2Q46A

Ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at5g02240
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
253
structure length
253
Chain Sequence
SANLPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGTSTPTKDFKALFSQVTSRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Protein At5g02240
total genus 77
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q46A00
1WWKA 3HHPA 1NQOA 4XJSA 2VNAA 3H5NA 2B35A 2W90A 1T2EA 3JYPA 4WKGA 3VZQA 3E03A 3VPSA 4G2NA 1G0NA 2D2IA 4YJHB 5DCWA 5U1PA 1JDJA 1WLYA 2ZIZA 3PP8A 3LC1O 4XYGA 1SMKA 3OECA 1QG6A 4MVJA 4O5OA 3WLEA 1VKOA 2OMEA 3WGYA 4DLAA 4J1QA 3L4SO 4CM3A 1UZLA 1GYPA 1T4BA 1IZ0A 1I24A 1WAMA 1M66A 1XLTA 5FWNA 3H3FA 1DC4A 2FP4A 3QLJA 3L9WA 4NFYA 1E7YA 4KUGA 4A27A 3WTBA 3FD8A 3JQ9C 4MKXA 3C3XA 5TLSA 1BXGA 1VLLA 3GQVA 1F17A 3DTYA 3FRJA 3WBBA 1PX0A 1HZZA 4C4OA 1CDOA 2Q49A 1GCOA 1E7QA 4B7XA 1E7MA 1R16A 1I2ZA 2VT3A 4DBZA 4Y6PA 1RM0A 4ALIA 2PKQO 3ZWOA 1DLIA 1PJSA 4PVCA 5IDYA 4IS3A 3I4FA 3DZHA 5DBFA 4OSPA 2GSDA 3DHNA 3RUFA 3F1LA 3OIDA 3PLRA 4DWVA 2RAFA 4E5NA 4QXMA 2O7SA 3O26A 2G5CA 4PLCA 1DFIA 4RGBA 4YB8A 2E6UX 5I9NA 5ICSA 4U6SA 3GEDA 3WGQA 3DEYX 4R51A 5JYEA 3FNEA 1I30A 1DJQA 2YV1A 1IULA 2CY0A 4QFCA 4YJHA 5F5NA 1X1EA 3R0IA 5BNIA 2XPCA 1PJTA 1F12A 2P91A 2QYTA 4CMEA 4YJFB 3NJ8A 1M76A 2JCVA 2FHSA 1PWZA 4OOEA 3WX0A 1ZKMA 1BDMA 3KZVA 2D5AA 3OMLA 1UDBA 4L74A 3JQFA 4YT4A 3D0OA 5KVSA 2B4TO 1OBFO 5KKAA 3ONFA 3QWAA 3ST7A 3TPCA 3W8FA 4I9NA 3ZW8A 5TRTA 3JQCA 3MJVA 1DRWA 2PLAA 2PR2A 2J5QA 3I9MA 4Z3DA 4FJ1A 3GHHA 5AYVA 1LRJA 4UVEA 1S7CA 3RC9A 1Z73A 2EJWA 3S2FA 3PGXA 2Z1NA 3HQ4O 3OA0A 4JXKA 3RROA 3ROPA 3U3XA 4CV2A 1CYDA 4W9NA 2ZKLA 3BMNA 4PLGA 3WICA 2VUUA 1HRDA 4BNFA 4WASA 4RF3A 2X86A 3RUDA 3GN2A 1B8VA 1I0ZA 2Q45A 3WTCA 4OSOA 5BT9A 2OHXA 1TT5B 1NBOA 4IJUA 2YV3A 2ZYGA 3WFJA 5KVVA 1NASA 4R1NA 1PZHA 3KOUA 1G1AA 5DBGA 4DTIA 1PQPA 5JO9A 3GR6A 3NDJA 3WGTA 4JJIA 5EERA 4PG4A 1DFHA 1BTOA 3HWRA 1B14A 2JHGA 5L7WA 4K9DA 2FY8A 5IDWA 4J4BA 4H16A 4IDCA 3ABIA 4XQ9A 1HXHA 2GR9A 3ZWAA 1IL0A 1HTBA 3WGZA 3C1OA 5L3ZA 3RCBA 2GZ1A 1EFKA 3DHEA 4WLNA 3T4XA 4CV3A 4JIGA 3I9KA 4RJTA 1Q7CA 1H2BA 4RV9A 5FYDA 5BR7A 3H7AA 1XEAA 5DP2A 4IXWA 5FEUA 3E82A 1FXSA 3TDKA 4OKIA 4YRBA 8ADHA 1DAOA 5EESA 5AXBA 3ORFA 3V5NA 3VH4A 1U5CA 5BSGA 3FSRA 3HB4X 1L7DA 3DDNA 4PLYA 4GL4A 2AXQA 2GLXA 5L45A 3G79A 2Q50A 3DMYA 2Q4EA 3ETEA 3G49A 4NU5A 5BNFA 3AOEC 3QRWA 4NG5A 5DBIA 3RBZA 1QYWA 1YL7A 1U3VA 3GUCA 4PGFA 1ZK3A 1EEHA 3LT4A 1GEGA 3RFTA 4XYLA 1XQ1A 1AHIA 1E0DA 5IG2A 3U9LA 2FN7A 2IXBA 3VOSA 3RBVA 4TRRA 3RFVA 4CMGA 1HZJA 1K5HA 1ZSYA 2AE2A 5BSHA 1KEVA 1I33A 5MDHA 2JFFA 2ZJ0A 4N18A 4BIIA 3TNLA 4IQ0A 1ZMOA 1T2AA 3BXXA 3OF2A 4AJJA 1JW9B 3KSDO 3TZCA 4HBGA 3PWKA 4RDIA 5ER9A 3WGOA 1LLCA 1A9YA 3GMDA 1J4AA 2BMAA 4I8XA 1E5QA 3AOGA 1QR6A 3E5RA 3MTGA 3DOCA 4YVFA 3VVBA 4H7PA 3ZWXA 5CDSA 2J5RA 3T7EA 4E13A 4TSKA 5KTKA 1F14A 1GYRA 4MJLA 2P9GA 1BMDA 4W6ZA 4BGUA 3QE3A 4YWJA 3HB5X 5JMPA 4B7UA 3KV3O 4Y98A 1SEVA 2B4QA 3EMKA 1Q2XA 3PI7A 3B1KA 3DZGA 4L4RA 1YDWA 2DPHA 2PZJA 4E5KA 1C14A 2JAHA 1O8CA 3FTNA 1LU9A 1YS4A 1FDSA 3TFOA 5HTOA 2EF1A 1GCUA 2O2YA 3JQGB 4O6VA 5DF1A 4ZQFA 1RYDA 4J0EA 1N7GA 5JBIA 1PQUA 1YB5A 1E3IA 4TKMA 3VKUA 2BGKA 1NP3A 3ANMA 1GYQA 3X2FA 3JQ6A 5ICMA 4E4YA 2PV7A 4R5MA 3UH1A 4KTTE 1R66A 2JFHA 4GWKA 2A4KA 4ALLA 3E9NA 1HDCA 4XIJA 2Q46A 2J8ZA 1XGKA 2O3UA 3GT0A 1LDNA 3UGKA 1NHGA 4RLSA 5K6AC 1UAYA 3P2YA 4CMCA 1JKFA 4L73A 3CZRA 3JCZA 3I52A 1ONPA 4ZQBA 5A5FA 5FFFA 3GZ4A 1I3NA 4XR9A 1H6CA 1I01A 1DRUA 3EZYA 3VC7A 1KC1A 2LDXA 4BKUA 4FSHA 3KLMX 1PJQA 2QIOA 2EW8A 4DRYA 3U62A 1NFRA 4A03A 4BNKA 2AG8A 3PRJA 3VVCA 4LCEA 3AM4A 4FBGA 5A3VA 1EQ2A 4MVJH 5AXDA 4AJPA 4CM6A 4DREA 1DO8A 4L76A 4B3IA 5CFZA 1EK5A 3NGLA 1CQIA 2EEZA 2HRBA 3R1IA 3GA0A 4MKZA 5TIIA 3Q1LA 3PLNA 3JQDA 1HE2A 2FR8A 4BGEA 3MWDB 3S2IA 3MWEB 1NWCA 2YHIA 3LVFO 2X4GA 3UCXA 3VTFA 3RFXA 4BNLA 4D3SA 5GMOA 2C7GA 3DOOA 4XEHA 4D7AA 2GERA 2VYND 1VC2A 4OH1A 1YOVB 4OMUA 4CQMA 3OETA 4NK4A 3RWBA 4E2YA 4RPLA 4DIFA 2C7VA 4DUPA 1Z75A 4BO4A 1JA9A 5CDYA 3OJ0A 3GDOA 4IXTA 2I3GA 1SB8A 3MOIA 3PK0A 2X5OA 4UUNA 3Q0EA 3BTUA 5JCJD 2AHRA 4PLWA 3PXXA 3ZN2A 2J3HA 1JWAB 1UXJA 3DBVO 1Y8RA 4YAIA 1B8PA 2DT5A 4MIYA 3NUGA 4IIUA 3M2TA 4J2HA 2FZWA 2P4QA 3EVTA 2V6GA 5ES3A 1KEUA 4OIMA 2B5WA 3ENKA 1MLDA 1AGNA 2AMFA 5COQA 3V1TC 3W8EA 3QWFA 5H81A 3I9OA 2DBQA 2RIRA 4BGVA 3OA2A 2X8LA 1ZK0A 1PZEA 3WFIA 2NVBA 1O5IA 1I2BA 2X7HA 1P1JA 3A4VA 3DBRA 3O4RA 3AU8A 4A10A 1EVYA 3H8VA 4YR9A 3B70A 3NT5A 3INTA 5DT9A 4ROSA 2BGLA 3P19A 1N7HA 3VKVA 2BLLA 1R4MB 2V6BA 2J3IA 3U4HA 4B7CA 1IZ9A 4YJDA 4C7KA 4CM9A 2ZB7A 1OMOA 2YFHA 3RUEA 4KWIA 3HNPA 2NQ8A 4Y6RA 4D41A 1I2CA 5HRUA 1FF9A 4JGBA 3FWZA 2DBRA 5JSFA 1BHSA 4FD3A 1KVTA 3JD0A 1K2WA 3WQSB 4R54A 3K6JA 2X0IA 4HFMA 5TGDA 4ZICA 4EBFA 3F6YA 2NU7A 2V7PA 3NAQA 3UF0A 2YQ4A 2YHUA 1XCBA 2POQX 2VHWA 2ET6A 3GG2A 2W2LA 4J16A 3TZQA 4KQXA 3K2EA 4OOFA 3WS7A 3H2SA 5A1TA 1GZ6A 5B4TA 1K6XA 4Y9DA 1OI7A 1U5AA 3FBGA 4JJGA 2YHIB 3I6QA 4NZ9A 4B3HA 1Q1NA 5F3RA 3GG9A 1SOVA 4J90A 4MP8A 4FQ8A 5C3MA 1S6YA 1VJ1A 1GZ3A 3QVXA 3K9QO 3OEYA 2NTVA 4E0BA 3ROQA 1JKIA 5JNLA 1VJTA 3PDJA 4J91A 1F8GA 5KVCA 3CINA 3RASA 2PZLA 3HFSA 4P8RA 5H82A 3PZBA 1CF2O 2V65A 1TXGA 3QV1A 1EE9A 3IJRA 2UDPA 5JE8A 4XRRA 3VHRA 2C2XA 2EG9A 3JQAD 2CUKA 5IJZA 1CERA 4CMAA 1I36A 2D4AA 4J1TA 2ZB8A 1QXSA 1LJ8A 5A4DA 3DWFA 1K3TA 4R9SA 5IZCA 5IDXA 2FPGA 1DC3A 1WZEA 4RLHA 1PS0A 2DUWA 3LU1A 2CDAA 4PLZA 4BS9A 1DIBA 4DMLA 1Z82A 5JY6A 1PR9A 5JCJA 4HP8A 2JJYA 5EL0A 5CDGA 4G65A 1D3AA 1FMCA 5L40A 5CP8A 3PZRA 3RSHA 3ON5A 4ONEA 4A7PA 2Y1FA 1PL7A 4E5PA 2QZ9A 1NPTO 3GUYA 4FFMA 4NBRA 2HMTA 4JLWA 4IDGA 3JD2A 3KLPX 1T2DA 3WR5A 2PA3A 5KKCA 2D8AA 1SC6A 3I9LA 4YRAA 1WDKA 2HAEA 3HJAA 5I7VA 1GPDG 3GY0A 3KEOA 3GVIA 2PD6A 2XF8A 1LDMA 3GEMA 4OXNA 4UEKA 5ENDA 1YBMA 3RAJA 3K2BA 3JQ7A 3F4LA 4EUFA 3RUAA 2DTEA 3DMTA 4ALMA 5KIAA 1OZAA 2Y67A 1WDMA 4GI2A 1H94A 3DQPA 5THKA 2PD4A 3I23A 3WG9A 1MC5A 1PGOA 2VWQA 4PVDA 3RBXA 3RJ5A 4D3FA 1W8DA 2NADA 3BHIA 3FPLA 3JQEA 5LDGA 1EVJA 3S2EA 3VDRA 1QP8A 2ZB3A 3LF2A 1BSVA 2VCYA 3GVHA 5DCUA 4CM8A 3OJOA 1E7SA 2VTDA 2OP1A 3BIOA 2NACA 4F6LA 2NVWA 2IDZA 4BKQA 1DC5A 1LC3A 3JSAA 4NK5A 5TNXA 4TMFA 3FBTA 2R00C 1RM3A 1GL3A 3VH3A 3K31A 1P0CA 3M2PA 2X5KO 4IGEA 1GQYA 4HUJA 2CSUA 2I76A 1I3MA 1E3WB 1OOEA 4PLVA 2EJVA 3RU9A 1YOVA 4A2CA 1CRWG 2WDZA 1E3WA 4BMSA 2IE0A 4ZRMA 3RUHA 1P1RA 2PTGA 2AQIA 2HMUA 1QKIA 3TJRA 5IN4A 4Z3KA 1NVTA 4FPXA 2FSVA 1DIAA 4S1VA 3QA9A 3RC2A 2I99A 4JQCA 1V9LA 3PHIA 4LGVA 2BFAA 1YB1A 1A7AA 2OFPA 4XB1A 2RBEA 3DHYA 1BVUA 2A94A 2BH9A 3GZNA 3LF1A 5KJ6A 5IZ4A 4U7WA 3ZWPA 5KWEA 1GAEO 1LTHR 4IBOA 4YAGA 1B7GO 1C3VA 1YBVA 1YE3A 4Y67A 4XD2A 1O0SA 3KYDA 3L4BA 2AEJA 2GASA 2EWMA 2WD8A 3F47A 3SEFA 5K0ZA 2GYYA 2C0CA 4MVJE 5L51A 4D42A 1DEHA 4PLFA 5DNAA 2WMDA 1Y8RB 3T7CA 1XYGA 4L0QA 5TX7A 3H3JA 5A04A 2AQHA 4IIVA 4CV0A 1D8AA 3DBLA 4WCFA 4EZBA 3AUSA 4XQEA 4J7XA 4QT0A 1X15A 2I66A 1LNQA 2X23A 1HDYA 1KETA 3A28A 3F5QA 3GNSA 4MVJM 4KMSA 4HKTA 2O3SA 2X0NA 1Z7BA 3RI3A 4DGSA 2Y1CA 4IINA 4K1LA 1ISMA 1LSSA 1W6UA 4AFNA 3V2UA 4YXFA 2VUTA 4TZTA 2D0IA 4CODB 1BW9A 2GCGA 4E12A 2I65A 3SJ7A 2EHDA 4OQYA 2VUSA 4BNYA 4E31A 1HE3A 1UP4A 1U2DA 4CQMD 3IL2A 1CIVA 1Q0HA 5BSEA 3CEAA 2VRCA 3G1UA 1T1SA 1ENYA 1H6BA 1NR1A 3ANNA 3DBHB 3E18A 1EE2A 3QVSA 1A71A 1X7DA 5G4KB 4RF5A 3NTOA 4NJOA 3E9MA 2Z5LA 1N1EA 2X0JA 3ITDA 3NRCA 3FF4A 3MEQA 3OIGA 3BMOB 1L7EA 1KC3A 2A9FA 4AVYA 3AUAA 2B36A 5CPFA 5A9TA 2ZATA 3OEWA 3ITKA 3SVTA 3HSKA 1W4ZA 4CMIA 1KEWA 2QRKA 4M8SA 4HXYA 2DBZA 4MVJG 3OH8A 5T64A 3LZ6A 4LRTB 5FF9A 1YH3A 2D5CA 3CXRA 5DOVA 1NAHA 3PJGA 4PLTA 1PGNA 3QJ5A 2B0JA 4D44A 1TLTA 5DCYA 1QYVA 2EKLA 2AE1A 1I10A 4NR0A 4F3YA 2HUNA 2Y1DA 4LRSB 1AUPA 1VSUA 1UUFA 4BNUA 4BQPA 4UUMA 3GDGA 2V6FA 3H9UA 2GZ2A 4RF4A 1DIGA 1BVRA 4YEDA 5IAAA 2YJZA 4GWGA 2O2SA 1U4OA 2NLOA 2CDCA 5ITWA 3TFQA 1UDAA 3GPIA 2ZCVA 1N2SA 1T24A 3KYCB 1EZ4A 4IMRA 4IS2A 3WNQA 1HL3A 3IDSA 1PL8A 4D79A 4TRJA 2JL1A 5TT1A 3PIDA 5DP1A 2OP0A 4IZIA 1YGYA 2Q1UA 2WTBA 5HS6A 1GR0A 3RD5A 1SAYA 3AI1A 3ONDA 2AG5A 4CMIB 1GDHA 3TL2A 2OO5A 3GGOA 1GQQA 5A03A 5JCXA 4CLOA 3EK2A 3KB6A 1IPEA 4WGGA 1ENOA 3SC4A 1T1RA 4BL5A 4DA9A 4GKVA 4OHUA 4FJ0A 4INAA 5T57A 4G5HA 2EKQA 1EBFA 2HJRA 4N7RA 3JQ7B 3Q9UA 1SB9A 2FR0A 4GSKA 4W7IA 3ZV5A 4DIOA 2QQ5A 3RC1A 2VWGA 3I9JA 4HADA 3WJAA 1V8BA 3M6IA 3AUUA 3PQDA 4CJXA 1I8TA 1K6IA 1WXDA 5GY7A 4RZIA 2E37A 1G6KA 4QECA 1PGPA 2FMUA 2X9VA 3MCVA 2EGHA 2QRLA 2C5EA 1ZZEA 4NNJA 4L4SA 3SJUA 3EW7A 3BMOA 4FFPA 5L4SA 1U3TA 1C0PA 4A5OA 3ASVA 1X0VA 3PJEA 3AU9A 1PJ4A 3GK3A 4YT2A 5F1KA 2J3JA 2G0TA 4TRNA 2DAPA 4JBGA 3G0OA 2JHFA 3ZV4A 4MIEA 2DPGA 1ZXLA 4XCVA 5AOVA 2OXIA 4DYVA 4CMJA 4BKPA 3IUPA 3Q2IA 3TF5A 3ZNPA 3RVDA 3BMCB 2WE8A 5KNLA 4S3MA 1IUKA 4DBVO 3UUWA 4IJWA 2YDXA 3D4PA 2VN8A 1ADFA 4J4TA 4EYEA 2VHYA 2DLDA 3L6OO 5KVQA 4ZJUA 3H65A 4NU6A 1UXHA 3DFUA 4M89A 4WOJA 4AJ1A 3FHLA 1N5DA 3ZNQA 2P68A 1PSDA 3FNGA 3JQ8A 3QWBA 3Q2KA 4EUEA 2OOSA 1JAXA 1LRKA 1SEPA 4NFHA 4WCFB 5GZ6A 3WYEA 3PWZA 3F1KA 4KP7A 2Q4BA 2PFGA 2WE7A 3EVNA 1V35A 5JW6A 1QSGA 3DXFA 3W4IA 4BNIA 1AE1A 3PHLA 5JAQA 5A06A 4NIMA 5AXAA 4CLOB 1Y5RA 3JQAA 1Y8QA 5L7TA 3AY3A 1HYGA 1IHYA 5GZ1A 2WYUA 1B3RA 3D4NA 4UULA 4BOYA 1C0LA 1TB4A 1Y5MA 4XDZA 4BO5A 1BG6A 1YJ8A 1PJ3A 4ND3A 2ZYAA 3GNTA 3GFBA 3ZNOA 4PZEA 1R6DA 2QYSA 3W4JA 3WGIA 4GPD1 5KOIA 4ZQGA 1NAIA 4GAEA 1LC0A 3AOEA 4PN3A 2NTJA 3JQ9A 3KO8A 1U3UA 3RJ9A 2ZJ1A 4II3A 4RO0A 4NH4A 4ZQEA 4B4VA 5GZ3A 1JVBA 1LLDA 4J9UE 3GGGA 1FDTA 4OKNA 1QYXA 3BHJA 5L9AA 4LISA 1ARZA 1NPDA 3WIDA 2PZKA 1U3WA 1E6EA 1U7HA 4IJKA 4P4GA 4CM7A 3ZWBA 3W8DA 5TJ9A 1YKFA 3ZWCA 1BW9B 2WEKA 2ZQZA 4F45A 1ONOA 1WP4A 4BO0A 1YL6A 3QVTA 3K5PA 1NR7A 3TRIA 2NUAA 1MG0A 1BRMA 4Z9YA 1LDGA 4YRDA 1ZW1A 3LT2A 4ID9A 2D3TA 4UVGA 3WMWA 1ZXBA 3LK7A 4YYZA 5IDQA 4XX0A 2Y0CA 2W2KB 1LSJA 2BI8A 1KS9A 3ZWYA 1EDZA 4XYMA 1A7KA 3C1TA 2PNFA 4E32A 4YT8A 5CDUA 3PFWO 3PJFA 1RJWA 4CR7A 1PGJA 1KVUA 3E9QA 3VZRA 1MFPA 1U4SA 2PGJA 4OO3A 4LCJA 1O94A 3NKLA 4PZDA 1LQTA 2HKIA 4I9UA 1XA0A 4U6QA 3TQHA 3D64A 2G76A 2O3QA 4CLRA 3GMSA 2DU8A 4DYDA 4JX8A 1T4DA 1LSOA 3UKOA 1NTOA 4NBTA 4D3DA 1R0SA 1ZK2A 4LN1A 4FW8A 1ADGA 1NQTA 5T67A 4CUZA 1NVGA 3QHAA 2O3RA 2NU6A 3RU7A 1D4FA 3ZV6A 1PTJA 5HWSA 1VL6A 1UJMA 5CEEA 4RVDA 1MUUA 4UUPA 3S1LA 5BSFA 2AA3A 1I32A 2ZTUA 4A73A 4RVGA 3ZCXA 5CDTA 3SLGA 4JK3A 2GO1A 1VPDA 3BMCA 3IOYA 3L07A 3PHGA 1CEQA 1FDUA 4ALJA 5JAIA 3NX4A 4CQLA 4YCAA 2G82A 1AXEA 2YYYA 3DBLB 3OQ6A 3H9JA 2O4CA 4IY1A 4CM8B 5G0UA 4QUKA 3D5QA 3IIEA 4AJ2A 1QV7A 3JD4A 4JBHA 4B79A 4WUVA 1XU9A 4I5DA 4ZA2A 3KXDA 1XG5A 3O9ZA 4R1TA 1PJLA 2DKNA 4ESOA 1UXIA 4BO6A 5T8KC 4DL9A 1GUYA 3H5AA 3BTSA 1PU2A 4BNZA 4PRLA 2AQ8A 2HK9A 4I9HA 5JFOA 3L0DA 2NU9A 4MO2A 3L9XA 1KVQA 4LVUA 4U5QA 3GLQA 4BO2A 4OAQA 1Y1PA 1ZH8A 2AQKA 1P0FA 1I5RA 3KYBA 1E1KA 2VHVA 5TQVA 5CG1A 1HDOA 3O03A 9LDTA 1G0OA 3GN1A 3JYQA 5JAZA 3ZU4A 1HSOA 3LDHA 3QP9A 5K9ZA 3IJPA 4URFA 3AUTA 1EMDA 1P33A 1PZFA 4NBUA 5C7LO 4AJKA 5JS6A 3KRTA 5LC1A 1YONA 4PG6A 3STHA 5HM8A 1V3UA 5G2OA 1WNTA 3PYMA 3W1VA 2AW5A 2F00A 2Y0DA 4TQGA 1ZK1A 1YBAA 3KYCA 1AXGA 3KEQA 5EMHA 4FN4A 1IOLA 4ND1A 4FFLA 4J7UA 3WWZA 3A06A 3VPXA 2I5PO 3NV9A 2GD1O 2GF2A 2PGDA 1UDCA 3RKRA 3OSUA 2ZYDA 1X7HA 3HUDA 2PH3A 1ISHA 4YJFA 4GH5A 1BDBA 1EK6A 3L77A 3AK4A 4IQGA 4CUKA 4XGNA 5J23A 3VZSA 4R4JA 1Y8QB 1XDWA 1JVSA 1RWBA 1SOWA 2P4HX 1H93A 1ML3A 3NGXA 1Q7BA 1Z74A 2JD0A 4YAKA 1DIRA 4J9VA 4Q3EA 1H5QA 2FWMX 2HMSA 1E1NA 2NV6A 1KBZA 2YFQA 4RL6A 1XQ6A 4E3ZA 2P9CA 4GBJA 1YRLA 1ISJA 3WBFA 3P5SA 4UEOA 4XQCA 3V1UA 2GN6A 1DHTA 1P31A 5FI5A 1UP6A 1UXKA 4NJMB 1QV6A 1W73A 3ICPA 4LW8A 3VPGA 2J6IA 4WPGA 3WMXA 1DBVO 3HN7A 3TSCA 5KJCA 2OBNA 2Z1MA 4HV4A 4QO7A 4YJGB 2B37A 1J0XO 4BO8A 2O7QA 1LDEA 3EDMA 2ZQYA 1KY4A 1X0XA 1A27A 1CJCA 1HKUA 2HRZA 3DONA 3F3SA 4XYEA 1DOHA 1LRLA 1U7TA 1V0JA 3IS3A 4RQTA 4DLLA 1DC6A 4D0SA 1DXYA 1VM6A 2EP7A 2BI7A 4MOWA 3JD1A 1N8KA 3DFZA 4MVJI 2EERA 4UVHA 2IYOA 4EJ6A 1NXQA 4P38A 5JDCC 2BFOA 1QMGA 1ZBQA 1B15A 3MJCA 5I8WA 3U5TA 2HQ1A 1GD1O 1JLLA 1X13A 2GDZA 3OQ1A 2Y1OA 4Q9NA 4GX0A 4J2OA 2FR1A 4BO3A 5AQ1A 4R3WA 1X1TA 4FGSA 3ASUA 3N74A 3H5RA 4WLOA 5TF4A 2WSBA 1QYCA 2WYWA 4XDYA 3GDFA 2NNLD 1A5ZA 1DJNA 1LQUA 2EW2A 4IDDA 3ZH2A 4CPDA 4GSLA 3GVPA 3C7AA 3CMCO 2D1YA 2P9EA 4FFOA 2PGLA 1GZ4A 3U09A 4WLEA 4B8WA 1FK8A 1FDVA 3PPIA 3AI2A 1VKNA 2PK3A 1T26A 5JLAA 3QY9A 1OC2A 4FFNA 4CQLB 3FPCA 1LLUA 2ZCUA 2VTEA 3BZUA 4WK6A 4CR8A 3WQQA 1P1KA 2QZZA 2Q2WA 3LC2O 1P74A 2TMDA 4L8VA 4BNJA 3QVWA 4ZQHA 1YQGA 2C82A 4CL8A 3W6UA 4B4OA 4BNNA 4RVUA 3OHSX 4KDFA 1DHRA 1MV8A 4K28A 2JKVA 3CSDA 1U28A 4QSMA 4TRMA 4UVIA 4LSWA 1NQAO 2Q1WA 4NJMA 3TOXA 1E1LA 1V3VA 4TVOA 4CMHA 7ADHA 5AVOA 4Z0HO 4JN6B 1H9BA 3SBOA 1YO6A 3TOZA 3V1YA 3G1TA 3K96A 5F5LA 2ZTVA 4QTZA 4P4NA 4KOAA 4BQRA 3GF4A 4UAGA 3IQDB 3PIIA 4UEJA 4HY3A 4NBVA 4PZCA 1R4MA 3LC7O 4XQGA 1SZJG 3QWHA 2C20A 2JCYA 4EW6A 1RPNA 4Q3BA 4U8GA 1WW8A 4Q39A 3H9EO 2B69A 2OL4A 4L9RA 4A26A 4FOOA 5KCZA 1PS8A 3M1AA 4J3FA 3DL2A 2IXAA 2PD3A 4D0RA 4GX5A 5F1PA 4DPMA 5COAA 1WMBA 1KVSA 1PEDA 4PIVA 5F21A 5CEJA 5L4LA 3LLVA 1SNYA 4U0JA 1BXGB 2GN8A 2EP5A 4EJMA 3WGGA 1D1SA 1XU7A 4ILKA 1GFSA 5BNTA 1HF3A 1GQ2A 3DAGA 5TC4A 3WNVA 2PWZA 3DB2A 4KUHA 5G4KA 4RVFA 2HSDA 4YACA 1A9ZA 3DBHA 2CNBA 3EUWA 3FR8A 3L4BC 4EDFA 4PRKA 4Q3CA 2VWPA 3E1KA 4J1SA 5DN9A 1ORRA 1UZNA 4M1QA 4D45A 1HETA 3KHUA 2RHRA 4WE3A 1KVRA 4PG7A 2SCUA 3OBBA 4IUYA 3ZWNA 1KIFA 3KBOA 5IXYA 2HU2A 1NYTA 1VI2A 5DZSA 4CM1A 3HDHA 1Y9AA 1VSVA 2IYPA 3RUCA 4Y6SA 4BB5A 2IZZA 2G1UA 3W4KA 4BB6A 1VL8A 1CETA 5ADHA 3IKVA 3UOGA 1M2WA 4BNHA 4MP3A 3S55A 3ZWMA 2NQTA 1E3SA 3ZGYA 3P7MA 4KZPA 3NDIA 2Q99A 4O63O 4AJLA 1HE5A 3BMQA 1R37A 3R3JA 2I9PA 2RH8A 4KTVE 4Z0TA 1DPGA 1CWUA 1M75A 2Z95A 3T4EA 5JDIC 5L4NA 1NM5A 2VHXA 3BA1A 3GAZA 1E3LA 3OJEA 5G0VA 3PQFA 2X9NA 1R0KA 3NT4A 1PL6A 9LDBA 2JCXA 3ICCA 4XKJA 1LLQA 3LSYA 1E3JA 5I9LA 3QVOA 5IN5A 3DR3A 4RPHA 2DM6A 1U9JA 2O3TA 4K6FA 4D43A 3FTPA 2E49A 2R00A 3B6ZA 4EUHA 1IPFA 1HLPA 1KY5A 1HYHA 2XAAA 2BELA 5ER6A 5JXWA 4FGWA 2I6TA 4W9NC 3GRPA 3KETA 4RQUA 3N7UA 4RDHA 4CR6A 4HX5A 4FFRA 3H6KA 1OFGA 2R2GA 4P22A 1AHHA 1TT7A 1QLJA 4YT5A 4JROA 4GQAA 1NX6A 3WB9A 1K6JA 5T6BA 4TWRA 4PLHA 3CZMA 3FWNA 3LQFA 3D1LA 4BO1A 5B1YA 1ZSVA 4R1UA 4BNXA 2IZ0A 3Q9NA 3HZZA 4L4XA 4R41A 3WSWA 3GVCA 2UV8A 3U49A 4WLFA 4CM9D 5A3JA 4R01A 3FNHA 4TVBA 1XR3A 3U4CA 3CMMA 2PY6A 4KUEA 1Y9EA 5KJFA 1T2CA 5T5QA 1XIVA 3OP4A 4M86A 1I3KA 4WNIA 5U4QA 2EIHA 1OAAA 1WVGA 2GGSA 2YQ5A 2HLPA 2C59A 1J6UA 4FJ2A 5C7IO 1UR5A 4IDBA 6LDHA 1R15A 2GN9A 2H5LA 3DTTA 1ONNA 5H83A 4R68A 4P4LA 4RPJA 4AJOA 3JQGA 3V8BA 4LK3A 2DUUA 4M54A 4F6CA 2O4UX 1VJ0A 3UFXA 3ZU3A 1M6HA 4HFJA 1A4IA 4YQZA 2VYVA 3DZKA 4CL3A 2DC1A 2UUPA 4CMKA 2HO5A 1C1XA 1PS9A 3WLFA 1C1XB 1E6WA 2C5AA 3WWYA 3IAHA 1DB3A 1JQBA 1GUZA 3RIHA 1A4UA 2XXJA 1SCUA 1ZEMA 5EQFA 2DTXA 4E30A 5JY1A 3MJSA 3JQ8B 4HNHA 2CDBA 2ZK7A 4HFRA 1EUDA 4ZVVA 1E6UA 3EY4A 2VYNA 3NJ4A 4BNGA 2VHZA 4AJIA 4FIZA 1HT0A 1JN0A 3PFFA 1T2FA 1EVIA 1KYQA 4IDFA 3KSZO 3C8MA 3C1AA 2GZ3A 1PZGA 1HEUA 3JD3A 4Q3DA 3BTVA 4CQMB 3AI3A 2VZ8A 2BHLA 3QIVA 4M49A 4C7JA 4OM8A 5B12A 2V6MA 4HFNA 1MC4A 2AEFA 3V2HA 4DPKA 4DQXA 3LT1A 3U4DA 4W4TA 4ZRNA 1J49A 2QX7A 3KVOA 2C2YA 4H15A 4NI5A 1IY8A 1N9GB 2Q2VA 1U8XX 1LXCA 2X9GA 4J6FA 1NQ5A 1PWXA 5I7EA 4EGFA 1ID1A 2JAPA 3D3WB 1MXFA 4CM4B 1X14A 1MA0A 4JCOA 3VPFA 1PJBA 4AL4A 1GEEA 1SO8A 1E7RA 4KWHA 4RPGA 3K73O 4JNKA 3FN4A 1DFGA 3B1FA 3E8XA 3R6DA 4A0SA 2LDBA 4I5EA 5TT0A 5I7SA 1WMAA 4WCFC 1T25A 1ISFA 1C0IA 4L75A 2F1KA 3F4BA 2EGGA 1Q7GA 2WWRA 4RCVA 1HLDA 3MJTA 1NHWA 2X58A 4JBIA 2Y66A 3GAFA 4PFJA 2WYVA 3JV7A 1EFLA 2ILTA 3UHAA 1RKXA 3K8ZA 3KSUA 4BMVA 1GUFA 2DQ4A 3HDJA 1NFQA 4TKLA 3HADA 4I5GA 1TT5A 1UH5A 2H1SA 2CMDA 3TN7A 1XHLA 2VZ9A 1C1DA 5HBRA 1ZUD1 4ND2A 2IZ1A 3VH2A 4EJ0A 1WZIA 3N58A 1B3BA 3QQPA 1HDGO 8LDHA 1Y81A 1XWFA 4I08A 1BWSA 3ZHBA 5ITVA 4BO9A 2GN4A 3PEFA 5K6AA 2P5YA 1DDOA 2YUTA 3IC5A 1H0KA 4BKOA 3AM5A 5JDCA 3GZNB 3E6AA 2PH5A 1D7OA 1ZMTA 1UP7A 3ZI0A 4B3JA 4XB2A 5B37A 5ENVA 5DDIP 3DMTC 4D46A 4WLUA 3K30A 4YBZA 2RCYA 2X6TA 3WGHA 4BV8A 2ZTLA 5I7FA 3V2GA 4XRGA 3I4CA 1MP0A 4PG8A 3F46A 3ETGA 2HMWA 1ADBA 1YXMA 2BF7A 1E3EA 3CIFA 4RZHA 1LX6A 1M6WA 3AJRA 3P2OA 1ENPA 3DZIA 3COSA 2BD0A 2BGMA 4RVHA 4MINA 1N9GA 3I5MA 4OQZA 2HMVA 4XYBA 2Y05A 1NWHA 2YDYA 3SLKA 4QQRA 1H2HA 1MG5A 5JO0A 4E2XA 5EJ2A 4B8ZA 5MGBA 4JP3A 4ITUA 1E77A 1P77A 3H9QA 4M87A 3Q3CA 4QX6A 2OGUA 3LT0A 4ND4A 3NT2A 3GFGA 4CMBA 1PJCA 4NBWA 3WYBA 2Q1SA 3PJDA 5IFLA 7MDHA 3OFSA 1Y6JA 4EEXA 3NTQA 1TI7A 3QWIA 3DZFA 5T8KA 3GNQA 3UICA 3GGPA 1ZJZA 3GC6A 4MIOA 2GNAA 3TWOA 3BMNB 1IE3A 3PTZA 4ALKA 2IEDA 2VOEA 5LCXA 3WQRA 5C37A 2IODA 4XR4A 2NU8A 3ZWVA 3RQSA 4ZD6A 4WNCA 2O50A 2VWHA 3ZHYA 5CAEA 1P44A 2XOXA 2DFVA 1I3LA 3KM0A 3GOHA 4EI2A 3D3WA 4DC0A 2I3AA 5FI3A 3AWDA 1E1MA 1O89A 3AY7A 3DAFA 5KJ1A 3OJFA 5DULA 2FSSA 3B20A 3UN1A 3QSGA 3ETDA 2BRUA 1YJQA 3AW9A 4E21A 5THQA 3BTOA 3TL3A 4CLRB 1IB6A 4DPLA 2NM0A 4PG5A 4BNVA 2BKAA 3K92A 3U0BA 2WD7B 4DIBA 1P1FA 2HK7A 2NVUA 4KQWA 1NPYA 3KYDB 1P45A 1ZEJA 2ZB4A 4O1MA 4Z9FA 3JYLA 1E5LA 2JD2A 2B4RO 2WJPA 4YDRA 3VAZA 3I1JA 4TROA 3H2ZA 4BVAA 5F1OA 4LVCA 4ZHSA 5JC8A 2VYVD 1R0LA 1YVEI 3IP3A 3BYZA 3SXPA 3ONEA 1K0UA 2TMGA 4R16A 4ZN6A 3WDSA 3ZW9A 3VH1A 1P9LA 3HN2A 5CG2A 2OORA 3HG7A 4AG3A 3ZZNA 3RUIA 3O38A 4EEZA 1PGQA 3R3SA 5IZCC 3DBRB 3KTDA 1U2GA 3JQBA 4NDNE 2EKPA 4RF2A 4JP2A 1YL5A 4J43A 4E5YA 1QRRA 1V6AA 1NNUA 1W0CA 5KJEA 2CVOA 2VOJA 3TZKA 1P3DA 2BFMA 5B4UA 2NTNA 4J7CA 1VE9A 4NPCA 1ULUA 3I3OA 1Q0QA 2H6EA 3M1LA 3BAZA 5G0WA 5JC1A 4IZHA 3U4IA 1ULSA 4CLDA 2VQ3A 3A14A 2AEMA 2J5KA 4FB5A 1HE4A 3E48A 4MVJP 3ZHZA 4WLVA 4BNMA 1GADO 3GRKA 1HDXA 4II2A 2EXXA 4XJTA 3WSVA 3LLSA 4WOKA 4B4UA 3D7LA 4E2WA 3CE6A 3DO5A 3FR7A 4GX2A 3HDQA 3B1JA 2WD7A 4HNGA 3TZ6A 1O9BA 2X22A 1ENZA 3TZHA 3D4OA 3GPDG 1AN9A 2H63A 2CD9A 3OJLA 1Z6ZA 1MX3A 3F5SA 1H6DA 1E92A 1EQUA 3ULKA 3I9NA 5LDHA 1ZIDA 3NEPX 1ADCA 1VL0A 3PHJA 4MP6A 5IXSA 2DBVO 3GHYA 4GMFA 4GLLA 3CTMA 2DVMA 4FR5A 1JAYA 4GGPA 3PQEA 3L6EA 4GGOA 3ROMA 2CVQA 2UUOA 3UW3A 4BNTA 3ZWWA 1NVMB 2Y1EA 4XGIA 3UVEA 3ZV3A 2OBYA 4YTEA 1ZO8A 2ZTMA 3AFMA 4BUCA 3IKTA 4HWKA 3EAGA 4DXHA 5G4LA 5A9SA 2YY7A 4E2ZA 3DC2A 5EN4A 4R1SA 2VRCD 4MPDA 4RVSA 3PVZA 3CUKA 3PYXA 4K26A 2A35A 5L53A 2GPTA 2PZMA 1C1DB 3O8QA 2O23A 4CMEC 1LBEA 1QYDA 4MDHA 4Z6KA 4YAJA 1RYEA 4NFSA 1O95A 2JFGA 2QHXA 3AFNA 3QW2A 4PCVA 4AJHA 1N1GA 1ISIA 5A05A 3ROKA 4AJEA 1O6ZA 5HA5A 1ISGA 3RKUA 3JQFC 3OM9A 2OUIA 3FCOA 3OICA 5JYDA 1LEHA 4BO7A 2W2KA 2R6JA 4N5MA 4FS3A 4LMPA 4O59O 3DAPA 2HJSA 2P5UA 2RH4A 4J49A 2QW8A 5ILGA 3S2GA 4DQVA 1EBUA 1R4NB 4ZU3A 2G17A 4N5NA 5ILOA 1PIWA 4OXKA 4F46A 3JYOA 4YPOA 1GV1A 1MFZA 1ZJYA 2X0RA 1FDWA 6ADHA 3JYNA 3I6IA 1B0AA 5L7YA 1ZFNA 1GV0A 1KERA 5B4VA 1N92A 1YQXA 5DOZA 4Z0PA 4FCCA 2X1HA 1NFFA 4TZKA 4XA8A 4X54A 5U9CA 4GMGA 4CM4A 2O3JA 4FOSA 3WYCA 2Q2QA 2PKQP 2CFCA 3AY6A 3ENNA 3FNFA 5CEFA 4JJFA 3A1NA 4WJZA 4CLEA 3ANLA 1B26A 1EVZA 3UCEA 3ZU2A 1EUCA 4Q3NA 1XKQA 1ZK4A 1UXGA 2NWQA 3C85A 2B5VA 1B16A 2FPPA 3CKYA 2DTDA 2NVUB 4XGKA 4GVLA 1CQJA 3WIEA 4E33A 3HDYA 4MKRA 5HS4A 4R5HA 5A02A 4BKRA 2EV9A 1IYZA 2I67A 3SX2A 2NSDA 4WEQA 1ZVMA 4IDAA 4E6PA 4Q3AA 4K6CA 3AM3A 1HYEA 2HK8A 4J4HA 2E82A 3PYLA 4BHTA 2Y0EA 4WEOA 3LYLA 2Q3EA 4BNWA 2PKRA 4YAEA 4W99A 1J5PA 5L95A 1BXZA 1JWBB 4R69A 4RORA 4IMPA 4QFDA 1JTVA 3JQBC 4R3NA 2CZCA 2GUGA 4FC7A 4Z9XA 4IM7A 4BMNA 2X5JO 4G81A 1MGOA 2HDHA 4UREA 4CLHA 2D59A 1DAPA 1C0KA 3PGJA 1XSEA 3EHEA 2B83A 2W98A 1R4NA 5CHEA 3PWSA 3O8QB 2YW9A 4EITA 5C5IA 1QLHA 4BGIA 4GVXA 3F9IA 5C7OO 1WPQA 2VNSA 1YWGO 3KUXA 5I9MA 2VRBA 1H9AA 3E5MA 3OIFA 4BV9A 4WECA 1JU9A 1PJ2A 3CPSA 4IQ8A 1M67A 1U8FO 4XZ3A 4QEDA 4YJGA 1B2LA 3VZPA 2CF5A 2Y68A 4IDEA 1B8UA 1WDLA 3GEGA 3GVXA 4QO8A 5EPOA 5TSDA 2UYYA 1YB4A 3X2EA 4CV1A 4UVDA 1K89A 2QG4A 2RHCA 1OC4A 3BMQB 3EYWA 4OXYA 3I83A 2FRDA 3PHHA 4MVJD 4CM5A 1UZMA 2BFPA 4I1IA 1HDZA 4KDEA 5A9SB 3NYWA 4DMMA 3G17A 1BXKA 2WM3A 4XIYA 4IJVA 3C7CB 3C24A 4B4WA 1LDBA 2JD1A 2C07A 1TVEA 1Z7EA 3PDUA 4E5MA 2IEBA 2Q1TA 3FI9A 3A9WA 1H6AA 4OGWA 1DSSG 4U0KA 1Q0LA 4UUOA 1D1TA 3S8MA 4MVJF 4LSMA 1X7GA 3HFGA 4NQZA 2W4QA 4O0LA 4XWYA 4AJ4A 1SBYA 2CF6A 4WCDA 5AXCA 3ZNNA 3UAGA 3L6DA 3UXYA 1YDEA 1Z45A 4N5LA 1YQDA 2W8ZA 5A9RA 4RPKA 3JTMA 3G3EA 4GX1A 4DC1A 1IHXA 1RM4A 1XELA 3ZDFA 2YV2A 1FJHA 2CVZA 1GTMA 3EZLA 1ZSNA 4CLXA 2VT2A 5A5EA 5TS3A 4GLOA 5I8ZA 1KOLA 3VTZA 5EQDA 1F0YA 2FPIA 3ADOA 4M55A 1EUZA 3IP1A 1TA4A 2FZEA 5CPBA 1F8FA 5TJHA 2E4AA 3SC6A 3WJ7A 2IRWA 2UVDA 5JDIA 4YQYA 3MZ0A 3Q6IA 2P2SA 1JKJA 3MJ4A 2UAGA 2C29D 2OZPA 1KEPA 4ALNA 4N54A 4W7HA 4PLPA 4NMHA 1PR3A 5BQFA 1L1FA 3NTRA 3OQBA 3WXBA 1E7WA 3GH3A 3VDQA 3H9GA 1P1HA 2O48X 3RC7A 3H4VA 4IPTA 4AJNA 3WOHA 2H9IA 1LA2A 1RM5A 1R12A 2YZ7A 1F06A 3BHMA 4J0FA 1TEHA 4GKBA 4Y8VA 3Q11A 4R9RA 3MJEA 3INGA 2QRJA 1PQWA 1DRVA 3CH6A 3W6ZA 2W2LD 4J1NA 3ZHXA 4DLBA 1MB4A 3ADPA 3IUSA 5G0TA 2A92A 2Y99A 4LMRA 2J3KA 4AICA 3D5TA 2VZ0A 1Y7TA 4YA6A 4ZGWA 4OL9A 1HDRA 5EINA 5IF3A 4FC6A 1A72A 1DLJA 4OYRA 1MXHA 2XXBA 1GY8A 4IGFA 3D3EA 2FOIA 2E48A 1U1IA 1QORA 2HCTA 2Y93A 4FDAA 5JAMA 2C54A 1SPXA 5G0SA 3VPHA 1BGVA 1GPJA 1UAGA 1ZCJA 3DZBA 1LUAA 4NHEA 4DQUA 3INRA 3C7DB 3ZU5A 1LI4A 3NDRA 3HE3A 1EDOA 2GRAA 5COBA 3UCFA 2DFDA 3EGOA 1HWYA 3EC7A 4CUJA 3MTJA 1ZNQO 1VRWA 1GU7A 3JQAB 1DIHA 1LSUA 3IMFA 3MOGA 4ND5A 3DZJA 1V3TA 4OJNA 4H3VA 4W82A 1LDYA 5EIOA 1HSZA 3DOJA 5JPIA 1P1IA 5JMWA 2Y1GA 4DVJA 4I5FA
chains in the Genus database with same CATH superfamily
3MBOA 1R0YA 2IEAA 3CG4A 4CRWB 1NQOA 5LZ9A 2VNAA 3E7DA 5K3SA 1Y3AA 1RNLA 4GIBA 3PQCA 4H7HA 1QZTA 2B35A 4HSEA 5KOJB 5HK9A 3E03A 4YRZA 4LIPD 3ZBUA 3OQMA 2ZBDA 4AN4A 4FYJA 2ZBQA 9ATCA 2WHPA 1GL7A 2AJTA 2HBRA 2HXSA 4URZR 4F84A 5KWIA 1YMVA 3WRVA 4XYGA 2FKNA 5FQNA 4UXIA 3R7NA 3SZMA 1HG0A 3O3CA 3W05A 4Q4JB 1ZITA 2F64A 2EWVA 4L5IA 5EXDA 2P6RA 4JT9A 4G0UA 1MCZA 1UKCA 2LNDA 2QUAA 4OGKA 2H4YA 3E27A 1SY7A 1RPAA 3DWIA 3L4SO 1UZLA 2IE8A 2AF3C 5DKFA 4B6OA 4DLAA 5L3SA 2PUDA 2Y0BA 1I24A 3FFWA 1P39A 4QEZA 3HLYA 1XLTA 1OB2A 1BWPA 4IDQA 4UDOA 4PSUA 2VK2A 3HZRA 1V7QA 3OCVA 4NG4A 4LRXA 4QVGA 1E7YA 3LP6A 4O3FA 4RD0A 2Y1XA 3V8EA 2IF2A 2B1IA 1FBTA 1XZAA 4MKXA 1JEQB 3ET4A 2YWBA 2PQ0A 1SQGA 3DEZA 4CTNA 3VR2D 1F17A 2VZEA 4C2TA 3FRJA 1IN4A 1IG0A 2OD7A 1DTWB 4UE3S 4MV4A 4LMAA 1CDOA 2BGIA 3MGKA 4KNVA 1GCOA 2AOTB 3ZZUA 1V43A 4D4MA 1KMIY 4RKRA 1H2EA 1MORA 3HUEA 3BRQA 3KOWA 3PWTA 3Q0TA 4C0WA 4DBZA 2ZE8A 4UTRA 2XBUA 4KQ9A 4YJ3B 3ZWOA 2QW1A 1W19A 1WXHA 2IC5A 4M8NE 4YQEA 3NBQA 3WLOA 5KZMB 1PJSA 1IXZA 2W5UA 3OX4A 4XSVA 4URVR 1TYBE 4LBZA 4M1OA 5IDYA 1UKVY 2R6DA 3I4FA 3DZHA 2IYRA 3LO8A 4OX9B 1E4YA 2BMVA 1P9OA 4UPDA 3RUFA 3OIDA 1V41E 3T41A 4IXDA 3WZMA 5JJKA 1QRSA 2V7BA 2OGZA 5IULC 1ODLA 3CUSA 3QMWA 3WLTA 2O7SA 3BB4A 5K99A 1HT1E 1JEJA 2BH2A 1HPLA 4M9CA 4HEQA 4CKWA 2O8CA 1DFIA 1OT3A 1SC9A 1ORTA 4RGBA 5I9NA 5I45A 3BF7A 3DR5A 5C8VA 1VG1A 3N53A 1XVUA 5AW9A 1G21B 4U6SA 4LJLA 3WGQA 1ES9A 1IWOA 2SICE 3DEYX 5FL7D 4AY4A 1L1EA 3O91A 5D87A 3MD0A 4L9WA 4YJHA 1EB8A 4DJTA 1GIAA 3FJYA 3L8MA 1Y8ZA 2P91A 2AH5A 4RIEA 4X7BA 2XA2A 2FPOA 4NYJQ 3IBGA 2YN4A 1FRVA 4DUYB 2ZSJA 3UTDA 1PWZA 3WNZA 1I1OA 4DDTA 3NHRA 3ORYA 3TTUA 5IM4F 4BE7B 5LA6A 1TFUA 1YA6A 3DL7A 4G07A 2JH8A 2JJ2A 1O57A 1CJBA 2G1AA 2LGJA 4U2BA 4D56A 1M83A 1LBHA 1BAPA 2FN4A 2J4CA 2QUZA 3EUEA 3OAAD 3QWAA 4Q3LA 5SY4A 3AHGA 3ZW8A 3OZDA 2IUEA 2NZJA 4B9AA 3MJVA 2V4UA 1DRWA 2PLAA 3IJ5A 4DLZA 4KHZA 4UVEA 1AJEA 2OPBA 3GLIB 3G6WA 4IIEA 4N0QA 5NULA 2W2MA 3PGXA 1XJ0A 2JIOA 3I39X 4ZI3A 4JXKA 1J21A 1WV0A 6PFKA 3ENVA 3UMYA 1CYDA 4W9NA 1DG1G 3BMNA 4PLGA 3EZXA 5K0NA 1JYSA 1NN0A 4HAUA 4B17A 3TFWA 2B94A 2X86A 4LY9A 3RUDA 4DM3A 2WJ4A 4EKNB 2OHXA 3UT6A 4IJUA 3AHEA 1SK8A 4DG5A 2WJAA 4R1NA 2UVPB 3KOUA 1FQOA 1QCZA 4KH1A 2E7ZA 1RQRA 1VBFA 4DTIA 3ZHVA 1X74A 4XIGS 3WGTA 3NDJA 3AJ8A 4JKIA 4CKBA 4JT2A 3WP0A 1CR4A 1RWVA 4JJIA 3TW4A 4DEYA 4ZTUB 3KZXA 4FDTA 3FGNA 3GLTA 2D2VA 4MWTA 2FY8A 2XTAA 3QF4A 3AMVA 4J4BA 4UMVA 4XFDA 2ZBVA 3FB4A 3GX1A 3HEBA 5JPDA 2I2FA 3M5CA 4P98A 2QPOA 3FSJX 5HUJA 3LMKA 3BIJA 1IL0A 5MGNA 1X7XB 2WJZB 3C1OA 3EULA 1OFHA 2PZEA 1KNQA 1C9MA 3I9KA 4FE7A 4RJTA 5KC9A 3OIWA 1RHKA 2HHCA 2W7TA 3HV0A 3QU9A 3KOZA 5FWAA 5AI6A 5FYDA 2RHBA 3H7AA 3UWDA 4G37A 4DIKA 3WWPA 2B34A 4RESA 3UUGA 4P3YA 3E82A 4C3VA 1M7HA 3QU2A 5AKHA 4H2DA 3JWHA 4YRBA 5B58C 8ADHA 4CEJB 1DAOA 4V2IA 1KRXA 4D4LA 5AXBA 5AVRA 2C4TA 4BJ6A 4DJDC 4EHKA 1TJ3A 1U5CA 1NUPA 1RIFA 3GLUA 1VRCA 3NM5A 3K7EA 3HB4X 5B7NA 5BSGA 1E9AA 1JFLA 3K1YA 3VR5H 3VISA 4PLYA 2AXQA 2QTRA 4B7ZA 5L45A 2ONZA 1HY3A 2HD4A 2R1VB 2YHAA 1QIIA 3EE6A 2WHRA 3G79A 2Q4EA 1VPVA 2ABWA 2HWKA 2JAOA 3KZCA 3O8OB 3R2JA 3AOEC 4I50F 2ZUVA 4C0QC 3EX7C 5K4GA 1O0CA 3GUCA 1L8XA 3FJOA 1ZK3A 1YRAA 2FHPA 2H4XA 4UXJA 1TMGE 3RFTA 4JNCA 1LI7A 3T1NA 3OKPA 2H48A 3U9LA 1UWKA 2IXBA 4EVIA 4I3FA 4E88A 4TRRA 1E6KA 5LJIA 4Y0AA 1K5HA 1KEVA 1I33A 3B8EA 3SX4A 2JFFA 4BIIA 1VJRA 4KX5A 1TE2A 1TUGA 5ESXA 1T2AA 2GEKA 2IXTA 3BJIC 2VO1A 1JW9B 4HGOA 4AJJA 4UM8B 1M5TA 3NLLA 4FCWA 4BFWA 2HFJA 5LMNB 2IYTA 2WSSA 2ZITA 4RDIA 3SZRA 1LLCA 1XPOA 1YI1A 5BPFA 5JFGA 2ATIA 2X2EA 4YPVA 1RMQA 1LS1A 4L8GA 3HYCA 2W6QA 4Z1OA 3PIRA 1NXSA 1MX1A 1EDEA 1T8YA 2BHNA 2AMVA 3FPBA 3MTGA 1CUUA 2JJMA 3C8HA 4V0MA 2X4IA 3AFGA 4TSKA 5KTKA 1FP7A 4F4DA 4NE2A 2JI4A 3ASZA 3L8ZA 5LJLA 2P9GA 2FE4A 4EYSA 3UY4A 1QYIA 3HB5X 1P4RA 3HJUA 1GPBA 2G77B 3KR2A 2J3EA 1XKLA 3P0IA 4GM4A 4QL3A 4B7UA 1Q2XA 3ZZMA 2B99A 3B1KA 4R8LA 1QRTA 4L4RA 4C04A 4HPWA 4DLRA 1ECCA 3S2ZA 1PD0A 3AF6A 4YAOA 4PQYA 2JAHA 4DG9A 2NT3A 1L7BA 2YL2A 3IHKA 3MTDA 3ZLBA 3TTYA 3E7FA 4E51A 3FGZA 4H08A 5AMXA 1LU9A 3PXUA 4XH9B 4F2HA 4QGHA 3K6SB 5HTOA 2IBSA 1JZSA 2BN4A 2KPOA 3KJFA 4HGYA 4N82A 4PTYA 2JJ1D 1N7GA 3TTSA 4Z7QB 1PQUA 3OKCA 1FP1D 4KHPB 2JASA 3L8YA 3MGGA 1BU8A 4F3KA 4JUAA 1MTOA 1XCJA 1E63A 3D8HA 2PV7A 1YDHA 4UDXX 1R66A 2FUG1 1GGHA 1VIMA 2A4KA 2E4ZA 4AQDA 2UVQA 3Q0IA 1HDCA 2OXEA 3O8LA 4MW5A 4EO7A 4C6SA 2IZ6A 1YQUA 2Q46A 4OI4A 2C2MA 2J8ZA 3ISTA 1TUEA 4GZLA 3LHDA 2O3UA 4K6GA 3UGKA 4Q00A 4WFJA 3MRXA 2PX2A 1ORDA 3QMVA 4TT3D 4RA9A 4I4TB 1L5KA 1G3QA 3UPTA 3JCZA 1BX0A 3VOBA 3B2NA 1EG2A 1FMJA 2XCQA 1P4AA 5FFFA 1RIIA 4XR9A 4BRSA 2R84A 1I01A 2X8AA 4M9ZA 4LYAA 4RACA 1CY6A 4N5IX 4HH3C 1KA9H 2LDXA 3Q87B 3R6WA 4QDKA 5E0OA 3DTNA 1FSZA 2EW8A 1BS9A 3AP2A 4X95A 1NFRA 2VJYA 1KI9A 3IDAA 2ZROA 3NEAA 3QU5A 1EQ2A 2DF8A 5A3VA 4CM6A 4FGZA 3TINA 2FW1A 3DE5X 3DLBA 1CQIA 3FHOA 1WBDA 2HRBA 1L7VC 3GA0A 3R1IA 2HTFA 5AJXA 1WF6A 2FR8A 4RA6A 1Z6GA 5FOWA 4KYTA 5ABPA 3WA7A 1E2BA 2YHSA 1RRMA 4BV2A 1NWCA 1YS9A 1Y4UA 3LVFO 4KI7A 3FOEC 4IOMA 2PM8A 1EI9A 4Q1DA 1N3IA 5J5AA 3TW0A 3DOOA 4NJEA 3H2GA 2JJQA 2GERA 2VYND 4JFRA 4OH1A 2F3RA 2QAIA 4AZ3A 4CQMA 4JFAA 1EFTA 4AM8A 3ZWDA 4BLVA 5C80A 5FTNA 2BRUC 1BDJA 2C7VA 3CBGA 4ND8B 4P3NA 4DUPA 1FTQA 1RHQA 4CF6A 4BO4A 1V1RA 3MT0A 4BZPA 2Z57A 4N1AA 3OJ0A 4G5XA 4U7TB 3SNHA 3GDOA 4X91A 4DFDA 5HIMA 2Q2NA 2I3GA 4IXTA 4CG0A 2L82A 3M6WA 3BQNB 4CCAA 5JCJD 5YASA 2CCKA 2CLDX 3LKVA 4PE5B 4WZAA 3TSAA 3ZN2A 2GHQA 4YUAA 1O5TA 3EXHA 1K8YB 3TXXA 3P45A 3FG9A 3H8WA 3WV4A 5MFZA 2G9VA 3M2TA 2XHZA 3HJGA 1KEUA 1BDIA 3B1VA 4DJAA 4LRUA 5CB4A 1MLDA 1AGNA 1WB4A 3JVDA 3NKVA 5COQA 3WWEA 5H81A 1H4SA 3V8VA 2DBQA 1DUIA 1XZQA 3BK1A 5KTOA 1ZD3A 2F55A 3L0YA 3QYPA 4MRNA 4OK5A 2X8LA 4QXAA 4PO9A 1ZK0A 4GE3A 3DLPX 1GSOA 3U80A 1WB9A 4Y0NA 1O5IA 1Z33A 1HA3A 1P1JA 2OCBA 4W5JA 3Q3HA 5DTMA 3VHXA 3BWMA 4C6TB 4YR9A 1U0FA 3OZUA 5CBPA 4MARA 3RU2A 3NH9A 4JEUA 5CMLA 2B2XA 1RHRA 1GSIA 2J3IA 3U4HA 4LV8B 5IAJA 4C7KA 2QN6A 4X60A 5A4JA 2I3DA 2G9NA 1O97D 2D1FA 5AKZA 3KZ1E 5FAXA 1OMOA 2Y3IA 3EW9A 1G59A 3CVVA 3QI7A 2NZ8A 2H2IA 1I2CA 2PSHA 3FWZA 4L2IB 1PFWA 1JDSA 3GEEA 3CVYA 1BHSA 1KVTA 3IMCA 2IDJA 4BP3A 1DRKA 4W8GA 3OOYA 1G64A 3EZ6A 4CTOA 5EJ4A 3HNOA 4X6YA 1C3OA 1EX7A 4JHXA 3AZOA 4GU5A 4HFMA 1QVVA 4ZICA 1WOYA 4BQNA 2ZJ3A 3FLBA 3AF4A 5KEIA 3NTLA 2R6ZA 3L79A 4HTFB 3OIUA 2POQX 3WDLA 1QFMA 1DQNA 2VHWA 4FU0A 4B47A 3D7RA 1H2FA 3LCRA 4KQXA 3H2SA 1F3LA 5A1TA 1P0QA 3ZIAA 5LKRA 1J1ZA 2UXBB 1V7ZA 2GYUA 4RPIA 4C4YA 2VHTA 1OI7A 1U5AA 3FBGA 4NZ9A 4B3HA 5BVGA 4DDWA 5F3RA 4WXPA 2ZB2A 2R6CA 1OR8A 4N49A 5E6RB 4RTOA 4Q9HA 1VMKA 3WZ2A 3QVXA 4IP0A 1U3GA 3KFVA 2PS3A 5C5CA 3DH0A 4UEQA 1Y1LA 2OKCA 2NTVA 3Q72A 3ROQA 2YQZA 1G6OA 3KQTA 4PM4A 1F8GA 1SPBS 4QJ5A 3RASA 2PZLA 1G8GA 4O4JF 4JXJA 1EAMA 1Z4PX 2IYNA 2JK0A 2HOQA 1CF2O 4OSEA 1BXRB 1FYDA 2MSNA 4C76A 5DI3B 4Z2YA 5MN6A 3HLTA 3IJRA 3MMZA 5H3LA 4ZHQB 3VHRA 2VC2B 3DT6A 5MN5A 1U8ZA 4GI7A 2P90A 3F8SA 1LPBB 4DBLC 2D4AA 3KQMA 3L8GA 3OKAA 1QXSA 2D8MA 1STOA 1ZD2P 1N57A 3MBIA 5HJ2A 4IRXA 4G0WA 1LJ8A 3T5TA 5A4DA 3O8RA 1K3TA 4M76B 4R9SA 5ULLA 5IDXA 1A8IA 1PE0A 3F96A 3IV9A 2CLSA 2QM7A 2WZDA 3KXKA 3WB0A 2JA1A 1VCOA 2D2FA 4AZVA 3RV3A 2CDAA 1PT6A 4Y6GB 4BS9A 1DIBA 4DMLA 1CUSA 1SHKA 3L6RA 4QHTA 5IJ9A 3AETA 1BKSB 3MCWA 1WZUA 4JI7B 4AY6A 4PTZA 1FMCA 1XCLA 1WB5A 3CLTC 5L40A 1FYEA 2G9QA 4RMNA 1A2BA 4ONEA 3IT2A 3NWPA 4H7EA 5LUBA 1YU9A 2XW6A 4IEIA 1PL7A 1CR0A 4KLNA 3GUYA 3JALA 4N6OA 1X3SA 1DX9A 2HMTA 3ZHSA 3QGMA 3VOAA 1FUEA 3OT1B 2MYTA 2Q6TA 3V1MA 2D8AA 1SC1A 4CEHB 5IJ0A 4NC9A 1IBMB 1BXRA 3L43A 3GY0A 1OLUB 4UKDA 4ARZA 1VXOA 4MLZA 2WF6A 3ZVNA 2A9OA 2PUTA 2FSFA 5ENDA 1W4AA 3EZ2A 1PLLA 3AHIA 3F6RA 3B12A 5KHAA 5TMEA 2R87A 3ETHA 2P9HA 5JIBA 4GI3A 2E55A 1VRVA 3HR7A 3M9XA 4ALMA 3A11A 5P21A 3UJPA 1IXRC 4ZVMA 1FLVA 1E64A 5JZBA 1OZAA 2Y67A 2I33A 1N34B 1WDMA 3M3PA 3O75A 1QDLB 1H94A 4OB6A 2FGKA 1X1RA 4CI9A 3U3KA 3BFVA 1AIPA 2OCDA 4J75A 1JQDA 4LQDA 1OFUX 1MC5A 3KUCA 1PGOA 2YTZA 3EQ6A 4PVDA 3VU9B 2ZSBA 4WX2B 1GDTA 1E5VA 3IV6A 2JLSA 1UIMA 3E58A 3GLFE 1Y7PA 3CNOA 3DAHA 3BEDA 4HDAA 2XGSA 1K68A 3FPLA 721PA 1OVMA 1BJKA 3K0KA 5SICE 3S2EA 3VDRA 1G5TA 1QQAA 3CX3A 3TQQA 1TUBB 5FLXA 2PLFA 4XWGA 3SXJA 3BIOA 1QJ4A 1XRRA 1F2VA 1XQYA 1WCIB 1KO1A 2QOEA 1Q0TA 1DGQA 1DC5A 1MQ9A 5TNXA 2RAPA 1G9SA 2ZRAA 3GJXC 2XYQA 1RM3A 4B2LA 3VH3A 4F8JA 4H77A 1ODKA 3T5DA 3RR2A 2NTEA 2IHTA 2OLEA 4FCTA 4XPIB 2CJYA 3IXQA 1NJ1A 4HUJA 1EWTA 4IL5A 4ZDKA 5FNZA 1I2DA 3RU9A 1VPWA 4BMSA 4LI3X 1IU9A 1SU8A 4ZAGA 2HC9A 2PEYA 4QYWA 5CAEB 1ZUWA 1L7OA 1QGAA 4QOIA 1UINA 2IYWA 2HMUA 3CB4A 3MAGA 4L02A 3TJRA 3TMAA 3HDGA 1YRHA 4BRZA 2FSGA 2R7AA 3VKHA 4JITA 5JSZA 4UAJA 3BE4A 1S01A 4KLAA 4LV5B 4S1VA 5D3QA 2I99A 4D8WA 4JQCA 1V9LA 5DM60 2BFAA 1L4YA 4M22A 3FCCA 1P6UA 3FHJA 1A7AA 3LIPA 2BSAA 3DE2X 2XB4A 3L93A 4QOGA 3W2IA 2XVAA 4TLEA 4EAAA 2O2EA 2A94A 4HH4A 4BFSA 1JE0A 4C01A 1SVWA 4UNQA 3QEOA 5KJ6A 5IZ4A 4QUGA 4HRAA 3UUFA 1SG9A 4U7WA 2RHTA 1ZCAA 3ZWPA 4AU1A 5IT0A 4H18A 4YAGA 3M1YA 1B7GO 5M5BA 4OP3A 3IEVA 2XNCA 2CXPA 1W4LA 2R6HA 4XD2A 1MOPA 1X2BA 2GJ9A 1O0SA 2B7BA 2VA9A 4Y67A 3DDUA 1O54A 2GASA 3F47A 4MUYA 3SEFA 5K0ZA 3LNTA 4AMBA 2BFFA 3NANA 4B48A 3NHFA 1UJCA 3CA8A 5AOCA 3JR3A 1F4LA 4B85A 2E5FA 2CNDA 1N3LA 1Z0JA 2WMDA 3SFZA 1Y8RB 3RVSA 2NO0A 3UQZA 4UARA 5DHUA 5EYPB 1CDEA 2I6SA 1VLQA 1MB0A 1OI4A 2Z3VA 1T3LA 2AQHA 2NYUA 1H5NA 4BTEA 4TV8F 1D8AA 1JALA 1JSRA 4CV0A 4WCFA 4EZBA 5DLEA 1P1BA 2ZEJA 4HEA6 4PNEA 5JNWA 4QT0A 2Z4SA 1GPAA 2I66A 1LNQA 4ZVSA 5C4GB 1RHJA 5DMHA 2ORVA 3MAAC 4MVJM 4HKTA 4AZ0A 1M2VA 2AC7A 1CJVC 3ZLTA 4OX9Y 1OA1A 4W5OA 4K1LA 1OFUA 2W83A 1KDOA 3IT0A 3P5BA 4UD6A 4A92A 3CBQA 1ANKA 1W76A 4MEAA 3C48A 1GNRA 3N0RA 3JAKB 4TZTA 2D0IA 1BW9A 1P60A 1Z0SA 1KZ1A 1JLLB 1U98A 2EHDA 2HNBA 4IFBA 2AJLI 4X7RA 5DSZA 4E31A 4DY6A 4HAXA 4HT3B 5IJAA 4C4TA 3IL2A 4ASUD 1XF9A 5BSEA 1EFRA 1QH0A 3OUZA 3ZTTA 3G1UA 4XPZA 3HUUA 1L7AA 1EKXA 1G9TA 1H6BA 1ZN9A 3ANTA 3AHDA 3DBHB 3E18A 4FFVA 2WPDD 1G4UR 3QVSA 4LWQA 5JLJA 1MR3F 2YZMA 1A71A 2QWXA 3MA0A 3FWKA 4PYNA 2C7OA 1FP4B 1DUSA 3ITDA 3IEKA 3OE7D 3Q12A 1VBMA 3ZVLA 2F1HA 3OIGA 4NOJA 4LHSA 1L7EA 2JDID 2B36A 3OEWA 1NXPA 2V0NA 4F97A 2C8JA 1W4ZA 3HSKA 1KEWA 2QRKA 3PR3A 5L8VA 4HXYA 4MVJG 1NVAA 3KALA 2Q21A 3DV2A 2GILA 3H1EA 3OH8A 4FGLA 4LRTB 4YUXA 3FHTA 4WV3A 3LA8A 1J2EA 2WHPB 5GONA 1XMIA 3D8NA 3EVAA 3PJGA 4PLTA 3QJ5A 4ZEXA 2R7LA 1TMYA 4KPEC 1F8UA 3ZLVA 1R7RA 2XUAA 5ADWA 1LK5A 1QYVA 2AE1A 2FPSA 3HGMA 3FH0A 1OD6A 4QFMA 3R7WA 4I4NA 2AUNA 2PVSA 1AUPA 1NOIA 2R25B 4FD2A 5H16A 5TPWA 3RAEC 5LDDC 3AILA 4NV3A 4ANFA 4P36A 2RJNA 3HB7A 1OLXB 2YH2A 1R5NA 4IEFB 4LF5B 1FNNA 1BVRA 3LLCA 3OQHA 4Z1MA 4EY6A 5IAAA 2O2SA 3OAAA 4LY0A 1UPTA 3GZJA 2BEKA 4KQJA 2G25A 1CE8B 1ZL2A 3K0AB 3LPLA 1UDAA 3Q9LA 4IGKA 5BWMA 1QHSA 1M1YB 2ZCVA 1N2SA 1S4QA 2GETA 3DXZA 1G63A 4Y2GA 3KYCB 4GOXA 2ETXA 1FLAA 5CR9A 5DM4A 1ZH2A 4MK4A 3R4VA 1CRLA 1YTLA 2C0QA 2WU1A 4HDRB 4DNPA 2O8BB 4X45A 2IA5A 5EPUA 3QZUA 2ZT8A 3HGTA 2HV9A 4IHJA 5GJCA 5EE9A 4LNHA 1YGYA 4I81A 4LJ4A 3UJ8A 1EXWA 1VCHA 3AVUA 4ZEVA 4GPTA 4G9BA 4M8KA 2IYEA 1XL0A 4PAMA 3ONDA 3PL5A 4YFVA 2B4AA 2ZRLA 4TT8A 2FX3A 3LV8A 2QL9A 1GQQA 3TG2A 4YIKA 3OE1A 5JCXA 1YVDA 3D3NA 4WNYA 4NXMB 3KT3A 4GKVA 2B1QA 3KWFA 3FZQA 3LWDA 4QGGA 1QK5A 1EBFA 3VDXA 2HJRA 4OY3A 1VI5A 1P2TA 1SB9A 2D13A 5FRDA 3CZPA 2ZPUA 1D4AA 3R41A 2CLFB 1P19A 4LC1A 1H0SA 2QQ5A 1U3CA 3NHBA 3M89A 4KGVA 4DWOA 4E7OA 3F6EX 3SEQA 4AYXA 2PU7A 3EGXB 3PQDA 4WOPA 4CJXA 3ADCA 3RADC 3JX9A 4KQ1A 1UK9A 1I8TA 4N76A 3HTXA 3MINA 4WFQA 2JFQA 2E37A 2PKCA 2Y8EA 1XZ8A 5HDQA 3VJKA 5LP6F 2FMUA 1O2DA 2SKEA 3CNHA 3VC2A 2EGHA 3H2BA 2EZ9A 1QAOA 3L8HA 2L69A 1C9EA 3LL7A 1KS2A 1TQHA 2M1XA 4JLPA 5KYYB 4B40A 1N25A 3DDSA 4L4SA 2JC3A 2PV0A 5HDBB 3SYNA 3DMRA 5KOYA 5ANRB 3FNBA 3MM4A 4WERA 1N6HA 5FLYA 4A5OA 1NURA 1X0VA 3PJEA 1JX6A 1SCKA 3AU9A 1NVKA 3GK3A 3EF0A 4JUDX 4LK2A 4R71A 5CNJA 2G0TA 2JHFA 1NIJA 5BURA 1KYIA 1U7UA 2ECOA 3SJAA 5C2JB 3H97A 1O6FA 1SVMA 4XCVA 4XXHA 1PEYA 3PC6A 1ZCZA 4XD7A 5DM0A 3RAPR 3C3EA 4DYVA 4CMJA 2GDJA 2HK6A 3K0CC 3ZDAA 4E03A 2G3YA 1LV7A 1Q84A 1RRGA 2OZVA 4EF5A 2WE8A 3LBNA 2DH6A 4S3MA 1Z2NX 3JVEA 5FIUA 3ROZA 1YFZA 1SKMA 3MIIA 4H4EA 4K05A 2Q0SA 3S1SA 2VN8A 1MO4A 5EUQB 4L6CA 4M6WA 4EYEA 4KMRA 1KO7A 4C06A 2DLDA 5BYAA 3GEBA 3BD9A 1NI4A 1HFEL 3NPAA 3PNPA 5JCPA 1T3GA 1KYTA 2XJ4A 4AJ1A 5LP1A 3KJZA 5FOQA 1ZCBA 3Q2KA 2K7ZA 4I6GA 2OOSA 5AKEA 4UTOA 1LRKA 2WT9A 3CSUA 3NC0C 3R3XA 4NFHA 4WCFB 5FBHA 3PWZA 4RM3A 2BR4A 3BJEA 4MS4A 1JDZA 2QLBA 3HYRA 1S8FA 3QXHA 4FYKA 2DFNA 5KYYA 3X1JA 1V35A 3E3OA 5LYJF 3DXFA 1D2RA 2WP8J 1IM5A 2XDWA 1AE1A 3FF1A 3PHLA 5JAQA 4BNIA 4PZPA 1PR6A 4CLOB 1Y5RA 3JQAA 3O5AA 2D5IA 5J4YA 2WRZA 1G8PA 2XGMA 1WEKA 3HWSA 2XMPA 3CEMA 5HF6A 3EFEA 4IV5A 5BSVA 1Y5MA 2PSEA 1BVYF 1ZM3A 3K4PA 1SD1A 1ZOLA 3PC4A 4W1SA 5EIXA 1Y4DE 2IOYA 2OZLB 5CH3A 5L6LB 1G3RA 2Q41A 3GNTA 4PC7A 1R6DA 4YN3A 1CUHA 5KOIA 4QJ4A 1E2NA 2UZ1A 1Z5GA 3GEHA 4UHHA 2JGEA 1EUCB 5AKYA 1N5JA 1KKMA 1U99A 2HXGA 4RL4A 3HZOA 2B1GA 1L5YA 2IZ7A 2Q3MA 3PT9A 4II3A 4RSGA 3EFOA 3RJ9A 3RJMA 3W9BA 1E9DA 1XJQA 2ODEA 4B4VA 5GZ3A 4Q03A 3QSYA 3TKLA 4QUIA 2RK6A 4RK5A 1N0WA 4JJAA 2IP4A 3PB3A 4G85A 4FYMA 5B53A 4JLNA 5CVJA 1FDTA 4UFOA 1KDYA 2D0PB 3WIDA 1NPDA 4UTXA 4B8YA 3IAAA 3CLHA 1NATA 5HMMA 3TAHA 4IJKA 1U7HA 4I6EA 3CWQA 2XE8A 3DMFA 4P4GA 4GXNA 4OJMX 5GWXA 3SP1A 2AFHE 1ONBA 2HWUA 2V7TA 3AY0A 4FHEA 3A9RA 3ZWCA 4DA8A 1Z6PA 2HRCA 2WEKA 3A6DA 2ZZKA 2AIRA 3EQ9A 2H1HA 3UGJA 2ZE6A 2EFJA 1AZTA 2BGNA 2NT4A 3BSSA 4H1HA 4IJ6A 4KH0A 4QXQA 3T35A 1VA5A 3DMHA 4F45A 5DNDA 4BO0A 3ZDDA 2H2HA 5FJJA 4FR2A 1U0BB 2CLLB 1NR7A 1R6TA 4G36A 2Z56A 4AZ0B 2ZIGA 3CU5A 3A2NA 2P75A 3E9ZA 1MG0A 3LS2A 4LTDA 4YCDA 1DEAA 4ZDWA 4B1FA 1I80A 4YRDA 4HWTA 5FHRA 1QPGA 1M2GA 3LT2A 3PNQA 4GBED 1DI0A 4P54A 3Q7EA 3NOQA 1XZJA 1Y63A 4XX0A 1F6BA 4G8DA 4KO4S 1KH1A 2XVZA 3BG5A 1OWMA 1S8AA 2V6JA 5NLLA 5MN4A 4OYLA 5DTRA 1U2ZA 5JANA 3IEPA 1EDZA 4MVXA 4E32A 3C1TA 4YT8A 5E2AA 3SSNA 1UKEA 3FPSA 3V3KA 3PJFA 1RJWA 5DVZA 4CR7A 1PV2A 4UUBA 3A1CA 1R88A 4P4SB 3VZRA 5KVAA 5E6SA 1NN5A 3QPVA 1RAEA 1ODCA 2WQZA 1O94A 1L3CA 1YB6A 3LL4A 3NKLA 4PZDA 1LQTA 1OWNA 5EFOA 3LUJA 1S3SA 5HIAA 4TQUS 2EGUA 3BQMB 3IVXA 4RJIA 4MPPA 3WFZA 2A6PA 2ISSD 1ZHOA 2WJIA 4JKOA 2ZBFA 1K06A 1VGRA 3VNVA 3GMSA 1RQ7A 1JXAA 3C14C 3HYTA 5TEVA 1KSHA 5BO5A 3T34A 4B3SB 4C22A 3KSRA 2GA9A 1NVVQ 5TE9A 1NTOA 2PMFA 2AFIE 4LECA 3UKOA 2R11A 1QOQB 4MI3A 1E8DA 4GPEA 3W06A 1T3ZA 3L4KA 3BRWD 5TIIA 1ADGA 3I04M 1LJUA 3T1HB 1NQTA 4JI0B 1E2HA 1RPTA 2JGFA 4PIPA 2O3RA 2NU6A 2Z09A 2FSUA 3ESCA 4JLBA 3RU7A 2SBTA 3COJA 1OI3A 1VL6A 4LXYA 4LBWA 1H0RA 3BFJA 4YMWA 4CVNA 3LSTA 5I01A 1VJCA 4WBSA 2BFCA 5BSFA 4GLJA 4DQDA 3RSFA 4C5CA 3QG5A 2IOHA 2XQVA 5C3UA 4A73A 1DEOA 1TK3A 3BBPA 3MW8A 3T9BA 3QEBZ 3F4KA 1DTWA 1UOOA 4IVNA 5ERGB 4RTNA 4JXXA 4HPXB 2OKGA 1CEQA 4AK9A 4ALJA 1IB0A 2WFMA 5HZGA 2J32A 1W30A 4QUAA 4CQLA 1EVEA 2A58A 1IOVA 2IHKA 4MGKR 3S7TA 4X94A 2ONCA 3IIEA 4ZO9A 1IZYA 3ILYA 4G1FA 3JD4A 2D6FA 1VL1A 1ZI6A 4ZDJA 1X7YB 4ZA2A 1MH1A 3MS2A 1XG5A 2VAWA 4MITA 4C0XA 4ZVLA 5FA8A 5E7MA 4LYYA 2W6JA 4ZT3A 2DKNA 4X9XA 4ESOA 2WOJA 1X7ZA 5A7FA 3RUPA 3U2QA 1KI1A 5T8KC 2XZDA 2I62A 3T8YA 1X92A 2Q9BA 3H5AA 1C3OB 1NJ5A 1PU2A 3OHMA 3N2KB 3JQRA 3PNSA 4TV8B 2AQ8A 4POOA 2HK9A 3ZJ5A 3K5IA 4BMXA 4KO2S 3IA2A 5G1OA 4RY9A 2XRFA 4G4GA 2RGBA 2HA6A 2XTJA 3E0XA 3KTAB 2IYVA 3O7WA 4UNPA 3T7JA 3V46A 2NU9A 3LXRA 4GPIB 3NZEA 2OO3A 1S2IA 2BJVA 1N8TA 3DYIA 4V39A 5JSQA 1D6NA 1N2XA 3GLQA 4OAQA 5KYXA 3QKRB 1H1LB 3BRCA 3RRXA 1I5RA 1ZHHA 2ZR0A 1E1KA 1I1NA 3KYBA 4LMBA 2K5UA 4X1KA 1HDOA 3JWIA 3PFIA 1K8RA 1ZS9A 3Q88A 3ZHQA 9LDTA 4CG3A 2OZKA 1T0PA 3LDHA 4N41A 5K9ZA 4ICIA 4AC9A 1AGXA 3ZGNA 2ILVA 2R8PA 2MSWA 3FSGA 3OC0A 3RS3A 1P33A 3SQOA 3F97A 3N2ZB 3WQBA 4DGQA 3ILXA 5LC1A 2O0LA 3WNCA 2H51A 3SIPA 3QXGA 2P0EA 4LQ4A 3STHA 2C3UA 1NNLA 3BKXA 3G5AA 4HNRA 1SN7A 5CNIA 1T3TA 2FI1A 3PSAA 2WSLA 4L16A 1JL3A 3I8SA 3H6GA 4I2VA 1JS1X 1OZ0A 2Y2VA 1DTEA 2VPIA 3HBAA 2Y0DA 3MTIA 5IRCD 4HDNA 3OFVA 3UH0A 3KYCA 3KEQA 1IOLA 1CUJA 1Q6ZA 4FFLA 3A06A 2Z2IA 1YCDA 3D6FA 5CB8A 2GF2A 2I4MA 4FILA 3DHWC 1PTKA 1UDCA 2XD4A 1KFCB 4XIFA 4H35A 2RG1A 3KCNA 3LOQA 4MW7A 3P52A 3FVTA 4PF1A 4YJFA 1ISHA 4EEKA 2BMDA 3AYZB 1BDBA 3K4HA 1SCQA 3TRDA 3D2AA 4IQGA 5CYFA 2HF7A 2C5SA 3U4GA 4CTMA 5ITWA 3GBSA 2B2NA 4B80A 4OUKX 3SX0A 2B7LA 1JVSA 1NQVA 1XUOA 4M37A 1T9DA 3O4HA 1H93A 1ML3A 4GMDA 1EP1B 4WW0A 1TCAA 4YAKA 4ETIA 3TCXB 4YUWA 1DIRA 1KHTA 2WNSA 3RYHA 3B8HA 1GNPA 1H5QA 2HMSA 2UYOA 4JIMA 2VDKB 4KVGA 2J08A 2XNHA 1L8OA 4GBJA 2VDPB 3TBHA 1JIJA 1ISJA 2PMBA 5EQTA 4QQ8A 3R9KA 3ZPXA 4JQZA 2YZ2A 4PHCA 1J2JA 1NG1A 1ZAKA 3KL2A 3ID6C 3HJRA 3PHCA 4IF6A 1TPZA 1P31A 3K1JA 4KCGA 4RH1A 5FI5A 2X0FA 1JKMA 4F7WA 1UXKA 1X1QA 1KFJB 2C3OA 3PG5A 3PXEA 2HY7A 1QB7A 5ALDA 4XVCA 3VPGA 1NZFA 4A5SA 3FOFC 1WOMA 2J6IA 1WETA 4OGWA 2VNJA 4D9HA 1DBVO 4OCZA 1LLFA 4JI2B 2CNWD 4U4AA 2JH3A 5KJCA 2Q5FA 4B6PA 2V55B 3T3GA 2YOHA 2CJWA 4AULA 1PV4A 2FEOA 2H16A 4BO8A 2PT7A 1SOAA 3E7XA 4QWMA 1N6RA 3ASYA 3VR5A 5JTUA 1KY4A 3GJ8A 3THOA 4O4HA 1DOHA 1LRLA 3M33A 1J0AA 4LSGA 1DC6A 2FVXA 4OMDA 1ECLA 1VYTA 2QG6A 3C8UA 5DXJA 3WGMA 1MX9A 3DFIA 2OBBA 5FULA 3QKIA 2YX1A 4MVJI 4GXTA 5BNWA 4M83A 1NXQA 4P38A 3H05A 5DIFA 1QMGA 3MJCA 3HA7A 3LPDA 4G5SA 3KVVA 1F5SA 2BGJA 4NBNA 1WUHS 3OCUA 1AQNA 1X13A 4P33A 5FV7A 2GDZA 1II0A 2ZDGA 2VQSA 1Y3FE 3NTXA 2MINB 3VR1A 2FLVA 4LNUB 3TKAA 2JNWA 3Q9SA 4DCCA 5EJEA 4WKCA 5FAKA 4RDXA 2FR1A 3V9AA 4X61A 1LVGA 3ORSA 1PJRA 4R3WA 1QAQA 1QP0A 2RH5A 4TMKA 3N74A 3H5RA 4PO1A 2ONKA 2WSBA 4Y1FA 2AYZA 2P6PA 3D6JA 4E70A 1JHZA 1DJNA 3IP6A 1XCMA 2KM1A 2FG5A 1Y6RA 4JI6B 1PFYA 3LX5A 2PGLA 1GZ4A 1T5OA 1Z25A 3B1WA 1YDMA 1RKBA 5EUCA 3TECE 4BVJA 3U09A 1CUIA 1H2ZA 2C2BA 3ABQB 1EJ2A 2IVZA 3ACBA 3AT1A 4YGXB 3RE1A 3W7VA 4YCBA 1R10A 4FFSA 1ESMA 1L1QA 3FPCA 3HL4A 3TMKA 3NHLA 1PUIA 4GICA 3LZDA 1P1KA 4Y9SA 2Q6OA 3MJDA 2OK7A 2Z6VA 1P74A 2TMDA 5FNVB 4CKWB 4UQLA 1DAKA 5FNVF 2C82A 4J16C 4RTKA 1LX7A 1OXXK 1ZRHA 4PAQA 5CLFA 4CL8A 5C1PA 2I2XB 2ZYUX 3ENZA 4MV6A 4AUKA 1DJPA 3AR9A 1YJBA 4HB3A 2KJQA 1N5LA 2JFUA 4K28A 2J87A 4LYGA 1ODTC 4DSOA 1TJ5A 4N7JA 3VSEA 2G80A 2PLRA 4LHZA 1E18A 5A6VA 1LTKA 4V0OA 1NQAO 1Z6AA 2HQRA 3ZGOA 3NWEA 4C20A 4CMHA 1P4GA 1YO6A 1GCGA 1SWWA 5ICFA 2ZTVA 1SM4A 4Q6WA 1S9HA 4KOAA 1I9CA 2CL0X 3THYB 1A76A 3KKOA 4UAGA 3PIIA 3G8AA 1QIHA 4WZBB 4KV9A 4NBVA 1J0BA 1P18A 1SZJG 4EW6A 1S96A 4OJYA 3OCXA 1WW8A 3W5IA 3TXAA 5J4LA 1OHHA 3GFOA 3STTA 6REQA 2YRXA 4P3XA 2WSSD 1WW2A 4MUFA 2ZRFA 5KCZA 1F6WA 3Q2OA 2XRMA 3DL2A 4J3FA 5ALSA 3T6KA 3UPUA 3R8FA 5DWVA 1X7WA 2QJRA 4I19A 1J70A 4Y2UA 3ZCPA 1KVSA 3K5WA 5F21A 2K4MA 3NQ41 4O1HA 5LQSA 1D2CA 5L4LA 3AUXA 3Q85A 1BXGB 1KIAA 3K70D 1EP3B 2J07A 4EJMA 5IT5A 1LPNA 4EFNA 2JIMA 2Q29A 1W25A 5T3UA 3M4JA 1U6IA 2X7XA 2CLHB 3BWXA 3K1AA 4OQ4A 4X62B 2VKTA 3GUHA 3C5HA 5DH9A 4I14A 1ZGZA 5CM2Z 2FF7A 5TC4A 1CQZA 5EXEA 2FMHA 4KUHA 1AV7A 2E89A 3MWKA 4RVFA 2B8TA 1JNYA 4KPYA 5DK4A 2BUAA 3DBHA 2Q5CA 3L4BC 1FU7A 3ZHOA 5ARDA 1EQAA 2PBRA 4KL8S 4Q3CA 4TN1A 4J1SA 2GBLA 1E9FA 1UZNA 3P2JA 2GXQA 1NUUA 1RXIA 2RHRA 1SXQA 4WE3A 1RP7A 1Z7YA 4PG7A 1DIOB 4MYHA 4RMJA 4EO9A 3N8HA 4WT7A 1W0KD 3ZE1B 5DZSA 4E3WA 2G06A 3TLCA 3THWA 1H66A 4ESEA 2I4OA 1OROA 3HDHA 4RTMA 5I51A 3WBKA 1BH6A 4IUDS 2P9FA 3NHWA 2A9KA 5D00A 3UK0A 4DCVA 3FLAA 1ZOPA 1GTSA 4Y6SA 2HW8A 2XXAA 1Z5UA 2G1UA 1WY5A 4U2GA 1VL8A 4YMIA 1OAOA 1BHJA 1ZONA 4PXYA