2Q4BA

Ensemble refinement of the protein crystal structure of selenomethionyl gene product from arabidopsis thaliana at5g02240 in space group p21212
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
243
Chain Sequence
b'SANLPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGTSTPTKDFKALFSQVTSRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein At5g02240
molecule tags Structural genomics, unknown function
source organism Arabidopsis thaliana
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
total genus 72
structure length 243
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q4bA00
1H6AA 1ZO8A 4MP8A 4WPGA 3ADPA 1JVSA 3QP9A 3VPHA 3F46A 3H7AA 1KVQA 3QWFA 4D46A 3RBVA 5JAQA 1PIWA 3MJ4A 2YV1A 4FC6A 4GVLA 4ND3A 4N5NA 3U4DA 5I7SA 4XCVA 5CP8A 1CRWG 2CF6A 3CEAA 2O3TA 1HDOA 3S2IA 1H9AA 2WMDA 4Q39A 3V8BA 3VAZA 4ND5A 3JQFA 3OP4A 1LDYA 1ZH8A 4CMEC 3LK7A 1P44A 3JQ6A 2VWHA 1BHSA 2NQTA 4ND4A 3G49A 4BNGA 3ASVA 3WOHA 1MC4A 5ER9A 1HDXA 4WEOA 1ZCJA 4DC0A 5KVSA 3GLQA 4DTIA 4E21A 1E7MA 1MUUA 1JDJA 1OI7A 1B2LA 2EGGA 3F1KA 5DOZA 5IDYA 1Q0LA 3E5RA 3DMTA 4FN4A 1Z74A 3DFZA 2DPHA 4I5EA 1EDOA 1LDGA 3OBBA 4B3IA 4NZ9A 1MFZA 2J5RA 1LQTA 2NU6A 1U5CA 3IJPA 4UEKA 2I76A 4NBWA 2ZATA 5JPIA 1XWFA 1KERA 1DIAA 5G4KA 4CM6A 2VT3A 2I9PA 3I52A 1LJ8A 4BS9A 3KLMX 2CMDA 3UCXA 2FZWA 4RO0A 2J5KA 1RWBA 2DAPA 5TS3A 4FS3A 1ZSVA 3UN1A 2VOJA 4BO5A 2EJWA 2GN6A 1XIVA 4TSKA 4OYRA 3ZWNA 1VL6A 3KZVA 2GD1O 1UH5A 3C7AA 4MKXA 3ROMA 2B4QA 1ISGA 3JYOA 2JFGA 4E5PA 2DUUA 3VZQA 5KTKA 3C1TA 4Q3AA 5F1OA 3LQFA 4M86A 4Y6SA 1LDMA 4WECA 1M67A 2O3SA 3CZMA 3PIDA 3PWSA 1I2ZA 5DF1A 4W4TA 3D5TA 4AJIA 4AJOA 3VPFA 2PKQP 3QVSA 4JBHA 5G0TA 1YBVA 2XXJA 1WMAA 4QUKA 5K9ZA 3ITKA 2DQ4A 2ZCUA 1T1SA 3GUCA 2ZIZA 3NGXA 5COQA 1P1FA 3GH3A 5DBIA 4FW8A 1ZMOA 4WLUA 4OKIA 1HETA 2Y1GA 5G0SA 3NX4A 4ROSA 4J16A 3V2UA 3VVBA 3OQ1A 4CUZA 3W8FA 4RF5A 2X1HA 5A3JA 5JW6A 4MVJD 4BGUA 1D3AA 1J5PA 4FPXA 4EI2A 4ZA2A 5C7IO 4R9RA 1DBVO 3A06A 4B79A 4XQEA 3TOZA 4CMBA 3ZWMA 3VDQA 1XLTA 4I5GA 4CQMD 1HDRA 2J3KA 1LSJA 4A26A 1FF9A 3PPIA 2RHRA 4WLFA 3H9JA 4D44A 1ENOA 1Z7BA 3H9QA 4YQZA 4R1UA 4O5OA 1MC5A 3JYQA 4U0JA 3GMDA 3ADOA 3INTA 3LC1O 4BO8A 3I9OA 2Q99A 4PLFA 4UUPA 4Y9DA 4N5LA 3HFGA 1MXHA 1AXGA 5ICSA 1WDMA 2O4UX 4EEZA 1GTMA 2Y67A 3FHLA 1NP3A 3PQFA 3F5QA 3GA0A 5TJHA 4XDZA 2NU9A 4BNNA 4WNIA 1P0CA 4IQ8A 4QQRA 1KETA 3OIFA 1F12A 2Y05A 3GZ4A 3UGKA 1BVUA 1PQWA 1MB4A 5L4LA 2J3IA 3H3FA 4JBIA 5A3VA 2DBVO 5EIOA 4D42A 4FR5A 4FFMA 4MIOA 1U1IA 4JJIA 5JNLA 2A4KA 1ZJYA 4NHEA 3HDQA 3RKUA 3ANMA 1J4AA 4YCAA 5EN4A 7ADHA 1RPNA 2JJYA 1HT0A 3AU8A 5DP2A 1HWYA 5T57A 3DOOA 4BO7A 1GADO 4GI2A 3OQ6A 1VSVA 1LRLA 2FY8A 3HB4X 2PZLA 2C7VA 4Z3KA 2Q2VA 2GF2A 3KYDA 1WP4A 2IZ1A 2RHCA 1ZK2A 1L1FA 3STHA 5IXSA 1DC6A 2QW8A 4BO4A 3PJFA 4YR9A 3KYBA 1ISFA 3QWAA 4J1SA 3K73O 1SCUA 2C29D 5DDIP 4L75A 4YJGB 3A1NA 1M6WA 4DQVA 1N9GA 1UUFA 4A7PA 4J9VA 1BVRA 2Q1SA 2PD3A 4H16A 3EZLA 4BGIA 5CEJA 1PJCA 3HE3A 1KVSA 1C1XA 4IDFA 4UREA 1J49A 2OBYA 5KJ1A 1EVIA 4HADA 3NYWA 3H6KA 1XDWA 3DEYX 1EK5A 3Q3CA 1OMOA 5DCUA 2DT5A 3PHGA 2ZTMA 2B69A 5ENVA 3BMCA 4OXKA 3AUUA 3OSUA 3S2FA 3JQFC 4YAGA 1NPYA 2FN7A 2CUKA 2DFDA 5DBGA 3TZCA 1EEHA 4BMSA 1ZUD1 5HTOA 5U1PA 2Q46A 1EMDA 4JQCA 4KTTE 3IP1A 2UVDA 3VOSA 3HFSA 3KHUA 3RFXA 1UR5A 3U5TA 2G17A 1NPTO 3RU9A 1O89A 5U9CA 3DZHA 3WFIA 3WLFA 1R12A 4XX0A 3DOJA 4BNTA 3DXFA 4CLOA 1DRUA 3KUXA 1P9LA 4FFLA 4PLHA 1CF2O 2VTEA 1SNYA 4IDGA 1XQ1A 3D4NA 3JQAB 3ZH2A 1IL0A 1B8PA 4RLHA 3GN1A 5DZSA 1DFHA 3RIHA 1HDYA 3WSVA 1LTHR 3UCEA 5I9NA 1K6XA 1ULSA 1ONNA 3HSKA 1EE9A 3ZV3A 3G79A 3ONEA 4BKUA 4XRGA 3K2BA 5G4LA 4PLYA 3KYDB 5L7YA 4YXFA 3BZUA 3IIEA 1F14A 2PK3A 4KP7A 1WZEA 4IS2A 4GGPA 1RM5A 3I4FA 2XXBA 4TRNA 4XYLA 1QYCA 4D45A 3H5AA 4MVJI 5IG2A 1YB4A 1EUDA 3KXDA 3VZRA 1H9BA 4UVEA 4OQZA 5IN4A 4TROA 4A0SA 4Y6RA 2CDCA 2J3HA 2YJZA 1YKFA 4GPD1 3N74A 2NLOA 5A9SA 3EDMA 3T4XA 4Z3DA 1N7HA 1UXIA 1H6DA 4AJJA 3LC7O 4GH5A 1ZIDA 4UEOA 1YDEA 4CR6A 3UHAA 1N9GB 1R6DA 2VHZA 3BMQA 3R0IA 3WXBA 3EYWA 4DPLA 5EMHA 3AUTA 5AVOA 2Q49A 4WEQA 1CDOA 3BIOA 3JQGA 3TJRA 3DQPA 1L7DA 3ZI0A 3U4IA 4U6QA 1NNUA 4J7XA 5JO0A 5A03A 3EZYA 1GYQA 4XQGA 1KEWA 1PGJA 1ENYA 1TT5B 2AG5A 3Q9NA 4Q3NA 3PDUA 5L95A 5JCJD 4IUYA 1F8FA 3NV9A 2YHIB 2X5JO 2DVMA 2SCUA 1DPGA 3WQSB 2QYSA 4FSHA 3KEOA 1KOLA 3HNPA 1TA4A 3OEWA 2I99A 5KJEA 3Q1LA 4AJ1A 4B7XA 3IKTA 3JD4A 1LNQA 3PWKA 4FOOA 2AQKA 5JY6A 1NVTA 3NRCA 3E82A 2P9EA 4GX0A 1DAOA 1M75A 3OJFA 3W6UA 2FRDA 2NVUB 4UULA 1CETA 4QFDA 4RPKA 3WICA 5B1YA 1GR0A 2H5LA 2B35A 2D59A 1M6HA 2I67A 4OJNA 4HY3A 3WIEA 2NNLD 3CMCO 6LDHA 3F47A 3V1YA 4GSKA 1CERA 1AGNA 3AI3A 3WTBA 2QHXA 5G4KB 4HBGA 2POQX 3NTRA 4R4JA 3LU1A 2O23A 4PVCA 3VZPA 4Y98A 3DAPA 2P4HX 3E9QA 3MWDB 1T2AA 1X7GA 5CG2A 4JIGA 4CM4B 4H7PA 2O50A 5KWEA 1V0JA 1GPJA 3RBZA 4U8GA 1OC4A 3EAGA 3GVHA 1NQTA 4JNKA 4IM7A 3O9ZA 3QA9A 3MWEB 3U62A 3S8MA 1EK6A 3LF2A 4NU5A 4MJLA 4P4GA 1K89A 1GD1O 4YT4A 3H4VA 3I83A 4S1VA 3B1FA 4DQUA 4C7JA 3OH8A 2PGJA 3O8QA 5TJ9A 4C4OA 3OHSX 2EW2A 4Y67A 4BQRA 4I1IA 4RZHA 4BNMA 2QG4A 4ND2A 2AEJA 1HE3A 4AG3A 5IZCC 3JQ9A 4OL9A 4O63O 5H83A 4B4OA 1WLYA 2Y1CA 5KJCA 4BGEA 1P1HA 4D0SA 2EHDA 4O59O 4W7HA 1ZK4A 4RPJA 1YO6A 4DIOA 1NR1A 3H9EO 2AQHA 4YYZA 2V6FA 2YY7A 2P5UA 3ZHYA 3O38A 4MP3A 4F45A 2P9CA 4XEHA 4KWIA 3WX0A 4NK5A 5ENDA 3HJAA 3ZGYA 4FD3A 1EDZA 5JAMA 3SJ7A 2PKRA 2UDPA 2DC1A 1GYPA 1NQ5A 1SMKA 1SO8A 3E6AA 2FOIA 3GAZA 5A5EA 5FF9A 4QFCA 3BHIA 4IY1A 5C7OO 2V6MA 3FI9A 4HNHA 4UUMA 4HXYA 4WK6A 2O3RA 1U9JA 1C3VA 4PZDA 2H6EA 1QR6A 4R01A 3VH4A 1EBFA 1UP7A 4FFPA 2LDXA 1EFLA 3E48A 1KY4A 2EXXA 5TC4A 2WTBA 3X2FA 5A9SB 4Q3DA 2O3UA 1U5AA 4PRLA 1SB9A 1U7HA 4B4VA 4YEDA 1JAXA 5TQVA 3KSUA 3ONFA 1YB1A 5FEUA 5TLSA 1QG6A 1QP8A 1UAGA 2PA3A 3MJTA 4PGFA 3RUDA 3F1LA 4D3FA 4EW6A 1FDSA 2IDZA 5TGDA 1ADBA 3KSDO 1OOEA 1BG6A 2PV7A 4QO7A 3DBVO 3ZHXA 3ZNPA 3ETEA 3L9WA 1P1RA 2BFOA 2A35A 4MP6A 1GCOA 3JTMA 3R6DA 3DBLB 1MG0A 4YA6A 3ZV5A 4D41A 1O94A 4FFNA 1UXHA 4RVHA 3U4HA 3E8XA 4FOSA 3NUGA 2X5KO 4R68A 1GV0A 1ID1A 1IY8A 5T5QA 3KM0A 2RAFA 2EG9A 3NDJA 5CEEA 1PX0A 5HRUA 4E5KA 1ZSNA 1HLPA 1DIBA 2YW9A 3DBHA 3MJVA 1NAIA 1O8CA 2VZ0A 2IXAA 5GMOA 3H9GA 5L53A 1NBOA 3RC9A 4YPOA 2FSVA 2Q3EA 4XDYA 2X5OA 5FYDA 1GEGA 1ZVMA 4BB6A 4DA9A 4TRMA 3V1UA 3VVCA 3L0DA 4E6PA 1B26A 3OETA 3TFQA 4CMHA 1SEPA 1QMGA 3GF4A 2DPGA 5GZ1A 4CLOB 2VUUA 1N1EA 1EE2A 3FCOA 1DJQA 2HLPA 4BIIA 5KJFA 4P4LA 5L9AA 4OGWA 2X8LA 2E4AA 4DMMA 1PL7A 4AFNA 3P19A 4DYVA 5MDHA 4R54A 3DZGA 1NVMB 3JQGB 4F3YA 1XR3A 4CQLA 1CYDA 3C7DB 3ZV4A 3BXXA 2YQ4A 4EEXA 2AQ8A 1ISJA 1T2FA 1RM4A 5L4SA 2PLAA 2X86A 1V3UA 1C0KA 3TSCA 3ZN2A 3E03A 3JQAD 4K28A 1ZMTA 1UZMA 3GZNA 2Y66A 3ENKA 2XOXA 2UV8A 2HK8A 1LX6A 3OA0A 1YJ8A 1X0VA 4D43A 3QVWA 1IZ9A 3VH1A 4BHTA 3H5NA 1VPDA 4TZKA 1I32A 3RJ9A 1E0DA 3G3EA 4YJHA 5FWNA 3AM4A 5LC1A 2PD4A 3JYLA 4BO6A 4R5HA 4DBVO 2J3JA 5CPFA 2VYVA 4MVJF 2VT2A 2V65A 2NTJA 1GUFA 4Z9XA 2BD0A 4AJPA 3L4BA 1W73A 3FF4A 1H94A 2NV6A 1OFGA 2Q50A 5THQA 2V6BA 4BOYA 2B83A 4BQPA 2X0IA 1E7SA 2C2YA 1LQUA 2HMUA 4DUPA 5ES3A 2HCTA 4TQGA 1BSVA 4IJUA 1A7AA 4LMRA 4II2A 3DZIA 4RDIA 5CG1A 2Z5LA 1PJ3A 5KIAA 4GWGA 3RU7A 4EDFA 1X0XA 4R1SA 4CV2A 1LDNA 5IZCA 2Y0CA 2OP0A 3I4CA 4Z6KA 2WD7B 5AOVA 2X22A 4DVJA 5G2OA 4D79A 9LDBA 2LDBA 4XKJA 1E1KA 1B3RA 3B70A 3IC5A 4WLVA 3QV1A 4R16A 4CJXA 4JGBA 2NSDA 2NVBA 2E48A 2BRUA 1YGYA 1TLTA 1Y8RB 4WOKA 4CM9A 2O2SA 1PSDA 4YRAA 3IKVA 5IN5A 2C2XA 3MTJA 1PEDA 1XA0A 3EUWA 3RASA 3BYZA 1VC2A 1R37A 2Z95A 5T6BA 4PG5A 4YAJA 4B7CA 3D4OA 5JC8A 3IUPA 5L7WA 4DWVA 1GAEO 3GVIA 1KVRA 4YWJA 3UF0A 1ZK1A 4WKGA 1Z6ZA 4Z9FA 3ZHBA 5BNIA 1A5ZA 1LUAA 2EW8A 3TZ6A 4KWHA 1PS9A 3PLNA 2VQ3A 1G0NA 1Y1PA 1FMCA 4K6CA 3I3OA 4JJGA 5BSHA 1ZEMA 1IE3A 1UDCA 3K96A 4NBUA 1H2HA 5A06A 2EIHA 1AXEA 2YHIA 3E1KA 3DFUA 1GU7A 3DL2A 3HHPA 3AM3A 4YACA 2OL4A 4ALNA 3DMTC 4JLWA 3WWYA 4NBRA 4R3WA 2OGUA 2RH8A 5F1PA 2CY0A 5IJZA 3RFTA 2VUTA 1ISHA 1C1DA 3PHHA 3NT5A 2FSSA 3E9MA 4B8ZA 3KSZO 1BDMA 3KYCB 5L51A 1DIHA 3SVTA 2BF7A 4QTZA 4P22A 4OM8A 1NYTA 3A4VA 5TF4A 1R0KA 4NQZA 1HYHA 1QLHA 1T2DA 3WJ7A 3ZWWA 2JD2A 5A1TA 1YWGO 3PXXA 4WLEA 2FR8A 1AHIA 3TFOA 2EP5A 3MCVA 3WS7A 3ZWAA 2D1YA 3GNQA 5A05A 2ZTUA 5LDGA 4FFRA 2EF1A 4NI5A 3IP3A 2X9NA 5K6AC 4J43A 3AW9A 3TRIA 1IHXA 3GFBA 4MVJM 3PJDA 1KC1A 1K6JA 3MTGA 3DZKA 4CLHA 1JQBA 4DLBA 2CZCA 4HWKA 4L4RA 1Y5MA 3FNGA 4JX8A 1Y9EA 3D3EA 2GGSA 4RGBA 2P2SA 4AJEA 4J2HA 4PRKA 4A2CA 2HQ1A 3HADA 3NTOA 4OHUA 5T8KA 4XB1A 4R5MA 1LDEA 3T7EA 3QIVA 2Q1TA 5MGBA 2C82A 4FFOA 2GZ1A 4EITA 5THKA 1P3DA 2TMDA 4TWRA 3GOHA 5JYDA 3F3SA 3IOYA 4OOEA 2V7PA 3FBTA 4JP3A 2WE7A 4XJSA 4JCOA 4B7UA 3EMKA 1I3MA 5DCYA 4E5NA 4ILKA 1T26A 3GDOA 4WLOA 5ER6A 1X14A 4LSWA 5B37A 1U4SA 4WE3A 3KO8A 1X1TA 2Q45A 3RBXA 4CMJA 1B14A 4PLZA 4R3NA 3KETA 5GY7A 4XRRA 2WWRA 3D5QA 9LDTA 1EQ2A 3WLEA 3QHAA 4BO3A 1T1RA 3PHLA 2IYPA 1Z7EA 2B5VA 1X7DA 2DLDA 2P5YA 2X6TA 3GK3A 2RH4A 1V3VA 4BNWA 5CEFA 5U4QA 3G17A 4U0KA 1JA9A 4J7CA 1F8GA 1W6UA 4BV9A 2VHVA 5JDCC 3K6JA 4GKVA 5JY1A 2JCVA 1Q7BA 5A9TA 1HE5A 4L73A 4IDAA 3IQDB 4YJHB 3AI2A 1EUZA 3MOGA 5KVQA 1YONA 5JDIC 1XYGA 4CV0A 4XGNA 1EUCA 2PWZA 4C7KA 1A9ZA 3FNHA 2H1SA 2RIRA 3RSHA 4O0LA 2NQ8A 4GX5A 1IPEA 1H6BA 1AHHA 4GQAA 4YQYA 3VPSA 4A10A 1HDZA 1B0AA 2I3AA 4XR4A 6ADHA 3UH1A 1VJ1A 1Q0HA 1HL3A 1ARZA 2X23A 3JQAA 1I2BA 1KY5A 2OP1A 3BHMA 4HNGA 4IS3A 4CUJA 1BRMA 2HRBA 3ETDA 4YTEA 3UKOA 4Z0PA 4PLGA 1HF3A 4YDRA 1VJTA 4OIMA 3GY0A 1ZK3A 1PJSA 2B4RO 3OF2A 4LSMA 3NJ4A 4ZICA 3WGIA 1LSUA 1WMBA 1KVUA 2Q2WA 4ZRNA 1UDBA 1K3TA 5BQFA 1U3VA 2HMVA 1P1KA 4NBVA 4YT8A 4CMIB 4CQMA 3LSYA 1ORRA 3EVNA 2BELA 2X0RA 4WGGA 4LCJA 4B3HA 4ZQHA 5HBRA 2NACA 1R0LA 3KLPX 3GGGA 3ABIA 2ZKLA 3PRJA 2FP4A 1XU9A 4KUEA 1R4MB 4R69A 1TT5A 2HK9A 1E1NA 1H93A 3PHIA 2NU8A 1PJQA 3KVOA 1C0PA 2EWMA 3L77A 3VPXA 4E13A 3F4LA 1DLJA 1ADCA 4M87A 4EJ0A 4CQLB 1DFGA 4W82A 3NTQA 4ZHSA 2GRAA 4K9DA 3FWZA 3ZNQA 4EYEA 5KKAA 1A72A 3O8QB 2IODA 1U8XX 3FR8A 1R0SA 3HDYA 4OO3A 5HWSA 3ZU2A 3D3WB 2XAAA 1TT7A 4E2XA 4K6FA 5ADHA 4I5DA 2VWPA 4MKRA 4WJZA 3LT0A 4CMGA 2BFMA 3HWRA 3D4PA 4RVUA 1B7GO 1L7EA 4RORA 5F21A 2WSBA 1V8BA 4PG8A 3ONDA 4XGKA 5EPOA 5HS4A 4BB5A 4JBGA 3AJRA 1M76A 1I3NA 4KOAA 2Q4BA 3ROKA 3U4CA 3WNQA 5AQ1A 2HRZA 1YBAA 5TSDA 3S2GA 1CWUA 2EERA 1C0LA 4PVDA 4PFJA 2PGLA 2GSDA 2WD8A 1RM3A 1S6YA 1HLDA 1LDBA 3NKLA 5JSFA 1NM5A 4ZN6A 3C85A 1JWAB 5KKCA 2FHSA 3AY6A 4J9UE 4M8SA 1PS0A 1V35A 2UYYA 4I9UA 3DWFA 4NJMB 4CUKA 3HZZA 2X58A 4M89A 1G6KA 1XHLA 4NFSA 1FXSA 1VL8A 1U3UA 3BMNA 2HUNA 4HFRA 1HDGO 5JCJA 1NFRA 1E7WA 2DFVA 4H3VA 4XIJA 2VTDA 4BNYA 3VZSA 1DIGA 5JBIA 2B5WA 2EKQA 2NTVA 4AJNA 4KTVE 4XYEA 1JKIA 3H5RA 4YT5A 1AUPA 1MX3A 3ZU5A 5EQDA 1PL8A 1TVEA 4KDFA 1OAAA 3V2GA 5G0VA 4BMNA 4IGEA 4NH4A 2D0IA 4BNUA 1HSOA 4R1TA 1NAHA 1N5DA 2OUIA 4M1QA 1GPDG 2Z1NA 3GDFA 4PLCA 5COBA 2E49A 2ET6A 3TDKA 1YL7A 2AG8A 3LF1A 3JQ7A 1GDHA 1NQOA 4PG6A 1X7HA 3PFWO 3GQVA 3GVCA 3M2PA 3RFVA 2W2KB 5JAIA 4UVIA 3F6YA 2OXIA 3UCFA 1KVTA 1N1GA 3A14A 1IUKA 4DPMA 4GSLA 3OJEA 3OECA 1PZHA 2Y99A 2WDZA 4HP8A 3WFJA 5IDXA 1FDUA 4P8RA 4NK4A 1IOLA 3K8ZA 2IEBA 2F00A 3GPDG 5B12A 3HDHA 1A4IA 2WEKA 5F5NA 4NFHA 4J1TA 5BNFA 1QORA 4DIFA 1NXQA 1GZ4A 1Y6JA 2B4TO 3WIDA 4A73A 4CL3A 2PFGA 1I30A 3OEYA 3WR5A 1FK8A 4J6FA 1BMDA 3PIIA 2FMUA 1HXHA 1S7CA 3DBLA 3MJCA 2ZCVA 3K92A 1JN0A 3Q9UA 3GEGA 5G0UA 2EP7A 2GCGA 1LSOA 3PEFA 4ONEA 1NHWA 4L8VA 3WG9A 1YH3A 3IDSA 3PJGA 4TVBA 4BNKA 2HAEA 4Q3BA 3CIFA 4W6ZA 1A9YA 1IB6A 2C07A 4IQ0A 2JFHA 2AEFA 4WCFA 1EVJA 1PQPA 2W98A 3DZFA 4IMRA 4Z0HO 2Y1EA 3RJ5A 3SC4A 3ZWYA 3DO5A 4I08A 3AY3A 1E77A 3RWBA 3OJOA 2P91A 3E18A 3PLRA 1HEUA 2QRLA 1LU9A 3GHHA 1JTVA 3JQEA 1GQYA 3CZRA 4YRDA 3PP8A 1SEVA 3KRTA 3M6IA 1QV6A 2FWMX 4J49A 3FNFA 3ZV6A 4L4XA 1K0UA 4GLLA 3AI1A 2GASA 1VJ0A 2OOSA 5DCWA 4BO1A 4J2OA 4J0FA 4HV4A 1PGPA 4OSOA 1G1AA 4E30A 5KOIA 2HJRA 3HG7A 4EUHA 4LGVA 5JYEA 3CH6A 5CFZA 2ZQYA 2IZ0A 4XZ3A 1EVZA 2HK7A 3OFSA 2ZTVA 3I9LA 1UAYA 3ICPA 4IMPA 5JO9A 1MLDA 1W0CA 4MINA 5B4UA 4CLEA 1Y81A 5EERA 4JK3A 1LLDA 5CPBA 1IHYA 3H2ZA 4MVJH 5EINA 1NX6A 1X1EA 1WDLA 4UVGA 3OJLA 3ZZNA 1YVEI 1Y8QA 2O2YA 1MFPA 3WNVA 2PR2A 1A71A 4RQTA 4WOJA 4UVDA 3FPCA 4XJTA 3TQHA 1I10A 4CL8A 4HKTA 2WE8A 2CVQA 3INRA 4GWKA 4FBGA 3VC7A 2EEZA 1B3BA 3W6ZA 4JJFA 2BFAA 3JQDA 3ULKA 2X7HA 3MEQA 3JD2A 4DBZA 2QYTA 3H8VA 2DBQA 4XIYA 3IL2A 3D3WA 3S1LA 3ETGA 4Z0TA 3ZW8A 1F0YA 2YUTA 1YL5A 1QV7A 2DBRA 3RAJA 3D0OA 4G65A 2E6UX 1ZJZA 1ZEJA 4MVJA 1P45A 1XU7A 5BSFA 4ALKA 2ZB7A 1QYVA 5DP1A 1XGKA 4WUVA 3RC7A 4YAEA 1PGQA 3ZWPA 1BXKA 3GFGA 1PZGA 4LRTB 4JP2A 3R3JA 3I1JA 3OIGA 2XPCA 4TMFA 1QYDA 3Q2IA 4DXHA 3BMNB 5ILGA 1OZAA 3R3SA 5KCZA 1HZZA 4FJ2A 5I7FA 2OMEA 2PZMA 5JDIA 1H0KA 1U8FO 2O7QA 3BMQB 4HFNA 1OBFO 3A9WA 2CD9A 1U2GA 2D5CA 3KEQA 4RLSA 3WDSA 1UJMA 1HYGA 2YDXA 5GZ3A 5ICMA 4KMSA 4CMKA 5LCXA 2EJVA 3AOEA 5T64A 3AK4A 2GERA 3M1LA 1SOVA 2CVOA 4GKBA 3H65A 4NBTA 1N2SA 4W7IA 3ON5A 4CLRB 2O4CA 3HUDA 3OA2A 1LRKA 2BH9A 5HA5A 5F3RA 4LK3A 3O03A 2DM6A 3B20A 4DLAA 2PNFA 3D64A 3C24A 4FJ1A 3P2OA 3U0BA 1PJ2A 4CODB 4CPDA 4WASA 2J6IA 3PZRA 3DR3A 4D3DA 2NTNA 3A28A 3I6IA 4N5MA 1FDTA 5IAAA 3CINA 3B1KA 3TNLA 2E82A 2BGLA 3FPLA 3Q2KA 3JD3A 4LN1A 2JKVA 2RBEA 3IAHA 2D5AA 2B37A 2DBZA 1MGOA 5JLAA 3KB6A 3L6EA 3PGXA 4XQCA 4RCVA 5DOVA 3N58A 5BSGA 3AOGA 4RVDA 4PIVA 4PZEA 3W4KA 4IQGA 3DAFA 1HE2A 1SPXA 1P77A 1GCUA 3KTDA 4IJVA 2YHUA 2H9IA 4ITUA 2BGKA 2O3JA 2FR0A 1X13A 4XA8A 4JXKA 5H81A 4QO8A 5L40A 1DXYA 1LBEA 3C1AA 3UICA 1DC4A 3M1AA 1GFSA 4BKQA 5IF3A 4NIMA 1QKIA 5CDTA 3ZCXA 4K26A 1RM0A 4IINA 1LC0A 5JE8A 2Q1UA 5JXWA 2GNAA 4ND1A 4N54A 3W1VA 2P68A 1KEVA 2IYOA 4NJOA 3P7MA 3RD5A 1YQGA 1T4BA 3GVPA 3DZBA 3WMWA 2ZB8A 3PGJA 5C5IA 3GVXA 1IPFA 4YAKA 1W4ZA 1YOVA 1DRVA 1JLLA 1KBZA 3QVXA 2JD0A 2H63A 5HS6A 1GL3A 3PJEA 4E12A 4E31A 1WXDA 2Z1MA 2ZJ1A 2BKAA 4XYGA 5DT9A 3UOGA 1BWSA 3I9NA 2QZZA 3QY9A 4TVOA 1DO8A 5DBFA 4NNJA 4B3JA 3PYMA 3GDGA 5EJ2A 3WYBA 2YFQA 3LT2A 4YB8A 5FI5A 1XSEA 3SLKA 5AXBA 4FC7A 2IRWA 3CE6A 4GGOA 4EBFA 5C37A 3TPCA 2NADA 3IS3A 3LVFO 3KOUA 1QLJA 1R4NB 1YOVB 4TRJA 3OMLA 4I5FA 3CUKA 2GN8A 1VRWA 3CTMA 2EGHA 5KVVA 2Y1FA 3H2SA 3SX2A 4IZHA 3TN7A 3QW2A 4UAGA 1XEAA 1UP4A 1TI7A 4YJFA 3L6DA 1B15A 1ZFNA 3VKUA 4ZQGA 3TZQA 4MVJG 2VHYA 4GX2A 3BAZA 3WMXA 1E6EA 1GUYA 4I8XA 4CLRA 2GO1A 1LEHA 3V2HA 2VCYA 4NPCA 2G0TA 1C1XB 2GR9A 1E92A 2FPIA 2NWQA 5C3MA 4IPTA 5TT1A 3KBOA 4TKMA 3ICCA 1E3IA 1HKUA 1ZXBA 5JS6A 3ANNA 2HDHA 2ZQZA 1Z82A 2ZYGA 1SBYA 3SXPA 1TEHA 4OSPA 2FR1A 1WDKA 3UXYA 1PJTA 4ZJUA 4E4YA 1IYZA 4Q3CA 2WM3A 1PGOA 3OIDA 5AXCA 4ALIA 4BNIA 4J91A 4FQ8A 2DKNA 2W2LD 5F1KA 2OZPA 4B8WA 2WYWA 4J90A 1Y7TA 3F5SA 4XYBA 1O0SA 1R66A 4DLLA 3GR6A 1E7YA 4CMAA 3GGOA 3K5PA 2YQ5A 2W2LA 3WGOA 3JQ8B 1YBMA 2DTXA 4OKNA 4S3MA 1GZ6A 3AY7A 3GG9A 3QQPA 1C14A 3AOEC 1B8UA 1Q1NA 1IULA 2BGMA 2D3TA 3AUAA 4GL4A 1X15A 4PLWA 4PG7A 2Q1WA 3ZNOA 2BI7A 3P5SA 4H15A 3RC2A 1PU2A 3TZHA 2JAPA 1SOWA 2QZ9A 1UDAA 4NJMA 4UUOA 2JL1A 3TF5A 4YAIA 4PLVA 2CVZA 1GUZA 3INGA 1BW9A 1T24A 1EQUA 4KDEA 1WNTA 4E0BA 1DDOA 2YYYA 3S2EA 4IIVA 4BMVA 3GRKA 5TX7A 3DOCA 2I66A 5AYVA 4CM1A 1DC5A 3AFMA 3Q11A 4L0QA 1NFQA 4OXNA 1LRJA 4G81A 2P4QA 1UP6A 2C54A 1R4MA 3LC2O 4IJWA 4YJFB 3GAFA 2CSUA 3RUIA 3QJ5A 2CDBA 4HUJA 3ZWCA 4RQUA 1H5QA 5BSEA 2Y93A 1H6CA 1XCBA 2VNSA 5I8WA 4N7RA 1VM6A 2Y0EA 1T2CA 4FB5A 3L4BC 4YT2A 1B16A 5F5LA 1PZFA 5DNAA 4IDDA 3UUWA 4BV8A 5COAA 3GNSA 4N18A 4LCEA 4R1NA 2HMWA 1PGNA 4W99A 2ZK7A 1V6AA 2YDYA 1E1MA 3JD0A 1UXKA 1LXCA 4XGIA 3NDRA 1GV1A 3KYCA 4PLTA 1U7TA 2I3GA 2I5PO 1H2BA 1LLCA 2RCYA 4XB2A 4J3FA 3CXRA 3UAGA 1ENZA 5JCXA 1OC2A 1E3JA 1E3SA 1KEPA 2O48X 4DGSA 4DYDA 4AJKA 4RF3A 1N7GA 4FCCA 2VUSA 4II3A 3W4IA 1ADFA 2VHWA 3U09A 3ST7A 5I8ZA 1HSZA 4TZTA 2PKQO 4K1LA 1YB5A 1I5RA 1I3KA 3PDJA 3JQBC 1DSSG 4IZIA 2VZ8A 1I33A 1JU9A 3ANLA 5A9RA 3K30A 3RKRA 1NHGA 1ISMA 3WGYA 1KEUA 2FPPA 4XQ9A 1E5QA 2D2IA 4Y8VA 1JWBB 1W8DA 5LDHA 3B6ZA 4BKRA 2YZ7A 1Q0QA 3OQBA 1NVGA 2VNAA 2HMSA 4IIUA 4W9NA 1C0IA 4INAA 2W8ZA 1T25A 2G1UA 5CDSA 2D4AA 1EVYA 2Y0DA 2R6JA 3WGHA 3GMSA 4BNZA 3ZHZA 3I9JA 1O6ZA 3ENNA 1E3EA 4NDNE 2E37A 5JMWA 3L4SO 3BMOB 4LMPA 4CV3A 3BA1A 5K0ZA 2I65A 3WBFA 4HX5A 4I9HA 4AJLA 3QWIA 3TZKA 2UUOA 4E3ZA 5L45A 3GG2A 1K6IA 4UUNA 1E6UA 1YDWA 2OFPA 2F1KA 3KV3O 4MDHA 1K5HA 4M55A 4WCFC 3C8MA 3VDRA 1O5IA 1D7OA 3G1TA 4ALJA 4DPKA 4NMHA 3FN4A 1I24A 3HDJA 3RC1A 3SEFA 5TRTA 3PI7A 3DBRB 4XR9A 3UVEA 3W4JA 3CMMA 3UW3A 3OICA 2PZJA 4KUGA 3U49A 1VE9A 4E2YA 1PR3A 1YQXA 1PTJA 5I7EA 1YRLA 1P74A 1XELA 3GEDA 3GPIA 4ZQFA 1CQIA 1G0OA 3F9IA 4QXMA 3ITDA 3RUCA 3AU9A 4PCVA 4F6CA 4ID9A 3RUAA 3RUEA 1Q7GA 3M2TA 3V1TC 1QYWA 2G5CA 1Q2XA 4J4HA 3I23A 3GEMA 4X54A 2GLXA 4XD2A 3K2EA 1AN9A 1E6WA 1I0ZA 2A9FA 2C5AA 1RYEA 3ZDFA 4QEDA 1ZNQO 3SC6A 4EJMA 1CQJA 2BFPA 4LVCA 2HMTA 4R9SA 3WGGA 1DOHA 1QXSA 4J0EA 5TNXA 4IJKA 4EUFA 3W8EA 3T7CA 1JKJA 1HYEA 3GZNB 4YJDA 4D7AA 1YJQA 3VTFA 2Y1DA 1T2EA 3PWZA 3VH2A 3WB9A 1WZIA 3PZBA 2WJPA 3C1OA 1NASA 2C0CA 5EQFA 3W8DA 1ULUA 1NFFA 2C59A 1UZNA 1DIRA 1LI4A 1ZSYA 4NG5A 3S55A 4CM3A 4EJ6A 3JYNA 3V5NA 1V9LA 3WQRA 3QVTA 4FIZA 2HU2A 2ZYAA 1ZBQA 3PYLA 3LDHA 2X4GA 1RJWA 4CM7A 1GZ3A 2VRCD 4I9NA 3DTTA 4E2WA 4ZU3A 4B4UA 3SLGA 3FD8A 3ZWXA 5L4NA 2V6GA 3WSWA 3ORFA 1PZEA 3T4EA 3Q6IA 5KNLA 4UVHA 1PJBA 3LT1A 1B8VA 4TRRA 1BXGA 2BLLA 3HQ4O 2WYVA 3MJSA 1TB4A 4J1NA 3NT2A 4AJ2A 5IFLA 2G82A 1M2WA 4L74A 1YQDA 3BTSA 1ENPA 2OHXA 2Y68A 1I2CA 4BNXA 2WD7A 4WLNA 2CFCA 4DL9A 1XKQA 3BTUA 2HSDA 3NJ8A 1VL0A 2A94A 4LW8A 1DAPA 3L07A 3IJRA 2Q4EA 1DC3A 2X9GA 3PQEA 2VYND 5IZ4A 4FGSA 3JQ7B 2YV2A 1R4NA 3ZW9A 4DQXA 3QRWA 3QSGA 2HKIA 3NAQA 3FTPA 4BO2A 4KQWA 2ILTA 3BTOA 1ZW1A 3QVOA 1PJ4A 2D8AA 2ZB4A 4RV9A 4CMEA 3GC6A 4ZD6A 4J7UA 3G0OA 3NT4A 4KQXA 2CF5A 3LLSA 4L4SA 1JAYA 1C1DB 1U4OA 4ZQBA 4DC1A 2C7GA 3U3XA 4MPDA 4XYMA 3I6QA 5IDWA 3N7UA 2UAGA 1PR9A 1R15A 2GN4A 3C7CB 3AWDA 3OM9A 3BMOA 5FFFA 1HTBA 1Q7CA 4MOWA 4IGFA 3E5MA 4P4NA 4A5OA 4E5MA 2QRKA 5EL0A 1CEQA 2VHXA 3ROPA 4CV1A 3JQ9C 2EKLA 2OO5A 3DC2A 1K2WA 3NEPX 3WYCA 4BUCA 1D4FA 3FRJA 5BNTA 1M66A 1V3TA 2VYNA 5FI3A 1YXMA 1LSSA 3B1JA 3K31A 3PFFA 3RQSA 3RCBA 1MV8A 1E3WA 3H9UA 4OAQA 2GZ3A 1I36A 3R1IA 1JKFA 2R2GA 4CM5A 2X0JA 4U7WA 1J0XO 2OORA 4AJ4A 1EBUA 1HZJA 2Q2QA 2WYUA 4RVSA 7MDHA 2GDZA 1XQ6A 4RDHA 2GZ2A 3G1UA 4ZVVA 3ZWOA 2ZTLA 2QX7A 4R41A 3RVDA 3VH3A 5ITVA 4AICA 2GPTA 5L3ZA 4L76A 1YL6A 1P33A 5CHEA 2VWGA 1GQ2A 3HN7A 3GT0A 1DEHA 1MA0A 1LLQA 5AXDA 1JVBA 2J8ZA 4CM9D 4Q3EA 2X0NA 2AE1A 1GEEA 4IDBA 3VHRA 1PS8A 1UZLA 3DONA 2BI8A 3EVTA 1QRRA 3HN2A 3NDIA 4BO9A 5I7VA 1UXJA 4BNVA 4E33A 1WVGA 3ASUA 4RVFA 4NU6A 2P9GA 2B0JA 4MIEA 4RPGA 2GN9A 1KS9A 3LZ6A 1DRWA 2DTDA 3C3XA 1PWXA 4BNJA 1I01A 2NM0A 1GQQA 4ZRMA 3ROQA 1FJHA 4CM4A 1D1SA 2XF8A 4BNFA 4BO0A 1R16A 4RF4A 3JCZA 2QQ5A 4IDCA 3RUHA 2JCYA 3PYXA 3BHJA 4YBZA 4QSMA 3SBOA 1P0FA 4CQMB 5CDYA 3GRPA 1LLUA 1SAYA 4LVUA 3ZU4A 5JFOA 3RROA 2VYVD 4CM8A 4F46A 1BDBA 4OXYA 4OOFA 5JAZA 2AHRA 3K9QO 1ZXLA 3IMFA 1GY8A 2FZEA 2TMGA 5A04A 4GX1A 4WCFB 2VZ9A 1F17A 4RL6A 4GVXA 4CM8B 1YS4A 3WBBA 2O3QA 1A27A 3DB2A 3HB5X 3VKVA 4GMGA 5K6AA 5CDGA 4FGWA 1VKNA 2X9VA 3EHEA 2PTGA 8LDHA 4CLXA 4ZQEA 5AXAA 5A5FA 3JQ8A 4KUHA 1MG5A 4LISA 3DBRA 4OH1A 4G2NA 3FSRA 3H3JA 2PGDA 1BXZA 1RYDA 3FBGA 5JDCA 4PLPA 3ZNNA 5CAEA 1SZJG 4AVYA 4OMUA 4EGFA 1D8AA 4GAEA 1Z45A 1JW9B 3X2EA 4ALMA 2UUPA 2AEMA 3DTYA 4J4TA 3GNTA 1D1TA 3FNEA 5GZ6A 3DDNA 1NPDA 1A7KA 1E7QA 3DAGA 4RZIA 3MOIA 4QECA 1NWHA 2W4QA 1MXFA 1PWZA 1ML3A 1ZK0A 1LC3A 2EKPA 4IBOA 3WGQA 5IXYA 3DHEA 4M49A 3PHJA 4WNCA 3RI3A 2W90A 3JQBA 5B4TA 2R00A 5A02A 2VWQA 4WCDA 4MVJE 1Y8QB 3GN2A 3LLVA 3JYPA 1Z73A 1FDWA 4PZCA 1O9BA 5DULA 3BTVA 2JAHA 5T8KC 2A92A 3FWNA 3QWBA 2VRBA 3NGLA 2IXBA 3ZWBA 3VTZA 1Z75A 4GLOA 1IZ0A 1WAMA 1NR7A 2W2KA 3D1LA 4TKLA 3PK0A 4CMIA 1E3WB 3FR7A 3L9XA 3WWZA 2NVWA 3FTNA 1QSGA 3CKYA 4DIBA 2AQIA 3AFNA 2VRCA 3DMYA 1I3LA 4HFMA 5C7LO 3VPGA 4L9RA 2R00C 4BKPA 3O4RA 2AA3A 2PH5A 4OQYA 4RVGA 3JV7A 3U9LA 4NR0A 2HO5A 2G76A 4CR8A 3MZ0A 2QRJA 2C20A 4U6SA 4QT0A 1U3TA 1XG5A 2PZKA 2AXQA 3IUSA 3PTZA 2NU7A 3WJAA 4IXTA 3WQQA 2JHGA 3ZWVA 1HDCA 4A03A 2GYYA 4O1MA 1CIVA 3COSA 4KZPA 4NFYA 3JD1A 1PL6A 2AW5A 2FPGA 4DREA 5CDUA 3GHYA 1P1IA 5T67A 4URFA 1DJNA 4M54A 4PG4A 8ADHA 3DZJA 3TL3A 4BKOA 4PN3A 4GBJA 1SB8A 4CLDA 5BT9A 5G0WA 3UFXA 3PQDA 3EGOA 3TOXA 1VKOA 2ZYDA 1U28A 2IEDA 3P2YA 3CSDA 4QX6A 4Q9NA 1HRDA 1DHRA 1RKXA 3MJEA 4EZBA 1WPQA 3I5MA 4MO2A 3WTCA 4CR7A 5JMPA 1LA2A 1Y9AA 1SC6A 2AE2A 3DHNA 1BW9B 1ZZEA 2OBNA 2ZJ0A 3Q0EA 1YE3A 2PY6A 2JCXA 3I9MA 2J5QA 4RPHA 5DN9A 3GGPA 5IDQA 4LRSB 3JSAA 1MP0A 1VSUA 4YJGA 1O95A 4J1QA 4E32A 4W9NC 2JFFA 4BNLA 2VOEA 3GUYA 5I9MA 2CNBA 2DUWA 3EY4A 1A4UA 4ESOA 4EUEA 3EK2A 5H82A 3CPSA 4YRBA 5B4VA 5KJ6A 5L7TA 3L6OO 2Y1OA 1BGVA 4AJHA 2DTEA 4BGVA 1N92A 3ZU3A 5TT0A 5BR7A 3DBHB 3QWHA 1PQUA 1Y5RA 2CDAA 4O6VA 1DHTA 1KIFA 1VLLA 3AM5A 4HFJA 1NWCA 2AMFA 5HM8A 2B36A 1J6UA 2QIOA 2YFHA 4IDEA 3BMCB 1GYRA 4MVJP 4MIYA 4FDAA 1BTOA 1VI2A 4J4BA 4YVFA 4ALLA 1FDVA 4ZGWA 1N8KA 4UEJA 1F06A 1ONOA 2NVUA 1NTOA 2PD6A 3DHYA 4IXWA 5ILOA 3I9KA 4Z9YA 4BL5A 1CJCA 1P1JA 2BHLA 3O26A 5TIIA 2JD1A 4RPLA 2DU8A 3EW7A 1PJLA 1U3WA 3RUFA 5A4DA 3LT4A 1Y8RA 3QLJA 2C5EA 1NQAO 2IE0A 1ONPA 5ITWA 4Y6PA 1KYQA 3QE3A 1TXGA 1E1LA 2YV3A 1DFIA 4JROA 3JQCA 2NUAA 3PVZA 4A27A 4RF2A 5I9LA 1I8TA 1WWKA 2ZB3A 4B4WA 4JN6B 3E9NA 3LYLA 3TL2A 4BNHA 1E7RA 5EESA 4DRYA 1AE1A 4E2ZA 1E5LA 2EV9A 4XWYA 2IZZA 1ADGA 2O7SA 1T4DA 1ISIA 4CMCA 3EC7A 3AUSA 5JC1A 1KC3A 4P38A 2JHFA 3WGZA 1HE4A 2GUGA 1WW8A 1U2DA 4BVAA 4DMLA 3WYEA 3OJ0A 2HJSA 1QYXA 2I6TA 4F6LA 1EZ4A 1DLIA 3WGTA 4RJTA 1EFKA 1UXGA 4D0RA 1ZKMA 5KVCA 3D7LA 4E5YA 1DB3A 4U5QA 5J23A 4G5HA 1P31A 4D3SA 2PH3A 4MKZA 4GMFA 4R51A 2BMAA 3F4BA 1BXGB 1E3LA 3SJUA 4FJ0A 3TWOA 2VN8A 4AL4A
chains in the Genus database with same CATH superfamily
3B2NA 4MP8A 1I6KA 1Z56C 3SHWA 1JVSA 3WWCA 4EGCB 3F3YA 4KIGA 1KVQA 4LNAA 2HR1A 2OBXA 3RBVA 4KU4A 1PIWA 3ESXA 4MUEA 4QU0A 1P61B 1PG0A 4JUAA 2IPMA 3LO8A 3SM3A 4XCVA 5CP8A 2H4YA 1HDOA 4JU8A 2QRGA 3S2IA 4Q39A 3JVDA 1RYYA 3HU5A 1QFZA 3GFQA 5GQSA 4PQEA 4E15A 3EZ6A 2X7XA 5ERXA 2FN3A 3LK7A 4LAFA 1OLUB 1BHSA 2NQTA 2VWHA 4ND4A 4EHAA 1Z7WA 2ZIGA 2OE2A 2YVAA 4PX3A 4R81A 2HQRA 4L28A 1MIHA 3O47A 4WEOA 1ZCJA 2R6GA 3FZQA 1IM8A 4E21A 1RQGA 1E7MA 1JDJA 1AZWA 1B2LA 1EK0A 1EDDA 4P32A 5H59A 5IDYA 3ZDYB 1JFRA 3E5RA 3TD9A 3NU1A 2JHAA 4ARAA 3GA5A 1XLVA 3L7JA 4MV4A 2IUFA 3RV4A 4EGSA 5K0SA 3OBBA 1J42A 4UTZA 1LQTA 2YL2A 2I76A 2ZATA 3SYTA 1XWFA 3EGDB 4DJ5X 5THXA 1JECA 1JIQA 1O4VA 4HNUA 4M21A 5BOVA 1Q5PA 3I52A 2OXRA 4LJLA 1M1YE 3NHMA 3HKEA 2GPJA 4PPGA 4KPEC 5CT6A 1NKVA 3PG5A 1VG8A 3SVZA 4B8YA 1C50A 1ORHA 3FMVA 1EFVB 4FS3A 3CN9A 3MS7A 4P98A 1JIXA 2VTBB 1MDBA 2GN6A 3DE6X 2VJQA 4AYWA 2EHJA 3ZQ4A 1M3SA 1VL6A 2YXEA 3A04A 1VLZA 4G0OA 1BE8A 2QTLA 1UH5A 3JRNA 4E5PA 2JFGA 2FVXA 3LCMA 3ZDRA 5ANRB 4M1MA 5DM0A 1ZOLA 4C4ZA 2REQB 1M2HA 1SUIA 3DT9A 4KRXA 4M86A 5E7JA 4X66B 2RHHA 5BWBA 3S2SA 3S99A 5CIYA 3CZMA 3UMGA 4AJIA 1SOMA 3UWOA 1EUCB 2OGTA 5LR6A 4Q9AA 4EYOA 3QVSA 3IBGA 5G0TA 3UJDA 2XXJA 3CJQA 1NDHA 4M37A 4QUKA 1JHZA 1OWPA 2DQ4A 2H65A 2HDOA 4BVJA 2CMKA 2WICA 3P8ZA 5CU7A 5SZHB 5COQA 1FFSA 5DBIA 2VA8A 2KPOA 4KKVA 2R6DA 1ZMOA 4GL2A 3R3YA 3UJBA 1BC5A 2GDJA 2QMYA 1TCAA 4RJIA 2Y1GA 1U3FA 3NX4A 4ROSA 1ZI9A 4TMTA 4JI2B 3HSSA 3T38A 3V2UA 3F49S 3OQ1A 3GD7A 3QUQA 5FL7D 4PFKA 1Q92A 3S2ZA 4NCNA 3IEVA 4MVJD 1NTRA 3AJEA 4AUKA 3ELYA 2VATA 1H2FA 1DBVO 1AUVA 1GPLA 1PK7A 4FIDA 3UZUA 4B79A 3TOZA 5C8DA 3E27A 4Q9HA 4CMBA 3L0OA 3ZUPA 1T34A 4CQMD 1XLTA 1NN5A 3HO6A 2EL7A 1SA0B 4LRYA 7REQB 3HJBA 2N47A 3OWHA 1FF9A 1I0LA 1Z4PX 2QLNA 3FCYA 1DBIA 4H3SA 4H7HA 4OQMA 4TYQA 4WLFA 4JLUA 3TIIA 1GZSA 2DQYA 2WT8A 5G1PA 4YQZA 3QFSA 3LKVA 2WWXA 4FVTA 4J0JA 5AHKA 5LD2C 1R9GA 4BZPA 1KQOA 3INTA 3LC1O 4EK9A 5EFOA 1FUEA 4UUPA 4DMRA 2JHCA 3TINA 2CE7A 4BX3A 1L8AA 3ZYCA 1E2GA 2ZR0A 4UTOA 5HM8A 5KNBA 4D3YA 3W04A 4Z4IA 5ICSA 5D3MB 5FXMA 2HV9A 1E3MA 2XDYA 1GRQA 2K5UA 3HCDA 1C5KA 1L7VC 3ONNA 2GCPA 4LC1A 1MHPA 5DHQA 4EEZA 1GTMA 2QWXA 3ZR4B 1Y37A 4K6MA 2LCFA 4JVSB 3GA0A 2NO5A 4XDZA 1G3QA 3N6XA 4BNNA 4IQ8A 1IHDA 4O2RA 3RRXA 2P4EA 4K8RB 1FFHA 4NONA 3SYRA 1F12A 2A0YA 4ZHQB 3R74A 2O5VA 1B6TA 4H7DA 1SKYB 4UQPA 4UM9B 1QMPA 1Q0ZA 1PQWA 3NRJA 5K0FA 5AWFC 3EHDA 5JUWA 2J3IA 4I1SA 4JBIA 1SULA 5DK6A 5EWLA 3K5HA 1NVAA 4MA5A 4UCQA 1M0TA 3KSBC 4XXHA 4GQBA 4GNRA 5HKKD 3GLFA 2ODQA 4PWZA 1YZVA 4WXPA 4ZVLA 4MIOA 3DO8A 1YULA 4G6ZA 3RIMA 5JNLA 4BMYA 2A4KA 4X8LA 2CWWA 2IW3A 3IEMA 3RKUA 3ISJA 1J4AA 1MX1A 2YASA 1JB1A 1OV4A 2Y1WA 3Q1KA 1HT0A 5H4GA 3D7RA 4R2LA 4WKCA 3FYCA 5T57A 3DOOA 5JD4A 4N8EA 1GADO 4GI2A 3UC5A 2WWYA 1NLMA 5C8XA 4AZ0A 3OQ6A 1TUBB 1NVUQ 3QU2A 5GIOE 3QMWA 4G8JA 3CR7A 2Q1YA 3LI2A 4PV7A 4TXJA 2C7VA 2A1TS 2Q2VA 2GF2A 1U65A 1WP4A 3KYDA 1UFOA 3V7FA 3STHA 1MJNA 1ZH2A 1DC6A 5FPPA 2V98A 4BO4A 1VG9B 1RWOA 2DYKA 5IXSA 3PC8A 2JBHA 1E9FA 3R7LA 1PYGA 4B3CA 5CD9A 2JFVA 3J7TA 3LVQE 5B3JA 3OCXA 1SXHA 3K1TA 1RAIA 3BL5A 1CIPA 1P8JA 1AHNA 3CBQA 2C29D 2RMKA 2GBLA 3CH7A 4KO1S 4LI0A 1M6WA 1MC8A 1UUFA 3KXIA 2Q2OA 4YJGB 4BVKA 4M53A 1CHDA 2PD3A 1RAEA 5LUAA 3BJMA 3A4IA 1R27A 3DOIA 4DNOA 1DMRA 2CT8A 5CEJA 3HE3A 3CTPA 1TE2A 1Z33A 3HY3A 4L9SA 1F4VA 4IDFA 3V7UA 2OBYA 4JGGA 5FO0A 3HH8A 1KQNA 3QU5A 3EDOA 2DH6A 1X2EA 3C3DA 3PEYA 1EGVB 4GRIA 7YASA 2O8EA 4KBFA 4V0ME 1EK5A 3Q3CA 2QT9A 5DCUA 3PHGA 1G98A 3JASB 4MVYA 5ENVA 5ALJA 2J3MA 1TW2A 3K70C 1NI5A 1UWCA 4OXKA 3SJCA 4BQNA 5J59A 3S2FA 3PC2A 3G88A 1MB2A 3K09A 1K7EB 3JQPA 1EEHA 1R0RE 5SZIA 4BMSA 5HTOA 3B9BA 3QKWA 2WMYA 3E9EA 2C7PA 1XK7A 2Z2ZA 1H9CA 1EMDA 1YC2A 3LUDA 4KTTE 4YRRA 2HMAA 2Q6TA 1BX1A 4DJFC 1F2VA 3LQKA 5B7QA 2G17A 1UJ5A 4IH1A 1C3XA 2QPLA 4IMIB 4Z1MA 4L7VA 2BGGA 4J0CA 5U9CA 3DZHA 1JJAA 5CM9C 1XQXA 3PBKA 1XN4A 5D5QA 1WQ1R 5E0KB 1QG4A 1M1YB 2OZLA 3DXFA 2N3ZA 3QUCA 3KUXA 1P9LA 4RA9A 4J0GA 4OHYA 3LTNC 1CF2O 3WK4A 1UZAA 1MO5A 1XQ1A 3D4NA 4ZYXA 4TLBA 4XWWA 1IL0A 2OK7A 4RZSA 1SVUA 3BULA 2Q9AA 3WZLA 5EMKA 2C5SA 3FJOA 3CW9A 5ECYA 2CFTA 3OQJA 1PW7A 4UNRA 4QBKA 3ZDBA 3T1YB 3ZV3A 2WTMA 4JLMA 4BKUA 4XRGA 3K2BA 3DYIA 2F8LA 5G4LA 4PLYA 3KYDB 2FCAA 1TQ4A 2PIDA 1RC0A 3IKMB 3IIEA 5F4ZA 2GAJA 3FHTA 2PK3A 4EWLA 2VXYA 4DQDA 2WZBA 2CJFA 4IS2A 1RM5A 2XXBA 3G9ZA 4XYLA 3RS2A 4ZVOA 2YHBA 3D6MA 1YB4A 3G13A 4FMDF 4E4RA 5CVTA 5DBEX 2N46A 4JDPA 4HYYA 4TROA 4EUSA 3UJ8A 1JI3A 1AB5A 3CWCA 3CVVA 5KAMA 1UMDB 1YKFA 3O8OB 4GPD1 5J40A 5A9SA 3LXRA 3EDMA 1WCIB 3P4XA 4Z3DA 2QMHA 2OY0A 5CX1B 4HQNA 1UFVA 4PR3A 2GF0A 4LQLA 5C3UA 2ZBQA 3JWPA 3KQOA 3RB8A 1UODA 2JH8A 2OBLA 5IANA 1KFEB 3T6KA 2WBLC 1UOQA 3AEYA 3R0IA 3EQ6A 3WXBA 4DPLA 1DELA 2WIFA 2IUSA 3M5DA 3BIOA 4TV8A 3CF6R 2CBZA 3TJRA 1C9DB 2YIDA 4RJKA 5F7ZA 2BM9A 1GL9B 4U6QA 1G38A 5FB3A 1MRSA 2XTJA 4J7XA 4RVNA 4HTAA 3SFTA 4O02B 4C4RA 4C7MA 3EZYA 4DRXA 1GYQA 1L5ZA 3LRPA 4RABA 1PGJA 1ENYA 3LY9A 2AG5A 2GSWA 4KFRA 2VPQA 4Q3NA 2NSYA 1B1AA 5F2EA 3UOAB 4G1FA 3VTKA 4EGQA 4JP5A 3SC2A 3NV9A 2PLWA 2RFLA 2VXOA 1BAPA 1HDEA 3O8BA 1DPGA 3PQ3A 4XARA 3RRFA 4NU0A 3STTA 4PSUA 1RW4A 2C2HA 4WY2A 3EVFA 3V34A 3ANSA 1KKLA 1TD9A 3JARB 4B7XA 3Q1LA 5BP7A 4Z4QA 4E5DA 2PAAA 2R66A 4X6YA 2IZ7A 2NYRA 2BEWA 2I6UA 1JHPA 3N8IA 4WDRA 2AQKA 5JY6A 3E82A 2P9EA 2RHDA 2WAXA 5AKEA 3ELDA 3VKGA 4YDHB 1H0SA 2YIMA 3W6UA 1RXIA 5LZ2A 3G23A 4QG3A 1CDDA 3F9RA 1B6SA 2REBA 1V7PC 4QFDA 2ADOA 1JEOA 4H08A 1EFAA 2AXNA 4RK5A 4TZ6A 3MCTA 4OJNA 3F8SA 2CNNA 3AESA 4OXRA 4FI3C 3WIEA 1DTEA 1FFXA 1M6VB 4ZQIA 3K0SA 3I2FA 4GT1A 4U2DA 3WTBA 4NOKA 1N2EA 2G72A 3NTRA 4R4JA 1DWQA 3ABQB 3PFGA 1H1DA 4PVCA 6CHYA 3VUFA 3QBDA 2B1JA 2D2FA 4H7IA 1G41A 2CCGA 2Q9BA 3MWDB 5FI0B 4DEXA 1GSIA 1X7GA 5CG2A 4JIGA 3ZCSA 2ZU6A 2O50A 3GJQA 2MSDB 5KWEA 2Q5FA 1IXYA 1V0JA 3UHJA 4H4CA 4JB2A 4P7KA 4U8GA 3KE8A 3T5CA 4H7JA 5JPDA 3ZIUA 2PL1A 3FAZA 4PAGA 1NNSA 2X14A 3O9ZA 3QA9A 5G3YA 3WY9A 3U62A 3CN7A 2EGUA 1E2BA 4B4DA 4M76B 4MO9A 1YBHA 4NU5A 1Q91A 1I0IA 1K89A 1ZRSA 1M6EX 2ZI6A 3RSFA 4BWFB 2AJCA 3T1HB 3TIXB 5LQUA 2BE7A 3B1FA 4OHPA 3PPXA 3T5MA 1H0RA 4BC0A 2MIIA 1GUAA 3ZLBA 2PGJA 5L3QB 2O0KA 4B2LA 4C4OA 1T15A 3OHSX 3BICA 4RZHA 4P3NA 1XNHA 4QG7A 5BSVA 3C97A 4UXJA 3SNHA 3PB3A 5KKNB 1W76A 1HE3A 5FCDA 4AG3A 2FUG6 2A0XA 3HB7A 3KQWA 5EZQA 1EIZA 3VU9A 5C80A 4X94A 2Y1CA 4D99A 1Y42X 2R65A 3TJZA 2EZ4A 4JVOA 3UMSA 2MSKA 1GAXA 4JVLA 1VECA 3OTWA 2EHDA 1KJWA 1MO4A 2CYCA 4O59O 4RBNA 1TVKB 3FSEA 1N6HA 4KXUA 4M8KA 1ZK4A 3ZTWA 3H9BA 5AKZA 3H9EO 3PI6A 2PXHA 2AQHA 1PFQA 5J1TB 2V6FA 5DIFA 4M99A 4YMHA 3E4DA 3O38A 3ZHYA 4YYZA 4MP3A 3HCFA 2P9CA 3NALA 4WK2B 4XEHA 1N36B 1CR4A 1RCFA 2H7VA 1GA1A 2J9YB 1NLUA 2FUEA 3ASYA 4EZIA 1XCMA 3B85A 3C6YA 3P9QA 4EG7A 3CRQA 1QGUA 3MUFA 2UDPA 4QDOA 3UK0A 2RIPA 2WOOA 1NQ5A 2ZSBA 1Q12A 4MHSA 3VJMA 1WSWA 4LF7B 1R8QA 1Q44A 2OQRA 4C6HA 1VE3A 1NVDA 1UWKA 2Q8NA 3IDOA 4IY1A 4HAZA 4QFCA 4RV4A 3SE7A 3IQEA 3T52A 1PR6A 1QM5A 2V6MA 4LY9A 4DXDA 4P31A 3VDXA 4UUMA 4GD3Q 2IITA 1G5RA 1C3VA 4PZ9A 4F6RA 3KT8A 2PX0A 4FFPA 4PZUA 1EFLA 4BLPA 3NHRA 5C8YB 3PUXA 5TC4A 2GK6A 4UQLA 2O8BB 4KE8A 3WHLA 4BFZA 1YSCA 2XWJI 3JVUA 2JDIA 5A9SB 2QZ4A 2YWXA 1Q3KA 4LYHA 4XIIA 1J2UA 2R79A 4QRDA 2AC7A 3S2YA 2I2DA 4BVGA 2FQYA 4FP9A 4YEDA 5HXAA 1DEXA 1O03A 2HRRA 4LF8B 3VKHA 1OGYA 2XHZA 3HZHA 3IXQA 3R3ZA 1HY3A 4RGYA 2CHVA 3NBQA 1CRQA 1SQGA 2YUIA 1UAGA 1SQ0A 3B13B 2PA3A 1BNCA 4PGFA 2PGAA 2AK2A 1ZIXA 1JAZA 4HQLA 5E38A 4G1UC 4GE3A 1FDSA 2O2GA 4F86A 3WHPA 1NT4A 1XDGA 4QO7A 4QQNA 2XUZA 5DBHX 3EIFA 3VR5H 2YJ6A 3WP0A 3L9WA 1OIWA 2G0NA 2IYXA 4MP6A 1AO0A 1GCOA 3JTMA 1QVWA 1PT8A 2F62A 1WHSB 1FUUA 3MSXA 4TT3D 3DBLB 3LHSA 1FMLA 3ZGXA 3ESDA 3ZV5A 1OTHA 1O94A 1BMQA 4FFNA 4P0TA 1UXHA 1TA9A 3C6MA 3HNOA 1ZGBA 2X5KO 3D8HA 4FKMA 3S1AA 1PZXA 4Q5IA 5EYPA 2OC4A 2DY0A 3KM0A 4D8WA 1BS2A 1QIDA 2EG9A 2JF0A 1CRLA 1SD2A 5HVNA 4EA9A 5KNBD 3EJWA 2I2CA 1RC1A 1WA5A 4U63A 3TLGB 3BFKA 1HLPA 3I4LA 2A5LA 2AWNA 2YW9A 3W9SA 2DR3A 4A16A 3BDAA 1KHHA 2ODTX 1O8CA 2QPTA 3A2NA 2D13A 2VZ0A 5TPWB 3EOAI 2ATIA 2JFUA 5HJ2A 4UPEA 1CY6A 1Y1TA 5K3DA 3H9GA 3UAZA 2ZRIA 3UTCA 4AKSA 3ZIDA 1JPNA 4H1TA 5L53A 5AW8A 2HA0A 3L1IA 4XDYA 3T3GA 1NDQA 2FG6C 4EVIA 1N3YA 1ZVMA 4RMNA 1TOAA 2R0QC 3V1UA 4CKEA 3OT4A 3RS7A 5LZ7A 4E6PA 1OI3A 1OASA 2VK8A 1F38A 4Q9DA 1NSTA 3DT8A 2XKKA 1SEPA 1ULAA 1QMGA 3BGVA 4FBMA 2DPGA 3N0VA 1Y5LA 4YY3B 3BT7A 3QTTA 5GZ1A 1RYMA 4CLOB 2VXBA 4V0SA 1C1YA 2ZAOA 2ZAIA 4W1PA 2EFCB 2ATCA 3PFIA 2UXCB 4DMMA 3E0QA 4AFNA 4DYVA 4N01A 1B0ZA 5ALEA 3JQGB 4FS8A 4V0LA 1XR3A 2NZWA 1FP4B 3R8CA 5BVGB 721PA 3C7DB 5DX0A 1VLVA 1XO1A 2Q9UA 5CK5A 3BXXA 4DIFA 3LPNA 3HVKA 4QC2A 1EP1B 4OYHA 3RS3A 4EEXA 1T2FA 5L4SA 2CVHA 2X86A 1C0KA 1TKBA 4W8OA 4BZZA 2CL5A 2B2CA 3E03A 1E8DA 4Y6LA 5KTRA 2OEPA 1UZMA 2V96A 1COZA 2Y66A 3GZNA 3ENKA 2XOXA 3NO4A 1LY1A 3OA0A 1V11B 1JJFA 4BEVA 1X0VA 4D43A 4HHEA 4IHKA 4ARBA 2BY4A 3DXYA 1T8TA 3W5BA 3B51X 1H8EA 1ZOOA 3BE8A 1E0DA 2X1MA 4YJHA 2E4VA 3CM0A 3RR2A 5ESDA 2Q5CA 4P08A 2PD4A 3JYLA 1EWVA 2WDPA 4BO6A 1MO2A 1TZMA 4ZZ0A 3MK31 2J3JA 5FUXA 2VYVA 2UXBB 1V11A 3AL0C 3ZDZB 1KKMA 3FOEC 3N2KA 1BVYF 1Z36A 3D2LA 1Z68A 5C35A 3L4BA 3O9VA 1JV2B 2PO5A 1Q17A 5F51A 5CFPA 4P4SA 1G8FA 1DUVG 1LK0A 2B5OA 2HV8A 2V6BA 2YC2C 3IUEA 2MJLA 3QEOA 4LY3A 3BQMB 4NEQA 4RVCA 3L92A 2X0IA 3R3UA 4BOYA 1E7SA 1LQUA 2EQ5A 1V8DA 4X6UA 2GK3A 1E89A 3I6YA 5DTIA 1OYWA 1M0WA 2VNKA 1Z07A 1X7WB 3O3CA 2J4FA 1FZQA 2HCTA 4X95A 3OCVA 3SSAA 2TMYA 4RDIA 4DJEC 1PJ3A 2IOQA 2QTVA 1YCHA 2ODAA 3RU7A 2RJ3A 2GLUA 4R1SA 2R7NA 2IS4A 1RHQA 3HPQA 3S7ZA 3FWYA 2X22A 1SURA 3ND9A 5BYJA 1E9RA 2E4XA 4RXUA 3U2QA 4D79A 4GFDA 1ZAYA 121PA 1E1KA 1NBWB 1O58A 3IC5A 4KWEA 4O25A 2HPZA 3HB9A 1TRKA 4CJXA 4D6PA 4R8MA 4Q7QA 4KYVA 1JIIA 3DUFA 2NW6A 4X1YB 3AHFA 1QR2A 4CKXA 4OTZA 1UK9A 4PX9A 1OJLA 1S96A 1ESMA 3IKVA 3T61A 2C2XA 4OAPA 1PEDA 4AZSA 4JI1B 1XA0A 1Z29A 3BYZA 3PCXA 3D4OA 5GJBA 4AY6A 4B47A 4POOA 4TQ9A 4DWVA 2RH9B 1SHZA 1IAVA 4O4LF 5C4IA 1L5MA 4IWYA 1G8SA 2XDWA 3ZHBA 1A9SA 1BN6A 1P2TA 2BHTA 3LGAA 4KWHA 1P1CA 3CVWA 4PX5A 3T3NA 1E3TA 3GRZA 2VHTA 2BUCA 2VQ3A 3OLZA 3QE0A 3L4EA 4IIEA 4E5UA 2R8XA 2OAEA 2DHCA 1EBBA 1T43A 1Z47A 4EJ2A 2SICE 4GW3A 4L0MA 1UDCA 4XWGA 2IBSA 1XZFA 4NBUA 5JQGF 5AKGA 4OHFA 4IG9A 1AXEA 5CH8A 3PICA 4EB6A 3DFUA 1V4NA 3REQA 1XLUA 2BT4A 3CU5A 1ATZA 2DSTA 3AM3A 3DL2A 3HHPA 5DXAA 1DKMA 4HLQB 3WZMA 5DTQA 1OJ7A 4KC0A 3B9QA 5TQ0B 2FEKA 4IIFA 5ALZA 4HQKA 4MQBA 4JL6A 5DN6A 4D9FA 2CY0A 2ZS7A 1JEEA 3L7DA 4OCZA 5FNVF 4C0BA 3ZY2A 1OFVA 5PNTA 1ISHA 3UQZA 1LK5A 2VZEA 3PHHA 4MW2A 3NT5A 1J0CA 2CZQA 3ETNA 1CS4C 1IVNA 5AUOB 1F2UB 5CLJA 1GILA 4ICIA 4LTNA 2QMQA 1DUSA 3KSZO 4UNQA 5JSKA 5JECA 2X15A 6ABPA 2CCJA 1QZTA 5E4YA 3L7LA 5FTWA 1C4WA 1NYTA 4Y0VA 4JWKA 2YHSA 1R0KA 1P5ZB 2CHUA 1JIUA 4PICA 5KCMA 4HGYA 5TF4A 1QB7A 3R7AA 1KMCA 2HNKA 1HGXA 1SUBA 1T2DA 1FYVA 2JI8A 3X1DA 2JD2A 1NT2A 3N2NA 4WZAA 2CNOA 2POCA 1GPYA 3S44A 1V47A 1CVRA 2H8KA 3K94A 4AP5A 2XEXA 1NU8A 3W6NA 1LW6E 1DAEA 1RXCA 4XM2A 5D1HA 3MCVA 4H1HA 5E95A 3TG2A 4MV0A 3QK7A 4RW0A 5LDGA 3IP3A 4X91A 1NRXA 3FUVA 4F4UA 3PTLA 1CY8A 1ZI8A 3AW9A 3CZQA 5A7HA 3TRIA 4YV1A 3A6KA 3FWPA 1NP6A 2V03A 1KC1A 3TPFA 3DZKA 4F71A 4INZA 3IDQA 1T9GR 2XYPA 4HWKA 4MV5A 4TS3A 2RK4A 2Z8YM 1EUQA 4KQGA 5KTTA 4BNDB 4JX8A 3UOWA 3ZD9A 4AKEA 5MFZA 3NH6A 1V5WA 4PW0A 3EXIA 1POWA 4KI0A 4MRMA 1DL5A 2WJJA 3AHJA 3UJPA 2D74A 1XVUA 1DQYA 2P1ZA 1GXSB 4HB3A 4R5MA 3AVYA 3Q7PA 2XR1A 1NVKA 3BD6A 2Z4TA 3N2GB 2QL5A 2OFFA 2ZVDA 3C7TA 4OJQA 1WSAA 4JSTA 2B99A 4MVWA 2VXCA 4GEGA 3V2IA 3IOYA 4AWBA 2Z0MA 1MIOB 2RGEA 1JQAA 1OLUA 4QPCA 5BUCA 3T7SA 2ZAGA 2HGSA 3ZHRA 1B4DA 1O1YA 4A6XA 1OYVA 1PCXA 4LXHA 3FGZA 2W6OA 4LXGA 1COWD 1T26A 5ER6A 4ABYA 1YA4A 3OEED 4QBHA 2GBCA 2G3YA 3R24A 3DYVA 3NP9A 3HLKA 3FNRA 3GRFA 2GBPA 3RBXA 1YZKA 2YRXA 3KKZA 4DZTA 1U2TA 1M54A 1BJKA 1WB5A 2XUFA 1JSRA 2GD6A 1TPZA 2D5BA 4MWTA 4S35A 4XRRA 1KR2A 4HB0A 1I6WA 4YJ3A 3WLEA 2CFOA 1EXNA 2JH9A 3C3BA 2WF5A 3EXHC 1Z7EA 2P5YA 3N5KA 1D2GA 2DLDA 3L0PA 4IIYA 4RLFA 1T1JA 4IR7A 2ZUTA 4C6RA 5CEFA 1LNSA 2ZT8A 1WB6A 3OF5A 1W4LA 1RWWA 1Q50A 3H2BA 4PGHA 5CGZA 4RTSA 1W6UA 5I7AA 4BV9A 3VKWA 3MMPA 4QULA 2VHVA 4HGRA 3TQOA 4Z1OA 1ZC4A 2G9RA 2A3RA 3KZ1E 5SZKB 4EY4A 4MS4B 5CBPB 3K6SA 4G86A 4IHJF 2AG0A 5BUZA 1HE5A 5IH3A 4IDAA 1Y63A 1XXHB 1J22A 2PMCA 3IVRA 1S8AA 1S2GA 2G80A 2H92A 3GFPA 3H11B 2BMVA 3M5WA 4OJTA 5IP5A 3R9KA 3BWYA 3MOGA 5DYWA 1XZBA 1QCCA 4B74A 2NYAA 2HWKA 4FMBB 4GOMD 3H5IA 3K0AA 5LMNB 1K27A 5KNDD 3THWA 2QP3A 3AEXA 1A9ZA 3O31A 3LFHA 2G6TA 3G6KA 3IR6A 2WP8J 4KMOA 1E2UA 3CPEA 4GX5A 4GPAA 2YW2A 2FX2A 4YQYA 3TOSA 4AKTA 2HF9A 1HDZA 1W29A 6ADHA 2O59A 5CD1A 2ABWA 1HL3A 1A2QA 4LYJA 2OP1A 4WY8A 1UPFA 3AUKA 3RREA 3ZZMA 4QJBA 4CUJA 4YTEA 5H9WA 1FW6A 3UKOA 2VP5A 2ZR9A 4PLGA 3IE2A 4YDRA 3UMFA 2V97A 4LYEA 1Y7IA 1ZITA 1ZK3A 4HGPA 4UBNA 4V0KA 4W1QA 2VP3A 3X0DA 4EKGA 3OF2A 3HABA 1J0DA 1N2CE 1V2HE 1K98A 1V1RA 1HG0A 3D7KA 4D02A 1JH8A 2NT4A 3NJ4A 3UTDA 4ZICA 1LSUA 1SFRA 3B53X 1G6HA 1TUIA 1UDBA 2Q2WA 3R2JA 4YO8A 4ZMBA 1KRWA 5BQFA 4FOPA 2C7OA 1VKHA 2XB4A 3RODA 4YT8A 5F23A 2FMKA 1JI0A 3SDSA 5IBCA 3BK1A 3BFXA 3LOPA 3QPCA 5REQB 1ORRA 1PG2A 3EVNA 3QFFA 4UM9D 4KHPB 1KK1A 1RHJA 2CMGA 3EGVA 3X1JA 4TYWA 4I81A 4WGGA 4LCJA 4ZQHA 5HBRA 1M8GA 1T6XA 1XJCA 3KLPX 4GOKA 1SCBA 4JS0A 4P3PA 3ABIA 5HZHA 3WDKA 1Z88A 2X6RA 4CKYA 3PRJA 4I4CA 2ZWIA 2FP4A 1XU9A 5CRIA 1TU3A 3OHMA 1PEYA 1O6CA 1TT5A 2QQEA 2C4KA 2X9LA 3D0QA 1H93A 3EBPA 3FCUB 4MMYB 4R8SA 2V6IA 4UW9A 1CB7A 1ZL0A 4K5QA 3RQIA 1C0PA 2EWMA 1JHMA 4JSRA 3VPXA 3WMWA 3F4LA 1DLJA 3KT6A 3HCCA 3RTEA 2HX1A 1N0UA 4B3XA 3GUVA 2Y6UA 4YP7A 4FHDA 1G3IA 2GRAA 3KE9A 4C87A 4HMPA 4RAQA 3RC3A 5AVSA 1U8XX 4KRYA 4PO9A 4DDKA 3D3WB 3C3PA 3KZXA 3Q9SA 4O2AA 3ZCRA 5ADHA 2W2MA 1IIRA 3TL6A 4GVPA 3DFKA 4WJZA 3A6GA 3IVGA 4G23A 4C5BA 2Q8PA 3HWRA 4PSKA 5DI3B 1W44A 1TC2A 4PAWA 1BWRA 3AX6A 4LYDA 3ZE6A 1KJQA 1B7GO 4RORA 5IKOA 2ODBA 1II9A 2ZXEA 1G7SA 1N2XA 1QFMA 4DCUA 1TUGA 3IEPA 5EPOA 4OATA 1W9HA 1XN1A 2KX7A 2ZANA 4POAA 3BSFA 3D3NA 3AJRA 4QBTA 5B57C 2O1EA 1M76A 1P2DA 3IHKA 3PT9A 3TW4A 4TKVA 2Q4BA 1SVWA 5AOCA 5B7PA 3U4CA 1KTIA 2ZBEA 2AGVA 3KLNA 1CWUA 3MTAA 3QBTA 1C8KA 4RD4A 4BQQA 4CF6A 1CJMA 4D9NA 5TGZA 4PVDA 4G1CA 1NOJA 4PFJA 1RYNA 2PUJA 3BEOA 5D85A 4GRDA 1JDUA 2FSFA 2JZOA 2C2MA 2Z3ZA 4ZAYA 1S6YA 1TQHA 2WD8A 1HLDA 1LDBA 2Y71A 2ZETA 3L3BA 4IJ6A 3GWGA 4KODA 4KR9A 3BWDD 1JWAB 3C85A 5LZ9A 1AS0A 2XJ4A 1PQ4A 5BXQC 4K6KA 1RLTA 4GO1A 4QOHA 2PUEA 3DDOA 5EWJB 3DWFA 3CX6A 1P17A 4XTCS 2XCTB 3HZZA 4GEKA 5BSUA 4AIIA 1PEKE 4M89A 4P4TA 2QVLA 2IYSA 4W5NA 3BIWA 1G18A 3E5HA 3OCJA 3L49A 4F3TA 2ZT5A 2IYWA 4D4IA 2AYZA 1VL8A 3AONB 1U3UA 5IULC 1HDGO 3A25A 3LPDA 4H3VA 3BE5A 4MW0A 3PGLA 1Y3IA 2QL6A 2XD9A 3HXOA 2B5WA 2EKQA 5KI6A 5HYVA 1RRCA 2GFQA 3BFPA 1BX0A 1UBRS 4Z54A 4KTVE 2B8EA 3AL3A 1JBQA 5I9IA 4WXRA 1P0IA 3DMFA 5EQDA 3VVMA 1PL8A 3E4CA 3WMGA 1WM1A 3N28A 1NSFA 4GPIB 3AYZB 4RHFA 5G0VA 1NN0A 3DA8A 4LJ8A 2ZRMA 2PLFA 1HSOA 3HGQA 4NYJQ 4DQLA 5BVHA 2V7TA 4L5IA 2OUIA 4J0IA 2WQ6A 1Z7GA 2Z1NA 5COBA 3LQ4A 5BN4B 4CF5A 5THQA 1FYFA 5E8RA 1K5GA 4C30A 4AAYA 3R9XB 4OHKA 5G3ZA 2AC2A 2VF5X 2RGUA 4M1EA 4O29A 5CX4A 5BNZA 3KWMA 5FTJA 1ZU5A 5KYUB 3ZI4A 1LPMA 3D2AA 1LF0A 1SPBS 1ICIA 2XTMA 4BFTA 2I4NA 1P18A 1CF9A 4XX0B 4BUJA 5JAIA 1I6LA 3A6JA 3UCFA 1KVTA 3I3SR 3EBLA 1IUKA 3LUBA 4FMPA 1Z6GA 5AHRA 4DPMA 1ZD9A 4GSLA 1Z0UA 5AM2A 1QRUA 2SKDA 2XE8A 4HP8A 2WDZA 3NHAA 3IMCA 5IDXA 3L6BA 4P8RA 4DFDA 2D1QA 3FLEA 5HIMA 3HCRA 5J5AA 2F00A 1EUDB 2VJYA 4Q4HA 2ZSKA 2AR7A 4KXMA 1OLXA 4EPXA 5HIAA 3R3WA 3GT7A 3T9FA 5M5BA 4GECA 1HT2E 1HPLA 1WXQA 1QORA 1U7XA 2V59A 4RXMA 2ZJYA 3DULA 1KI9A 3MWYW 1IHPA 2B4TO 1MJHA 4M0PA 3AKEA 5ALXA 3UK2A 3EPKA 3LWDA 4TTTS 4ZXPA 2QKYA 1EFUA 4CL3A 5KYNA 4HDNA 1C80A 1JB9A 5K0TA 3MYYA 2FW0A 5BSMA 2BAGA 1H0HA 2FMUA 2Z3VA 2EOAA 1TADA 1MO3A 2H07A 1JZTA 1FVFA 3EF1A 3K92A 3MJCA 3FPHA 2OG2A 4PYKA 3AF1A 2VJBA 1WCWA 1KF0A 1C7QA 3ZD7A 2HPVA 1NC3A 5AD1A 1BCSB 3TLXA 3G5AA 4WOBA 1PWHA 4RSGA 3G7SA 5FUQA 1Y3AA 3HKCA 4Q3BA 5FBKA 2KBFA 4W6ZA 2XODA 1BGXT 4B09A 1IB6A 3ZHSA 2C07A 2PS3A 4IQ0A 1QFJA 2JFHA 5CM8B 3DZFA 3SC4A 4H7FA 3RJ5A 4F2DA 4L9WA 1UM9A 4QD3A 2ECFA 2W6ZA 1TJPB 2X4IA 5L6MB 4TN1A 2REOA 5D5PA 2H57A 1L4MA 1E77A 3SJZA 4CKEB 3EXIB 5KNDA 3PLRA 1NA5A 4TUYF 8GPBA 4ZAXA 5KDDA 2ZM5A 2QRLA 4JL5A 1LU9A 2HC9A 3JQEA 2Z43A 4YRDA 4B0PA 3KRTA 1VLJA 1CQJB 1EM8A 1QV6A 2W6MA 1J33A 3HVJA 3FNFA 2P77A 4MW1A 4ZO6A 5LQMA 1NUHA 4G37A 1ORVA 3FPJA 5ABPA 1Q15A 4ILEA 2OOSA 2AIRA 3NM6B 5JWOA 4C2AA 2Q5IA 2H4WA 1Q0UA 3AC0A 4KLNA 4MB2A 1SZPA 2AMVA 2EFDB 3FM9A 1CCWA 3OD5A 1XWIA 4LBWA 2QORA 3HG7A 4LGVA 4XX1A 5EUQB 1IH8A 3CH6A 3G0CA 4QKQA 4OGLA 1L6RA 2NIPA 3UT5A 4YREA 3LBIA 5LP1A 4E7OA 4XZ3A 4RPCA 1FRNA 1LWOA 1T5TA 2I1VB 1N2ZA 4KB5A 2IOHA 4LJSA 4B3DA 3J7AC 3ICPA 4EL0A 2AN4A 3CH5A 4BEJA 4EATA 4AI6A 1W0CA 4G5QA 3I72A 1TO1E 5K0JA 3B36A 3ML1A 5EJ5A 4ZDIA 3MQ2A 1KEZA 4KVZA 5EWLB 1N0IA 3MCWA 2CL6X 2ZRGA 4H3HB 3AP1A 4IZOA 5EERA 5ESXA 1L5KA 5HWSA 4O3MA 4AF8A 3ZCQA 1R9NA 3MYRA 2JLXA 4NBLA 2VNJA 2AMJA 4E5SA 4C0LA 1X1EA 1WDLA 4GS5A 1W36C 4YMGA 3OJLA 3K8QA 3IOBA 2FSGA 2WU0A 4DGQA 1GGEA 2B92A 4GF5A 3C8UA 2O2YA 3BDVA 2ECKA 1WTAA 3QENA 1MW9X 4I1OA 4ZO7A 3OM8A 3RVNA 3WNVA 3L4KA 2ONZA 3FUWA 5CJPA 5ECWA 1AG9A 5FFMA 2JGDA 3O90A 3OIVA 3V00A 4CL8A 3H0EA 2LIPA 1GTZA 2CVQA 2ZYVX 2QTTA 3HBMA 3QELA 4IH9A 3NRBA 4HDOB 3VC7A 5DNUA 5HRCA 1JR3D 2ZUCA 2X0DA 2I33A 1D2NA 2H08A 3Q7QA 3WL6A 3EPHA 1J8VA 5IYZA 4QOEA 1H4TA 4WBNB 5HK9A 1CQWA 1UKEA 4DBZA 3H8VA 5JXGA 2DBQA 4XIYA 1CE8A 2XITA 4KVFA 4MGHA 3RVMA 3S1LA 1LWNA 3BRCA 4Q7JB 2VBFA 3ZW8A 1OUMA 4KX3A 4OQDA 2YUTA 1A7UA 4KQKA 2GZMA 4KN5A 3WIOA 2VCHA 2ATEA 3SS7X 4GI1A 1RLJA 2V5AA 3CRVA 3RAJA 2G36A 1FUYB 4UNSA 2E6UX 4DARA 3F7MA 3DVAA 1ZEJA 2IH2A 4KZKA 4WTOA 3NNNA 1ZN2A 4ALKA 2BM0A 4JP8A 2JGRA 1VOTA 1E94E 4GOOD 2VDKB 4AN0A 1M7GA 2X8AA 1PFGA 3WV4A 1T10A 1OGIA 2A9VA 2GVDC 4YAEA 1MQAA 1M6YA 3WNBA 3FVWA 3QY0A 3I1JA 3BWCA 4BMOB 3N8GA 5F5XA 3Q2IA 3WSTA 5DGDA 3V42A 3M6LA 3E8SA 3TNYA 5KCZA 2C4HA 5I7FA 5KQGA 2I9KA 1KQPA 1E2KA 2Q6KA 5H80A 4W9MC 1H0KA 3GJ0A 1Q22A 1OBFO 1XEFA 2CD9A 1L8LA 2Z04A 1OFUA 2QVGA 3FI0A 5DNVA 5FOXA 1KH2A 2VAVA 1XFAA 4PINA 2O19A 4D3XA 4DLXA 1WABA 5LCXA 3WMEA 1L3BA 2I22A 1UBOS 2MU1A 3O3OB 2R25B 1FU4A 3AK4A 3UKDA 1QGAA 4HXFB 2GYVA 4CEIB 1E2MA 2XQJA 4GKBA 3X1WA 5IAJA 3IAAA 4P35A 1MAUA 4PRZA 1WSDA 2O4CA 4H4EA 4M7RA 2GARA 3IP8A 3B20A 3O03A 4G4JA 3MPOA 5AVXA 1CJVC 1N8TA 1NQVA 3D64A 4NAVA 4WFJA 4FJ1A 3U0BA 2WUFA 1PJ2A 3NVAA 4L2IB 1RI5A 4WASA 1FDIA 2ZBRA 3PZRA 4X6LA 1L5SA 5AI4A 2YN0A 4O8CA 3OMXA 3RFCA 4ZTUB 2ZIVB 4DR3B 2JNWA 2NTNA 3A28A 2TECE 1CUDA 2ZSFA 3DCIA 3T15A 5J4HA 2CJXA 1FDTA 3ESBA 5IAAA 1T1GA 4HGNA 3B1KA 3TNLA 4PNPA 5FLKA 2E82A 2VNIA 3FPLA 3K16A 4DT1A 4X3CA 2ISQA 4I6GA 1RXWA 3UWDA 2MR5A 4MGIR 2IZ5A 5BYBA 5IYZF 4IRMA 5T3UA 4YMIA 3Q3VA 1GSHA 1A88A 3FKSA 3KVNA 3C0KA 2QJRA 4XQCA 4R98A 3AOGA 4RXTA 3CKLA 4CHTA 5GTDA 1HV8A 5AK5A 3W4KA 4V0MA 1KDOA 3OY2A 1HE2A 4BAGA 4PIMA 3LOUA 1W5TA 1E0JA 4DNFA 2YHUA 4XUDA 5HIKA 4MUGA 1Z12A 4QYIA 5FR1A 5EIXA 2YWEA 1MGPA 4PZAA 4M6WB 1LCIA 4QO8A 5KQMA 2XNDD 3C1AA 1LBEA 4BASA 3DMGA 4L16A 5A2GA 4CGZA 4EMUA 1DC4A 1HT1E 3M1AA 4OB7A 1TYZA 5IF3A 2DQSA 1QYRA 4RKRA 5AM0A 1CEYA 4OP2A 3DO6A 1NBMA 3SS8A 4BFLA 2J9RA 4G9GA 2Q1UA 4K9OA 3LDGA 1ZN9A 2ID4A 5HFNA 3GIDA 4ND1A 4DWJA 2YXNA 4QUJA 1P91A 3NWOA 3RO7A 3I61A 2FOXA 4NCKA 5FPTA 5HE9A 4UJ5A