2Q47A

Ensemble refinement of the protein crystal structure of a putative phosphoprotein phosphatase from arabidopsis thaliana gene at1g05000
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
151
Chain Sequence
HLIPPLNFSMVDNGIFRSGFPDSANFSFLQTLGLRSIIYLCPEPYPESNLQFLKSNGIRLFQFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLTSIFDEYQRFAAAKARVSDQRFMEIFDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Probable tyrosine-protein phosphatase At1g05000
total genus 40
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2q47A00
4NNDA 2IMGA 4D3RA 1LYVA 2I6PA 5KABA 3N0AA 5MMZB 2PT0A 1ONYA 3AWFA 4JMJA 4TVVA 3AWGA 1EENA 1T49A 1YTNA 3EU0A 1XBOA 1PYNA 4NYHA 2PI7A 3MOZA 2PQ5A 1OEVA 4ZI4A 5BUGA 2HCMA 4JBCA 1OEMX 3V0FA 1C86A 5K9WA 1ZCLA 3EB1A 2I6OA 2FJMA 2M3VA 5K24A 3ZMPA 4KYQA 4RI4A 1NL9A 4KI9A 1C84A 4I8NA 1LARA 2FJNA 1X24A 1OHDA 2BIJA 3GXGA 2HC1A 2P6XA 1QZ0A 1AAXA 2I5XA 5KA4A 2QDCA 2I4EA 2I4HA 4GFVA 3QCBA 3QCNA 1Q1MA 5M43A 1C88A 2HNPA 2VEUA 1C87A 3QCDA 3ZM2A 2I6IA 4RI5A 2J16B 1ZCKA 2F71A 1NZ7A 1KAKA 1JF7A 2NV5A 4H34A 1YGRA 3D1OA 2G6ZA 4BJOA 2ESBA 3F41A 4GFUA 2BV5A 2I1YA 4MBBA 4R30A 2F6FA 3BLUA 4QBWA 4ZRTA 4HRFA 1PXHA 2CNEA 2H4VA 1G1HA 4H1OA 1Q6TA 1ZZWA 1BZHA 1PTTA 1PH0A 2OZ5A 5KAAA 1PTVA 3ZV2A 2MBCA 5HDEA 1YTSA 4GE2A 1I9SA 3QCFA 4ICZA 2H02A 2HY3A 3O4UA 2OC3A 1Q6JA 1YZ4A 2F6ZA 3QCMA 3ZMQA 1WCHA 4RH5A 1V3AA 3QCEA 2WGPA 1T48A 1MKPA 3V0EA 1Q6PA 1A5YA 3RGQA 5KA1A 1R6HA 1OETA 5KA0A 3V0JA 1GFYA 3D1QA 1ECVA 3BRHA 2B4UA 1C83A 2HVLA 5IBSA 2Q05A 2Y96A 3RGOA 2NTAA 2PBNA 1LQFA 4BPCA 2B4SA 2BGDA 3O4TA 4WU2A 2I3UA 1KAVA 4B04A 1XRIA 3U96A 5KA7A 1G7GA 4OHHA 4KYRA 5BX1A 3MMJA 4GS0A 3QCHA 3S3FA 3ZM1A 1XM2A 1YTWA 5BZZA 3BLTA 3QCIA 4Z6BA 4OHEA 2F46A 2QEPA 2GWOA 4Y2EA 4RDDA 4WTYA 2NZ6A 2I42A 2DXPA 1SUGA 2G59A 1FPRA 2J16A 2BZLA 2QDPA 3BM8A 4QUNA 2I6JA 2CNGA 4Y14A 1QXKA 3LJ8A 3RO1A 5KADA 1YPTA 1Q6SA 3OMHA 4GE5A 3CWEA 1VHRA 1YGUA 4GRZA 2QDMA 4RH9A 4NWGA 1C85A 5KA9A 3F99A 4J51A 2PA5A 2HC2A 3S3KA 2B4PA 2CMCA 2SHPA 4QAHA 4D3PA 4JMKA 1RXDA 3EZZA 4IKCA 2F70A 3S3HA 3SR9A 1OHEA 2Y2FA 3GXHA 1FQ1A 1WAXA 4PYHA 2QBSA 3I7ZA 1G1GA 2QCTA 2HXPA 2OOQA 3O5XA 2AHSA 1JLNA 4WOHA 2F6YA 1NNYA 2VEVA 1U26A 3OLRA 4R0SA 1NWEA 1OEUA 4R0TA 1P15A 4HJQA 5EHRA 2AZRA 1XXPA 3D44A 3QKPA 4OHLA 3EMUA 3QCJA 5KA8A 1GWZA 3NMEA 2CM8A 4ZN5A 1XXVA 2QBRA 2C46A 5I6VA 4QAPA 3ZM0A 1PA1A 2E0TA 2NT2A 2A3KA 3AWEA 1YWFA 1YFOA 4NX8A 3F81A 3A5KA 4D3QA 2F6TA 2B3OA 5K9VA 5EHPA 5KA2A 2YDUA 1U24A 4HJPA 2H03A 2FH7A 5AWXA 1PTUA 2CNFA 2CM3A 4DGXA 2H4GA 3QKQA 2C7SA 2I6MA 1NO6A 2HB1A 4GWFA 4AZ1A 2CJZA 1L8KA 1M3GA 2BGEA 4PVGA 5LXQB 3D42A 3QCCA 2CMBA 2F6VA 3CM3A 5K23A 2ZMMA 1PTYA 3H2XA 3QCGA 2CNIA 3MOWA 4RHGA 3S3EA 2HNQA 2CM7A 2I3RA 2F6WA 2H4KA 4GRYA 5K22A 1D5RA 2B4OA 3I80A 1L8GA 1FPZA 2ZN7A 4YAAA 3EAXA 1I57A 2CM2A 2Q47A 2P4DA 3F9BA 3QCLA 4GE6A 4NWFA 2PSZA 2B07A 1PA9A 1U25A 1G4WR 1G7FA 2I75A 1BZJA 2NLKA 3V0DA 2I4GA 3F9AA 3PS5A 1BZCA 3A5JA 2A8BA 1T4JA 4OHIA 2CMAA 2CNHA 1WRMA 3B7OA 4YR8B 5J8RA 3V0IA 2RF6A 4S0GA 3S4OA 3QCKA 5IBMA 2J17A 1Q6NA 1Q6MA 3S4EA 3O3LA 1RPMA 2R0BA 2B49A 2JJDA 5GTJA 1NWLA 3SMEA 2VEYA 2OUDA 5BZXA 1OESA 3O4SA 3V0GA 2NT7A 1OHCA 3ZM3A 4ERCA 2H04A 1I9TA 4QBEA 3V0HA 1ZC0A 4JNBA 1OEOX 1ONZA 2QCJA 1G1FA 2VEWA 2GJTA 2QBQA 3D9CA 2GP0A 3D1HA 1J4XA 1G4US 5KACA 3M4UA 4OHDA 5KA3A 4RKKA 4QUMA 2VEXA 1YN9A 2CFVA 2QBPA 1EEOA 4WU3A 5K25A 3RZ2A 4DGPA 3I36A
chains in the Genus database with same CATH superfamily
4NNDA 2IMGA 4D3RA 1LYVA 1GQQA 2I6PA 3ZL8A 5KABA 3N0AA 5MMZB 2PT0A 1ONYA 3AWFA 1GG4A 4JMJA 4TVVA 4QF5A 3AWGA 1EENA 1O5ZA 1T49A 1YTNA 3EU0A 1XBOA 1PYNA 2GC5A 2XPCA 4NYHA 2PI7A 3MOZA 2PQ5A 1OEVA 4ZI4A 5BUGA 2HCMA 4JBCA 1OEMX 3V0FA 1C86A 5K9WA 1ZCLA 3EB1A 2I6OA 2FJMA 2M3VA 5K24A 3ZMPA 4KYQA 4RI4A 1NL9A 4KI9A 1C84A 4I8NA 1LARA 2FJNA 1X24A 1OHDA 2BIJA 3GXGA 2HC1A 2P6XA 1QZ0A 1AAXA 2I5XA 5KA4A 2QDCA 2I4EA 2I4HA 4GFVA 3QCBA 3QCNA 1Q1MA 5M43A 1C88A 2HNPA 1W78A 1C87A 2VEUA 3QCDA 1P31A 3ZM2A 4CVKA 2I6IA 4RI5A 2J16B 1ZCKA 2F71A 1NZ7A 2Y67A 1KAKA 1JF7A 2NV5A 4H34A 2Y68A 1YGRA 3D1OA 2G6ZA 4BJOA 2ESBA 3F41A 4GFUA 2BV5A 2VTDA 2I1YA 4MBBA 4R30A 2F6FA 3BLUA 4QBWA 4ZRTA 4HRFA 1PXHA 2CNEA 2H4VA 1G1HA 4H1OA 3MVNA 1Q6TA 1ZZWA 1BZHA 1PTTA 1PH0A 2OZ5A 5KAAA 1PTVA 3ZV2A 2MBCA 5HDEA 1YTSA 4GE2A 1I9SA 3QCFA 4ICZA 2H02A 2HY3A 3O4UA 2OC3A 1Q6JA 1YZ4A 2F6ZA 3QCMA 2WTZA 3ZMQA 1WCHA 4RH5A 1V3AA 1P3DA 3QCEA 2WGPA 1T48A 1MKPA 3V0EA 1Q6PA 1A5YA 3RGQA 5KA1A 1R6HA 1OETA 3NRSA 5KA0A 3V0JA 1GFYA 3D1QA 1ECVA 3BRHA 2B4UA 4UAGA 1C83A 2HVLA 5IBSA 2Q05A 2Y96A 3RGOA 2NTAA 2PBNA 1LQFA 4BPCA 2B4SA 2BGDA 3O4TA 4WU2A 4CVLA 2I3UA 1KAVA 4B04A 1XRIA 1EEHA 1UAGA 3U96A 5KA7A 1G7GA 4OHHA 4KYRA 5BX1A 3MMJA 4GS0A 3QCHA 3S3FA 2GCBA 3ZM1A 1XM2A 1YTWA 5BZZA 3BLTA 3QCIA 4Z6BA 4OHEA 2F46A 2QEPA 2GWOA 4Y2EA 4RDDA 4WTYA 2NZ6A 2I42A 2DXPA 1SUGA 2G59A 1FPRA 2J16A 2BZLA 2QDPA 3N2AA 3BM8A 4QUNA 2I6JA 2CNGA 4Y14A 1QXKA 3LJ8A 3RO1A 5KADA 1YPTA 1Q6SA 3ZM6A 5A5FA 1W7KA 5A5EA 3OMHA 4GE5A 3CWEA 1VHRA 1YGUA 4GRZA 2QDMA 4RH9A 4NWGA 1C85A 5KA9A 3F99A 4J51A 2JFGA 2PA5A 2HC2A 3S3KA 2B4PA 2CMCA 2SHPA 4QAHA 4D3PA 4JMKA 1RXDA 3EZZA 4IKCA 1JBWA 2F70A 3S3HA 3SR9A 1OHEA 2WJPA 2Y2FA 3GXHA 1FQ1A 1WAXA 4PYHA 2QBSA 3I7ZA 1G1GA 2QCTA 2HXPA 2OOQA 3O5XA 2AHSA 1JLNA 4WOHA 2F6YA 1NNYA 2VEVA 1U26A 3OLRA 4R0SA 1NWEA 1OEUA 2UUOA 4R0TA 1P15A 4HJQA 5EHRA 2AZRA 1XXPA 3D44A 3QKPA 2VTEA 4OHLA 3EMUA 3QCJA 5KA8A 3PYZA 2GCAA 1GWZA 3NMEA 2CM8A 4ZN5A 1XXVA 2QBRA 2C46A 5I6VA 4QAPA 3ZM0A 1PA1A 2E0TA 2NT2A 2A3KA 3AWEA 1YWFA 1YFOA 4NX8A 3F81A 2X5OA 3A5KA 2JFFA 4D3QA 2F6TA 4BUBA 2B3OA 5K9VA 4BUCA 2Y1OA 5EHPA 5KA2A 2YDUA 1U24A 4HJPA 2H03A 2FH7A 5AWXA 1PTUA 2CNFA 2CM3A 4DGXA 2H4GA 3QKQA 2C7SA 2I6MA 1NO6A 2HB1A 4GWFA 4AZ1A 2CJZA 1L8KA 1E8CA 1M3GA 2BGEA 4HV4A 4PVGA 5LXQB 3D42A 3QCCA 2CMBA 2F6VA 3CM3A 5K23A 3LK7A 2ZMMA 1PTYA 3H2XA 3QCGA 2CNIA 3MOWA 4RHGA 3S3EA 2HNQA 3ZM5A 2CM7A 2I3RA 2F6WA 2H4KA 4GRYA 5K22A 2AM2A 1D5RA 2B4OA 3I80A 1L8GA 1FGSA 3HN7A 1FPZA 2UUPA 2ZN7A 4YAAA 3EAXA 2VORA 3QCZA 1I57A 4C12A 2CM2A 1E0DA 2Q47A 2P4DA 3F9BA 3QCLA 4GE6A 4NWFA 3UAGA 2PSZA 2B07A 1PA9A 1U25A 2Y66A 1G4WR 1G7FA 2I75A 1BZJA 2GC6A 2NLKA 3V0DA 2I4GA 4ZIYA 1JBVA 3F9AA 3PS5A 1BZCA 3A5JA 2A8BA 1T4JA 4OHIA 2CMAA 2CNHA 2F00A 1WRMA 3B7OA 4YR8B 5J8RA 3V0IA 2RF6A 4S0GA 3S4OA 3QCKA 5IBMA 2J17A 1Q6NA 1Q6MA 3S4EA 3O3LA 1RPMA 4CVMA 2JFHA 2R0BA 2XJAA 2B49A 2JJDA 5GTJA 1NWLA 3SMEA 2VEYA 2OUDA 5BZXA 1OESA 2VOSA 3O4SA 3V0GA 2NT7A 1OHCA 3ZM3A 4ERCA 2H04A 1I9TA 4QBEA 3V0HA 1ZC0A 4JNBA 4QDIA 1OEOX 1ONZA 4C13A 2QCJA 1G1FA 2VEWA 2GJTA 2QBQA 2AM1A 3D9CA 2GP0A 3D1HA 1J4XA 1G4US 5KACA 3M4UA 4OHDA 5KA3A 4RKKA 4QUMA 2VEXA 1YN9A 2CFVA 2QBPA 1GQYA 1EEOA 1J6UA 4WU3A 5K25A 3RZ2A 4DGPA 3I36A 2UAGA
chains in the Genus database with same CATH topology
4NNDA 2IMGA 4D3RA 1LYVA 2I6PA 5KABA 3N0AA 5MMZB 2PT0A 1ONYA 3AWFA 4JMJA 4TVVA 3AWGA 1EENA 1T49A 1YTNA 3EU0A 1XBOA 1PYNA 4NYHA 2PI7A 3MOZA 2PQ5A 1OEVA 4ZI4A 5BUGA 2HCMA 4JBCA 1OEMX 3V0FA 1C86A 5K9WA 1ZCLA 3EB1A 2I6OA 2FJMA 2M3VA 5K24A 3ZMPA 4KYQA 4RI4A 1NL9A 4KI9A 1C84A 4I8NA 1LARA 2FJNA 1X24A 1OHDA 2BIJA 3GXGA 2HC1A 2P6XA 1QZ0A 1AAXA 2I5XA 5KA4A 2QDCA 2I4EA 2I4HA 4GFVA 3QCBA 3QCNA 1Q1MA 5M43A 1C88A 2HNPA 2VEUA 1C87A 3QCDA 3ZM2A 2I6IA 4RI5A 2J16B 1ZCKA 2F71A 1NZ7A 1KAKA 1JF7A 2NV5A 4H34A 1YGRA 3D1OA 2G6ZA 4BJOA 2ESBA 3F41A 4GFUA 2BV5A 2I1YA 4MBBA 4R30A 2F6FA 3BLUA 4QBWA 4ZRTA 4HRFA 1PXHA 2CNEA 2H4VA 1G1HA 4H1OA 1Q6TA 1ZZWA 1BZHA 1PTTA 1PH0A 2OZ5A 5KAAA 1PTVA 3ZV2A 2MBCA 5HDEA 1YTSA 4GE2A 1I9SA 3QCFA 4ICZA 2H02A 2HY3A 3O4UA 2OC3A 1Q6JA 1YZ4A 2F6ZA 3QCMA 3ZMQA 1WCHA 4RH5A 1V3AA 3QCEA 2WGPA 1T48A 1MKPA 3V0EA 1Q6PA 1A5YA 3RGQA 5KA1A 1R6HA 1OETA 5KA0A 3V0JA 1GFYA 3D1QA 1ECVA 3BRHA 2B4UA 1C83A 2HVLA 5IBSA 2Q05A 2Y96A 3RGOA 2NTAA 2PBNA 1LQFA 4BPCA 2B4SA 2BGDA 3O4TA 4WU2A 2I3UA 1KAVA 4B04A 1XRIA 3U96A 5KA7A 1G7GA 4OHHA 4KYRA 5BX1A 3MMJA 4GS0A 3QCHA 3S3FA 3ZM1A 1XM2A 1YTWA 5BZZA 3BLTA 3QCIA 4Z6BA 4OHEA 2F46A 2QEPA 2GWOA 4Y2EA 4RDDA 4WTYA 2NZ6A 2I42A 2DXPA 1SUGA 2G59A 1FPRA 2J16A 2BZLA 2QDPA 3BM8A 4QUNA 2I6JA 2CNGA 4Y14A 1QXKA 3LJ8A 3RO1A 5KADA 1YPTA 1Q6SA 3OMHA 4GE5A 3CWEA 1VHRA 1YGUA 4GRZA 2QDMA 4RH9A 4NWGA 1C85A 5KA9A 3F99A 4J51A 2PA5A 2HC2A 3S3KA 2B4PA 2CMCA 2SHPA 4QAHA 4D3PA 4JMKA 1RXDA 3EZZA 4IKCA 2F70A 3S3HA 3SR9A 1OHEA 2Y2FA 3GXHA 1FQ1A 1WAXA 4PYHA 2QBSA 3I7ZA 1G1GA 2QCTA 2HXPA 2OOQA 3O5XA 2AHSA 1JLNA 4WOHA 2F6YA 1NNYA 2VEVA 1U26A 3OLRA 4R0SA 1NWEA 1OEUA 4R0TA 1P15A 4HJQA 5EHRA 2AZRA 1XXPA 3D44A 3QKPA 4OHLA 3EMUA 3QCJA 5KA8A 1GWZA 3NMEA 2CM8A 4ZN5A 1XXVA 2QBRA 2C46A 5I6VA 4QAPA 3ZM0A 1PA1A 2E0TA 2NT2A 2A3KA 3AWEA 1YWFA 1YFOA 4NX8A 3F81A 3A5KA 4D3QA 2F6TA 2B3OA 5K9VA 5EHPA 5KA2A 2YDUA 1U24A 4HJPA 2H03A 2FH7A 5AWXA 1PTUA 2CNFA 2CM3A 4DGXA 2H4GA 3QKQA 2C7SA 2I6MA 1NO6A 2HB1A 4GWFA 4AZ1A 2CJZA 1L8KA 1M3GA 2BGEA 4PVGA 5LXQB 3D42A 3QCCA 2CMBA 2F6VA 3CM3A 5K23A 2ZMMA 1PTYA 3H2XA 3QCGA 2CNIA 3MOWA 4RHGA 3S3EA 2HNQA 2CM7A 2I3RA 2F6WA 2H4KA 4GRYA 5K22A 1D5RA 2B4OA 3I80A 1L8GA 1FPZA 2ZN7A 4YAAA 3EAXA 1I57A 2CM2A 2Q47A 2P4DA 3F9BA 3QCLA 4GE6A 4NWFA 2PSZA 2B07A 1PA9A 1U25A 1G4WR 1G7FA 2I75A 1BZJA 2NLKA 3V0DA 2I4GA 3F9AA 3PS5A 1BZCA 3A5JA 2A8BA 1T4JA 4OHIA 2CMAA 2CNHA 1WRMA 3B7OA 4YR8B 5J8RA 3V0IA 2RF6A 4S0GA 3S4OA 3QCKA 5IBMA 2J17A 1Q6NA 1Q6MA 3S4EA 3O3LA 1RPMA 2R0BA 2B49A 2JJDA 5GTJA 1NWLA 3SMEA 2VEYA 2OUDA 5BZXA 1OESA 3O4SA 3V0GA 2NT7A 1OHCA 3ZM3A 4ERCA 2H04A 1I9TA 4QBEA 3V0HA 1ZC0A 4JNBA 1OEOX 1ONZA 2QCJA 1G1FA 2VEWA 2GJTA 2QBQA 3D9CA 2GP0A 3D1HA 1J4XA 1G4US 5KACA 3M4UA 4OHDA 5KA3A 4RKKA 4QUMA 2VEXA 1YN9A 2CFVA 2QBPA 1EEOA 4WU3A 5K25A 3RZ2A 4DGPA 3I36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NND A;  2IMG A;  4D3R A;  1LYV A;  2I6P A;  5KAB A;  3N0A A;  5MMZ B;  2PT0 A;  1ONY A;  3AWF A;  4JMJ A;  4TVV A;  3AWG A;  1EEN A;  1T49 A;  1YTN A;  3EU0 A;  1XBO A;  1PYN A;  4NYH A;  2PI7 A;  3MOZ A;  2PQ5 A;  1OEV A;  4ZI4 A;  5BUG A;  2HCM A;  4JBC A;  1OEM X;  3V0F A;  1C86 A;  5K9W A;  1ZCL A;  3EB1 A;  2I6O A;  2FJM A;  2M3V A;  5K24 A;  3ZMP A;  4KYQ A;  4RI4 A;  1NL9 A;  4KI9 A;  1C84 A;  4I8N A;  1LAR A;  2FJN A;  1X24 A;  1OHD A;  2BIJ A;  3GXG A;  2HC1 A;  2P6X A;  1QZ0 A;  1AAX A;  2I5X A;  5KA4 A;  2QDC A;  2I4E A;  2I4H A;  4GFV A;  3QCB A;  3QCN A;  1Q1M A;  5M43 A;  1C88 A;  2HNP A;  2VEU A;  1C87 A;  3QCD A;  3ZM2 A;  2I6I A;  4RI5 A;  2J16 B;  1ZCK A;  2F71 A;  1NZ7 A;  1KAK A;  1JF7 A;  2NV5 A;  4H34 A;  1YGR A;  3D1O A;  2G6Z A;  4BJO A;  2ESB A;  3F41 A;  4GFU A;  2BV5 A;  2I1Y A;  4MBB A;  4R30 A;  2F6F A;  3BLU A;  4QBW A;  4ZRT A;  4HRF A;  1PXH A;  2CNE A;  2H4V A;  1G1H A;  4H1O A;  1Q6T A;  1ZZW A;  1BZH A;  1PTT A;  1PH0 A;  2OZ5 A;  5KAA A;  1PTV A;  3ZV2 A;  2MBC A;  5HDE A;  1YTS A;  4GE2 A;  1I9S A;  3QCF A;  4ICZ A;  2H02 A;  2HY3 A;  3O4U A;  2OC3 A;  1Q6J A;  1YZ4 A;  2F6Z A;  3QCM A;  3ZMQ A;  1WCH A;  4RH5 A;  1V3A A;  3QCE A;  2WGP A;  1T48 A;  1MKP A;  3V0E A;  1Q6P A;  1A5Y A;  3RGQ A;  5KA1 A;  1R6H A;  1OET A;  5KA0 A;  3V0J A;  1GFY A;  3D1Q A;  1ECV A;  3BRH A;  2B4U A;  1C83 A;  2HVL A;  5IBS A;  2Q05 A;  2Y96 A;  3RGO A;  2NTA A;  2PBN A;  1LQF A;  4BPC A;  2B4S A;  2BGD A;  3O4T A;  4WU2 A;  2I3U A;  1KAV A;  4B04 A;  1XRI A;  3U96 A;  5KA7 A;  1G7G A;  4OHH A;  4KYR A;  5BX1 A;  3MMJ A;  4GS0 A;  3QCH A;  3S3F A;  3ZM1 A;  1XM2 A;  1YTW A;  5BZZ A;  3BLT A;  3QCI A;  4Z6B A;  4OHE A;  2F46 A;  2QEP A;  2GWO A;  4Y2E A;  4RDD A;  4WTY A;  2NZ6 A;  2I42 A;  2DXP A;  1SUG A;  2G59 A;  1FPR A;  2J16 A;  2BZL A;  2QDP A;  3BM8 A;  4QUN A;  2I6J A;  2CNG A;  4Y14 A;  1QXK A;  3LJ8 A;  3RO1 A;  5KAD A;  1YPT A;  1Q6S A;  3OMH A;  4GE5 A;  3CWE A;  1VHR A;  1YGU A;  4GRZ A;  2QDM A;  4RH9 A;  4NWG A;  1C85 A;  5KA9 A;  3F99 A;  4J51 A;  2PA5 A;  2HC2 A;  3S3K A;  2B4P A;  2CMC A;  2SHP A;  4QAH A;  4D3P A;  4JMK A;  1RXD A;  3EZZ A;  4IKC A;  2F70 A;  3S3H A;  3SR9 A;  1OHE A;  2Y2F A;  3GXH A;  1FQ1 A;  1WAX A;  4PYH A;  2QBS A;  3I7Z A;  1G1G A;  2QCT A;  2HXP A;  2OOQ A;  3O5X A;  2AHS A;  1JLN A;  4WOH A;  2F6Y A;  1NNY A;  2VEV A;  1U26 A;  3OLR A;  4R0S A;  1NWE A;  1OEU A;  4R0T A;  1P15 A;  4HJQ A;  5EHR A;  2AZR A;  1XXP A;  3D44 A;  3QKP A;  4OHL A;  3EMU A;  3QCJ A;  5KA8 A;  1GWZ A;  3NME A;  2CM8 A;  4ZN5 A;  1XXV A;  2QBR A;  2C46 A;  5I6V A;  4QAP A;  3ZM0 A;  1PA1 A;  2E0T A;  2NT2 A;  2A3K A;  3AWE A;  1YWF A;  1YFO A;  4NX8 A;  3F81 A;  3A5K A;  4D3Q A;  2F6T A;  2B3O A;  5K9V A;  5EHP A;  5KA2 A;  2YDU A;  1U24 A;  4HJP A;  2H03 A;  2FH7 A;  5AWX A;  1PTU A;  2CNF A;  2CM3 A;  4DGX A;  2H4G A;  3QKQ A;  2C7S A;  2I6M A;  1NO6 A;  2HB1 A;  4GWF A;  4AZ1 A;  2CJZ A;  1L8K A;  1M3G A;  2BGE A;  4PVG A;  5LXQ B;  3D42 A;  3QCC A;  2CMB A;  2F6V A;  3CM3 A;  5K23 A;  2ZMM A;  1PTY A;  3H2X A;  3QCG A;  2CNI A;  3MOW A;  4RHG A;  3S3E A;  2HNQ A;  2CM7 A;  2I3R A;  2F6W A;  2H4K A;  4GRY A;  5K22 A;  1D5R A;  2B4O A;  3I80 A;  1L8G A;  1FPZ A;  2ZN7 A;  4YAA A;  3EAX A;  1I57 A;  2CM2 A;  2Q47 A;  2P4D A;  3F9B A;  3QCL A;  4GE6 A;  4NWF A;  2PSZ A;  2B07 A;  1PA9 A;  1U25 A;  1G4W R;  1G7F A;  2I75 A;  1BZJ A;  2NLK A;  3V0D A;  2I4G A;  3F9A A;  3PS5 A;  1BZC A;  3A5J A;  2A8B A;  1T4J A;  4OHI A;  2CMA A;  2CNH A;  1WRM A;  3B7O A;  4YR8 B;  5J8R A;  3V0I A;  2RF6 A;  4S0G A;  3S4O A;  3QCK A;  5IBM A;  2J17 A;  1Q6N A;  1Q6M A;  3S4E A;  3O3L A;  1RPM A;  2R0B A;  2B49 A;  2JJD A;  5GTJ A;  1NWL A;  3SME A;  2VEY A;  2OUD A;  5BZX A;  1OES A;  3O4S A;  3V0G A;  2NT7 A;  1OHC A;  3ZM3 A;  4ERC A;  2H04 A;  1I9T A;  4QBE A;  3V0H A;  1ZC0 A;  4JNB A;  1OEO X;  1ONZ A;  2QCJ A;  1G1F A;  2VEW A;  2GJT A;  2QBQ A;  3D9C A;  2GP0 A;  3D1H A;  1J4X A;  1G4U S;  5KAC A;  3M4U A;  4OHD A;  5KA3 A;  4RKK A;  4QUM A;  2VEX A;  1YN9 A;  2CFV A;  2QBP A;  1EEO A;  4WU3 A;  5K25 A;  3RZ2 A;  4DGP A;  3I36 A; 
#chains in the Genus database with same CATH topology
 4NND A;  2IMG A;  4D3R A;  1LYV A;  1GQQ A;  2I6P A;  3ZL8 A;  5KAB A;  3N0A A;  5MMZ B;  2PT0 A;  1ONY A;  3AWF A;  1GG4 A;  4JMJ A;  4TVV A;  4QF5 A;  3AWG A;  1EEN A;  1O5Z A;  1T49 A;  1YTN A;  3EU0 A;  1XBO A;  1PYN A;  2GC5 A;  2XPC A;  4NYH A;  2PI7 A;  3MOZ A;  2PQ5 A;  1OEV A;  4ZI4 A;  5BUG A;  2HCM A;  4JBC A;  1OEM X;  3V0F A;  1C86 A;  5K9W A;  1ZCL A;  3EB1 A;  2I6O A;  2FJM A;  2M3V A;  5K24 A;  3ZMP A;  4KYQ A;  4RI4 A;  1NL9 A;  4KI9 A;  1C84 A;  4I8N A;  1LAR A;  2FJN A;  1X24 A;  1OHD A;  2BIJ A;  3GXG A;  2HC1 A;  2P6X A;  1QZ0 A;  1AAX A;  2I5X A;  5KA4 A;  2QDC A;  2I4E A;  2I4H A;  4GFV A;  3QCB A;  3QCN A;  1Q1M A;  5M43 A;  1C88 A;  2HNP A;  1W78 A;  1C87 A;  2VEU A;  3QCD A;  1P31 A;  3ZM2 A;  4CVK A;  2I6I A;  4RI5 A;  2J16 B;  1ZCK A;  2F71 A;  1NZ7 A;  2Y67 A;  1KAK A;  1JF7 A;  2NV5 A;  4H34 A;  2Y68 A;  1YGR A;  3D1O A;  2G6Z A;  4BJO A;  2ESB A;  3F41 A;  4GFU A;  2BV5 A;  2VTD A;  2I1Y A;  4MBB A;  4R30 A;  2F6F A;  3BLU A;  4QBW A;  4ZRT A;  4HRF A;  1PXH A;  2CNE A;  2H4V A;  1G1H A;  4H1O A;  3MVN A;  1Q6T A;  1ZZW A;  1BZH A;  1PTT A;  1PH0 A;  2OZ5 A;  5KAA A;  1PTV A;  3ZV2 A;  2MBC A;  5HDE A;  1YTS A;  4GE2 A;  1I9S A;  3QCF A;  4ICZ A;  2H02 A;  2HY3 A;  3O4U A;  2OC3 A;  1Q6J A;  1YZ4 A;  2F6Z A;  3QCM A;  2WTZ A;  3ZMQ A;  1WCH A;  4RH5 A;  1V3A A;  1P3D A;  3QCE A;  2WGP A;  1T48 A;  1MKP A;  3V0E A;  1Q6P A;  1A5Y A;  3RGQ A;  5KA1 A;  1R6H A;  1OET A;  3NRS A;  5KA0 A;  3V0J A;  1GFY A;  3D1Q A;  1ECV A;  3BRH A;  2B4U A;  4UAG A;  1C83 A;  2HVL A;  5IBS A;  2Q05 A;  2Y96 A;  3RGO A;  2NTA A;  2PBN A;  1LQF A;  4BPC A;  2B4S A;  2BGD A;  3O4T A;  4WU2 A;  4CVL A;  2I3U A;  1KAV A;  4B04 A;  1XRI A;  1EEH A;  1UAG A;  3U96 A;  5KA7 A;  1G7G A;  4OHH A;  4KYR A;  5BX1 A;  3MMJ A;  4GS0 A;  3QCH A;  3S3F A;  2GCB A;  3ZM1 A;  1XM2 A;  1YTW A;  5BZZ A;  3BLT A;  3QCI A;  4Z6B A;  4OHE A;  2F46 A;  2QEP A;  2GWO A;  4Y2E A;  4RDD A;  4WTY A;  2NZ6 A;  2I42 A;  2DXP A;  1SUG A;  2G59 A;  1FPR A;  2J16 A;  2BZL A;  2QDP A;  3N2A A;  3BM8 A;  4QUN A;  2I6J A;  2CNG A;  4Y14 A;  1QXK A;  3LJ8 A;  3RO1 A;  5KAD A;  1YPT A;  1Q6S A;  3ZM6 A;  5A5F A;  1W7K A;  5A5E A;  3OMH A;  4GE5 A;  3CWE A;  1VHR A;  1YGU A;  4GRZ A;  2QDM A;  4RH9 A;  4NWG A;  1C85 A;  5KA9 A;  3F99 A;  4J51 A;  2JFG A;  2PA5 A;  2HC2 A;  3S3K A;  2B4P A;  2CMC A;  2SHP A;  4QAH A;  4D3P A;  4JMK A;  1RXD A;  3EZZ A;  4IKC A;  1JBW A;  2F70 A;  3S3H A;  3SR9 A;  1OHE A;  2WJP A;  2Y2F A;  3GXH A;  1FQ1 A;  1WAX A;  4PYH A;  2QBS A;  3I7Z A;  1G1G A;  2QCT A;  2HXP A;  2OOQ A;  3O5X A;  2AHS A;  1JLN A;  4WOH A;  2F6Y A;  1NNY A;  2VEV A;  1U26 A;  3OLR A;  4R0S A;  1NWE A;  1OEU A;  2UUO A;  4R0T A;  1P15 A;  4HJQ A;  5EHR A;  2AZR A;  1XXP A;  3D44 A;  3QKP A;  2VTE A;  4OHL A;  3EMU A;  3QCJ A;  5KA8 A;  3PYZ A;  2GCA A;  1GWZ A;  3NME A;  2CM8 A;  4ZN5 A;  1XXV A;  2QBR A;  2C46 A;  5I6V A;  4QAP A;  3ZM0 A;  1PA1 A;  2E0T A;  2NT2 A;  2A3K A;  3AWE A;  1YWF A;  1YFO A;  4NX8 A;  3F81 A;  2X5O A;  3A5K A;  2JFF A;  4D3Q A;  2F6T A;  4BUB A;  2B3O A;  5K9V A;  4BUC A;  2Y1O A;  5EHP A;  5KA2 A;  2YDU A;  1U24 A;  4HJP A;  2H03 A;  2FH7 A;  5AWX A;  1PTU A;  2CNF A;  2CM3 A;  4DGX A;  2H4G A;  3QKQ A;  2C7S A;  2I6M A;  1NO6 A;  2HB1 A;  4GWF A;  4AZ1 A;  2CJZ A;  1L8K A;  1E8C A;  1M3G A;  2BGE A;  4HV4 A;  4PVG A;  5LXQ B;  3D42 A;  3QCC A;  2CMB A;  2F6V A;  3CM3 A;  5K23 A;  3LK7 A;  2ZMM A;  1PTY A;  3H2X A;  3QCG A;  2CNI A;  3MOW A;  4RHG A;  3S3E A;  2HNQ A;  3ZM5 A;  2CM7 A;  2I3R A;  2F6W A;  2H4K A;  4GRY A;  5K22 A;  2AM2 A;  1D5R A;  2B4O A;  3I80 A;  1L8G A;  1FGS A;  3HN7 A;  1FPZ A;  2UUP A;  2ZN7 A;  4YAA A;  3EAX A;  2VOR A;  3QCZ A;  1I57 A;  4C12 A;  2CM2 A;  1E0D A;  2Q47 A;  2P4D A;  3F9B A;  3QCL A;  4GE6 A;  4NWF A;  3UAG A;  2PSZ A;  2B07 A;  1PA9 A;  1U25 A;  2Y66 A;  1G4W R;  1G7F A;  2I75 A;  1BZJ A;  2GC6 A;  2NLK A;  3V0D A;  2I4G A;  4ZIY A;  1JBV A;  3F9A A;  3PS5 A;  1BZC A;  3A5J A;  2A8B A;  1T4J A;  4OHI A;  2CMA A;  2CNH A;  2F00 A;  1WRM A;  3B7O A;  4YR8 B;  5J8R A;  3V0I A;  2RF6 A;  4S0G A;  3S4O A;  3QCK A;  5IBM A;  2J17 A;  1Q6N A;  1Q6M A;  3S4E A;  3O3L A;  1RPM A;  4CVM A;  2JFH A;  2R0B A;  2XJA A;  2B49 A;  2JJD A;  5GTJ A;  1NWL A;  3SME A;  2VEY A;  2OUD A;  5BZX A;  1OES A;  2VOS A;  3O4S A;  3V0G A;  2NT7 A;  1OHC A;  3ZM3 A;  4ERC A;  2H04 A;  1I9T A;  4QBE A;  3V0H A;  1ZC0 A;  4JNB A;  4QDI A;  1OEO X;  1ONZ A;  4C13 A;  2QCJ A;  1G1F A;  2VEW A;  2GJT A;  2QBQ A;  2AM1 A;  3D9C A;  2GP0 A;  3D1H A;  1J4X A;  1G4U S;  5KAC A;  3M4U A;  4OHD A;  5KA3 A;  4RKK A;  4QUM A;  2VEX A;  1YN9 A;  2CFV A;  2QBP A;  1GQY A;  1EEO A;  1J6U A;  4WU3 A;  5K25 A;  3RZ2 A;  4DGP A;  3I36 A;  2UAG A; 
#chains in the Genus database with same CATH homology
 4NND A;  2IMG A;  4D3R A;  1LYV A;  2I6P A;  5KAB A;  3N0A A;  5MMZ B;  2PT0 A;  1ONY A;  3AWF A;  4JMJ A;  4TVV A;  3AWG A;  1EEN A;  1T49 A;  1YTN A;  3EU0 A;  1XBO A;  1PYN A;  4NYH A;  2PI7 A;  3MOZ A;  2PQ5 A;  1OEV A;  4ZI4 A;  5BUG A;  2HCM A;  4JBC A;  1OEM X;  3V0F A;  1C86 A;  5K9W A;  1ZCL A;  3EB1 A;  2I6O A;  2FJM A;  2M3V A;  5K24 A;  3ZMP A;  4KYQ A;  4RI4 A;  1NL9 A;  4KI9 A;  1C84 A;  4I8N A;  1LAR A;  2FJN A;  1X24 A;  1OHD A;  2BIJ A;  3GXG A;  2HC1 A;  2P6X A;  1QZ0 A;  1AAX A;  2I5X A;  5KA4 A;  2QDC A;  2I4E A;  2I4H A;  4GFV A;  3QCB A;  3QCN A;  1Q1M A;  5M43 A;  1C88 A;  2HNP A;  2VEU A;  1C87 A;  3QCD A;  3ZM2 A;  2I6I A;  4RI5 A;  2J16 B;  1ZCK A;  2F71 A;  1NZ7 A;  1KAK A;  1JF7 A;  2NV5 A;  4H34 A;  1YGR A;  3D1O A;  2G6Z A;  4BJO A;  2ESB A;  3F41 A;  4GFU A;  2BV5 A;  2I1Y A;  4MBB A;  4R30 A;  2F6F A;  3BLU A;  4QBW A;  4ZRT A;  4HRF A;  1PXH A;  2CNE A;  2H4V A;  1G1H A;  4H1O A;  1Q6T A;  1ZZW A;  1BZH A;  1PTT A;  1PH0 A;  2OZ5 A;  5KAA A;  1PTV A;  3ZV2 A;  2MBC A;  5HDE A;  1YTS A;  4GE2 A;  1I9S A;  3QCF A;  4ICZ A;  2H02 A;  2HY3 A;  3O4U A;  2OC3 A;  1Q6J A;  1YZ4 A;  2F6Z A;  3QCM A;  3ZMQ A;  1WCH A;  4RH5 A;  1V3A A;  3QCE A;  2WGP A;  1T48 A;  1MKP A;  3V0E A;  1Q6P A;  1A5Y A;  3RGQ A;  5KA1 A;  1R6H A;  1OET A;  5KA0 A;  3V0J A;  1GFY A;  3D1Q A;  1ECV A;  3BRH A;  2B4U A;  1C83 A;  2HVL A;  5IBS A;  2Q05 A;  2Y96 A;  3RGO A;  2NTA A;  2PBN A;  1LQF A;  4BPC A;  2B4S A;  2BGD A;  3O4T A;  4WU2 A;  2I3U A;  1KAV A;  4B04 A;  1XRI A;  3U96 A;  5KA7 A;  1G7G A;  4OHH A;  4KYR A;  5BX1 A;  3MMJ A;  4GS0 A;  3QCH A;  3S3F A;  3ZM1 A;  1XM2 A;  1YTW A;  5BZZ A;  3BLT A;  3QCI A;  4Z6B A;  4OHE A;  2F46 A;  2QEP A;  2GWO A;  4Y2E A;  4RDD A;  4WTY A;  2NZ6 A;  2I42 A;  2DXP A;  1SUG A;  2G59 A;  1FPR A;  2J16 A;  2BZL A;  2QDP A;  3BM8 A;  4QUN A;  2I6J A;  2CNG A;  4Y14 A;  1QXK A;  3LJ8 A;  3RO1 A;  5KAD A;  1YPT A;  1Q6S A;  3OMH A;  4GE5 A;  3CWE A;  1VHR A;  1YGU A;  4GRZ A;  2QDM A;  4RH9 A;  4NWG A;  1C85 A;  5KA9 A;  3F99 A;  4J51 A;  2PA5 A;  2HC2 A;  3S3K A;  2B4P A;  2CMC A;  2SHP A;  4QAH A;  4D3P A;  4JMK A;  1RXD A;  3EZZ A;  4IKC A;  2F70 A;  3S3H A;  3SR9 A;  1OHE A;  2Y2F A;  3GXH A;  1FQ1 A;  1WAX A;  4PYH A;  2QBS A;  3I7Z A;  1G1G A;  2QCT A;  2HXP A;  2OOQ A;  3O5X A;  2AHS A;  1JLN A;  4WOH A;  2F6Y A;  1NNY A;  2VEV A;  1U26 A;  3OLR A;  4R0S A;  1NWE A;  1OEU A;  4R0T A;  1P15 A;  4HJQ A;  5EHR A;  2AZR A;  1XXP A;  3D44 A;  3QKP A;  4OHL A;  3EMU A;  3QCJ A;  5KA8 A;  1GWZ A;  3NME A;  2CM8 A;  4ZN5 A;  1XXV A;  2QBR A;  2C46 A;  5I6V A;  4QAP A;  3ZM0 A;  1PA1 A;  2E0T A;  2NT2 A;  2A3K A;  3AWE A;  1YWF A;  1YFO A;  4NX8 A;  3F81 A;  3A5K A;  4D3Q A;  2F6T A;  2B3O A;  5K9V A;  5EHP A;  5KA2 A;  2YDU A;  1U24 A;  4HJP A;  2H03 A;  2FH7 A;  5AWX A;  1PTU A;  2CNF A;  2CM3 A;  4DGX A;  2H4G A;  3QKQ A;  2C7S A;  2I6M A;  1NO6 A;  2HB1 A;  4GWF A;  4AZ1 A;  2CJZ A;  1L8K A;  1M3G A;  2BGE A;  4PVG A;  5LXQ B;  3D42 A;  3QCC A;  2CMB A;  2F6V A;  3CM3 A;  5K23 A;  2ZMM A;  1PTY A;  3H2X A;  3QCG A;  2CNI A;  3MOW A;  4RHG A;  3S3E A;  2HNQ A;  2CM7 A;  2I3R A;  2F6W A;  2H4K A;  4GRY A;  5K22 A;  1D5R A;  2B4O A;  3I80 A;  1L8G A;  1FPZ A;  2ZN7 A;  4YAA A;  3EAX A;  1I57 A;  2CM2 A;  2Q47 A;  2P4D A;  3F9B A;  3QCL A;  4GE6 A;  4NWF A;  2PSZ A;  2B07 A;  1PA9 A;  1U25 A;  1G4W R;  1G7F A;  2I75 A;  1BZJ A;  2NLK A;  3V0D A;  2I4G A;  3F9A A;  3PS5 A;  1BZC A;  3A5J A;  2A8B A;  1T4J A;  4OHI A;  2CMA A;  2CNH A;  1WRM A;  3B7O A;  4YR8 B;  5J8R A;  3V0I A;  2RF6 A;  4S0G A;  3S4O A;  3QCK A;  5IBM A;  2J17 A;  1Q6N A;  1Q6M A;  3S4E A;  3O3L A;  1RPM A;  2R0B A;  2B49 A;  2JJD A;  5GTJ A;  1NWL A;  3SME A;  2VEY A;  2OUD A;  5BZX A;  1OES A;  3O4S A;  3V0G A;  2NT7 A;  1OHC A;  3ZM3 A;  4ERC A;  2H04 A;  1I9T A;  4QBE A;  3V0H A;  1ZC0 A;  4JNB A;  1OEO X;  1ONZ A;  2QCJ A;  1G1F A;  2VEW A;  2GJT A;  2QBQ A;  3D9C A;  2GP0 A;  3D1H A;  1J4X A;  1G4U S;  5KAC A;  3M4U A;  4OHD A;  5KA3 A;  4RKK A;  4QUM A;  2VEX A;  1YN9 A;  2CFV A;  2QBP A;  1EEO A;  4WU3 A;  5K25 A;  3RZ2 A;  4DGP A;  3I36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...