA 3H2ZA 2FP4B 3CW2A 2Z98A 3LYLA 3OD5A 4CIYA 4O4HA 3A4MA 2ZU0C 1CR6A 3K9WA 4LI3X 1QNLA 1SBNE 3FGNA