2Q4FA

Ensemble refinement of the crystal structure of putative histidine-containing phosphotransfer protein from rice, ak104879
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
143
structure length
140
Chain Sequence
SAAAALRDQLTALLSSMFSQGLVDEQFQQLQMLQDTPGFVSEVVTLFCDDADRIINEIATLLEQPVVNFDKVDAYVHQLKGSSASVGAQKVKFTCMQFRQFCQDKSRDGCLMALAVVRNDFYDLRNKFQTMLQLEQQIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine-containing phosphotransfer protein 1
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Oryza sativa
molecule tags Signaling protein
total genus 61
structure length 140
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2q4fA00
1A0BA 4G78A 1WN0A 1OXKA 2LP4A 1C03A 1Y6DA 2OOCA 3U3BA 3US6A 1I5NA 4EUKB 2Q4FA 2A0BA 1FR0A 1YVIA 1C02A 2R25A 4PACA 3KYIA 1SR2A 2LCHA 1QSPA 3KYJA 1OXBA 3MYFA 1BDJB 3IQTA 1TQGA 2LD6A
chains in the Genus database with same CATH superfamily
5D91A 1Q0MA 3NG1A 3K66A 5F5HA 3S90A 2HV6A 3DM9B 4BJ6A 4G7OF 3N24A 1CGNA 3DZAA 4BJ6C 3EGDB 3M4BA 1VLTA 4PJMA 1RXQA 1XWJA 1KU2A 3U8PA 2LFFA 4NY3A 1F1MA 5DLJA 4MNDA 1OR2A 1PD1A 2YRFA 2GWWA 1C02A 4K7BA 4OD4A 5T3WA 2YLDA 4AL1A 4RD9A 3CSKA 3U2LA 1WGWA 5DQTA 3OEOA 2A1DD 4K0DA 5IY5C 1MQVA 3SXMA 4N06A 5K0IA 1WTYA 2HJMA 2ZXWC 3JYHA 3KYJA 2R05A 1EQ1A 3I5QA 2TMVP 3GWNA 2EPKX 3AG2C 4U9EA 1DOWA 4P9TA 3V5XA 3JRTA 1GQAA 4EIYA 4ONSA 4MVOA 5AGFA 1BR4A 5FCLA 1T6UA 4C3DA 2NUPB 4FAPB 2GAQA 2X51A 2MYSA 1I4ZA 2W4BA 3O6XA 3EHNA 4AL0A 2ZXRA 2P61A 4C7OB 1KNYA 1TR2A 4CSAA 3T9OA 1CPRA 4MQ9F 3LEOA 2V26A 4CS9A 4DVZA 4CSAC 5BQGA 4CS9C 1LPEA 5L0GA 3U9MA 3B71A 3NDBB 3WODF 1YVIA 4EKWA 4Z9IA 1I4YA 4BJTA 1NFOA 3T4RA 2DYSC 3L34A 3JSZA 2YKZA 4YWQA 3H2UA 3ITFA 3W2VA 4XEKA 1K04A 3OA1A 4QDLA 3MBGA 1RKCA 2XLOA 4WGYA 5E3CA 4BG0A 3O55A 3J06A 4XEVA 1AEPA 4U5CE 1TQGA 4EBKA 3POVA 4HEAJ 1V74B 2HS5A 3ECSA 1NU7D 4B6IA 1JPJA 4W8PA 3JCUQ 4BPMA 4CDAA 2BL2A 2YVKA 4O6NA 1K05A 2BC5A 2IXPA 2QTVA 1C03A 1R5ID 3W2WA 3MLGA 1OCOC 3B0PA 4JZAA 4MW8A 3RVYA 4EUKB 5GPGB 2R7XA 2YL1A 3R7CA 2R02A 3TJ6A 2XM4A 5DS5A 2DYRC 4GEHA 5L3VA 3EHMA 3GEIA 2DGJA 3EGXA 2H7VC 4I44A 2H7OA 4W8KA 4CBEA 3ZTMA 1OW7A 5B3SC 1FR0A 4EBBA 3ZVRA 1AUEA 3BRJA 4G7ZF 1RJ9B 1YA9A 3EPVA 1FMVA 2H8AA 4LDKA 5HV9A 2OG2A 3TK0A 2OCCC 1G4US 1H7IA 2VCCA 4ANJA 3DWWA 3HJCA 4OIOF 1M2VB 3PDMP 4JTCB 1BDJB 2J9BA 4U5EE 2ZD9A 4YK5A 1E86A 1ZVZA 4I3MA 4PK4A 3AG3C 5BUOA 5KYXB 2I8BA 4G78A 4D4XA 2Y3HA 4DRHB 2A69F 3DM5A 3QW1A 3FDQA 2VCAA 3L8IA 1NG1A 1OCZC 2M64A 1A7EA 2VH3A 3K7DA 1FNTc 1GGQA 3Q6NA 4MTFA 2Q4FA 1M56C 2L6HA 1BR2A 2YHSA 2QE9A 3GM2A 3HNLA 3PMRA 4O6YA 2QY9A 2HKVA 1E84A 3JT1A 4PACA 3QVZA 4A2NB 3IQCA 2Z15A 2L9JA 1ZU4A 1M57C 4E18A 2XLEA 3KMIA 2L81A 2XLMA 4YT4A 4IAQA 2EPLX 1YJGA 1EI7A 1QLEC 3ZDLA 2A0UA 4XLNF 1OW6A 3H65A 2LK4A 2YLIA 1IZMA 3T6BA 4H4KC 4MVMA 3EGDA 2ICWG 3RFYA 4YT8A 1T5OA 2M4EA 1IW7F 3RH3A 2J0XA 2OOCA 3AGUA 1HMDA 1L7CA 1QKRA 3FOPA 3M4CA 1Z63A 1TFKB 2P7VA 4I1MA 3FHDA 3EJNA 4GQHA 3C8GB 4JJFA 1U6HA 4Q5SF 2WL8A 3QVYA 4XPYA 3RQGA 4IGGA 3SXYA 5KYWB 4GYTA 4MS2A 3V7OA 4AE4B 3B9QA 2R7UA 1H6GA 2W9YA 3C18A 4XPXA 4J32B 2XL6A 3M15A 3ZSUA 1JPNA 4EBJA 3VYWA 2AVKA 4NCQA 3K33A 2OU6A 2CCYA 1VTMP 4DBQA 4Q4ZF 3A9CA 3C63A 1ORJA 2WZLA 1VLSA 2BE5F 2EIMC 2RSEB 3JRMO 4O7GA 2NUPA 3AJMA 4LERA 1G8XA 2IXNA 2DI3A 2QLAA 2YEVA 5JP7A 1E83A 4XEFA 1NBBA 5L0DA 4C7OA 3UMKA 1NFNA 1U89A 3NMIA 3VAYA 2NUTB 1HW1A 2G3VA 2JX0A 4PFOA 1I5NA 3UNGC 3FMSA 4BEJA 2MWQA 2ZXPA 3ABLC 5AC5A 1RMVA 5KYNA 2I15A 1YZCA 4XWJA 3UGPA 3NKDA 2F22A 2ETSA 5COMA 1Y4CA 1HE9A 4JRZA 1SR2A 4Z9HA 2J7PD 2LSEA 3B0UX 1D1BA 1JAFA 5A6BA 3NYMA 3GWLA 3NYJA 1J8YF 2PX3A 1APCA 4PFPA 1Q0GA 2WZGA 2YLGA 4PR9A 4AK9A 4NC3A 4QI2A 3DXJF 2XLDA 4FX5A 5E3AA 3QW0A 1LM3B 1OKKA 1TWAA 4HFFB 3TJ5A 1JRAA 2LFDA 2XS8A 2YQYA 4Q7CA 4U5DE 3UGOA 1OXKA 3EQLF 3K1IA 3U0CA 2HSQA 256BA 4HE8D 2IBFA 3K1IC 5CI8A 3X2QC 2CNWA 4UDVA 5EHHA 3HLZA 4CS7A 3LS1A 3LUTB 1V54C 4N4WA 2HV7A 2IM8A 3ABKC 2Y69C 3ZTZA 3W4YA 1HY5A 3GEEA 3N2ZB 4OIRF 1PV3A 1RJ9A 2Q3TA 2R25A 5BQHA 4IAOA 3ATPA 1Q0FA 3GANA 2PNOA 3FAJA 2NSFA 1NSGB 4MVSA 4BJ5A 4CS8A 1ZYRF 1QSPA 2XLVA 4NTFA 1LIHA 4BJ5C 1TFOB 1D1AA 3DI5A 4CDYA 2Y3DA 1HE1A 1YYXA 1BZ4A 4OD5A 2XXAA 2FFHA 4JURI 1Z3IX 2R9RB 1QVXA 5JLIA 4JEBA 5KYXA 3DE9A 3IQTA 4E7SA 2CGEA 2EINC 4MVQA 1QZXA 1VYIA 3F47A 1J8MF 4YN0B 1KTMA 2HMZA 3O10A 4N6HA 3EH1A 1FMWA 4ER9A 2YL3A 3AQBA 3WHNA 3K6BA 4JKVA 4XQ1A 5BQIA 1Z5ZA 2XLHA 3KKBA 3SZRA 3UMIA 2KC3A 1FFHA 1YLMA 4A4AA 3GM3A 4M63A 4XLPF 2L6FA 2UUHA 2CDQA 4EWCA 2QNLA 2KGOA 1GM5A 5L0IA 4CJGA 1WASA 1ORSC 2C04A 4FWVA 1MMDA 2C03A 2O9XA 3C7JA 3VF0A 3NKEA 2XLWA 2D4UA 1ZU5A 1YYJA 3EFOB 1MMGA 2V3CC 5DS4A 1B68A 5B1BC 1G5ZA 3G4ZA 1ZHYA 2VB6A 3RF3A 1ZHXA 4N6CA 1FTSA 2R7OA 2YL0A 1BBHA 1SMYF 2W45A 2Y3GA 2AWCA 1JOGA 5DVWA 3LESA 3PHF2 3L1MA 4OIPF 2CYDA 3E70C 2OKUA 2L6GA 4E0IA 4YT5A 3IQ5A 3C8GA 3RW0A 4Z9JA 4XPWA 4DOZA 5L3QA 5KYWA 2ZPAA 4MVZA 3DAFA 3HNKA 4CDVA 4HFKB 3T6JA 4CIHA 3R2PA 4DJ9A 1AVOB 3NRHA 5DQZA 2A68F 2OJQA 5T1DB 1ST6A 3PCVA 1D1CA 2PBEA 4CJOA 4IARA 4E17A 1E85A 3QZCA 5EK0A 5A6BD 3SP1A 1OCCC 4JVSA 1S05A 4BEMJ 1MNEA 1A7DA 4P9FA 1NLXA 2Q9CA 3ASOC 2EIJC 3LLKA 2KYHA 3ZWIA 1OKKD 2L7AA 1WN0A 2NUTA 3LAYA 4C3EA 4YL0A 1TWCA 1YZAA 3QTHA 1O87A 2CW0F 3S27A 4ULVA 1E2XA 1S7ZA 2CNWD 2J9WA 1H9GA 3RVZA 3WG7C 5A6AA 4PJNA 1Z23A 2IYLD 2R03A 3S29A 3EGXB 4JTDB 3W8IA 1LI7A 2H7BA 2R7VA 1PCXA 3HKKA 1C17M 2Y3BA 1TKNA 1OCRC 1RKEB 2LCHA 3NMKA 4LDQA 2X0CA 3U9JA 3C8ZA 2PF4E 3O39A 3TD7A 1U0BB 2Q00A 3MYFA 4EHPA 1G4WR 4J7YA 1VYKA 2GDCA 1OW8A 2EPNA 4LLEA 1D0XA 4IRUA 2R7SA 1ZHWA 2LP4A 1SF8A 1V4AA 5FZTA 2YZSA 2OQMA 1NZEA 2YWAA 1ORYA 3Q7LA 3SNHA 3OWTA 2KNHA 2PX0A 4O6MA 2WVQA 2OEVA 3M79A 5F28E 3JTLO 3UR3C 3GODA 3S0XA 1CGME 2D5RB 4K1OA 1V55C 1N1CA 1EA8A 3ZG1A 3LNMB 5JVEA 4KNVA 5KYUB 1LS1A 3JYYA 4AX2A 1LE4A 1LKXA 3I4UA 4NQFA 1YAUO 5A69A 1MMNA 5L0FA 1WOLA 2GFHA 2WB7A 3EG9B 4D4NA 2LD6A 4KNWA 2R7WA 1A0BA 1FFTC 1JMWA 2J9UA 3G4XA 3LEVA 2Q7RA 4DBRA 4U5HA 3Q7GA 2VCBA 3LLIA 1VB5A 3U3BA 4P6IC 1MMAA 1Z7Qc 3CAXA 1A7VA 2J9VA 2JPUA 4I1OB 3TOMA 2LIGA 3FOOA 4LDRA 2B0JA 3C8GD 4KBLA 4ZLDA 3VM6A 5KYYB 2R7TA 3I5PA 4IJJA 4U5GA 4MW3A 1MNDA 3IQ6A 1CPQA 1TWHA 3MYIA 5JSLA 4E0HA 4OIQF 3U2MA 4U9DA 1NU9C 1VOMA 3ASNC 4CIPA 1T01A 2J46A 3EFOA 2OEXA 2P0NA 4C3BA 2YL7A 3LJBA 1M6TA 2XS1A 3RQFA 3VRCA 4CS8C 1M2VA 4JTAB 4WGZA 1O5HA 3JZ0A 4L6RA 3CQZA 2AWYA 1LI5A 1HW2A 3B29A 2EIKC 5L0CA 3L0IA 4NTBA 3JSEO 1T9KA 3WAQA 4G7HF 4MVUA 1Y6DA 4JE9A 2EPOA 1M2OA 2P1AA 1QQ3A 4JW1A 5D92A 5JS5A 5A6KA 3BEHA 2KW3C 2Y39A 1YARO 1GS9A 2VASA 3RQEA 3CZ6A 3S84A 2A0BA 2RD9A 1LS4A 1YDIA 2R7QA 3EZHA 2DB4A 2OJED 5JUAA 2HFIA 2B0HA 5B1AC 4NTAA 1T6QA 1WATA 3FXHA 2WVOA 2HZ8A 2QUPA 2XRHA 3AG4C 3DE8A 3IHUA 4IWBA 4F4BA 2MHRA 2XL8A 3ABMC 5JT4A 2G62A 2HUJA 2AU5A 3NMJA 4JCHA 2VC9A 4DXWA 2HJ3A 2Q9BA 3MX3A 4DVYP 3C62A 2NSGA 4MTOA 1R4TA 1Z6AA 3FAPB 3HNIA 4U5FE 5T3TA 5EGYA 1XZQA 2ASRA 4JC7A 2XL4A 1OQCA 2GA0A 3LS0A 5E33A 1Q0KA 2AP3A 3US6A 3HTKC 4ZLCA 1DOVA 4LACB 5COGA 2EPMX 3W8HA 2IXOA 3A11A 3V5ZA 3DJUB 2HMQA 1D0ZA 4PJJA 3EH2A 4YL3A 4CX9A 3TQOA 4YT2A 3TULA 3SXKA 3UMHA 2NG1A 2R7RA 4AE4A 2J7PA 2PFDA 3GM1A 2KQ9A 2LQGA 1RKEA 1YA7O 1QPUA 3KYIA 3M1CB 2EILC 2IOQA 3NYLA 3S28A 4DRJB 1H9TA 5DS6A 3V5YA 5B3IA 2WVNA 3B0VC 1LVKA 4DRIB 1ZHZA 3AQCA 4J30B 2KK1A 4FESA 1OXBA 3DMDA 4YL1A 2KJGA 3AOUA 4RBNA 4E7ZA 5HSWA 2XXAB 3KH2A 1UG7A 3N0TA 4J7TA 3FVYA 1SZIA 4ULWA 3QMKA 3ZC4A 5CIVA 1LE2A 2NPUA 1L3PA 3SYNA 5AC4A 2XM0A 5A6JA 3DKAA 3X1OA 5JRAA 3MFNA 3ZQVA 2J8WA 1BR1A 3AG1C 3RYLA 3RKOF 3HNJA 1Q0DA 1K40A 4KC9A 3DD7A 4MVRA 4JEAA 3IEEA 1TWGA 2XSEA 1HMOA 3Q6MA 3K1HA 2Q9AA 3E9VA 1ZW2A 2UUIA 3H2VA 4RDAA 2PP4A 5E2QA 2KSFA 3KPHA 2P6VA 5KYUA 4KI2A 2J0WA 4JIOA 3GEHA 3L8JA 3GORA 3SEOA 1JR8A 4O79A 4G0HA 1SYQA 3EG9A 4H54A 4R32A 3U8VA 3RIPA 2G3KA 2J45A 1D0YA 1ZHTA 1WWPA 4XTKA 4YJWA 3DAGA 5L0HA 1RCPA 1ZW3A 4WJ0A 1T6IA 4WABA 5COFA 2A6HF 2FGYA 3CEXA 1UFBA 2HSBA 2A6EF 1CGOA 3IPMO 1OR3A 4IB4A 5TJ5E 2IXMA 3G50A 3F46A 1EKYA 3LNRA 1FAPB 4LLCA 2FAPB 3U3FA 3S9OA 5KYYA 1XZPA 3ZIBA 1ZZPA 1VK5A 4JJGA 4MTGA 5L0JA 3DJNB 4BJ1A 3AGTA 2E87A 2ZXOA 5CI9A 4OINF 5F5FA 4QI0A 1A41A 3TOLA 1PD0A 3ZQYA 2W4MA 3EZIA 3KL4A 3SXZA 2JD3A 4JCZA 3U5SA 2WZFA 4U5BE 3T6GB 1W2WA 1O3UA 1VMAA 4X0RA 4PJLA
chains in the Genus database with same CATH topology
1A0BA 4G78A 1WN0A 1OXKA 2LP4A 1C03A 1Y6DA 2OOCA 3U3BA 3US6A 1I5NA 4EUKB 2Q4FA 2A0BA 1FR0A 1YVIA 1C02A 2R25A 4PACA 3KYIA 1SR2A 2LCHA 1QSPA 3KYJA 1OXBA 3MYFA 1BDJB 3IQTA 1TQGA 2LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0B A;  4G78 A;  1WN0 A;  1OXK A;  2LP4 A;  1C03 A;  1Y6D A;  2OOC A;  3U3B A;  3US6 A;  1I5N A;  4EUK B;  2Q4F A;  2A0B A;  1FR0 A;  1YVI A;  1C02 A;  2R25 A;  4PAC A;  3KYI A;  1SR2 A;  2LCH A;  1QSP A;  3KYJ A;  1OXB A;  3MYF A;  1BDJ B;  3IQT A;  1TQG A;  2LD6 A; 
#chains in the Genus database with same CATH topology
 5D91 A;  1Q0M A;  3NG1 A;  3K66 A;  5F5H A;  3S90 A;  2HV6 A;  3DM9 B;  4BJ6 A;  4G7O F;  3N24 A;  1CGN A;  3DZA A;  4BJ6 C;  3EGD B;  3M4B A;  1VLT A;  4PJM A;  1RXQ A;  1XWJ A;  1KU2 A;  3U8P A;  2LFF A;  4NY3 A;  1F1M A;  5DLJ A;  4MND A;  1OR2 A;  1PD1 A;  2YRF A;  2GWW A;  1C02 A;  4K7B A;  4OD4 A;  5T3W A;  2YLD A;  4AL1 A;  4RD9 A;  3CSK A;  3U2L A;  1WGW A;  5DQT A;  3OEO A;  2A1D D;  4K0D A;  5IY5 C;  1MQV A;  3SXM A;  4N06 A;  5K0I A;  1WTY A;  2HJM A;  2ZXW C;  3JYH A;  3KYJ A;  2R05 A;  1EQ1 A;  3I5Q A;  2TMV P;  3GWN A;  2EPK X;  3AG2 C;  4U9E A;  1DOW A;  4P9T A;  3V5X A;  3JRT A;  1GQA A;  4EIY A;  4ONS A;  4MVO A;  5AGF A;  1BR4 A;  5FCL A;  1T6U A;  4C3D A;  2NUP B;  4FAP B;  2GAQ A;  2X51 A;  2MYS A;  1I4Z A;  2W4B A;  3O6X A;  3EHN A;  4AL0 A;  2ZXR A;  2P61 A;  4C7O B;  1KNY A;  1TR2 A;  4CSA A;  3T9O A;  1CPR A;  4MQ9 F;  3LEO A;  2V26 A;  4CS9 A;  4DVZ A;  4CSA C;  5BQG A;  4CS9 C;  1LPE A;  5L0G A;  3U9M A;  3B71 A;  3NDB B;  3WOD F;  1YVI A;  4EKW A;  4Z9I A;  1I4Y A;  4BJT A;  1NFO A;  3T4R A;  2DYS C;  3L34 A;  3JSZ A;  2YKZ A;  4YWQ A;  3H2U A;  3ITF A;  3W2V A;  4XEK A;  1K04 A;  3OA1 A;  4QDL A;  3MBG A;  1RKC A;  2XLO A;  4WGY A;  5E3C A;  4BG0 A;  3O55 A;  3J06 A;  4XEV A;  1AEP A;  4U5C E;  1TQG A;  4EBK A;  3POV A;  4HEA J;  1V74 B;  2HS5 A;  3ECS A;  1NU7 D;  4B6I A;  1JPJ A;  4W8P A;  3JCU Q;  4BPM A;  4CDA A;  2BL2 A;  2YVK A;  4O6N A;  1K05 A;  2BC5 A;  2IXP A;  2QTV A;  1C03 A;  1R5I D;  3W2W A;  3MLG A;  1OCO C;  3B0P A;  4JZA A;  4MW8 A;  3RVY A;  4EUK B;  5GPG B;  2R7X A;  2YL1 A;  3R7C A;  2R02 A;  3TJ6 A;  2XM4 A;  5DS5 A;  2DYR C;  4GEH A;  5L3V A;  3EHM A;  3GEI A;  2DGJ A;  3EGX A;  2H7V C;  4I44 A;  2H7O A;  4W8K A;  4CBE A;  3ZTM A;  1OW7 A;  5B3S C;  1FR0 A;  4EBB A;  3ZVR A;  1AUE A;  3BRJ A;  4G7Z F;  1RJ9 B;  1YA9 A;  3EPV A;  1FMV A;  2H8A A;  4LDK A;  5HV9 A;  2OG2 A;  3TK0 A;  2OCC C;  1G4U S;  1H7I A;  2VCC A;  4ANJ A;  3DWW A;  3HJC A;  4OIO F;  1M2V B;  3PDM P;  4JTC B;  1BDJ B;  2J9B A;  4U5E E;  2ZD9 A;  4YK5 A;  1E86 A;  1ZVZ A;  4I3M A;  4PK4 A;  3AG3 C;  5BUO A;  5KYX B;  2I8B A;  4G78 A;  4D4X A;  2Y3H A;  4DRH B;  2A69 F;  3DM5 A;  3QW1 A;  3FDQ A;  2VCA A;  3L8I A;  1NG1 A;  1OCZ C;  2M64 A;  1A7E A;  2VH3 A;  3K7D A;  1FNT c;  1GGQ A;  3Q6N A;  4MTF A;  2Q4F A;  1M56 C;  2L6H A;  1BR2 A;  2YHS A;  2QE9 A;  3GM2 A;  3HNL A;  3PMR A;  4O6Y A;  2QY9 A;  2HKV A;  1E84 A;  3JT1 A;  4PAC A;  3QVZ A;  4A2N B;  3IQC A;  2Z15 A;  2L9J A;  1ZU4 A;  1M57 C;  4E18 A;  2XLE A;  3KMI A;  2L81 A;  2XLM A;  4YT4 A;  4IAQ A;  2EPL X;  1YJG A;  1EI7 A;  1QLE C;  3ZDL A;  2A0U A;  4XLN F;  1OW6 A;  3H65 A;  2LK4 A;  2YLI A;  1IZM A;  3T6B A;  4H4K C;  4MVM A;  3EGD A;  2ICW G;  3RFY A;  4YT8 A;  1T5O A;  2M4E A;  1IW7 F;  3RH3 A;  2J0X A;  2OOC A;  3AGU A;  1HMD A;  1L7C A;  1QKR A;  3FOP A;  3M4C A;  1Z63 A;  1TFK B;  2P7V A;  4I1M A;  3FHD A;  3EJN A;  4GQH A;  3C8G B;  4JJF A;  1U6H A;  4Q5S F;  2WL8 A;  3QVY A;  4XPY A;  3RQG A;  4IGG A;  3SXY A;  5KYW B;  4GYT A;  4MS2 A;  3V7O A;  4AE4 B;  3B9Q A;  2R7U A;  1H6G A;  2W9Y A;  3C18 A;  4XPX A;  4J32 B;  2XL6 A;  3M15 A;  3ZSU A;  1JPN A;  4EBJ A;  3VYW A;  2AVK A;  4NCQ A;  3K33 A;  2OU6 A;  2CCY A;  1VTM P;  4DBQ A;  4Q4Z F;  3A9C A;  3C63 A;  1ORJ A;  2WZL A;  1VLS A;  2BE5 F;  2EIM C;  2RSE B;  3JRM O;  4O7G A;  2NUP A;  3AJM A;  4LER A;  1G8X A;  2IXN A;  2DI3 A;  2QLA A;  2YEV A;  5JP7 A;  1E83 A;  4XEF A;  1NBB A;  5L0D A;  4C7O A;  3UMK A;  1NFN A;  1U89 A;  3NMI A;  3VAY A;  2NUT B;  1HW1 A;  2G3V A;  2JX0 A;  4PFO A;  1I5N A;  3UNG C;  3FMS A;  4BEJ A;  2MWQ A;  2ZXP A;  3ABL C;  5AC5 A;  1RMV A;  5KYN A;  2I15 A;  1YZC A;  4XWJ A;  3UGP A;  3NKD A;  2F22 A;  2ETS A;  5COM A;  1Y4C A;  1HE9 A;  4JRZ A;  1SR2 A;  4Z9H A;  2J7P D;  2LSE A;  3B0U X;  1D1B A;  1JAF A;  5A6B A;  3NYM A;  3GWL A;  3NYJ A;  1J8Y F;  2PX3 A;  1APC A;  4PFP A;  1Q0G A;  2WZG A;  2YLG A;  4PR9 A;  4AK9 A;  4NC3 A;  4QI2 A;  3DXJ F;  2XLD A;  4FX5 A;  5E3A A;  3QW0 A;  1LM3 B;  1OKK A;  1TWA A;  4HFF B;  3TJ5 A;  1JRA A;  2LFD A;  2XS8 A;  2YQY A;  4Q7C A;  4U5D E;  3UGO A;  1OXK A;  3EQL F;  3K1I A;  3U0C A;  2HSQ A;  256B A;  4HE8 D;  2IBF A;  3K1I C;  5CI8 A;  3X2Q C;  2CNW A;  4UDV A;  5EHH A;  3HLZ A;  4CS7 A;  3LS1 A;  3LUT B;  1V54 C;  4N4W A;  2HV7 A;  2IM8 A;  3ABK C;  2Y69 C;  3ZTZ A;  3W4Y A;  1HY5 A;  3GEE A;  3N2Z B;  4OIR F;  1PV3 A;  1RJ9 A;  2Q3T A;  2R25 A;  5BQH A;  4IAO A;  3ATP A;  1Q0F A;  3GAN A;  2PNO A;  3FAJ A;  2NSF A;  1NSG B;  4MVS A;  4BJ5 A;  4CS8 A;  1ZYR F;  1QSP A;  2XLV A;  4NTF A;  1LIH A;  4BJ5 C;  1TFO B;  1D1A A;  3DI5 A;  4CDY A;  2Y3D A;  1HE1 A;  1YYX A;  1BZ4 A;  4OD5 A;  2XXA A;  2FFH A;  4JUR I;  1Z3I X;  2R9R B;  1QVX A;  5JLI A;  4JEB A;  5KYX A;  3DE9 A;  3IQT A;  4E7S A;  2CGE A;  2EIN C;  4MVQ A;  1QZX A;  1VYI A;  3F47 A;  1J8M F;  4YN0 B;  1KTM A;  2HMZ A;  3O10 A;  4N6H A;  3EH1 A;  1FMW A;  4ER9 A;  2YL3 A;  3AQB A;  3WHN A;  3K6B A;  4JKV A;  4XQ1 A;  5BQI A;  1Z5Z A;  2XLH A;  3KKB A;  3SZR A;  3UMI A;  2KC3 A;  1FFH A;  1YLM A;  4A4A A;  3GM3 A;  4M63 A;  4XLP F;  2L6F A;  2UUH A;  2CDQ A;  4EWC A;  2QNL A;  2KGO A;  1GM5 A;  5L0I A;  4CJG A;  1WAS A;  1ORS C;  2C04 A;  4FWV A;  1MMD A;  2C03 A;  2O9X A;  3C7J A;  3VF0 A;  3NKE A;  2XLW A;  2D4U A;  1ZU5 A;  1YYJ A;  3EFO B;  1MMG A;  2V3C C;  5DS4 A;  1B68 A;  5B1B C;  1G5Z A;  3G4Z A;  1ZHY A;  2VB6 A;  3RF3 A;  1ZHX A;  4N6C A;  1FTS A;  2R7O A;  2YL0 A;  1BBH A;  1SMY F;  2W45 A;  2Y3G A;  2AWC A;  1JOG A;  5DVW A;  3LES A;  3PHF 2;  3L1M A;  4OIP F;  2CYD A;  3E70 C;  2OKU A;  2L6G A;  4E0I A;  4YT5 A;  3IQ5 A;  3C8G A;  3RW0 A;  4Z9J A;  4XPW A;  4DOZ A;  5L3Q A;  5KYW A;  2ZPA A;  4MVZ A;  3DAF A;  3HNK A;  4CDV A;  4HFK B;  3T6J A;  4CIH A;  3R2P A;  4DJ9 A;  1AVO B;  3NRH A;  5DQZ A;  2A68 F;  2OJQ A;  5T1D B;  1ST6 A;  3PCV A;  1D1C A;  2PBE A;  4CJO A;  4IAR A;  4E17 A;  1E85 A;  3QZC A;  5EK0 A;  5A6B D;  3SP1 A;  1OCC C;  4JVS A;  1S05 A;  4BEM J;  1MNE A;  1A7D A;  4P9F A;  1NLX A;  2Q9C A;  3ASO C;  2EIJ C;  3LLK A;  2KYH A;  3ZWI A;  1OKK D;  2L7A A;  1WN0 A;  2NUT A;  3LAY A;  4C3E A;  4YL0 A;  1TWC A;  1YZA A;  3QTH A;  1O87 A;  2CW0 F;  3S27 A;  4ULV A;  1E2X A;  1S7Z A;  2CNW D;  2J9W A;  1H9G A;  3RVZ A;  3WG7 C;  5A6A A;  4PJN A;  1Z23 A;  2IYL D;  2R03 A;  3S29 A;  3EGX B;  4JTD B;  3W8I A;  1LI7 A;  2H7B A;  2R7V A;  1PCX A;  3HKK A;  1C17 M;  2Y3B A;  1TKN A;  1OCR C;  1RKE B;  2LCH A;  3NMK A;  4LDQ A;  2X0C A;  3U9J A;  3C8Z A;  2PF4 E;  3O39 A;  3TD7 A;  1U0B B;  2Q00 A;  3MYF A;  4EHP A;  1G4W R;  4J7Y A;  1VYK A;  2GDC A;  1OW8 A;  2EPN A;  4LLE A;  1D0X A;  4IRU A;  2R7S A;  1ZHW A;  2LP4 A;  1SF8 A;  1V4A A;  5FZT A;  2YZS A;  2OQM A;  1NZE A;  2YWA A;  1ORY A;  3Q7L A;  3SNH A;  3OWT A;  2KNH A;  2PX0 A;  4O6M A;  2WVQ A;  2OEV A;  3M79 A;  5F28 E;  3JTL O;  3UR3 C;  3GOD A;  3S0X A;  1CGM E;  2D5R B;  4K1O A;  1V55 C;  1N1C A;  1EA8 A;  3ZG1 A;  3LNM B;  5JVE A;  4KNV A;  5KYU B;  1LS1 A;  3JYY A;  4AX2 A;  1LE4 A;  1LKX A;  3I4U A;  4NQF A;  1YAU O;  5A69 A;  1MMN A;  5L0F A;  1WOL A;  2GFH A;  2WB7 A;  3EG9 B;  4D4N A;  2LD6 A;  4KNW A;  2R7W A;  1A0B A;  1FFT C;  1JMW A;  2J9U A;  3G4X A;  3LEV A;  2Q7R A;  4DBR A;  4U5H A;  3Q7G A;  2VCB A;  3LLI A;  1VB5 A;  3U3B A;  4P6I C;  1MMA A;  1Z7Q c;  3CAX A;  1A7V A;  2J9V A;  2JPU A;  4I1O B;  3TOM A;  2LIG A;  3FOO A;  4LDR A;  2B0J A;  3C8G D;  4KBL A;  4ZLD A;  3VM6 A;  5KYY B;  2R7T A;  3I5P A;  4IJJ A;  4U5G A;  4MW3 A;  1MND A;  3IQ6 A;  1CPQ A;  1TWH A;  3MYI A;  5JSL A;  4E0H A;  4OIQ F;  3U2M A;  4U9D A;  1NU9 C;  1VOM A;  3ASN C;  4CIP A;  1T01 A;  2J46 A;  3EFO A;  2OEX A;  2P0N A;  4C3B A;  2YL7 A;  3LJB A;  1M6T A;  2XS1 A;  3RQF A;  3VRC A;  4CS8 C;  1M2V A;  4JTA B;  4WGZ A;  1O5H A;  3JZ0 A;  4L6R A;  3CQZ A;  2AWY A;  1LI5 A;  1HW2 A;  3B29 A;  2EIK C;  5L0C A;  3L0I A;  4NTB A;  3JSE O;  1T9K A;  3WAQ A;  4G7H F;  4MVU A;  1Y6D A;  4JE9 A;  2EPO A;  1M2O A;  2P1A A;  1QQ3 A;  4JW1 A;  5D92 A;  5JS5 A;  5A6K A;  3BEH A;  2KW3 C;  2Y39 A;  1YAR O;  1GS9 A;  2VAS A;  3RQE A;  3CZ6 A;  3S84 A;  2A0B A;  2RD9 A;  1LS4 A;  1YDI A;  2R7Q A;  3EZH A;  2DB4 A;  2OJE D;  5JUA A;  2HFI A;  2B0H A;  5B1A C;  4NTA A;  1T6Q A;  1WAT A;  3FXH A;  2WVO A;  2HZ8 A;  2QUP A;  2XRH A;  3AG4 C;  3DE8 A;  3IHU A;  4IWB A;  4F4B A;  2MHR A;  2XL8 A;  3ABM C;  5JT4 A;  2G62 A;  2HUJ A;  2AU5 A;  3NMJ A;  4JCH A;  2VC9 A;  4DXW A;  2HJ3 A;  2Q9B A;  3MX3 A;  4DVY P;  3C62 A;  2NSG A;  4MTO A;  1R4T A;  1Z6A A;  3FAP B;  3HNI A;  4U5F E;  5T3T A;  5EGY A;  1XZQ A;  2ASR A;  4JC7 A;  2XL4 A;  1OQC A;  2GA0 A;  3LS0 A;  5E33 A;  1Q0K A;  2AP3 A;  3US6 A;  3HTK C;  4ZLC A;  1DOV A;  4LAC B;  5COG A;  2EPM X;  3W8H A;  2IXO A;  3A11 A;  3V5Z A;  3DJU B;  2HMQ A;  1D0Z A;  4PJJ A;  3EH2 A;  4YL3 A;  4CX9 A;  3TQO A;  4YT2 A;  3TUL A;  3SXK A;  3UMH A;  2NG1 A;  2R7R A;  4AE4 A;  2J7P A;  2PFD A;  3GM1 A;  2KQ9 A;  2LQG A;  1RKE A;  1YA7 O;  1QPU A;  3KYI A;  3M1C B;  2EIL C;  2IOQ A;  3NYL A;  3S28 A;  4DRJ B;  1H9T A;  5DS6 A;  3V5Y A;  5B3I A;  2WVN A;  3B0V C;  1LVK A;  4DRI B;  1ZHZ A;  3AQC A;  4J30 B;  2KK1 A;  4FES A;  1OXB A;  3DMD A;  4YL1 A;  2KJG A;  3AOU A;  4RBN A;  4E7Z A;  5HSW A;  2XXA B;  3KH2 A;  1UG7 A;  3N0T A;  4J7T A;  3FVY A;  1SZI A;  4ULW A;  3QMK A;  3ZC4 A;  5CIV A;  1LE2 A;  2NPU A;  1L3P A;  3SYN A;  5AC4 A;  2XM0 A;  5A6J A;  3DKA A;  3X1O A;  5JRA A;  3MFN A;  3ZQV A;  2J8W A;  1BR1 A;  3AG1 C;  3RYL A;  3RKO F;  3HNJ A;  1Q0D A;  1K40 A;  4KC9 A;  3DD7 A;  4MVR A;  4JEA A;  3IEE A;  1TWG A;  2XSE A;  1HMO A;  3Q6M A;  3K1H A;  2Q9A A;  3E9V A;  1ZW2 A;  2UUI A;  3H2V A;  4RDA A;  2PP4 A;  5E2Q A;  2KSF A;  3KPH A;  2P6V A;  5KYU A;  4KI2 A;  2J0W A;  4JIO A;  3GEH A;  3L8J A;  3GOR A;  3SEO A;  1JR8 A;  4O79 A;  4G0H A;  1SYQ A;  3EG9 A;  4H54 A;  4R32 A;  3U8V A;  3RIP A;  2G3K A;  2J45 A;  1D0Y A;  1ZHT A;  1WWP A;  4XTK A;  4YJW A;  3DAG A;  5L0H A;  1RCP A;  1ZW3 A;  4WJ0 A;  1T6I A;  4WAB A;  5COF A;  2A6H F;  2FGY A;  3CEX A;  1UFB A;  2HSB A;  2A6E F;  1CGO A;  3IPM O;  1OR3 A;  4IB4 A;  5TJ5 E;  2IXM A;  3G50 A;  3F46 A;  1EKY A;  3LNR A;  1FAP B;  4LLC A;  2FAP B;  3U3F A;  3S9O A;  5KYY A;  1XZP A;  3ZIB A;  1ZZP A;  1VK5 A;  4JJG A;  4MTG A;  5L0J A;  3DJN B;  4BJ1 A;  3AGT A;  2E87 A;  2ZXO A;  5CI9 A;  4OIN F;  5F5F A;  4QI0 A;  1A41 A;  3TOL A;  1PD0 A;  3ZQY A;  2W4M A;  3EZI A;  3KL4 A;  3SXZ A;  2JD3 A;  4JCZ A;  3U5S A;  2WZF A;  4U5B E;  3T6G B;  1W2W A;  1O3U A;  1VMA A;  4X0R A;  4PJL A; 
#chains in the Genus database with same CATH homology
 1A0B A;  4G78 A;  1WN0 A;  1OXK A;  2LP4 A;  1C03 A;  1Y6D A;  2OOC A;  3U3B A;  3US6 A;  1I5N A;  4EUK B;  2Q4F A;  2A0B A;  1FR0 A;  1YVI A;  1C02 A;  2R25 A;  4PAC A;  3KYI A;  1SR2 A;  2LCH A;  1QSP A;  3KYJ A;  1OXB A;  3MYF A;  1BDJ B;  3IQT A;  1TQG A;  2LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...