2Q4BA

Ensemble refinement of the protein crystal structure of selenomethionyl gene product from arabidopsis thaliana at5g02240 in space group p21212
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
253
structure length
243
Chain Sequence
SANLPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGTSTPTKDFKALFSQVTSRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein At5g02240
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 72
structure length 243
sequence length 253
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q4bA00
2DPHA 2JD0A 4OOEA 4E5NA 2P68A 4B79A 5DBGA 1C0PA 3RBVA 3FWNA 3EK2A 4BNKA 4YACA 3JQ8B 1NM5A 4YBZA 5L4NA 5KVCA 3E6AA 2E37A 4AJ1A 4C4OA 2D5CA 3KYCA 4Q3CA 1GADO 3WBBA 1N1GA 5AQ1A 1K5HA 4J2HA 4CMIA 2VCYA 3UCFA 4BQPA 3D5TA 4N54A 5TGDA 4YQZA 3X2FA 3MTGA 4LCEA 5DDIP 4DLBA 4IM7A 2FZEA 4RPLA 1NHWA 1AUPA 5TS3A 1KEVA 2A92A 1GR0A 4WLNA 1D1TA 4CL8A 1KVQA 1R37A 1QKIA 4FB5A 3BTVA 1Z74A 5JCJD 1D7OA 1FJHA 4R1TA 4NMHA 3G0OA 2PK3A 1HF3A 1I3KA 3PJEA 5HWSA 3LDHA 3NKLA 3VZQA 3ZWPA 3WYCA 2QIOA 3G49A 2ZB7A 5LC1A 1T24A 1MG0A 3GAZA 4E5KA 4PG7A 3WTBA 1Z7BA 4E2YA 2FPGA 1KVRA 2OP1A 4ZQFA 1TB4A 4GL4A 4BKOA 4CUZA 2X23A 3RCBA 3VKVA 3CMMA 3L0DA 2RCYA 1SB9A 3H5RA 1E3JA 4S3MA 3IUSA 2ZQYA 3Q9NA 1PGOA 1O6ZA 3JQAB 1QYVA 1IHXA 4QSMA 4CM7A 3DEYX 4YR9A 3EUWA 5GY7A 2YV2A 4UVIA 2BI8A 2YFQA 4FFMA 4JQCA 1SMKA 4XIYA 1U7TA 1GZ6A 2GYYA 3I6IA 3PZBA 1U7HA 3H7AA 3PZRA 3SVTA 3JQAD 4MVJD 1BXGA 3AI1A 3IAHA 2O2SA 2XOXA 1I2BA 3T7EA 3DZKA 4LVCA 3Q3CA 4YYZA 3PHJA 3HSKA 3QA9A 1N7GA 4PLPA 3I1JA 4CM4B 1YOVA 1E3LA 2DAPA 3QW2A 4BNVA 3RC7A 3DAGA 4IQ0A 5T67A 5JYEA 4QXMA 2NTNA 1WDKA 4XDZA 5DNAA 3BZUA 2WYVA 1QXSA 4FJ2A 2VHYA 3JQGA 1V35A 5JDCC 4J4TA 1P1RA 4ND5A 4EZBA 4AJLA 1NYTA 3D4OA 5L7TA 4B8WA 3Q2KA 4FJ0A 2RH8A 4WKGA 4HY3A 3O9ZA 1G0NA 1ZJZA 5DOZA 3LLVA 3U49A 5TJ9A 4NIMA 1HRDA 4E33A 1PJQA 4F46A 5EINA 3CUKA 4YVFA 1BG6A 4BO2A 1SO8A 2C5EA 4CM1A 2NVUA 3RVDA 1GUFA 1D4FA 3W4KA 3A4VA 5I7VA 3M1AA 1MFZA 2FPPA 1QYWA 3LC2O 4XB2A 4LVUA 3ZWMA 3EZLA 1ISHA 3ZNQA 3TFOA 4CM6A 1K6XA 1FMCA 2C20A 1C0KA 1HE5A 1UZMA 2DFDA 3UXYA 5BSHA 5JC1A 1T26A 3ETGA 5FI5A 4Z9YA 1P3DA 3BA1A 5FI3A 2EWMA 4DLAA 3LT2A 3FBGA 1FDWA 4ZJUA 5EERA 4FR5A 5AXCA 2QYSA 4BGIA 4OMUA 1F17A 3L4SO 4BNMA 2QW8A 2P4QA 1U3VA 1F8FA 1ISIA 5I9NA 2VZ0A 3PK0A 3SJUA 4A7PA 1C0IA 3CINA 3VAZA 2J6IA 3V2GA 2NVWA 2NSDA 4R54A 2B37A 5IDYA 1U28A 2FN7A 2HUNA 3S55A 3O8QB 1ZFNA 3M1LA 1U4OA 3W8EA 5IN4A 1DDOA 4GBJA 3WLFA 3E8XA 4L4SA 4YT5A 1BW9A 4HX5A 2OBNA 4WUVA 4JCOA 1PL7A 3NTOA 4RPJA 1XWFA 2Y93A 1F0YA 2GN4A 3C7CB 4RPKA 2OGUA 3ZI0A 1LLCA 3HN7A 4DREA 4E4YA 1M76A 5BNTA 3PQEA 5CDUA 1GCOA 3ASUA 1Z82A 3ADOA 4E3ZA 1M67A 4YAEA 1KY4A 1PX0A 1YB5A 2NTVA 3SC4A 4DYDA 4KQXA 4QFDA 5IDQA 4EGFA 1PJ4A 1ULUA 1VL6A 4J7XA 1EE2A 1Q7GA 4XYBA 1HYHA 3MWEB 3GGPA 4WLFA 4WLEA 1C3VA 1ZUD1 2OORA 5ADHA 4J7UA 2BFPA 1P1JA 1CWUA 2W8ZA 1HLDA 1YBAA 2RHCA 4HV4A 5CG1A 3QWBA 3D5QA 3RC2A 2IEDA 2X22A 4XA8A 3WLEA 3JQ9A 4P38A 2EP7A 2CMDA 3JD4A 1LRLA 1X1TA 2BLLA 2TMDA 4K9DA 3GGOA 3NYWA 5BNFA 1PGQA 5EMHA 2Y68A 3KBOA 1TI7A 4MDHA 2PWZA 5TJHA 1S6YA 2JCVA 3A14A 4E21A 1ZXBA 3T4XA 4DTIA 4ZRMA 5TT0A 1GEEA 3KYDA 5IXYA 4PZDA 1E7WA 1YQGA 3WFJA 5JSFA 2B5WA 4E12A 5KJCA 4IJWA 3GGGA 4JBHA 4UEKA 1PGJA 5T5QA 3P5SA 4TRJA 4BHTA 1A4IA 1J49A 1GUYA 3LT4A 4IGEA 4PG4A 1K89A 3DR3A 3INTA 4XRRA 1XQ6A 3EC7A 4IQGA 5KWEA 1LLDA 4DXHA 1DRVA 4QO7A 4GSLA 3U09A 1LXCA 2G1UA 3HDQA 1I3LA 3JQ7A 1LLQA 3BYZA 5C7IO 1ZNQO 4Q3BA 3HDHA 5CHEA 4AJ4A 3UCXA 2QRKA 3WGQA 2YQ4A 1PZEA 1EVJA 3WQRA 3S2EA 3NEPX 1NPDA 5IAAA 1EVZA 1I3NA 2PZLA 4ZRNA 3WJ7A 4FSHA 1DOHA 2WSBA 2XXBA 3RFXA 1I2CA 1XSEA 4O0LA 4TRMA 1LSUA 3GQVA 3IKVA 2Q1SA 1ISMA 4PLGA 1MX3A 3SC6A 1JWAB 3QSGA 1EUCA 4KTVE 3RUCA 4FC7A 2OMEA 1AN9A 3I9LA 2BKAA 5GZ1A 4WLOA 3LC7O 3WNQA 4ZD6A 3JD1A 3DBVO 4W9NA 4F45A 2EXXA 2JFGA 2X7HA 2EW8A 4FD3A 4GAEA 3D3WB 4YAJA 4U5QA 2V6BA 3ONDA 1JVSA 2P9CA 2Z95A 3QV1A 3BMOB 4TSKA 1I36A 1PZFA 2VUUA 4YJFA 1WZIA 2VHZA 3BAZA 4Y6SA 3U4DA 3ULKA 1E7YA 4EEZA 4M87A 3NT5A 4L4RA 4D44A 1JN0A 1VJTA 3NDIA 4JX8A 4WGGA 5ENDA 5BR7A 4LGVA 1VE9A 4ND4A 1NXQA 2OXIA 1YQDA 3PGXA 5DP2A 4CM8A 2FMUA 5K6AA 2WE7A 3FN4A 3DHEA 2Q2QA 5JDIA 1GZ3A 3ICCA 3CEAA 3PJFA 4P8RA 3LT1A 5ICSA 4RVHA 4PIVA 3OICA 2BELA 4LSWA 3WGGA 3GZ4A 3GG9A 2B4QA 4R5HA 2VTEA 1NAHA 3GHYA 1U3TA 4A26A 4YAGA 4J0EA 1ZIDA 1OFGA 1XIVA 1HETA 1HDXA 3GEDA 4MKZA 1H5QA 3PWKA 3GOHA 3PJGA 5C7LO 2C7VA 4TVBA 1G6KA 1HDGO 1P77A 3DHNA 4LSMA 3PXXA 3PYXA 4DA9A 4GPD1 5EQFA 3U9LA 3ZCXA 3OIGA 4ZN6A 3VVBA 4R9SA 4TKLA 1DJNA 4IS2A 1PJ2A 4JP3A 3F6YA 1YH3A 5F5LA 3MJEA 1P1FA 1PU2A 1KS9A 3OQ6A 4KWIA 5AXBA 1H93A 3ZH2A 4CMBA 2VRCD 1EQ2A 2YDXA 3G3EA 1GCUA 2X0IA 3B1JA 4YTEA 5CDYA 1RYDA 4DQUA 1P9LA 1ZXLA 5G4KB 3G79A 3N58A 4J7CA 3H9JA 3S2GA 3TDKA 1I5RA 2O3UA 3WGYA 3HDYA 3FTNA 4IJKA 5COBA 1F06A 1LNQA 5KNLA 4RO0A 4BGEA 2C2YA 1KIFA 2Q45A 4WLUA 1T4DA 4LK3A 1GQ2A 1XEAA 3DDNA 3RFVA 2ZIZA 3L4BC 3QE3A 4AG3A 1PJ3A 3R3SA 3PHHA 1LQUA 3UVEA 1PWZA 3C85A 1KOLA 1YRLA 3MOIA 2Q1TA 3MOGA 1LDMA 4K28A 3LLSA 1MG5A 1IPEA 1B16A 4CLDA 1YKFA 2P9GA 3CMCO 1M6HA 4KUEA 2YDYA 4NK5A 4Q39A 4H15A 3L6EA 3OMLA 3GPDG 1PJLA 4FPXA 4HFJA 1VSVA 3ADPA 4ZQEA 4ZA2A 4BNXA 4B8ZA 1K0UA 3BHJA 3LK7A 3KXDA 3WQQA 3PWSA 1G0OA 5MDHA 1HE3A 3DHYA 4F3YA 3IC5A 3FPLA 2I9PA 1Y1PA 4XGIA 2JFHA 3E18A 1LDEA 3GPIA 1NFFA 3NAQA 4GGPA 4Y8VA 2R00A 2C07A 1G1AA 1BVRA 1DJQA 3DONA 1LUAA 5L3ZA 3WMWA 2G5CA 1RKXA 5DN9A 5L53A 4ZICA 1CERA 2J8ZA 2D8AA 3DZIA 2HO5A 3CH6A 1RM3A 4RPHA 3SXPA 4CR8A 1GAEO 1XR3A 1R4MB 4PLWA 1IPFA 4OKIA 1YJQA 3GVIA 4GH5A 4OSPA 2V6MA 2JD1A 1Q7CA 1ADGA 1NBOA 2CDBA 4BNTA 1HT0A 4KUGA 1GQQA 4N5LA 3UOGA 1UDBA 4RLHA 4IUYA 5F5NA 5TF4A 1A4UA 4DMMA 1MC5A 4MVJG 4D45A 2PKQO 1DEHA 2JHFA 3JYNA 4KZPA 2VWGA 3H5NA 1BMDA 2DUWA 1LC0A 1PR9A 4FFNA 5KKCA 4TVOA 4CR7A 3HQ4O 5ES3A 1J4AA 2BHLA 2GRAA 1TT5B 1OC2A 1T1RA 1O5IA 1UXGA 2GN8A 2I76A 2Q2VA 2YJZA 3HFSA 2ET6A 5IFLA 4NH4A 2HAEA 5AVOA 2Y1EA 3FRJA 2UAGA 5KJFA 2NQ8A 1N2SA 1WPQA 4PLYA 3PLNA 4GVLA 4XGNA 2VYVD 1JLLA 1TT7A 4S1VA 4UVGA 1PJBA 5JBIA 1GEGA 1QLHA 1NVMB 1WVGA 2BF7A 3U62A 4BUCA 4OSOA 4BNZA 1HDCA 1W8DA 5DCYA 4I9NA 2HJSA 4F6CA 4YB8A 2AEJA 4D7AA 2OHXA 2GPTA 4WCFA 1CF2O 3LZ6A 4HFNA 2FSVA 4XQ9A 4CLOB 2DLDA 5ITVA 1TEHA 3TRIA 3UKOA 1ML3A 4RVFA 1KC3A 4Y9DA 2VYNA 2B69A 3QWAA 1T2AA 2DM6A 4NNJA 4R1NA 4A5OA 2YHIA 1E0DA 1E1KA 2NWQA 3QQPA 5H83A 1S7CA 5F21A 1T2FA 3RKRA 3ZWOA 4OAQA 2XF8A 1OBFO 3DMTA 4R41A 1DRUA 5L4SA 5BSFA 3GVCA 3F1LA 2NU8A 1YL5A 2WM3A 2FZWA 4WEOA 4LCJA 5JY6A 3L9XA 4R1SA 3TOXA 4QUKA 3BHMA 3H9UA 3VPSA 4CQMA 2E82A 4XRGA 1ENZA 1NPTO 2DTDA 3H3FA 4AVYA 3ZWAA 3ZWYA 1HDYA 5B4VA 2Q4EA 3V1TC 3H3JA 4RZHA 3RROA 3QLJA 2ZB8A 4MIOA 1X0XA 4IDGA 2AEFA 4HNHA 4XR4A 3WGZA 4CM5A 4HFRA 3AFMA 4K26A 1IY8A 4ITUA 3T7CA 2VHWA 1YS4A 1LSJA 4HP8A 1LC3A 4A73A 4E13A 4EITA 3TPCA 2D0IA 3JQCA 3SEFA 2VOEA 2I66A 4TMFA 5COQA 3F3SA 1XCBA 3VPXA 5T6BA 4Q3EA 4YPOA 3K73O 1MLDA 4M89A 3IIEA 5CPBA 4YDRA 4TQGA 5EIOA 3JD0A 4J4HA 2B0JA 1XKQA 4B3JA 1ZEJA 3F5SA 3QWHA 2HK9A 3Q6IA 3HWRA 1F14A 4AL4A 2EIHA 1T2EA 3IP1A 4RVGA 3DAFA 1YO6A 4IZHA 4TKMA 2B4TO 3MJSA 4XEHA 5H81A 1SPXA 3S8MA 1PEDA 4CLXA 2PGDA 1E7QA 2BGLA 3U5TA 5T8KA 3EGOA 5CEFA 1DC6A 2D4AA 1RWBA 3HG7A 3WSVA 1O89A 3CSDA 2YW9A 1W0CA 3BMCA 4G2NA 1KEPA 4ZU3A 3VZSA 4H3VA 1RM0A 1Z73A 5ENVA 4Y6RA 4AJHA 4K6CA 1MFPA 4KWHA 4JN6B 5B1YA 1HYGA 4IPTA 3KUXA 4IDFA 4II2A 3KOUA 4DMLA 2I67A 2ZB4A 3D4PA 4CUKA 3IJPA 5F1PA 5A4DA 2Y99A 1E7SA 4MVJE 1NQ5A 1R16A 3GHHA 3AJRA 3ZWBA 1IULA 3RKUA 3DBRA 3L6OO 4LRSB 2WEKA 1SCUA 2PD4A 2W2LD 3BMQA 1PJCA 3O4RA 2W2KB 3OJEA 4YT2A 3GRKA 4BKRA 3RC1A 1ZK3A 1VKOA 1HXHA 3RUFA 3WJAA 1C14A 2X9NA 4YWJA 2WYUA 1DRWA 1C1DA 1V9LA 2BMAA 3OJOA 3ABIA 1DFGA 3GUYA 2IXAA 1NVTA 3R0IA 2EG9A 1PWXA 3BMNB 3I9NA 4OYRA 3ZV4A 1UZNA 1B3RA 2Y1DA 4CMCA 4KTTE 4L73A 7ADHA 1LBEA 1Q7BA 3GC6A 4CMAA 1EK6A 4MP8A 3STHA 3H5AA 1VPDA 4I9HA 4RVSA 2FRDA 1O0SA 1UXHA 3DOCA 1DC3A 4CMJA 4EI2A 1VKNA 2Q99A 3S1LA 2V6FA 4GX2A 5A9SA 1H0KA 3QY9A 3ITKA 2ZCUA 1JAXA 1FDUA 2AMFA 4YJGB 2GNAA 2BFOA 2OUIA 3ROQA 2CF6A 3ZU5A 5I7FA 1M2WA 4ZHSA 1PZHA 3K2BA 2O3TA 4N5MA 5A3VA 3KO8A 2OO5A 4DC1A 4Q9NA 2Z5LA 2JD2A 4IINA 3I9MA 1NVGA 4NJMA 2O3QA 4OJNA 4E6PA 3OQ1A 1QLJA 2UVDA 3FCOA 3JYOA 1HTBA 5JC8A 4RGBA 5L4LA 1Y8RB 2EGHA 4BO8A 3V1UA 3N74A 1A27A 3F4BA 1JKJA 4D46A 2OFPA 3K2EA 4C7JA 3H9EO 2DPGA 3GFBA 3HHPA 4W4TA 1X7DA 1AHHA 1PQWA 4UAGA 4BNFA 1XYGA 3TF5A 2J3HA 2Q1UA 3RC9A 5LDGA 2CZCA 4FC6A 4IDEA 1ONOA 2IRWA 2X86A 1ISGA 2Z1NA 2NADA 1SOWA 2PFGA 3AM4A 4O63O 4YJHB 2ZJ0A 3HADA 1HZJA 5L9AA 4WK6A 3H9GA 4XGKA 3FR8A 3WDSA 3GH3A 1P0CA 3ETEA 2VOJA 1LLUA 3MCVA 4RV9A 1HDRA 3WNVA 2DTXA 4CQLA 4WOKA 5A9RA 2Q46A 2WTBA 2HK8A 4EJ0A 3MJVA 2X0RA 2YV1A 2CNBA 2IEBA 2P9EA 1GV1A 1PIWA 4ZQHA 1ZCJA 3GFGA 1C1XB 2HQ1A 3W8DA 4CLEA 4N18A 3RUEA 4IIUA 3ZWWA 4JBIA 4J1TA 1KEWA 5CFZA 1UJMA 3IS3A 1OAAA 4M54A 1KVSA 4UVDA 4GWGA 5CP8A 5JYDA 3CZRA 5KVQA 1XELA 2BD0A 4KQWA 3IP3A 3QWFA 1ZMOA 1ISFA 5F1KA 1LSSA 1N8KA 1QYXA 2JAPA 4JROA 4MIEA 1JAYA 2IYOA 3EVTA 3ZU3A 3VZPA 1N9GB 2PLAA 1Q0HA 4WEQA 4FFLA 3DB2A 3M6IA 3NGXA 5IZ4A 3MWDB 3PWZA 2D2IA 3WGTA 1WWKA 5BSEA 4W7HA 2NNLD 3EW7A 1DSSG 1WDLA 4R01A 2ZCVA 1R6DA 3QHAA 3U3XA 4DPLA 4E2XA 4WJZA 1B8PA 3GVPA 5EL0A 3QVXA 4MJLA 3BIOA 5C5IA 1Y9AA 3ENNA 4RCVA 1IUKA 2C7GA 2GGSA 3W6UA 2QHXA 3TL2A 7MDHA 1SBYA 5G0VA 1YVEI 1CQIA 3OSUA 3DBHA 2DKNA 1SZJG 4G65A 3U0BA 1E3EA 2VNAA 1R66A 2AHRA 3O03A 4CODB 3F9IA 5FF9A 4BL5A 2BFMA 5DCUA 5A5FA 4BOYA 1Y8QB 4D0SA 1GY8A 3K96A 3UCEA 4D79A 1B14A 1FF9A 1Z75A 2FOIA 5THQA 3JYLA 5JDCA 4WASA 2B36A 1JWBB 1JW9B 3PGJA 3OH8A 3VDQA 4NU5A 1I0ZA 4QFCA 2WWRA 1Y5RA 1CQJA 1XHLA 4XR9A 1DHRA 2VYVA 4Q3NA 4JXKA 1OMOA 3DBLB 2QRLA 1SOVA 3R3JA 3MTJA 1ZKMA 4RF3A 1UR5A 1X15A 3JQBC 1RM5A 2DBZA 3PRJA 4R3NA 1PJSA 1QSGA 2G0TA 2V7PA 2ZYGA 1E1NA 3E5RA 1GYRA 3PIIA 3ZW8A 4DIOA 5EJ2A 5EQDA 3EY4A 2AE2A 3E48A 5U9CA 1NWHA 3I4CA 5FYDA 5JE8A 1HKUA 1A71A 3AY6A 3GY0A 5TQVA 3RASA 1E5QA 1R0KA 3H8VA 4HNGA 5CEEA 2GERA 3GZNB 5JFOA 3CIFA 1YBVA 5DF1A 3WIDA 1VC2A 3ZV5A 4ND3A 2CUKA 2A9FA 4Y67A 4B3IA 1WMAA 2YUTA 5FEUA 3E9MA 3G1UA 3HE3A 4GX5A 2G17A 2AW5A 4Q3DA 4YA6A 3INRA 3JD2A 1JU9A 2NUAA 1KVUA 4U6SA 2GD1O 1R12A 4E5PA 1E3WA 1HYEA 1N92A 4G81A 4CLRB 4DRYA 1GPDG 1LRJA 3UH1A 4ALLA 3WQSB 3LU1A 1PSDA 5B4TA 1Z45A 2PZKA 4DQVA 3Q1LA 3GNQA 1YQXA 2HMVA 4FJ1A 3WG9A 2GUGA 3IMFA 2WE8A 5A05A 1B3BA 3TZKA 2EGGA 2YFHA 4ZQBA 4DUPA 1N5DA 3B6ZA 4YT4A 2D59A 2WDZA 3B1FA 3U4CA 2PNFA 4BNGA 3D64A 1L1FA 1YJ8A 3ZHXA 1T25A 2CVQA 2VUTA 5DBFA 4IMPA 4L76A 4BO0A 1ADBA 4RDIA 5TT1A 2I3AA 4NBVA 1NQAO 1BHSA 3S2IA 1YB4A 3AUAA 4GGOA 4Z9FA 2WD7B 2X0NA 5KIAA 1DAOA 4ND1A 1ZW1A 5I9LA 5H82A 1WZEA 2CVOA 1OOEA 4WCDA 3F47A 4MPDA 3ON5A 4NBRA 2VHVA 3VPHA 4GWKA 1EZ4A 1XQ1A 2Y0EA 3RQSA 3ZNOA 1KBZA 2Q49A 1SEPA 3JCZA 4JIGA 5DULA 1UP7A 5DCWA 4QTZA 4GLOA 3ZWVA 4EBFA 4FFPA 4ALKA 2C0CA 3DFZA 3M2PA 4MVJH 2IZ1A 4A2CA 4D0RA 1GZ4A 1LA2A 1PGNA 3TWOA 3EHEA 3KYCB 5IXSA 5ILOA 2GR9A 4B4OA 2X5KO 3H4VA 3ZN2A 1X1EA 3SX2A 3UW3A 5JY1A 1UP4A 4CMIB 1BGVA 2G82A 5DZSA 1ULSA 2PH5A 1GFSA 1ZK4A 3QP9A 2YY7A 2E6UX 4AJPA 3KV3O 3GG2A 4OHUA 5KJ6A 3OHSX 1P1KA 4IDBA 1QV7A 1B2LA 2RIRA 2GN9A 2IODA 3CE6A 2CD9A 1BWSA 4M49A 4UUMA 1NFQA 1KY5A 3H2ZA 2IYPA 4PG6A 4CV1A 4YRBA 4JBGA 1R4NA 4R16A 2B83A 4R5MA 4CMKA 3PP8A 4ESOA 3K5PA 1ORRA 4IDCA 2UUOA 1CEQA 3H2SA 3CPSA 3OF2A 2UUPA 3TZCA 3JQ8A 3JSAA 4D41A 1EQUA 4NDNE 5FFFA 4BVAA 1H2BA 4BO9A 3TL3A 3ZDFA 2UV8A 3AU8A 4Z3KA 2C29D 3WBFA 6ADHA 1NFRA 3DMYA 1EDZA 4PLFA 2IDZA 5JCJA 2DFVA 2CFCA 4PLTA 1IOLA 1ONNA 1NWCA 1UAGA 3A28A 3E1KA 1YE3A 1X13A 1HEUA 3EYWA 4RQTA 4AJEA 1VLLA 1VL0A 3ZU2A 4PGFA 3H9QA 3MJTA 4RZIA 4J4BA 1PL6A 3IKTA 1P33A 4I5DA 4RQUA 1XG5A 4YCAA 4DL9A 1BXGB 2GASA 3K30A 1ZSNA 1QV6A 3DTYA 4E0BA 2TMGA 2O4UX 4NG5A 4B4VA 4QO8A 4YT8A 1YOVB 3LQFA 4IXWA 4BV8A 3PJDA 4J90A 5G0SA 4HXYA 3RJ5A 3TSCA 2RH4A 5DP1A 2RHRA 4MINA 4OH1A 2FR8A 2X4GA 2IXBA 2GSDA 3JQGB 4GKBA 2DT5A 4QQRA 3RJ9A 3ZGYA 1WDMA 2EHDA 3N7UA 1P1HA 3FNGA 3AUSA 5DOVA 4BKQA 4BMNA 5JCXA 3ZWNA 5K0ZA 1L7EA 3JQAA 5CPFA 1DO8A 4J1SA 3F4LA 2Q1WA 4MVJA 5A03A 3WOHA 5JXWA 1SB8A 1WLYA 1KYQA 4EW6A 1VJ1A 4NJOA 4UUNA 2P4HX 2NVUB 1IE3A 2HJRA 4Y98A 5L51A 2FPIA 3W8FA 1ENYA 2C54A 3NTRA 2A94A 2E4AA 4DLLA 3DZHA 2BRUA 1NASA 1EFKA 1K6IA 2GLXA 3UF0A 4TROA 3KRTA 1DPGA 1E77A 3CKYA 1TXGA 1U1IA 3RFTA 4AFNA 3C24A 3FWZA 4CM9D 1KERA 4ND2A 1LQTA 3QRWA 3U4HA 3PVZA 1Y81A 2QG4A 3BTSA 2AQKA 1W6UA 4L0QA 3ZHYA 4CM4A 2DBRA 4O59O 2R2GA 5L7WA 2CVZA 2FR0A 5U4QA 1AXEA 5HTOA 3AOEC 1DIHA 1P1IA 1T4BA 1U3WA 3KZVA 5A3JA 5TC4A 3PHLA 4I8XA 1F8GA 4XJTA 4U0KA 3W4JA 4EYEA 3P7MA 1D1SA 2POQX 1GYPA 3WGHA 4F6LA 3I9JA 3VKUA 3OETA 3A1NA 5TSDA 4L4XA 4IDAA 5L95A 1X7GA 3JQFC 1DLJA 3GRPA 3ROMA 4IBOA 2DU8A 4FOOA 1JQBA 3C8MA 3KHUA 5G0WA 1YGYA 3ROKA 1BW9B 2YZ7A 3QVWA 1UDCA 4BO3A 1DHTA 2I6TA 5JAMA 3JV7A 4J0FA 3VOSA 1N1EA 2W90A 1HSZA 3M2TA 4J2OA 3L4BA 2QRJA 1E1MA 1H6CA 2LDXA 1UH5A 2VNSA 1PR3A 4MKXA 4PFJA 3NT2A 4TWRA 3GEMA 4MVJI 2JCYA 4Y6PA 1GDHA 1GU7A 1I24A 3SLKA 2GDZA 3JD3A 3KEOA 1U5CA 3IUPA 2EKLA 1A5ZA 1GUZA 1KVTA 3EMKA 3NV9A 1LDBA 4PCVA 1V3UA 2RBEA 2YQ5A 4PRLA 1Q2XA 4KUHA 4E30A 4CMEC 5JW6A 3O8QA 5TRTA 1HE2A 1AGNA 1H2HA 3DOOA 3QWIA 1QP8A 5ILGA 4JJFA 5CEJA 2EJVA 1O95A 2HMUA 2NM0A 1EVYA 4BKPA 1NR1A 1XDWA 2DC1A 4NHEA 4BNLA 3KYDB 4II3A 4P4LA 3LF2A 1B7GO 5IZCC 4FCCA 2QYTA 2PD6A 4FS3A 4NBWA 4Z0PA 1ADCA 5JLAA 1I8TA 5A04A 2WMDA 4BNYA 1X0VA 2AA3A 3E5MA 2Q2WA 2P5YA 1J6UA 2O3SA 4PVCA 3W4IA 4BIIA 4D3SA 4NPCA 3VVCA 2VHXA 3OJLA 1CRWG 4RF5A 4Z9XA 5B12A 1V6AA 1QG6A 5U1PA 4P4NA 2D1YA 3FNHA 3DC2A 5KCZA 5IF3A 4XX0A 2CY0A 4B7XA 2IE0A 5BQFA 1GYQA 4OQYA 3A9WA 3K92A 3D3EA 4Z0HO 3K9QO 3JQ7B 4PG5A 1MV8A 3AY3A 4AJOA 2CDAA 4X54A 4XQCA 2I65A 1LDGA 3GDGA 4BB5A 1WNTA 3NJ8A 1XLTA 5J23A 3GMSA 1ZEMA 3ROPA 1NR7A 3I9OA 2VT2A 4PG8A 5G0UA 3MJCA 4LISA 4U7WA 2XPCA 2YYYA 4Z3DA 4YEDA 3VH4A 4RORA 1SC6A 2BFAA 1PQUA 3AUTA 4DBZA 4HKTA 1D3AA 3WMXA 4WOJA 3KETA 4PZCA 4L9RA 2AG8A 3VH3A 4I1IA 4TZKA 2WD8A 3OQBA 4L74A 4RDHA 2ZYAA 4E31A 1ZK0A 1EFLA 1EEHA 3DZFA 4CMEA 1EE9A 1WP4A 2R6JA 3RUHA 3Q9UA 4ILKA 5I7EA 2GN6A 2FHSA 5CAEA 1EUDA 1U3UA 2J3IA 1DC5A 4YJFB 2UDPA 4L75A 3KVOA 3WFIA 5A5EA 3TZHA 3EAGA 1ZO8A 1BXZA 2QX7A 1B26A 4RVDA 4GI2A 4BO7A 4IS3A 2D5AA 4CUJA 3PEFA 4R9RA 3HDJA 4JJGA 1RPNA 4KOAA 4WLVA 1LJ8A 1O94A 3WXBA 4BNNA 4UREA 1UXKA 4ZVVA 2X0JA 4CM8B 4CV0A 1QRRA 1WMBA 1PS9A 2NU9A 3HNPA 3VPGA 1NQOA 3LC1O 2QZZA 4A27A 4MVJM 3BTUA 3O26A 1I3MA 1VI2A 5JAQA 3HB5X 3WYBA 2EKPA 3GA0A 4YAIA 1PZGA 5BNIA 3FBTA 4JP2A 3TNLA 4XDYA 2ZKLA 1UXJA 1VL8A 2EJWA 2I5PO 4CM3A 4XIJA 3KLMX 1YONA 3PYMA 4IQ8A 3WICA 4AJNA 1DAPA 3D3WA 5ITWA 3OFSA 3BMOA 1UZLA 4BO1A 2PKQP 1Y5MA 3VH1A 3PFFA 2QZ9A 1P74A 5TX7A 2ZK7A 3HFGA 1DIAA 1ISJA 1EK5A 3DL2A 1DIRA 3FSRA 3GN2A 1GV0A 3TN7A 3X2EA 5KOIA 1A7AA 4R51A 3NJ4A 1XGKA 1DIGA 1P31A 2JFFA 3I5MA 3NX4A 3L9WA 3OP4A 3HZZA 2DQ4A 3JTMA 1O8CA 1YL7A 4KDFA 3Q0EA 1KC1A 2ZYDA 3I9KA 4GX1A 3NDRA 1OC4A 3WS7A 3DZJA 4YAKA 1ENOA 2XAAA 3ZV6A 1U2DA 2X9GA 1ARZA 3HN2A 3P19A 3JYPA 3VDRA 4XYMA 1IB6A 2RAFA 4FGWA 4M8SA 4IIVA 2C59A 4BQRA 2NLOA 3OEWA 3EZYA 3T4EA 4EJ6A 1J0XO 1Q0QA 3ST7A 5A9TA 4EEXA 1MC4A 4W7IA 4JK3A 2PA3A 4MP6A 2HU2A 1EBUA 5AXAA 1H9AA 1E6UA 1H9BA 1PGPA 2P91A 4HFMA 1W4ZA 3H6KA 3ONFA 4Q3AA 2VRCA 1C0LA 2HSDA 4GLLA 5TNXA 4GSKA 2H9IA 3V2UA 4XQGA 3WGIA 4H16A 4XYLA 1JA9A 3RU7A 4YJDA 4N7RA 4ALIA 1SAYA 4HUJA 3PLRA 2J5KA 1PL8A 2VUSA 5TLSA 4WECA 1P44A 3I3OA 1GPJA 5EESA 2Z1MA 3NRCA 3TOZA 1QYDA 1XA0A 1LRKA 1WXDA 3KEQA 4RLSA 2DBVO 3VZRA 5GZ6A 5G4KA 3IL2A 1YWGO 4QECA 1R0LA 2O7SA 3MEQA 5DBIA 3GEGA 2C2XA 3GUCA 4XKJA 3FI9A 4AICA 2G76A 4PRKA 2ZQZA 4BGUA 5A06A 3E9NA 1Y6JA 3RUAA 2GZ3A 1Y7TA 4B4UA 3QVSA 4DYVA 1AXGA 1DXYA 1RM4A 4OKNA 1NHGA 4AJ2A 1X14A 1LEHA 1E7RA 3ANMA 4UVEA 4J1NA 3R1IA 4NZ9A 2GZ2A 3V8BA 3ZW9A 3ZHZA 5JAZA 3NUGA 4OQZA 3BXXA 1UAYA 8LDHA 2P2SA 3GMDA 5ER6A 3WIEA 4DQXA 1DC4A 5KVSA 4A10A 4JLWA 2BI7A 3DAPA 4OXNA 4W82A 5JPIA 4ONEA 1YBMA 2PH3A 4GQAA 1Q1NA 2Y0DA 3FTPA 1MXFA 1AHIA 1BTOA 1Y9EA 2O3RA 2AQHA 5HBRA 1TA4A 2F1KA 4J16A 4C7KA 5CDSA 3PIDA 3FPCA 1VRWA 2VZ8A 4CM9A 2HMTA 4MOWA 3AK4A 3UGKA 2VT3A 4CJXA 4MO2A 3AM5A 5LDHA 3KM0A 1P0FA 1E6EA 4BNWA 3JQ9C 4NFHA 3GAFA 4JJIA 4YRDA 1OZAA 2O2YA 1KETA 4XJSA 4EDFA 5KJEA 2BH9A 3GVHA 3AW9A 2JHGA 3RI3A 4I9UA 1ZSYA 3DTTA 4UVHA 2ZATA 3RBXA 3E82A 4H7PA 3K8ZA 2VWHA 3RUIA 3VH2A 1BDBA 5G4LA 1R4MA 3OIDA 4YXFA 2ZTVA 3KSDO 1MB4A 4JGBA 5C3MA 4NBTA 4EUEA 3CXRA 4WCFB 3I52A 5MGBA 4CLHA 5KVVA 1K6JA 3F46A 5F3RA 5HRUA 1IYZA 4FGSA 1YXMA 3RU9A 5EPOA 2WYWA 3PPIA 3C3XA 4INAA 3UFXA 3DZBA 2J5RA 2AG5A 1OI7A 1H6DA 3DXFA 4O1MA 4MVJF 3LYLA 2VQ3A 2YHIB 3ZHBA 2X58A 4J9UE 1TT5A 3JQDA 2XXJA 4BNJA 4FDAA 3VTZA 3PFWO 1V3VA 3TFQA 1VJ0A 2VYND 3ANNA 2E48A 4UEOA 1FDSA 3F5QA 4QEDA 4L8VA 1R15A 1HWYA 5A02A 5IN5A 4PLZA 5I7SA 4CQMB 1M66A 1I32A 3VHRA 4DIBA 3I6QA 3AM3A 4NBUA 3ZWXA 2PZJA 3D7LA 3FNFA 3UICA 5EN4A 4PN3A 3GLQA 4FQ8A 4ALJA 4M55A 3IQDB 3ZNNA 1FDTA 1UP6A 1NQTA 4AJKA 4OIMA 4CV2A 5B37A 4G5HA 1U4SA 1EMDA 4CQMD 3INGA 5A1TA 2VWQA 4CLOA 3PYLA 5IJZA 2ZB3A 5JNLA 4D42A 1NPYA 2E49A 1K3TA 3KSZO 4W9NC 1GTMA 3K31A 3FHLA 4NFSA 4IXTA 3WTCA 2I99A 2HCTA 1HSOA 1ENPA 4U8GA 2X9VA 3OIFA 3WGOA 2OOSA 1NX6A 1DFIA 1ADFA 1PJTA 1H6AA 1UXIA 1TLTA 4NI5A 1LDYA 2UYYA 2PZMA 3TZ6A 2ZJ1A 5AYVA 4N5NA 5JO9A 2C5AA 2V65A 3ONEA 2GCGA 3CZMA 3FNEA 4FIZA 1KEUA 2Y1GA 4FBGA 1CETA 2X5JO 5JAIA 3WWZA 3JQ6A 1FDVA 3WX0A 2FY8A 3I83A 5K6AC 1QMGA 3BMCB 1L7DA 4JNKA 5JDIC 2AXQA 1M75A 5K9ZA 3PI7A 5I9MA 1LSOA 1ZJYA 1E6WA 3SJ7A 1Z6ZA 4J9VA 3TJRA 3GDOA 4E2WA 4MP3A 4NR0A 3O38A 4XYGA 1F12A 2H6EA 3WB9A 3JQBA 3PDJA 4BKUA 1ZK2A 4ROSA 2DUUA 3NTQA 1DLIA 1T2CA 3AWDA 3DBRB 2PGLA 4WNIA 3BMQB 2P5UA 4J6FA 1O9BA 4BO6A 4CV3A 4IDDA 1U8XX 4O6VA 3AUUA 1HLPA 1IHYA 1ZMTA 3ASVA 5THKA 5GZ3A 5KKAA 4M86A 2HLPA 2C82A 1LTHR 2HRZA 1C1DB 2NVBA 3C7AA 4R3WA 1E7MA 3QVOA 3V1YA 3GR6A 3LF1A 4UUOA 4DIFA 3OBBA 1EBFA 4B3HA 1QORA 3L07A 1CDOA 2OP0A 3PQFA 2WJPA 3HB4X 2DBQA 4O5OA 2ILTA 3E03A 2Q3EA 4RJTA 1A7KA 2W2LA 3GT0A 3DQPA 4I5FA 2OZPA 5A9SB 3OM9A 4FW8A 5ICMA 1HE4A 4IGFA 4PLCA 1ID1A 1PQPA 3L77A 3L6DA 1JKIA 1CJCA 4PVDA 3IOYA 3GF4A 3KB6A 2O7QA 2VWPA 3QJ5A 2B4RO 4UULA 4ALNA 4P22A 4OL9A 1MXHA 1ZVMA 1BXKA 2H1SA 4M1QA 4CR6A 4E5MA 3NDJA 2W2KA 1ZK1A 4NU6A 3SLGA 3ZNPA 2DVMA 3OJ0A 1YB1A 4J3FA 1DBVO 4IJUA 1H94A 5G0TA 4NJMB 1YDEA 3RAJA 3C7DB 1BVUA 2JJYA 1EVIA 2PKRA 3KSUA 2BGKA 4ZQGA 2W98A 2I3GA 3OA0A 1U9JA 2NACA 4BGVA 4FOSA 3B1KA 3BMNA 4QX6A 3EVNA 4Z0TA 1MP0A 5L40A 1GQYA 1I2ZA 4WNCA 1DFHA 2GO1A 3HUDA 5JS6A 3ZWCA 4J49A 2ZTLA 3AU9A 2R00C 1Z7EA 2NU6A 4K6FA 4OO3A 3ZV3A 1UDAA 1MUUA 4P4GA 4RF2A 4CL3A 4ZGWA 4IZIA 1RYEA 2HMSA 4MVJP 4YJGA 5HM8A 4RL6A 1DB3A 2CF5A 1B15A 3I23A 4NFYA 5IG2A 3B70A 3COSA 3RUDA 3G1TA 2PR2A 5C37A 2NQTA 4KDEA 2Q4BA 3F1KA 2O4CA 4D43A 1IZ9A 2PD3A 5KTKA 4BNHA 1V0JA 3GNSA 2PY6A 4D3DA 1LX6A 2Y66A 2EERA 4U0JA 4CQLB 1JDJA 4XB1A 4R68A 2J3KA 2FR1A 1BSVA 5JMWA 3VC7A 1E1LA 3GNTA 1Y8RA 3IJRA 5COAA 2HDHA 4BB6A 1LU9A 4DPKA 5KJ1A 5FWNA 8ADHA 4LMRA 1YL6A 1M6WA 1U2GA 1GL3A 1WAMA 3W6ZA 1E5LA 2Q50A 1T1SA 2EF1A 3DOJA 1B8VA 3GK3A 4NK4A 4BMSA 2X1HA 3GN1A 1TVEA 3ANLA 1PS8A 2O50A 5I8ZA 1FXSA 4J91A 4J43A 3C1OA 2SCUA 2ZTMA 3LSYA 3WWYA 1Q0LA 4DWVA 1X7HA 3RWBA 3QIVA 4HADA 4YJHA 5L45A 1E3IA 4OXYA 2EV9A 1B0AA 1H6BA 1HZZA 3OA2A 3CTMA 1CYDA 5IDWA 2HKIA 5GMOA 2IZZA 3KYBA 5TIIA 4W99A 4NQZA 3PHGA 4WCFC 1DIBA 2Y1OA 3D4NA 1W73A 4GMFA 2O48X 3B20A 2VTDA 1T2DA 5HS6A 4AJIA 1E3SA 1VSUA 3U4IA 1C1XA 1V8BA 3MJ4A 4YQYA 2JCXA 3NGLA 3OJFA 5L7YA 2EW2A 4OGWA 4Z6KA 4XQEA 5JO0A 1NP3A 2LDBA 5AXDA 3DMTC 5T57A 1R0SA 3LVFO 2HRBA 3DBHB 3RBZA 1I33A 4B4WA 3SBOA 1PTJA 4XZ3A 2W4QA 3DZGA 2Y67A 4CMGA 1BDMA 2Y0CA 4TZTA 2H63A 3PHIA 4WPGA 1VM6A 1ZSVA 4LMPA 2OBYA 3ENKA 2O23A 4KMSA 3V2HA 2ZTUA 2FWMX 3I4FA 3DO5A 4BO4A 2AE1A 1HL3A 3ICPA 2IZ0A 3S2FA 4BS9A 4BMVA 2PV7A 5F1OA 1XU7A 1N9GA 2PTGA 1JVBA 1AE1A 2JAHA 1JKFA 4XWYA 4DPMA 4LN1A 1A9ZA 5T64A 3PDUA 1LDNA 4ID9A 2A35A 4PZEA 2D3TA 4URFA 3UAGA 3UN1A 4A03A 2HK7A 4UEJA 2O3JA 4CMHA 2PGJA 2VRBA 2BGMA 2HMWA 2VN8A 3PTZA 4HBGA 4RVUA 3BHIA 5AOVA 3AI2A 3WYEA 4K1LA 9LDTA 1YDWA 1ZH8A 4FFOA 3Q11A 3P2YA 1BRMA 1UUFA 4J1QA 4AJJA 3P2OA 4YRAA 2X6TA 3KLPX 4EJMA 1I01A 1PS0A 1QYCA 9LDBA 1MA0A 3ORFA 1WW8A 4W6ZA 3K6JA 3AOGA 1FK8A 1XU9A 4IMRA 3LT0A 3EDMA 4MKRA 4OXKA 4FN4A 1D8AA 2V6GA 5T8KC 4D3FA 1Y8QA 4BNUA 1MGOA 4RPGA 2NV6A 1RJWA 3AOEA 4R4JA 2B35A 4PLHA 4LRTB 2JKVA 2DTEA 6LDHA 1QR6A 3WSWA 4OM8A 2CSUA 5BT9A 4MIYA 4R1UA 3JYQA 1IZ0A 1NNUA 3WR5A 1E3WB 2Y05A 3FR7A 5IDXA 2F00A 3JQFA 1JTVA 3DBLA 3MZ0A 5LCXA 4B7CA 2A4KA 2JL1A 3HJAA 2YHUA 4I5EA 1GD1O 2GZ1A 3FD8A 4GMGA 4HWKA 4EUHA 4A0SA 4PLVA 1I30A 5HS4A 3RIHA 3IDSA 1NTOA 2FSSA 4FFRA 5I8WA 2CDCA 2X8LA 3OECA 3PQDA 4GX0A 4IJVA 3RSHA 3OEYA 3Q2IA 1SEVA 5ER9A 1U5AA 1A9YA 4EUFA 3GZNA 4E5YA 2QQ5A 4U6QA 2FP4A 1J5PA 1IL0A 4XD2A 4I08A 5B4UA 2VZ9A 2J3JA 1P45A 2AEMA 3FF4A 3R6DA 5JMPA 1EUZA 2EEZA 5CDTA 3AFNA 2OL4A 1LI4A 1A72A 3AY7A 2B5VA 3ITDA 1HDOA 4TRNA 3ETDA 1HDZA 2X5OA 2AQ8A 4DVJA 2AQIA 4CLRA 4DGSA 4BO5A 3UUWA 2GF2A 3D0OA 4QT0A 3H65A 5CG2A 1ONPA 4GKVA 1B8UA 3DFUA 3NT4A 4TRRA 4BNIA 3VPFA 1ZBQA 4LW8A 3VTFA 2H5LA 3AI3A 5BSGA 3C1AA 3UHAA 4IY1A 4B7UA 2EKQA 1CIVA 4XYEA 5IZCA 3GDFA 4KP7A 1EDOA 4E32A 2J5QA 3DWFA 1N7HA 1I10A 4I5GA 3D1LA 3G17A 3TQHA 4BV9A 4OOFA 1SNYA 3ZZNA 3C1TA 2Y1CA 5DT9A 2Y1FA 3JQEA 4R69A 1K2WA 3A06A 3V5NA 5HA5A 1E92A 4WE3A 1U8FO 3ZU4A 1NAIA 4ALMA 4DBVO 5C7OO 3BTOA 4E2ZA 3TZQA 5G2OA 1V3TA 2NU7A 2NTJA 2WD7A 3E9QA 3KTDA 4XCVA 1ZZEA 4GVXA 4RF4A 5CDGA 4CPDA 3RD5A 2YV3A 3W1VA 3QVTA 3GVXA 4UUPA 4DC0A 2EP5A 1R4NB
chains in the Genus database with same CATH superfamily
4F04A 3CGWA 2DPHA 4X8LA 4OXRA 1GVHA 3ZK8A 3RAFC 2O8VA 2P68A 2P3QA 2P3LA 1RKBA 2C31A 1QCYA 2VJCA 2IOQA 1KR5A 2MMCA 1OJLA 4PF1A 4V3CA 2HZBA 4QQNA 3RBVA 2WHYA 3GUVA 1OLXB 5F3WB 4Q4HB 4XASA 3NIWA 3VR3A 4MI9A 3OE7D 4X3PA 4H2DA 2E37A 5D85A 2B78A 2ZYHA 3N2YA 1N4DA 3W2EA 4Z7NB 1AA6A 1MABA 1SU4A 1K5HA 3E7DA 5BWCA 2DMRA 1QHSA 1S4QA 1T5DX 2C4TA 2PEZA 4Q4JB 5FFMA 4CMIA 4BQPA 1G4UR 2HA6A 3IIKA 3R2JA 5HGXA 4OU5A 2FFJA 1Z8DA 3R23A 4N54A 4YQZA 5TGDA 5AJVB 4LCEA 3JZFA 1P5HA 5DDIP 4ZPXA 2Q3MA 2QV0A 1ZD8A 1KEVA 2A92A 2D1FA 4FLMA 2G4VA 5JT1A 1KVQA 2UYHA 2ADFA 3PHBE 4WESA 5DKFA 4MI6A 3WISA 3DLPX 1W0JA 4A5SA 5JCJD 5JSYA 3SI7A 3MWJA 5FHRA 1FJHA 2A9OA 4MUXA 4NMHA 2PK3A 2RGXA 1QBKC 4R1TA 1JEOA 3PJEA 3LDHA 5HWSA 3WYCA 2QIOA 1GPKA 4Z7QB 2ZB7A 4AYWA 7ABPA 1FX0B 1H05A 1QFZA 3GAZA 1RMTA 4QDKA 4PG7A 4IOKA 4E5KA 3ZJYA 1JEYA 2CXRA 3RYIB 5JAUA 1N5IA 3Q10A 5KYTA 1T8RA 1TB4A 1Z2OX 1I6MA 4CUZA 1FFSA 4BLWA 1NXTA 4F2HA 3WA7A 1G6OA 1F0NA 4WKNA 1LFDB 4TV8B 3CMMA 3VKVA 2I8LA 3WL5A 4OTZA 2QX4A 2RCYA 4JWTA 3SX0A 1SB9A 3KPVA 3H5RA 3NVAA 1L5LA 3H75A 4WK2B 4NFLA 3ZY6A 3TLYA 2YV5A 2ZQYA 5TE9A 1PGOA 3UKDA 3JQAB 4RSMA 1PSWA 4K9OA 3UJ8A 3DEYX 1SXHA 2C77A 4KAJA 1ZWKA 2YV2A 4MV7A 4GUAA 2OO3A 4UVIA 3KAJA 1XTRA 5KTPA 2ORIA 1GILA 3ESQA 4XIYA 1SMKA 3TSWA 1MJ5A 5BRJA 1U7TA 3I6IA 3Q12A 5AKEA 3KZ1E 1U7HA 3EVZA 3PZBA 4H0CA 4RSGA 3SVTA 2FPIB 1SQ0A 3EPLA 1E61A 2EU8A 3KJNA 4IIBA 1T8SA 1BXGA 1TC2A 4HVLA 2OKGA 1HNZB 3IAHA 2XOXA 3BDIA 3DO6A 1KZ9A 4ER6A 1EG2A 2Z98A 4ZIRA 1V8FA 5C8YA 3CLUD 2EL9A 3GRZA 3KT6A 4ZZIA 1YOVA 3BXHA 1W4BA 3QW2A 4WNAB 3RC7A 2BTQA 1AQJA 3DAGA 2KB0A 4H1VA 1G5RA 1I1HA 1RHQA 1V9SA 4EF5A 4XDZA 3IT3A 2NYUA 3BZUA 5HIJA 4U4AA 1QXSA 4FJ2A 2VHYA 1Z0AA 4W8GA 4R8VA 1P1RA 2GXAA 3CUVA 2HA7A 1NYTA 1AGPA 3D4OA 2YNMC 4KH1A 4YROA 3U4GA 3O0TA 4B8WA 4LOJA 5EJFA 1L3CA 1C9DB 1N25A 5A6SB 3TCKA 3TVYA 1G0NA 2JLVA 4O4LB 1REQB 2B94A 1BAPA 2DQYA 2VH1A 3L2OB 3LLVA 2AMJA 4II7A 2CLFB 1S8OA 4NIMA 1BFDA 1XKTA 5HYVA 2RMKA 3ABRB 4KSCA 1RE1A 1LY1A 4IXNA 4FHZA 4WL0A 2XNCA 4L8GA 1TJ4A 1Z56C 3QXGA 3JWEA 1JUDA 5I7VA 3M1AA 2AJCA 4EO7A 4CGYA 5F76A 5HKBA 1MFZA 3G2OA 4RHCA 3LC2O 1N2CA 4G97A 1CUIA 3PQ3A 5CA0A 5LZ9A 3AEQB 4LYHA 1GCIA 3DGFC 3GRCA 3EIHA 4FE7A 4C6RA 5JWOA 1X1CA 3PVSA 1FMCA 2QN9A 2GJAA 1C0KA 1HE5A 2DFDA 2VP4A 5BSHA 4OB6A 2CLHB 3N76A 4RFVA 1T9KA 5FI5A 2J3EA 4LYJA 4P80A 1P3DA 3BA1A 2EWMA 3V7FA 2I4MA 2PPVA 2Q0XA 4ZJUA 3V8QA 5JH7B 3BJMA 2A5DA 1B1CA 4BNMA 1Q57A 2J7PD 2OVFA 3ZGZA 1NXPA 4JC5A 4WTOA 2GA8A 4QT4A 2VZ0A 5HKKD 2XOKD 2X2EA 2C4HA 3ISVA 4NCJA 2J6IA 2XB4A 3C3WA 4PQYA 3PNPA 5AKGA 2AN1A 3LW7A 3AHIA 1CUSA 4HZUA 3V2GA 2AFIA 3ZTYA 1WNFA 1TFUA 1Z29A 2WKQA 5EZYA 2I4IA 3F73A 3W8EA 5TQ0A 4BKMA 2H1HA 1RBQA 1Z4JA 2XRFA 2P6PA 4AO6A 5JYCA 5LIRA 5B1SA 4LJ4A 4NF2A 2H2WA 4MRVA 4WUVA 1MR3F 1Y82A 3DM5A 3L1JA 5LZ5A 2Y93A 3HM2A 1F0YA 3X1DA 3MB8A 1Z5WA 1XCOA 4RPKA 5ALHA 5KSWB 3BQNB 1NVKA 2GPNA 4Y3UA 3HN7A 1R2QA 2YWFA 1OAOC 4UD2A 1P81A 4HDRB 4B8YA 1GCOA 5CT8A 4F85A 1QG0A 2OGSA 2OQIA 4E3ZA 2XD9A 5DLYA 1M67A 2ZSHA 4ZEMA 2WICA 4QD3A 1VXRA 4CF5A 1KY4A 1DVRA 5B2FA 4R8SA 5FLKA 2PXHA 2NTVA 4TTQA 2I1VB 2VCHA 3BH6A 2EYQA 3ED1A 3COWA 2OK7A 1AT1A 3IEXA 4HRXA 4IIYA 4KJZA 4MA4A 3T54A 4QFDA 1Z68A 1RVDA 1H5NA 4HLDA 4EGFA 1PJ4A 4J7XA 2ERYA 3B89A 4ZALA 3GGPA 4MUIA 4WLFA 1C3VA 1D4AA 3EWSA 3VNAA 4AS2A 2HA4A 3BKWA 2BFPA 5IC6A 2VJOA 3DE3X 3I0MA 1CWUA 3H5OA 4RPCA 3SZOA 1HLDA 4EM6A 1B6GA 4RTLA 5CG1A 3HEAA 3GJQA 3IHKA 1KYXA 5KTNA 3UBTA 2HI0A 4PQEA 3JQ9A 4P38A 3JZIA 1NUUA 2EP7A 3HP1A 4R2LA 1T8WA 3JD4A 1LRLA 1TZJA 1X1TA 2BLLA 2IHUA 2TMDA 4KACA 3ELBA 3GGOA 3NYWA 2XUZA 4K9DA 4EYGA 2O8CA 1MDFA 3FFXA 5C1PA 3PV0A 4MWEA 1K7FB 3L7AA 3FI0A 4MDHA 5LBTA 5TJHA 1KZ1A 1S6YA 2JCVA 3GLIB 4EECA 4OQEA 1W48A 3FWKA 3HLYA 3T4XA 4BB9A 2MYPA 3I2KA 3OCYA 3OM1A 3TDMA 1F4PA 4BEBA 5IXYA 4PONA 3USES 1E9DA 3W7VA 5JSFA 2B5WA 4BFCA 4Y0NA 2X3FA 3EFBA 2XNDA 3GGGA 3QOXA 2XWSA 3LPLA 1J0CA 3TNYA 1ABBA 5AW2A 2ZBUA 1QDEA 4TRJA 2R8YA 1XZNA 1JP7A 4WZAA 1MF7A 2BHSA 4EG3A 2J7KA 4PG4A 4DARA 3DR3A 3MW8A 2X42A 1XQ6A 1X9IA 2HA0A 2IXGA 3KT3A 3QJYA 4M8NE 3PX7A 4WVLA 3AQ4A 2A58A 3ESBA 4Q93A 1GNPA 4QO7A 5ALZA 1CY8A 3U09A 4ZV9A 1IM8A 4HNVA 3JQ7A 5AJUA 1LLQA 2K7ZA 2I55A 5C7IO 3TLJA 1T9AA 1XCJA 1ZNQO 4RBNA 1OTHA 2TECE 4EYQA 1P6QA 5ALIA 2QRKA 1QF6A 4DV0B 1KH1A 2ZSJA 2B0CA 3L5OA 2A0XA 4KK4A 2FPXA 2HHJA 3G9QA 4FCVA 3WQRA 5E4FA 3NEPX 4J94A 3FPAA 5IMSA 1L8XA 3BEOA 1TNDA 2MJLA 1I3NA 4P4TA 4ZRNA 4B5LA 2R7NA 3PG5A 1V47A 1AM4D 3SR0A 1M0WA 3RFXA 1AIPA 1N7IA 2FWJA 1ISMA 1DKUA 2Q1SA 1V5EA 5G1PA 2BSAA 2PSFA 5EZQA 1EFRA 2AFHB 3QSGA 4HN9A 2HXGA 4KGZA 1Z0KA 1EEXB 2OMEA 4Q18A 4PGHA 1O94D 1QIJA 3UC5A 4ZEVA 5JS8A 1G63A 1CXZA 2BKAA 4XUCA 1GT6A 3AHFA 4AZWA 1G8JA 3AVTA 3LC7O 2WJ4A 3D6UA 5IJ9A 2BMDA 2NO4A 4ZD6A 3JD1A 4W9NA 5K45A 1RQ2A 2ORYA 2MWMA 1U3CA 3CZAA 4F72A 2CNWA 1FNNA 1XDSA 4BMOB 4ZDWA 2YH2A 3B2EA 4S0XA 4U5QA 2V6BA 3ONDA 1JVSA 1G4AE 4PBSA 4F2GA 1C50A 2O05A 4IF4A 1UT8A 4D8XA 1NTRA 1I36A 2JBWA 3MS2A 2IFTA 4H7DA 5AMXA 5J59A 1BHO1 3OC6A 1AZLA 1W87A 2XEXA 3BAZA 4YCBA 5FBVB 3LQQA 4QEKA 5H02A 4K03A 3HYTA 3ULKA 2OQVA 5KPJA 1ZCZA 2E1RA 3L92A 1JN0A 1UWLA 1VJTA 2FW8A 2WKPA 3NDIA 4JX8A 5K0LA 5CB6A 5E4JA 5BR7A 4LGVA 3UGJA 2Z2IA 3HY3A 2TYSB 1LJLA 4KREA 3NUQA 4O8ZA 5DP2A 5ICCA 4RAQA 1MNAA 3OD1A 2QS9A 1I6WA 1W59A 2L19A 1JJBA 3LQRA 1DP4A 1ECPA 2WE7A 4P9NA 3LPCA 3FN4A 4KFRA 3U1VA 2XDQB 4TWAA 1IBSA 1K7XB 3GARA 2R86A 3QH4A 3LT1A 5ICSA 3PXEA 4YIKA 5EZ6B 4GIBA 3FTQA 1RJGA 1X77A 3CVJA 3R41A 4LAFA 2OUKA 3GG9A 4PYOA 2B4QA 2Y0PA 1EJBA 3WNZA 3SFVA 1NAHA 1CQPA 2LE0A 4G1UC 3OQIB 5TQ2B 4DV7B 1ESNA 5C4IA 1E62A 4MGKR 4ZU1X 1HETA 1VE1A 1NBME 2I29A 4OVKA 4UD6A 1H8EA 3GEDA 1SBTA 4BN4A 4MKZA 5KNCH 4BZZA 2GEBA 2R79A 3DTNA 2C98A 4KBGA 3GOHA 5DYGA 3RIGA 5EE5B 4NNOA 2J48A 5CVUA 2C7VA 4Q4CA 1HDGO 2X14A 4P0QB 3U9LA 3ZCXA 4UDXX 4ZN6A 4ETIA 4X8OA 3VVBA 4TXNA 5LVAA 4HGPA 5K6RA 3WC4A 1NN1A 4QQFA 1PR4A 3MJEA 3OQ6A 5HF6A 1EX1A 1H4TA 1P8JA 4HH0A 3TW0A 5C34B 2J08A 2QN7A 4KN8A 2VRCD 4LA4A 1S1MA 4OHPA 1EFVB 4PX3A 5BSVA 2O2HA 2YDXA 3FTCA 4GECA 1JHMA 2X0IA 4EX6A 4EJSC 1Z2DA 1RYDA 2VEDA 4GOJA 4LWPA 2O5CA 4QLBA 1XMOB 4FOPA 4C03A 5F35A 4NCKA 5CM2Z 3D8HA 4PSDA 4Q03A 5FNZA 2ODQA 1EGMB 3T52A 3N6RA 1N6IA 1LD3A 5CFPA 4J7CA 1M8GA 4GRIA 3TDKA 3CXUA 4GXRA 4H77A 4GP7A 4XFJA 1KBQA 3WGYA 1A5SB 4HHEA 4BGEA 1ETUA 3WWDA 3SMQA 4ZZ1A 2VPZA 4LK3A 5GWXA 1WUJS 1MENA 1XEAA 5B58C 4PFQA 3RFVA 2XBLA 3B6KA 3QE3A 1ZGGA 4AG3A 5JNUA 2OE2A 3PHHA 5KSYA 1VG0B 3OIUA 3C85A 1N9KA 4ZZ2A 2Q1TA 4N0PA 2SBTA 3LLSA 1QTNA 2BDTA 2W6MA 4DNPA 2V55B 1B16A 2QT0A 3CMCO 4RACA 1M6HA 3QKSB 3TD6A 1KH2A 2BFNA 4NXMB 3OMLA 5JROA 2R6CA 1SOAA 4GOLD 3PR1A 1O08A 3ZQ6A 4EL5A 2VQEB 3HPRA 2RGCA 3ELUA 3OUZA 1H3EA 1MZPA 1HE1C 5KYXB 4B8ZA 4P58A 4KFCA 3BHJA 3D6MA 4RMIA 1FBNA 2PYIA 2XJ9A 3HJBA 2P6OA 1XO1A 2WHPA 1T3SA 4LPKA 4NEGA 4ZO8A 3TOCA 3PCRB 1ZIOA 5T4EA 5CUQA 3WQQA 2YY6A 2CD7A 1VCMA 3GLHE 3ZIUA 5LP6B 5LYJA 4LQCA 2WW8A 5BVHB 5AW0A 1XBTA 3UUEA 1CZLA 3QI7A 3TZBA 1ODLA 5KYVA 1M1ZA 3DE5X 3LSTA 3Q7EA 4D02A 3I0NA 4IUDS 4EFMA 5JZSA 4Y8VA 3MMXA 5IVDA 2C03A 2VNKA 3EQ6A 5F2NA 2JCBA 2VJAA 3H13A 1MQSA 1G1AA 4M0UA 2P9BA 1LUAA 1NRJB 1KE2A 2YC2C 4ON9A 4F71A 3FE2A 2H65A 3V2IA 2HUPA 5DN9A 5CBPA 4ZICA 1CERA 1SUFA 2D8AA 2HO5A 4MGIR 4E1VA 1BYUA 3MXOA 4K40A 3GPLA 1R4MB 3OU6A 4PLWA 2IHNA 1MJGA 4OKIA 4YP5A 2V6MA 3IIJA 1Q7CA 2NT3A 1ADGA 5JG7A 2WI8A 1NBOA 4NX2A 3C4JA 4MEBA 4KUGA 2Y77A 4DLPA 3O7WA 3CRQA 3VTKA 4IUYA 3HCAA 5DTRA 4DMMA 1YZFA 2X2PA 4PYRA 5CD9A 3SCZA 2ILVA 1NN0A 1MC5A 4ND6A 1X7WA 1JFFA 1DEHA 1UBSB 1E2JA 1D0IA 3HLTA 3HI6A 3R5TA 1K6MA 1RRGA 3H5NA 5L7TA 3EH2A 3QX3A 3VV2A 4PR0A 4FFNA 1QM5A 2Y6VA 3GUUA 4TVOA 5LQRA 4CR7A 3CVXA 1J4AA 3ZX5A 4WINA 5LXTB 1XPOA 1TT5B 5FJJA 1OC2A 4N3CA 3NBKA 4Z1MD 3F67A 4EJ2A 2YJZA 4D0GA 5DI3A 3DG9A 1UKVY 1Z63A 3CB2A 2ET6A 3PE6A 3PR3A 3QENA 4CEHA 3EXHB 3COZA 4NH4A 5AVOA 2ERXA 1DEOA 2Y1EA 3FRJA 5AI4A 5H3CA 5BPHA 5KJFA 3J81k 2JJ1A 3KS9A 4B3XA 2X1VA 1XLTC 1OLSB 4GVLA 4S1VA 4XGNA 1M0EA 1HV8A 2G28A 1X19A 5LZ4A 3U62A 2ERCA 1XALA 4A2PA 4OSOA 4F3TA 1R0YA 4MRNA 4URYR 2OCGA 3BUSA 4RESA 4FYWA 4F5WA 3HJUA 1G3MA 4I14A 1KO7A 4TT3D 3U0VA 4DJAA 4QJIA 2NXJA 2JEOA 4BFUA 1INLA 4K7JA 4MKIA 4WCFA 5KX5B 2C7PA 3S2UA 4J76A 3O82A 2JLYA 1JHDA 3CRRA 3R6LA 5CNMA 2FEKA 5BV2P 3ROEA 5ITVA 3PGLA 1M6VB 1Z5OA 1TEHA 5GINE 4RQAA 2HDOA 4RVNA 5LMZA 3M5DA 3LQKA 1P0PA 2VYNA 1RKVA 3EIXA 3INYA 5FEMA 1U5BA 4R1NA 3FB4A 3ETLA 3FIJA 4Q1BA 5A3SA 2HWWA 3JQQA 3ICWA 1E1KA 4FMBB 4XH9B 1XJ0A 1S7CA 3RKRA 4EHLA 2A9RA 3EXG1 1EXVA 4ZEOA 1NN5A 3H11A 4HK4A 2QPOA 1U1CA 1E63A 1RMQA 3CCCA 3DMTA 3ZVNA 5CB8A 4B3TB 5A6VA 1DKNA 3EVCA 1XPJA 1PYGA 1GCGA 1SK9A 3ER8A 2FZWA 1ZJJA 4LCJA 4FYVA 4PNEA 3AX6A 4TZ6A 5DTIA 4J0IA 1V16A 4WACA 1IZ8A 1X3LA 3P5BA 2E82A 4CQNA 1JA0A 1P2BA 1ENZA 2DTDA 2EZTA 4MQUA 5JTTA 1FU7A 5FBWB 1YCGA 5TEVA 4EPYA 4PYIA 3CUSA 3D8TA 3WRYA 1YRHA 3H3JA 4RZHA 1Z17A 3QLJA 5K8UA 3RS0A 3W5BA 1ZJ4A 1P18A 2AEFA 3HU2A 4PE5B 1CDDA 3WGZA 1MHPA 4CM5A 4MLPA 4HFRA 4AURA 4HB2A 1IY8A 4UXJA 4R83A 1UINA 5FBKA 1RRVA 4E2FA 1YS4A 2SHKA 1BU8A 4UHKA 4CKCB 3TPCA 2D0IA 3OIVA 4MVCA 1VLZA 3SEFA 4PO3X 2GZSA 2KS6A 5COQA 1XNHA 3LCUA 5IJ0A 1A1VA 5HDBB 1VSTA 1G8HA 2D00A 3RS3A 3W9SA 1RZRA 1RLOA 5D00A 1CS0B 1LBSA 4LHVA 3K73O 1QANA 4Q3EA 4LMAA 3NIFB 1R9NA 3VZCA 4A8PA 3NHAA 3NU1A 3IIEA 3P27A 1KQ3A 5EIOA 1SKUA 4LJSA 1Y4AE 2QTZA 4R9UC 4J4HA 1SZDA 5H0IA 1NNEA 3A8TA 1MU0A 3SZLA 1KPIA 3ROGA 4OYLA 3S3TA 4OYYA 1XKQA 3QWHA 4DLZA 5AJYA 3STTA 5D5QA 2K7FA 3Q6IA 5LXTF 1OI3A 2Q5QA 3R24A 1AB5A 1PJ8A 2AK2A 3DAFA 4TYQA 5EKTA 1YO6A 4IZHA 3KOZA 5H81A 3S8MA 5IT5A 4NESA 1IM5A 4YN3A 4TL8A 4RKYA 1NJ5A 3HA2A 1CF9A 4KYIB 1C80A 3EGOA 5CEFA 4L4ZA 2NO9A 4EYSA 1DC6A 1JE1A 5D87A 2WU4A 1RI2A 1RWBA 4F1WA 4G8BA 3TRHA 3WGUA 1YJ5A 2YW9A 5FFNA 4G2NA 4FKMA 1KEPA 3OHMA 3VR4H 4H3VA 4JBXA 3VZSA 5ABPA 2EBUA 1U2DC 1FFXA 1M7HA 4MW1A 1MFPA 2FEWB 3B51X 4JN6B 1HYGA 4X71A 1Q1QA 2W43A 3KUXA 3SN6A 4LKOA 4NE7A 4NJEB 5FPKA 4GZ5A 1J20A 1GQOA 2I67A 3CF4G 2ABWA 1SULA 2CLKB 5CLIA 4D57A 1ILWA 2V9ZA 3IJPA 3MPOA 1QTQA 3R7BA 2O8EB 5A4DA 2ZJOA 1TZBA 3CVUA 1PG0A 1LCIA 4RA6B 3U60B 4IOMA 4EHDA 3WGMA 1QGED 4LC9A 1GN8A 3V3TA 4DJDC 3S8YA 3RPEA 3T6KA 2WTEA 3FZNA 3ROXA 1S8FA 2Y1XA 3DBRA 1XZQA 4HWSA 3K70D 3BMQA 4HNAA 4ZGBA 4F7WA 4YT2A 1BQEA 2JVIA 1ACMA 2RJNA 4BKRA 1K7YA 3Q8WA 1ZK3A 2Y8EA 3O4IA 1ODJA 3I05A 5IHXA 4TLCA 3I2FA 4YWJA 4L9AA 2NSHA 2WM2A 5K8VA 1C1DA 1JTEA 1YTUA 3EDYA 1M1XB 3OJOA 2VQ6A 3ABIA 4FT2A 5KKNB 3FROA 1KKUA 4REMA 2IXAA 4O25A 2JIPA 3ET5A 3R0IA 4UAUA 1KYTA 3VNQA 1PWXA 3I9NA 3MAJA 2RC6A 1B3RA 2Y1DA 2YUIA 4Q16A 1P4HA 2HADA 4CMCA 1LBEA 1Q7BA 2H4WA 4YPVA 2A33A 4CMAA 4MP8A 3H5AA 3OOJA 2FQQA 4I9HA 3SWWA 1UJ4A 1V5GA 2QTLA 2P4UA 2FRDA 5LWHA 3MERA 3L02A 1C7FA 1MO6A 4BMCA 4EW3A 3OT1A 5CGZA 2BKEA 2NU6B 3S1LA 2P2NA 2QDXA 1PHRA 1RQRA 2V6FA 3DOEA 4GX2A 4XEUA 3UIEA 5LJLA 2WOOA 1K5PA 3ZE8A 3ITKA 1A77A 3FAZA 1Q0ZA 4JT9A 4U7GA 1JAXA 1FDUA 2IPOA 2QJFA 3PDIB 4TTTS 4XGQA 3UWSA 1CUDA 2GNAA 3F2IA 4B17A 5B6IA 1JBQA 3BGDA 1DEXA 3V32A 1XX6A 2VBCA 4RJIA 2VHCA 1SIBE 1F2TB 4FUTA 2CF6A 5I7FA 1SXQA 1LJUA 1M2WA 1C3XA 3NPAA 5AKXA 1FS4A 2G5TA 4BFYA 4ZKDA 5KNDD 3A9UA 5B53A 4D4MA 3REGA 3RLFA 2OO5A 4S05A 3CE9A 4Q9NA 3MELA 4NJMA 5AK3A 3ICQB 3TMYA 1E4OA 3OTHA 4OJNA 4E6PA 4ESEA 2JLBA 1QLJA 4QJ5A 4HEJA 1AUXA 3ASYA 5JC8A 5JXGA 4RGBA 1YR6A 5L4LA 3A2KA 1G8MA 4IKOA 3RYHA 2E55A 4KFTA 2QYOA 1TCVA 3H8WA 3E9CA 3DUFA 2C84A 2B30A 1H2EA 2I7XA 4DN6A 1ONBA 3K2EA 5TGTA 4G56A 1OH6A 2I6SA 5KS2A 1UFKA 1Y9ZA 2WTMA 4ZEXA 3SKVA 4YXWD 2PSHA 1Z36A 3H42B 4PZPA 1PQWA 2Q29A 2NYRA 3W9BA 3M4ZA 3QXSA 1XJCA 4KQ9A 1DOZA 2AI2A 4P3XA 3RC9A 2CZCA 2YINC 2QBYA 3FMVA 4IHJB 1CRPA 4IDEA 2SCUB 3CUTA 4D2IA 5I45A 3NEYA 4G0PA 4LJ7A 2J59A 1SOWA 3SIRA 4MW4A 4QULA 2QIPA 3HADA 4CL2A 1GAQA 4IEFB 3H9GA 4NV0A 4NYMQ 3S4YA 4JP8A 5BNZA 2XTNA 4N8DA 1KAOA 4XARA 4X91A 2XD4A 2XIJA 3ETEA 1I3CA 2VOJA 1M10A 4LZLA 1OVMA 2A9QA 3MCVA 2JGAA 1G19A 3L6UA 1OJ7A 3IQEA 4G4SO 2DTXA 3KTAB 4Q1DA 4XLTA 3TI7A 5AVUA 2RAPA 1ONSA 2Q46A 2E5WA 4OGFA 3RSCA 1D1PA 4BXOB 1NKVA 3MJVA 4M0FA 4RNDB 1JDZA 5JVDA 2CNBA 5D2CA 1PIWA 2VUIB 2ZWAA 3MMSA 4N3NA 3W8DA 3WNCA 1RE0A 3SGLA 2R8OA 1PQ4A 4BIMA 4XVHA 4HB4A 4J1TA 4WQMA 3DEKA 3Q3JB 3IS3A 3ZCPA 3KR9A 2H1LA 3AFHA 5FPTA 1TO6A 4XXHA 3T06B 4CKWA 4M54A 4UVDA 3JAWB 2BEJA 1VIDA 3CZRA 1G21B 3PRHA 3RE1A 4YRIA 5C80A 1DCFA 1BX3A 3CH7A 2JLXA 2QE6A 2DWUA 3QWFA 4OHOA 1K86A 1ISFA 3PKZA 2LW7A 1LSSA 1N8KA 4JI3B 3WRWA 4IUBS 4MIEA 4AN4A 2EFHB 2OZVA 2PLAA 3U3RA 4C1BA 2HMYB 5IZ4A 3CN9A 3MWDB 4FDUA 4QGGA 4ENVA 3VNRA 2PNJA 2L42A 4HL6A 2JB9A 4MUGA 4FONA 1H1LA 3C7TA 5JCOC 3EW7A 4N0QA 1NBMA 1R0BA 1WDLA 4R01A 4CQJA 5ALMA 1XZFA 1R88A 2WPDD 2YIDA 1IQ0A 1B8PA 4C76A 1PUJA 2C9DA 3H5LA 3O84A 3QU5A 3QVXA 3R5KA 3BIOA 4M36A 4Q37A 3ENNA 4RCVA 5C5IA 1N6PA 4X8MA 3TL2A 3DOHA 7MDHA 1NUAA 5G0VA 2BEKA 4ZT6A 4QG3A 1K8YB 2FX3A 5BMVA 1DTEA 2DKNA 5ARDA 3O8CA 1HQYE 4UMEA 5JALA 2WK1A 3U0BA 1A4RA 4G89A 3H04A 4G5FA 1CG6A 3IA7A 3ORSA 4CODB 3TLKA 2WLSA 3TVDA 1IWPB 3ONWA 4BL5A 4XGRA 2OAGA 3MRVA 1NW7A 3AILA 3FCXA 4IDHA 3VU0A 2CLMB 3F6CA 3K96A 1H0SA 4JL6A 3WGNA 4F4UA 3CEJA 3SQNA 3AUXA 3VYRB 1JEQB 3AFIA 1GO2A 4O1HA 2OXRA 3JYLA 3VPAA 1OXUA 4I6GA 3FVRA 2OBBA 3FMOB 4HAUA 2H0RA 4LWZA 4CL0A 4YRSA 1EM8A 4L57A 2BMVA 2QN8A 5JQGA 3GLGE 3G5AA 3IDFA 1P17A 1Y5RA 2WWRA 1XHLA 4FNAA 4XM1A 2VYVA 4XR9A 3T5BA 2AOUA 3VVLA 3QEKA 2QX8A 1OMOA 4B2YA 1JR6A 2QRLA 3R3JA 5BSUA 5C9ZA 4ZO6A 3DR5A 4F6RA 2REBA 2JZOA 4TL9A 1SELA 5EJ7A 4ZANA 1H9CA 5EMMA 4HZGA 1QP4A 1AS3A 1XQYA 5FIUA 1IBMB 1PJSA 4RANA 4BDTA 3E5RA 1LZLA 3K9WA 1TEXA 1GPLA 4DIOA 2HFJA 5EJ2A 1XQVA 2EBHX 2X8AA 1R00A 3EY4A 2ZTHA 4GM1A 5D5HA 5I4BA 2REXB 2BFBA 2PSEA 3CT4A 1NWHA 5ALDA 3B3GA 3IO5A 5FYDA 1A71A 3AY6A 3GY0A 5TQVA 4ID3A 2CFIA 2GCOA 1E2GA 1F38A 2AD1A 1NVDA 5CEEA 4X84A 4NSNA 2C0PA 4EEKA 1LI5A 1PEKE 4AI6A 1SCAA 4YMWA 3CIFA 2RKWA 3VKHA 4IV8A 3GLHA 1FQWA 3R6GA 4B6FA 3L7KA 4JUIA 1Y48E 2P78A 1GTJ1 4B3IA 2Q4OA 1WMAA 4D4IA 5HOQA 3AB3A 3G1UA 2GVDC 2NXWA 2ZUEA 1RHJA 4IG4A 4Q3DA 2XGJA 4DE5A 3INRA 1GXSB 1JU9A 2BLNA 3JD2A 4XLZA 5FUQA 4U6SA 4EB8A 3HJRA 4C7BA 5DBOA 1IVNA 5AKKA 3NNSA 1GPDG 1O97C 2UZ1B 4UNPA 1XEXA 4YJ2A 1E89A 1HMPA 3LU1A 4TSFA 2G40A 3B7GA 1PSDA 3OAAD 4KO3S 3C8ZA 2J9GA 5B4TA 3R74A 4CEIB 3M6MD 2PZKA 4XSVA 4V1CA 4DC9A 3GNQA 1YQXA 1E1RD 2VSQA 4NPAA 1PDWA 3OBIA 3OLVA 4QA9A 4TSRA 4ASUD 1RD4A 1A98A 3RSFA 5AW5A 3IPXA 3HR7A 1YFZA 5FPQA 2XQKA 3TZKA 2EGGA 1NU6A 3OKAA 1VZ3A 2AOTB 3DE1X 3PFBA 3U7GA 2V3VA 3B1ZA 2J0UB 4HB0A 4M0KA 4BBJA 4CDMA 1NVXQ 1VYTA 1A04A 2D59A 2XWQA 4A0HA 4BV2A 4IO0A 3TG8A 3QF7A 1E9CA 1L1FA 2ZCJA 5IBRA 3PQ5A 2VUTA 4BO0A 3L7DA 3BXOA 4N49A 4JYCA 3UYKA 1U80A 4BASA 1TUBB 3KE8A 4PHFA 4V24A 2H16A 2PS3A 4NBVA 5EIFA 2ZYRA 4ARUA 4Q3KA 1H2YA 1NQAO 3AUAA 4GGOA 4QOGA 1U9IC 2WD7B 5ERYA 2X0NA 2FJ0A 4EKDA 2WF7A 3OKFA 1PV4A 1XQXA 1P80A 3AIOA 5FWYB 5KAMA 5FBZA 4IX9A 2C8VA 2CVOA 5DM60 4E03A 3BE8A 4JYZA 1ISRA 5J9FA 1OOEA 2WWYA 2HWKA 4N3AA 4ARCA 5HVNA 3KVYA 4NBRA 2VHVA 4DANA 3ETNA 3MCZA 3IHTA 4B3SB 1ZINA 2D54A 1S01A 1EZ4A 1XQ1A 5KREA 2YOFA 2Q49A 2I87A 4LDJA 1BXRB 3ZPXA 4OAOA 2QTFA 3DF7A 3QIAA 1N8SA 3AHEA 4UCWA 5DCWA 2ISCA 3LFUA 4QTZA 1NYLA 2Q2OA 3ZWVA 2YYAA 5EWLA 4BLPA 4XTCS 3M2PA 4MVJH 4D0RA 1KSFX 4A2CA 1GZ4A 3NUZA 3TWOA 2FZVA 1JG6A 4ZCSA 3FOCA 3D8BA 4RIFA 4LFAB 2PO7A 4ZTBA 3H4VA 4L9SA 2AZDA 3DL4A 3IP8A 3UW3A 2IWHA 5JY1A 1UP4A 4G9GA 1GPMA 2G82A 3BOSA 4ZEWA 4HNQA 1Z5GA 1ZK4A 2F3RA 2YY7A 4V1CI 1N2JA 2E6UX 1TU3A 4M1MA 3R9KA 3KV3O 2Z6VA 3GG2A 1E96A 3OHSX 5LZ2A 1PFYA 3DUWA 4HAOA 2UUAB 4HQOA 1L5OA 3L04A 3GIWA 1FNBA 1ZI6A 3AHCA 2Y9PB 4UHCA 1LW6E 1ZI9A 1KY5A 4LGYA 4TPKA 3H2ZA 5IJXA 2CHFA 2J3DA 5K09A 3OE7A 1FTGA 3KDSE 1UM9B 3L7JA 4MUMA 3LUGA 1SCKA 3D1JA 3WKDA 1MD9A 2B83A 2RJ3A 3NCTA 4CMKA 3PP8A 4RY2A 1ORRA 1CEQA 3H2IA 3TQTA 1GU1A 4HDKA 2VDOB 3OF2A 1U7DA 4IH9A 3ZE1B 1EQUA 2MSLA 4HXEB 2ZLBA 1C30A 1U8YA 1V2GA 4B75A 1WDTA 1A0OA 4YFVA 5HIMA 1A9SA 1M6YA 1JYFA 3AU8A 3GGCA 1Y37A 2C29D 5I01A 3GBSA 5TXGA 3LYAA 6ADHA 1GGMA 3BSYA 3J81A 4TLEA 1TECE 2IDZA 5JCJA 2FPMA 3TINA 3E1KA 4O2BF 3H97A 4G09A 1YE3A 2Q8PA 4RQTA 2XZOA 1TD1A 3O8LA 5CT5A 1VLLA 3ZU2A 1UF9A 2K4MA 3ABQB 1L3IA 1U7PA 5IVPA 5EHZA 1TVKA 1CUZA 3W2HA 3D7NA 1PL6A 4I5DA 2WIBA 4DL9A 4MB2A 5ED0A 1QV6A 5K4HA 4K0RA 1H0HA 2TMGA 1OFUX 2AXEA 2O4UX 1RAIA 2HRRA 2R6FA 4B4VA 1WR8A 4KGDA 4QO8A 5K3AA 2I2CA 3IUJA 4O4JA 3LHSA 3R7WA 4YT8A 3S8EA 2P5TB 4BV8A 1NXXA 3R3UA 5F73A 1PEAA 4D26A 1R6UA 4J90A 4XWKA 2CSXA 4HXYA 3RJ5A 1QGUB 2CC2A 2IEGA 3CV3A 4OH1A 3RJ9A 2C2ZA 3M9LA 4HAXA 1Q7EA 1F1JA 1RPJA 1X2BA 2FA9A 5JI3E 2G77B 4BKQA 3WL7A 4BMNA 1B43A 3ZWNA 4XX1A 1UPAA 2BH2A 1MEJA 1ZVVA 3BB3A 1SN7A 3NANA 1YJBA 2DPLA 5JXWA 2MINB 2RI0A 4PQFA 2IS6A 3JVDA 1SB8A 1F7UA 3KPUA 5FAKA 4F38A 3EUAA 3SZRA 4F0JA 4B2LA 3PEWA 4RS4A 2EJCA 2PS1A 1NIJA 2Q3DA 4YH1A 2P4HX 3OCWA 2HJRA 3VAYA 1CULC 3DULA 3ZD9A 2B2NA 1CY2A 4YMLA 1H1TA 1US8B 1ZISA 4XQ0A 3AF1A 1SVOA 1Z4PX 2E4AA 4O4IB 4ZCLA 4B6RA 1D07A 4BC1A 4OXQA 2BRUA 1K6IA 2ZAYA 3DV0B 1DPGA 3HB9A 3PXCX 3RFTA 3THSA 1LK0A 2CMGA 4AFNA 2EATA 1KERA 4KLZA 4ND2A 2JASA 3V1LA 4G1FA 4OM7A 1V37A 1Y81A 2G5GX 4L0QA 2K6GA 4CM4A 3R8FA 1S3SA 2B5OA 3ZDCA 5DM0A 5U4QA 1AXEA 3W5CA 1VJ5A 5KHOC 1DEKA 2IDMA 3AOEC 5A3JA 2R6GA 2REQA 2EWWA 1YRBA 3W4JA 5EPUA 2HTFA 3TR0A 5A7GA 1AKYA 1YZNA 2ORED 1FYWA 1GYPA 2P2GA 3HCNA 4L22A 2QK4A 2RG1A 3ILSA 3I01M 4IP0A 4CW7A 3Q7IA 2IVFA 5HMLA 2D5IA 3AO0B 1E3MA 1WY7A 2CJYA 2D13A 3IIMA 4FOOA 1JQBA 3C8MA 2Q21A 4TWJA 4HDSA 4BAUA 1V7QA 3WGLA 1ZOSA 3KZXA 3SQXA 1DHTA 3VOSA 3V4RA 3IBYA 4GBGA 5FJIA 2O8FB 1ZAKA 2O0HA 4DMFA 2ZIWB 2C5LA 4PXAA 3AQIA 1Q44A 1H6CA 5CYGA 2CFTA 1CR1A 3AT1A 2VNSA 2BCGY 4MKXA 2J7PA 5IKMA 4X93A 3NT2A 4TWRA 3EA0A 3AVOA 1U98A 3JARB 5IT9A 2IU4A 2XOKA 4Y6PA 4P82A 1GU7A 1I24A 3CX3A 2BSQA 4DM7A 4LDRA 4GXNA 2JANA 3IODA 3IUPA 1JQEA 1ZN8A 2EKLA 2QLBA 1A5ZA 3C3BA 4DHEA 4XVCA 2ZRNA 2XMDA 2JGDA 5K3CA 5DSXA 2OV2A 2CYCA 2M9MA 3EIFA 1J7JA 2VHUA 1P3JA 2PBRA 3A36A 2DYKA 3DH0A 2GJ4A 4QTXA 4MEAA 4NYJR 5I8PA 3WWCA 1I51A 2GZRA 4EA8A 2P4SA 5D1NA 1PV1A 5TRTA 1HE2A 1LS6A 3DOOA 1QH0A 1X1QA 1Y3FE 5D7BA 1CU1A 1AGXA 4ZYYA 5CEJA 2O5RA 3U80A 2QVZX 3SXUA 1R7RA 4OF4A 4CCWA 1NR1A 4GKKB 5DMXA 2KM1A 3LYHA 4D8VA 1YDGA 2DC1A 3QHPA 4PAOA 5IYZB 1DUIA 4DQDA 3EVEA 2PA0A 5CT6A 4PSUA 5BV0A 3LF2A 1B7GO 3D59A 5LM3A 1XKXA 1MOSA 1DKQA 2I7TA 3L7BA 4Z0PA 1LV7A 1ZA1A 3IDQA 4G8DA 5LA6B 3RHFA 3WLMA 5BW5A 2AMLA 5CBKA 4FSXA 1X0VA 5ALXA 3WRXA 2Q2WA 4E7PA 2CL7X 4BIIA 2MMGA 4L16A 1GG8A 4NPCA 1EXMA 3QE4A 3HJNA 3VVCA 3OJLA 5C8XA 1JR4A 1XZEA 2XT6A 4QICA 2IPAB 5DRTA 5B12A 2I6QA 4E88A 3VV3A 4Z4EA 3W7BA 2QAGB 4QYSA 4ABYA 3NB0A 3MWEA 3EWNA 3H4TA 4ZVMA 4OP1A 2H48A 1ZS9A 2CY0A 1Y7HA 2X2OA 3L06A 3K92A 2Q9CA 3D3EA 2YS7A 1WQ1R 1S2NA 2HL6A 4G2TA 4KIGA 1MV8A 1GRCA 4PG5A 3AY3A 4MYUA 4YCJA 3DLAA 4AJOA 4BFZA 1RXCA 5FNVB 2CDAA 2C5BA 3R6WA 5IEJA 2GYUA 2C4VA 2G36A 1AOXA 5DHFA 1QFXA 4GDMA 3E58A 4NV3A 3COJA 4OMCA 1ZEMA 1YZVA 2OV3A 3T7DA 1GZVA 1FEZA 1NURA 1NYRA 2R68A 1XMSA 4LISA 4LY0A 4U7WA 1T8TA 3TJMA 2YYYA 3UM9A 4BJ1A 4L08A 3PDWA 4MNTA 4YEDA 5AWFC 3VH4A 3ZU6A 3I1FA 3EVDA 4JBNA 1MX9A 3ZZ1A 5JDCA 3AUTA 4DBZA 3STXA 3ZZ0A 3OWHA 4DT1B 4O4HF 2AG8A 3VH3A 1CZKA 2DHQA 4XCQA 3LY9A 4UHEA 1Z39A 2R9VA 3WP1B 2VJDA 3ZTWA 5CVDA 3J7TA 1T4MA 3DZFA 3HKDA 4JH0A 4P0TA 1G5QA 5AJZA 4EAQA 4ZI2A 5A4IS 5LD2B 5ADUS 1EE9A 2WWXA 3LPAA 3QLTA 4ILKA 2Z5VA 2ANBA 3DWEX 3TLMA 5JZVA 2W6NA