2Q4PA

Ensemble refinement of the crystal structure of protein from mus musculus mm.29898
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RS21-C6
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q4pA00
1YVWA 2OIGA 5IE9A 1VMGA 3CRAA 2YXHA 2Q5ZA 3CRCA 2Q9LA 2Q73A 2GTAA 2OIEA 1Y6XA 4QGPA 3C90A 2A3QA 1YXBA 2P06A 2Q4PA 2A7WA
chains in the Genus database with same CATH superfamily
3B77A 4UFZA 1XREA 4WFHA 1S77D 1WLEA 5AG2A 3NR7A 2A0LA 5LMNO 2PUSA 1URFA 5J2UB 4DV7O 5IY5B 2CTQA 1W59A 3N2GB 1I08A 2BE3A 3P32A 1EN6A 3GWKC 2WLJA 4GX0A 1R6NA 2YICA 1P7GA 3RYHA 2UUBO 2OTJV 4UCTA 2UU9O 1PPJH 1M1KW 3JASB 5JH7A 2PYLA 1S72V 3JALA 3CMEV 2R9AA 2YXLA 3APQA 3UT5B 1RPRA 1SS3A 3SPGA 2P67A 5ITZA 5CB4B 3WG7B 4FLZA 3CCVV 2IJHA 4X1IA 2W0XA 3GWOA 1YHQV 3CRQA 5BMVB 2LFRA 5LHGA 1YITV 4DXWA 2Q7GA 5EIBC 4FJCC 3FKSG 5EBMC 2QTOA 3OEEG 4NVPA 4LF9O 3CWBH 1XQ8A 4RQEA 3LDCA 5KAFZ 2ADPA 1XNRO 3CCLV 1IVSA 3OAAG 3E8HA 1JFFB 2XAJA 1SQVH 4FVMA 1XBLA 1F23A 4HAMA 2UUCB 4DW0A 1P4RA 2XOKG 1G4YB 2JVDA 3E8GA 3IGAC 3ZIAG 2LGQA 4JAAA 2F43G 1I94B 5LMUB 3U11A 1BMFG 1AI5A 5LHHA 4B3RO 1FXKC 3N2KB 4I0XA 3TETA 5BZBA 4BR6A 5KMGB 5C8YB 4B3TO 3DTUB 1VQ9V 1X4TA 4F6RB 4R6ZA 2H3OA 1MSDA 3JARA 3S3WA 2GHYA 3B8MA 3QTCA 5CBFA 3LUTB 5K1XA 2HKOA 1TUBA 5LOVA 4PJ0Z 5L3CA 4FK5C 1DK1A 4DR5B 2DYSB 1DGSA 3STZC 1H8HG 4LF7B 2A06H 1O9HA 4IYHA 2Q7HA 2RMKB 3FB5C 4TV8B 1FJGB 2HHHO 2Q73A 3K5OA 2NN4A 2RCVA 5EBWC 1J5EO 1M57C 2JS5A 2HVJC 1TA8A 4DR7B 2F93B 1SESA 2EIKB 1JQ0A 4TOIA 3VOUA 5IJ9A 2EIMC 1IDSA 3STLC 1YVWA 2FMLA 3CE2A 3AG4C 3CCRV 5CA0A 3TXQA 2HVKC 3DXRA 4LH6A 4OGQB 1M93A 4O2AB 2P4VA 1XOUA 1QLEB 2KQXA 3ASNB 4EEQA 4K3AA 3W7XA 4Q20A 4DR1O 2JS3A 3CS5A 2D2CB 1NH2B 4ZBMA 5GONA 1Y76B 2YDEA 4GX5A 5H6QA 2UUCO 1GK9A 2HR3A 4GZRB 2WA3A 1NS1A 2YS8A 1I94O 5GTHZ 2QM4A 2Q68A 3X2QB 3CYOA 1H8EG 3GVMA 3ML0A 3ZS8C 2QWQB 4CS2A 4XDLA 2E5LB 3F7VC 1RM1B 4X65B 1QVFU 2KG7B 3WB1A 4KXRA 3HKDA 4PELA 1Z5VA 3WG7C 1SERA 4DR5O 2DJVA 5D5PA 2B9ZA 1YIJV 1RSOB 1TUEB 4X1YA 4LF7O 1G8MA 3NXSA 4LFAO 3E83A 3J7AU 4IIJB 4JI8O 4YY3B 1FJGO 2YI8A 4QJFB 3JATB 2Q0OC 1GN2A 3OUFA 4TUYA 4J7JA 1QR8A 4I50A 1MNGA 2YEVA 2RNBA 3ETEA 4DR7O 5BXZA 2ZR3A 4OX9B 1EN4A 5JWPA 1GN4A 3C90A 2IW5A 2Q4PA 5LXTA 1N8RW 4DR2B 1XI1A 3SPCA 2Z3YA 2QR4A 4X62O 2DOSA 3KKYA 2UUAB 1V55C 4UCUA 2GTAA 4DV2B 3QVNA 4P9OA 2X6CA 2GUZB 3JSLA 4BIUA 3OT7A 1SZTA 4U3JA 4LBEC 5CN0A 1ZAUA 4GT1A 1YJ9V 2EULA 5EBLC 1JMKC 1Z5WA 1Q90D 4KP4A 4KUMA 1YEWA 4PDRA 3K0DA 1KUQA 4BWAA 1WPBA 1YSCA 2ZE5A 4WFGA 3RT3C 2EINB 2L35A 2DYSC 4LFCB 1Y74B 1ZUQA 4Z2WA 4LCUC 4EKWA 5FNVA 1K73W 2Z5UA 4JASA 1NH2D 2E75B 5GTIZ 5B5EZ 3RYFA 2UXXA 4JZGA 4WCEV 4RUEA 4P30A 4BIOA 1ZSPA 2LQTA 3LNNA 3ABTA 4DV1O 4PA3A 1IXBA 2E5LO 2EIKC 3BAAA 4X65O 5IT9N 4LF4O 4DR3B 3T2MA 5IYDO 4CH3A 5B1OA 5DN6G 1XMOB 4J9ZB 3H01A 4X64B 1DF5A 1FFXB 1R6TA 2QA4V 3BA8A 3B2EE 3JD4A 1SA0A 3HKCA 3M99B 1ORQC 4OPAA 2JGDA 3CP1A 1W2BU 4JYAB 1QLEC 2ZE6A 3K57A 1DTOA 1LUVA 3TJTA 3UQ8A 1VQ7V 4FM1A 4RQFA 2W6IG 4LWSB 2QGNA 4J42A 1Y4MA 2NNUA 1OCRB 1P84F 3L70H 2Q67A 4OX9O 4GKJB 4DR6B 3JYCA 2BTQA 1Z2GA 4I9WA 5J2TB 4UCRA 3Q4HA 4UCSA 4FPPA 3KCXA 2WSSG 1Q8IA 2QKAA 2QM7A 2GSMB 3CJHB 4JAVA 1W0JG 2KSDA 3LSSA 5JVDB 1FD9A 1VF7A 4DRXA 2UUAO 1K34A 4I55B 3WB0A 1VQ5V 1FXKB 2ZNIA 5CBHA 1Q82W 5JQGB 1OCCB 2XASA 1NBMG 5H5NA 3HKEA 1HR0B 1UPGA 3CCJV 1PNMA 3SDLA 1RM1C 4P2ZA 2OYQA 3CCMV 2ZT9B 1I7FA 2Y48A 4J11A 4CH6A 3QO7A 3F5TA 3OUSA 3JD1A 2QWOB 3K08A 4LFCO 1GAXA 2EZOA 1KQSU 4MTXA 4FLYA 1PL0A 2G38A 1IBKB 3I56V 4LWSA 5LYJA 5B3SB 1QCEA 2IJKA 2QM8A 2PYJA 1R73A 1NI8A 4MW8A 1JJ2U 5L3BA 2IBZH 3RW0A 2ZE7A 1N33B 4JI7B 1Y67A 1K8AW 1VQ8V 4CS4A 1XMOO 1HWYA 3E2EA 4D7TA 3FAVA 2ZDIA 3RYHB 3JAMN 2ILMA 5EC1C 1D5NA 5JJJB 5JH7B 4ZHQA 3QO5A 3CSXA 3JALB 2Q9LA 3PN1A 3IJ4A 1XMQB 2IU0A 1PV0A 1WN7A 2WWWA 2RQ6A 5ITZB 4JYAO 2V4DA 3U0ZA 3CC7V 3JAKA 4X1IB 3TGUH 2XAHA 4NR1A 4NTWA 2JIZG 4NYKA 2KB1A 5IJ0A 3APOA 3TCUA 1Q6IA 1GH6A 2VS0A 4DR6O 3A0RA 4FLXA 5CBGA 2ODMA 4ZOLA 4DV3O 1N34B 4NXMB 1VQPV 1EM1A 1Q86W 1VQ4V 4LP8A 3WU2Z 2K9PA 2UXBB 1K97A 1H2KA 4H13B 3JCZA 4GKKO 3JD0A 4ZKIA 1CPYA 5LL6Y 1MSWD 3FB6C 2BSKA 3ZHQA 1HR0O 4PA4A 5KX5A 2E76B 2CTRA 3OTOB 4I0XB 4RUFA 2PI4A 2ZCEA 3A8TA 4I4TA 2PGGA 1GMGA 2R72A 3P3PA 1HNWB 1AI7A 4JF3A 1L0LH 4JGSA 3JARB 3SJBC 1AP5A 5EK0A 2W6JG 3ZRWA 1TUBB 5LOVB 4I7ZB 5KA6A 1EZJA 1YI2V 3ICXA 5FLXN 4L87A 4NXNO 4O4IA 1IBKO 1GRJA 4ABMA 3CCSV 5FL7G 4UB6Z 4UVAA 2LJ2A 2ARHA 3OTFA 3SJCC 2W0FC 3CEIA 1OCRC 2Y4TA 4X20A 2WA4A 4MVZA 2CH7A 2VWJA 1IBMO 3RN4A 1N33O 4JI7O 1L1FA 3CRRA 1GN6A 1R3IC 4B3SB 2UXDB 1P7BA 2HJDA 3AG1B 3AG3C 4J7ZA 1JOYA 5IJ9B 1QBZA 3K04A 4IYIA 1VEWA 3CRCA 1NTZH 4IHJA 4YJ3B 3CRMA 4HYOA 4DV0B 1V55B 1OCCC 1SRYA 3FD9A 2CUGA 4DUZO 3BPZA 2ETNA 5KHJA 5CA0B 3DXRB 1SQQH 1AB3A 2WLNA 1M4UA 3EVKA 4W4KA 2DMXA 1IX9A 4MVOA 3CCEV 1V9PA 2DQ3A 2Y4UA 4NKGB 4O4HA 3D3IA 1ENVA 1FFTB 3VBBA 2JRIA 1N34O 2H94A 4KFMA 1KKDA 4DV4B 3HKBA 1VQKV 2UXBO 3ZRSA 4DV6O 3DC5A 4JI4B 3K3WA 5GONB 2IH1C 2CTWA 4QPKA 2FB5A 1NR7A 3OM3B 4TV9A 5B3SC 2CTPA 3RYIA 3CCUV 3THOA 1UJWB 2XUMA 3B8NA 3FB8C 3D3QA 3SPIA 4MTFA 4WBNA 4LF5B 2K1EA 2ITDC 1K7DA 3TK1A 4FLWA 1QVGU 2AZ0A 1V54C 1JVMA 1ZL8A 4YJ3A 5IE9A 2FL4A 4F6EA 4D7SA 4F4LA 2Y69C 3T4ZA 1KP3A 1BE3H 2KKWA 3RVZA 1AP6A 1S3JA 2HP8A 4JI0B 1AI4A 3F5WC 3W7TA 3H1HH 5H9CA 3K5MA 1FAFA 2QWNB 2MW2B 4J9YB 1OV9A 1BL8A 2DWEC 3JD2A 3VQXA 1IZ3A 3HKDB 2WLMA 3AG2C 2V1DA 4DUYB 5D5QA 1NZ6A 2X6AA 2AHYA 1OCOC 2ZE8A 1QQCA 4X1YB 2ATKC 1F4MA 1B04A 3K59A 1VF6A 1FYJA 5KA5A 2YIBA 2LFSA 3QNEA 3SYQA 1WP7A 1R1BA 4YHHB 4I5SA 4B3SO 4TUYB 2F1MA 2P06A 4I50B 1R3LC 3L75H 4MT8A 2YEVB 2NR5A 3IFXA 5LMUO 1NU1H 3G6BA 5LXTB 4JI2B 5IYZB 4MVRA 2WAMA 1S5LZ 1WJZA 3ZX6A 2DW4A 3LSQA 4KHPB 1H2SB 3CHXA 2OCCB 4A5UB 4PV1B 4X88A 5L3FA 1XNQB 2BCCH 2BOCC 3ZHSA 1BCCH 4U3FH 1MA1A 5DM6V 1U97A 3M7MX 1WB7A 4U3JB 3DGEA 5LP6A 3T1HB 3K9SA 3L71H 1THZA 5CA3A 2ZD9A 4DV4O 3T1YB 4AI8A 4X89A 3B09A 2Z0AA 3O9OA 4CS3A 4JI4O 3BCCH 2A79B 2XAQA 1K33A 4XDKA 2QSAA 1FS0G 4H44B 1S76D 5FNVB 4JI3B 4G2KA 1JCHA 2Q5ZA 2YUAA 2IJIA 3H1KH 3RYFB 1LUWA 2AXTZ 2A9HA 1NTKH 3RVYA 4YIPA 4LF5O 1UFIA 3E8FA 2HG5C 1CXZB 2HFEC 1AJNA 5IYZA 1JR9A 1ZTEA 3OR7C 4QE7A 4PI2A 3AG1C 4LNUA 4H33A 1VMGA 2WPDG 4JI0O 4RO2A 4UV8A 4E4EA 1TGOA 2NLJC 1E1RG 2OIEA 1Q5OA 3QO8A 4DUYO 3ZMSA 1SA0B 3HKCB 3C3TA 1XL4A 4MVSA 1U96A 2JGDB 5FPRA 1TVKA 4LF6B 4B7KA 3CRAA 1HNZB 2AHZA 4DV5B 2X6BA 2UXNA 4YJ2A 3OMAB 5CMUA 4B08A 1WA8A 1PNLA 2LP7A 4UXNA 2BTOA 4JI2O 1J95A 2BTQB 2YSUB 4MTOA 3RYCA 4R8CA 1MG1A 3Q4HB 2F4VB 2B1IA 2Q7EA 1KD1W 3E22A 3L72H 2OWOA 4BW9A 2Y0PA 5EZYA 3ZEDA 4DRXB 5B66Z 5IDJA 4FLUA 4JI6B 1VF5B 4MSWC 3O65A 3ZHRA 4TWKA 5JJNB 3HKEB 3T4DA 2EBOA 3VQVA 2PF4E 4G28B 1MZFA 1RFYA 2ZM6B 1MMMA 4O4LA 5LP6C 1AR5A 2M6YA 3T1YO 4HNAB 4FIPC 3P30A 2BOBC 2QTSA 4OXSA 3MD0A 4JI3O 3SYAA 3N27A 2P5OA 4YY3O 4WFFA 1HDJA 5L3GA 5LYJB 5C93A 1VQ6V 5BR8B 1N32B 4FM0A 1AR1B 5B1BB 2A3QA 4PDMA 4Z1VA 1NR1A 4LR3A 3D36A 1SQFA 4DR2O 1SQPH 2UXCB 1VQNV 1NTMH 3AG3B 3OGIB 1B3QA 3U10A 1Q81W 3SGIA 3FAVB 4Z1MG 4DV2O 2GV9A 2OCCC 4ZHQB 3E8BA 3K5LA 5LA6A 5LGTA 2P90A 1YXBA 4QNHB 3M8AA 2WLIA 1GKFA 1YZBA 4LF6O 4UV9A 1LR1A 4BW5A 4GCZA 4O2BA 4DV5O 4BIZA 3JAKB 3UO2A 1B06A 4CC6A 1PKXA 3ETGA 4HNAA 5IJ0B 4PD4F 2MK3A 4K8ZA 1H2GA 4G27B 1NJIW 1VP7A 3W7WA 3W7UA 3HR0A 3RBZA 3G71V 1GN3A 3L9DA 2CAZC 2Q0AA 3H1JH 4X9QA 4AQYB 1BGYH 3FX7A 2UUBB 2QKSA 4ZOLB 2EILC 2F4VO 5L3DA 2VWKA 4GLXA 1K5SA 4UB8Z 3DC6A 3ZN0A 4QGPA 5KHHA 2BSKB 2ITCC 1HW7A 4J41A 1KMIZ 4DR3O 3JAWA 5KX5B 3OEHG 1RP3B 1A32A 1BSMA 2ZKOA 2FTKA 2LW1A 3G80A 3SYPA 4X64O 1V54B 2P22C 2HJFC 4NTYA 3R65A 4I4TB 2ZM6O 3T1CA 1VARA 2Y69B 4DYLA 4RAIA 5FPOA 1R6KA 1I5XA 3LDEA 2DYRB 2JEXA 1XNRB 4K0KB 1XL6A 4KL1A 4EFBA 1S5HC 3AG2B 3SYCA 3ZRWB 3ZRVA 1COWG 4FFBA 4JTAB 3ABLB 1OCOB 4NTXA 1N0NA 4O4IB 3A2FA 2B5UA 3BY6A 1PM9A 3CX5F 1GM9A 3K0GA 5BR8O 4TT3G 3J80N 1N32O 3UKMA 1AJPA 1S5JA 4GKJO 2Q69A 4MVQA 1XEQA 4X20B 5F2VO 3ASOB 2CH7B 3QF7A 3S3XA 3L74H 4PA6A 1JA8A 1T5EA 5BY1A 3WB2A 2PTMA 3JCUZ 2ZXWC 3F7YC 4OPHA 1KB9F 4IHJB 4H0LB 5DECA 3K5NA 2DE0X 5CA1A 5A2QN 4O4JA 1VIBA 1G1XB 1BQZA 1OHHG 2QWPB 1Q6UA 3H1IH 4UVCA 4U7NA 4ASUG 3I5DA 4LF8B 2PI5A 5JJEB 2HHHB 1QLNA 2GDSA 3OE7G 1J5EB 1LNQA 2N04A 4FMTA 1PD3A 4WF9V 4MTGA 4AQYO 1HNXB 2Q6AA 4O4HB 3CMAV 4C7UA 2D3OW 2CGNA 4UUJC 3HKBB 2RDCA 4EB6B 1MABG 4QIWF 3SPJA 1FKAO 1CEZA 4N21A 2JJ1G 4TV9B 3MHSC 3CXHF 1SQBH 3ZN1A 1OJHA 4DO2A 1FXHA 3RYIB 1AR4A 1QU7A 4GX2A 5B1BC 3E86A 3A0BZ 4JTDB 1HP8A 4WFBV 1CP9A 5K1PA 4WBNB 1KU9A 4Q6GA 5KUMA 1L8DA 3SJAC 1Q6HA 4ZI7A 4DR1B 4YIOA 3ZJZA 2GTSA 1XMQO 4K0KO 1ZL8B 2ZDIC 4X1KA 2H8PC 4ZIBA 2R70A 1GM8A 2Y0IA 2JK5C 1E1QG 2A7WA 2OCHA 3D8CA 2R9IA 4GX1A 3W7SA 5H6RA 5J2UA 2ZQMA 3ABKC 1M90W 1PNKA 1Q3EA 4R50A 1MZEA 3N2GA 1F4NA 1D5AA 1NVPB 4PDLA 3I55V 4FLTA 1M9NA 1EZVH 3JASA 4U7OA 1FXVA 4NXMO 5KHKA 4EB6A 2EJRA 3BA9A 3UT5A 4FLVA 3BHPA 5CB4A 1K9MW 2E3CA 1OZ0A 3ZRXA 2N74A 1NT2B 3CXCU 5DEDA 2ZINA 4IL6Z 3ZMZA 5L3EA 4D6TH 3ETDA 2OT5A 1WNSA 5BMVA 5J9PC 3H1LH 4J80A 4FZ0A 1Q7YW 1PP9H 3OTOO 2PZSA 2ZIMA 4MS2A 2YIAA 2C2AA 4JI5B 2CDYA 4TQDA 3MHHC 1E79G 4LFAB 1N4CA 3OGCC 3ETQA 1BZKA 1HNWO 4LFBB 2DWDC 4JI8B 4AILC 1N36B 3KCYA 2EIJC 1QR9A 4LF8O 1DLBA 1JFFA 2YXHA 4CBCA 4BAYA 4PHZA 4FM2A 1O9GA 2N05A 3BEHA 2DYRC 2ADQB 1IXMA 5LP6B 4TQFA 1MOFA 2F95B 4R7CA 3CCQV 1HNXO 4GUNA 2HEPA 1IURA 3B4SA 3ABLC 3IC7A 2F66C 4WFEA 5KAIZ 3N2KA 3J81N 2XAGA 1AROP 4X62B 4JV5B 3OMIB 5KMGA 3KZIZ 5C8YA 1X59A 1IBLB 4LH7A 4F6RA 1W0KG 3G67A 3ZHVA 4PI0A 3G6EV 1SKVA 1XHXA 1NQTA 2UXDO 3ASOC 4FFKA 4QPJA 3OFNG 4JTCB 1GTOA 2IU3A 5KUKA 3AK2A 3SPHA 3C3SA 1JPXA 4LNUB 4DV0O 3ZHTA 1G6UA 1OCZC 1M56B 5KHIA 3AK1A 2YIDA 1Q43A 1XUQA 4JI1B 4JYBA 3OW2U 2RN9A 4TV8A 4J7KA 3BABA 4QE9A 3MAQA 5A9GA 4UCVA 5B1AB 2VRZA 2P6JA 4MVUA 2E74B 5IY5C 2LW7A 1TVKB 2XAFA 4E2LA 3FFQA 3OD4A 4H37A 4DV1B 1WAZA 1NVPD 2IM9A 1SF9A 1D2DA 4YJ2B 2B1GA 4GYCB 4LF4B 2RJZA 2WLKA 1P49A 1KC8W 1BS3A 3RFRA 2YIBD 1WA8B 2EILB 3UO3A 4CH5A 2FYUH 4O2AA 3RYCB 2HLDG 1ROPA 1I5YA 2QJ1A 4IGGA 1RPOA 1Y66A 1BHAA 3P3NA 1WP8A 3E22B 4JI5O 1TAEA 5LGNA 3LDDA 5EZYB 5KHGA 1JJOA 4LFBO 1KKCA 5LGUA 1N36O 2M7WA 2YI9A 1US6A 5E79Z 1KBHA 1Y76A 4DK0A 4JPRA 3HPLC 2EJ7A 1VQLV 2Q8VA 3RWRD 4I9QA 4PDVA 1QHTA 1FPOA 4AHCA 4O4LB 3AG7A 2CK3G 1XDCA 2QKCA 4J10A 2WLLB 4YXWG 2DQ0A 1SQXH 1YTFB 4JV5O 4CZZA 1EFRG 2LGWA 1IBLO 2VQFB 3EFFK 3H9VA 3SR2C 3ABMB 5EYPB 4RWUA 3G4SV 1QNMA 3IC9A 1EBOA 4UCOA 1Y6XA 1VF6C 2VQEB 4YHHO 3VQYA 2KG7A 4L8JA 1ZX3A 1ZLZA 2YC0A 5H2FZ 5LHIA 4LC1A 5HFMA 1B6QA 3CC4V 3IAYA 3BFRA 5E1AC 3E35A 3ZBHA 3CC2V 1VQMV 4ICGA 2QE7G 4PA7A 4XDJA 4DR4B 4KHPO 4FZ1A 1RSOA 4X8AA 2ZXWB 3K9AA 4JI1O 1XNQO 2F23A 4IIJA 3AK3A 3BVOA 2XT9A 1K5QA 2DN9A 3MDSA 1KECA 3E89A 3OR6C 5LA6B 3JATA 5KLVH 1M5IA 3AEIA 3JSNA 3ABUA 4PA9A 2WLIB 3T1HO 5B1NA 2ZR2A 1K92A 3FYIB 4O2BB 2L6LA 4X66B 4W4LA 2WLLA 4JAUA 1BHBA 3ZMTA 1AVMA 2EZPA 5EC2C 5TISZ 5IYBO 5EYPA 4WFAV 2JJ2G 2GUZA 4DK1A 1YF2A 4XBFA 5JCOA 1VQOV 2JEUA 1AI6A 1H2MA 1SQGA 3TXSA 4HBNA 2JGUA 3ZHUA 1N0JA 2FKXA 4CC5A 2XTAA 3ASNC 3LSUA 1NKDA 3JAWB 5IWAB 1Y74A 1KYOF 1BQ0A 1M56C 3JD3A 3K79A 1H38A 4DV3B 2AZ2A 2X7RB 2P7TC 2JDIG 4B3MB 1F7YA 3RGBA 2LO1A 4CH4A 3UM7A 3GB7C 3ABKB 3ZMUA 4GKKB 2VQFO 4FFBB 2CGOA 1HNZO 5B1AC 3L73H 5LMNB 1SZXA 1AJQA 3X2QC 1YTFD 1SC5B 4DV7B 2VQEO 3CB2A 1S0VA 3KG2A 3EXAA 1ZWIC 2AGAA 2OTLV 3UCSC 3LNMB 1FFXA 2IJJA 3EHBB 2UU9B 3BRCA 1YJNV 1R3KC 3K06A 1BT8A 4DR4O 3VQWA 4TSFG 1K3EA 4JZ2A 3OMNB 1KP2A 1GM7A 4JI6O 3ZCCA 2IH3C 4MVMA 1K4DC 3WFVA 4NXNB 1DF4A 1H2LA 1WPXA 3HB3B 4P9PA 1L0NH 3CPWU 5CA1B 1YDXA 2WLHA 4O4JB 4IT5A 2EIJB 4DW1A 1PL4A 4UVBA 4X66O 4N23A 4LF9B 1M57B 5J2TA 3PJSK 2XNDG 2ZIOA 3B40A 1YJWV 4B7EA 2YXYA 3QG5A 2P4KA 1XILA 1XHZA 1R3JC 3A0HZ 2XHBA 3FB7C 1AILA 1IBMB 3CJHA 2EIMB 4K8XA 1JX9A 4K35A 5JVDA 2V7QG 4I55A 1FXKA 1I0HA 3AG4B 3FYEB 5JQGA 1H2NA 3K58A 2CE4A 1SETA 3ABMC 2R9RB 4B3RB 4MW3A 2X0LA 5JCOC 1GO3F 5LBQA 4EFEA 4DUZB 2QWRB 2AW9A 4B3TB 2ZNJA 3K03A 2UXCO 1F51A 4JYYA 3ZMVA 3SJQC 2EX3A 1EN5A 2OIGA 3D36C 1YCIA 5IWAO 4HZ3A 5HFLA 1WB8A 3DSQA 2QEXV 3R66A 3CD6V 5GW7A 2QDOA 2EINC 5EIBD 2O57A 2PY5A 4JYCA 4ZI7B 5IYCO 1OCZB 4NB5A 4X1KB 2GBOA 4B3MO 1K4CC 3SYOA 4DV6B
chains in the Genus database with same CATH topology
1YVWA 2OIGA 5IE9A 1VMGA 3CRAA 2YXHA 2Q5ZA 3CRCA 2Q9LA 2Q73A 2GTAA 2OIEA 1Y6XA 4QGPA 3C90A 2A3QA 1YXBA 2P06A 2Q4PA 2A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVW A;  2OIG A;  5IE9 A;  1VMG A;  3CRA A;  2YXH A;  2Q5Z A;  3CRC A;  2Q9L A;  2Q73 A;  2GTA A;  2OIE A;  1Y6X A;  4QGP A;  3C90 A;  2A3Q A;  1YXB A;  2P06 A;  2Q4P A;  2A7W A; 
#chains in the Genus database with same CATH topology
 3B77 A;  4UFZ A;  1XRE A;  4WFH A;  1S77 D;  1WLE A;  5AG2 A;  3NR7 A;  2A0L A;  5LMN O;  2PUS A;  1URF A;  5J2U B;  4DV7 O;  5IY5 B;  2CTQ A;  1W59 A;  3N2G B;  1I08 A;  2BE3 A;  3P32 A;  1EN6 A;  3GWK C;  2WLJ A;  4GX0 A;  1R6N A;  2YIC A;  1P7G A;  3RYH A;  2UUB O;  2OTJ V;  4UCT A;  2UU9 O;  1PPJ H;  1M1K W;  3JAS B;  5JH7 A;  2PYL A;  1S72 V;  3JAL A;  3CME V;  2R9A A;  2YXL A;  3APQ A;  3UT5 B;  1RPR A;  1SS3 A;  3SPG A;  2P67 A;  5ITZ A;  5CB4 B;  3WG7 B;  4FLZ A;  3CCV V;  2IJH A;  4X1I A;  2W0X A;  3GWO A;  1YHQ V;  3CRQ A;  5BMV B;  2LFR A;  5LHG A;  1YIT V;  4DXW A;  2Q7G A;  5EIB C;  4FJC C;  3FKS G;  5EBM C;  2QTO A;  3OEE G;  4NVP A;  4LF9 O;  3CWB H;  1XQ8 A;  4RQE A;  3LDC A;  5KAF Z;  2ADP A;  1XNR O;  3CCL V;  1IVS A;  3OAA G;  3E8H A;  1JFF B;  2XAJ A;  1SQV H;  4FVM A;  1XBL A;  1F23 A;  4HAM A;  2UUC B;  4DW0 A;  1P4R A;  2XOK G;  1G4Y B;  2JVD A;  3E8G A;  3IGA C;  3ZIA G;  2LGQ A;  4JAA A;  2F43 G;  1I94 B;  5LMU B;  3U11 A;  1BMF G;  1AI5 A;  5LHH A;  4B3R O;  1FXK C;  3N2K B;  4I0X A;  3TET A;  5BZB A;  4BR6 A;  5KMG B;  5C8Y B;  4B3T O;  3DTU B;  1VQ9 V;  1X4T A;  4F6R B;  4R6Z A;  2H3O A;  1MSD A;  3JAR A;  3S3W A;  2GHY A;  3B8M A;  3QTC A;  5CBF A;  3LUT B;  5K1X A;  2HKO A;  1TUB A;  5LOV A;  4PJ0 Z;  5L3C A;  4FK5 C;  1DK1 A;  4DR5 B;  2DYS B;  1DGS A;  3STZ C;  1H8H G;  4LF7 B;  2A06 H;  1O9H A;  4IYH A;  2Q7H A;  2RMK B;  3FB5 C;  4TV8 B;  1FJG B;  2HHH O;  2Q73 A;  3K5O A;  2NN4 A;  2RCV A;  5EBW C;  1J5E O;  1M57 C;  2JS5 A;  2HVJ C;  1TA8 A;  4DR7 B;  2F93 B;  1SES A;  2EIK B;  1JQ0 A;  4TOI A;  3VOU A;  5IJ9 A;  2EIM C;  1IDS A;  3STL C;  1YVW A;  2FML A;  3CE2 A;  3AG4 C;  3CCR V;  5CA0 A;  3TXQ A;  2HVK C;  3DXR A;  4LH6 A;  4OGQ B;  1M93 A;  4O2A B;  2P4V A;  1XOU A;  1QLE B;  2KQX A;  3ASN B;  4EEQ A;  4K3A A;  3W7X A;  4Q20 A;  4DR1 O;  2JS3 A;  3CS5 A;  2D2C B;  1NH2 B;  4ZBM A;  5GON A;  1Y76 B;  2YDE A;  4GX5 A;  5H6Q A;  2UUC O;  1GK9 A;  2HR3 A;  4GZR B;  2WA3 A;  1NS1 A;  2YS8 A;  1I94 O;  5GTH Z;  2QM4 A;  2Q68 A;  3X2Q B;  3CYO A;  1H8E G;  3GVM A;  3ML0 A;  3ZS8 C;  2QWQ B;  4CS2 A;  4XDL A;  2E5L B;  3F7V C;  1RM1 B;  4X65 B;  1QVF U;  2KG7 B;  3WB1 A;  4KXR A;  3HKD A;  4PEL A;  1Z5V A;  3WG7 C;  1SER A;  4DR5 O;  2DJV A;  5D5P A;  2B9Z A;  1YIJ V;  1RSO B;  1TUE B;  4X1Y A;  4LF7 O;  1G8M A;  3NXS A;  4LFA O;  3E83 A;  3J7A U;  4IIJ B;  4JI8 O;  4YY3 B;  1FJG O;  2YI8 A;  4QJF B;  3JAT B;  2Q0O C;  1GN2 A;  3OUF A;  4TUY A;  4J7J A;  1QR8 A;  4I50 A;  1MNG A;  2YEV A;  2RNB A;  3ETE A;  4DR7 O;  5BXZ A;  2ZR3 A;  4OX9 B;  1EN4 A;  5JWP A;  1GN4 A;  3C90 A;  2IW5 A;  2Q4P A;  5LXT A;  1N8R W;  4DR2 B;  1XI1 A;  3SPC A;  2Z3Y A;  2QR4 A;  4X62 O;  2DOS A;  3KKY A;  2UUA B;  1V55 C;  4UCU A;  2GTA A;  4DV2 B;  3QVN A;  4P9O A;  2X6C A;  2GUZ B;  3JSL A;  4BIU A;  3OT7 A;  1SZT A;  4U3J A;  4LBE C;  5CN0 A;  1ZAU A;  4GT1 A;  1YJ9 V;  2EUL A;  5EBL C;  1JMK C;  1Z5W A;  1Q90 D;  4KP4 A;  4KUM A;  1YEW A;  4PDR A;  3K0D A;  1KUQ A;  4BWA A;  1WPB A;  1YSC A;  2ZE5 A;  4WFG A;  3RT3 C;  2EIN B;  2L35 A;  2DYS C;  4LFC B;  1Y74 B;  1ZUQ A;  4Z2W A;  4LCU C;  4EKW A;  5FNV A;  1K73 W;  2Z5U A;  4JAS A;  1NH2 D;  2E75 B;  5GTI Z;  5B5E Z;  3RYF A;  2UXX A;  4JZG A;  4WCE V;  4RUE A;  4P30 A;  4BIO A;  1ZSP A;  2LQT A;  3LNN A;  3ABT A;  4DV1 O;  4PA3 A;  1IXB A;  2E5L O;  2EIK C;  3BAA A;  4X65 O;  5IT9 N;  4LF4 O;  4DR3 B;  3T2M A;  5IYD O;  4CH3 A;  5B1O A;  5DN6 G;  1XMO B;  4J9Z B;  3H01 A;  4X64 B;  1DF5 A;  1FFX B;  1R6T A;  2QA4 V;  3BA8 A;  3B2E E;  3JD4 A;  1SA0 A;  3HKC A;  3M99 B;  1ORQ C;  4OPA A;  2JGD A;  3CP1 A;  1W2B U;  4JYA B;  1QLE C;  2ZE6 A;  3K57 A;  1DTO A;  1LUV A;  3TJT A;  3UQ8 A;  1VQ7 V;  4FM1 A;  4RQF A;  2W6I G;  4LWS B;  2QGN A;  4J42 A;  1Y4M A;  2NNU A;  1OCR B;  1P84 F;  3L70 H;  2Q67 A;  4OX9 O;  4GKJ B;  4DR6 B;  3JYC A;  2BTQ A;  1Z2G A;  4I9W A;  5J2T B;  4UCR A;  3Q4H A;  4UCS A;  4FPP A;  3KCX A;  2WSS G;  1Q8I A;  2QKA A;  2QM7 A;  2GSM B;  3CJH B;  4JAV A;  1W0J G;  2KSD A;  3LSS A;  5JVD B;  1FD9 A;  1VF7 A;  4DRX A;  2UUA O;  1K34 A;  4I55 B;  3WB0 A;  1VQ5 V;  1FXK B;  2ZNI A;  5CBH A;  1Q82 W;  5JQG B;  1OCC B;  2XAS A;  1NBM G;  5H5N A;  3HKE A;  1HR0 B;  1UPG A;  3CCJ V;  1PNM A;  3SDL A;  1RM1 C;  4P2Z A;  2OYQ A;  3CCM V;  2ZT9 B;  1I7F A;  2Y48 A;  4J11 A;  4CH6 A;  3QO7 A;  3F5T A;  3OUS A;  3JD1 A;  2QWO B;  3K08 A;  4LFC O;  1GAX A;  2EZO A;  1KQS U;  4MTX A;  4FLY A;  1PL0 A;  2G38 A;  1IBK B;  3I56 V;  4LWS A;  5LYJ A;  5B3S B;  1QCE A;  2IJK A;  2QM8 A;  2PYJ A;  1R73 A;  1NI8 A;  4MW8 A;  1JJ2 U;  5L3B A;  2IBZ H;  3RW0 A;  2ZE7 A;  1N33 B;  4JI7 B;  1Y67 A;  1K8A W;  1VQ8 V;  4CS4 A;  1XMO O;  1HWY A;  3E2E A;  4D7T A;  3FAV A;  2ZDI A;  3RYH B;  3JAM N;  2ILM A;  5EC1 C;  1D5N A;  5JJJ B;  5JH7 B;  4ZHQ A;  3QO5 A;  3CSX A;  3JAL B;  2Q9L A;  3PN1 A;  3IJ4 A;  1XMQ B;  2IU0 A;  1PV0 A;  1WN7 A;  2WWW A;  2RQ6 A;  5ITZ B;  4JYA O;  2V4D A;  3U0Z A;  3CC7 V;  3JAK A;  4X1I B;  3TGU H;  2XAH A;  4NR1 A;  4NTW A;  2JIZ G;  4NYK A;  2KB1 A;  5IJ0 A;  3APO A;  3TCU A;  1Q6I A;  1GH6 A;  2VS0 A;  4DR6 O;  3A0R A;  4FLX A;  5CBG A;  2ODM A;  4ZOL A;  4DV3 O;  1N34 B;  4NXM B;  1VQP V;  1EM1 A;  1Q86 W;  1VQ4 V;  4LP8 A;  3WU2 Z;  2K9P A;  2UXB B;  1K97 A;  1H2K A;  4H13 B;  3JCZ A;  4GKK O;  3JD0 A;  4ZKI A;  1CPY A;  5LL6 Y;  1MSW D;  3FB6 C;  2BSK A;  3ZHQ A;  1HR0 O;  4PA4 A;  5KX5 A;  2E76 B;  2CTR A;  3OTO B;  4I0X B;  4RUF A;  2PI4 A;  2ZCE A;  3A8T A;  4I4T A;  2PGG A;  1GMG A;  2R72 A;  3P3P A;  1HNW B;  1AI7 A;  4JF3 A;  1L0L H;  4JGS A;  3JAR B;  3SJB C;  1AP5 A;  5EK0 A;  2W6J G;  3ZRW A;  1TUB B;  5LOV B;  4I7Z B;  5KA6 A;  1EZJ A;  1YI2 V;  3ICX A;  5FLX N;  4L87 A;  4NXN O;  4O4I A;  1IBK O;  1GRJ A;  4ABM A;  3CCS V;  5FL7 G;  4UB6 Z;  4UVA A;  2LJ2 A;  2ARH A;  3OTF A;  3SJC C;  2W0F C;  3CEI A;  1OCR C;  2Y4T A;  4X20 A;  2WA4 A;  4MVZ A;  2CH7 A;  2VWJ A;  1IBM O;  3RN4 A;  1N33 O;  4JI7 O;  1L1F A;  3CRR A;  1GN6 A;  1R3I C;  4B3S B;  2UXD B;  1P7B A;  2HJD A;  3AG1 B;  3AG3 C;  4J7Z A;  1JOY A;  5IJ9 B;  1QBZ A;  3K04 A;  4IYI A;  1VEW A;  3CRC A;  1NTZ H;  4IHJ A;  4YJ3 B;  3CRM A;  4HYO A;  4DV0 B;  1V55 B;  1OCC C;  1SRY A;  3FD9 A;  2CUG A;  4DUZ O;  3BPZ A;  2ETN A;  5KHJ A;  5CA0 B;  3DXR B;  1SQQ H;  1AB3 A;  2WLN A;  1M4U A;  3EVK A;  4W4K A;  2DMX A;  1IX9 A;  4MVO A;  3CCE V;  1V9P A;  2DQ3 A;  2Y4U A;  4NKG B;  4O4H A;  3D3I A;  1ENV A;  1FFT B;  3VBB A;  2JRI A;  1N34 O;  2H94 A;  4KFM A;  1KKD A;  4DV4 B;  3HKB A;  1VQK V;  2UXB O;  3ZRS A;  4DV6 O;  3DC5 A;  4JI4 B;  3K3W A;  5GON B;  2IH1 C;  2CTW A;  4QPK A;  2FB5 A;  1NR7 A;  3OM3 B;  4TV9 A;  5B3S C;  2CTP A;  3RYI A;  3CCU V;  3THO A;  1UJW B;  2XUM A;  3B8N A;  3FB8 C;  3D3Q A;  3SPI A;  4MTF A;  4WBN A;  4LF5 B;  2K1E A;  2ITD C;  1K7D A;  3TK1 A;  4FLW A;  1QVG U;  2AZ0 A;  1V54 C;  1JVM A;  1ZL8 A;  4YJ3 A;  5IE9 A;  2FL4 A;  4F6E A;  4D7S A;  4F4L A;  2Y69 C;  3T4Z A;  1KP3 A;  1BE3 H;  2KKW A;  3RVZ A;  1AP6 A;  1S3J A;  2HP8 A;  4JI0 B;  1AI4 A;  3F5W C;  3W7T A;  3H1H H;  5H9C A;  3K5M A;  1FAF A;  2QWN B;  2MW2 B;  4J9Y B;  1OV9 A;  1BL8 A;  2DWE C;  3JD2 A;  3VQX A;  1IZ3 A;  3HKD B;  2WLM A;  3AG2 C;  2V1D A;  4DUY B;  5D5Q A;  1NZ6 A;  2X6A A;  2AHY A;  1OCO C;  2ZE8 A;  1QQC A;  4X1Y B;  2ATK C;  1F4M A;  1B04 A;  3K59 A;  1VF6 A;  1FYJ A;  5KA5 A;  2YIB A;  2LFS A;  3QNE A;  3SYQ A;  1WP7 A;  1R1B A;  4YHH B;  4I5S A;  4B3S O;  4TUY B;  2F1M A;  2P06 A;  4I50 B;  1R3L C;  3L75 H;  4MT8 A;  2YEV B;  2NR5 A;  3IFX A;  5LMU O;  1NU1 H;  3G6B A;  5LXT B;  4JI2 B;  5IYZ B;  4MVR A;  2WAM A;  1S5L Z;  1WJZ A;  3ZX6 A;  2DW4 A;  3LSQ A;  4KHP B;  1H2S B;  3CHX A;  2OCC B;  4A5U B;  4PV1 B;  4X88 A;  5L3F A;  1XNQ B;  2BCC H;  2BOC C;  3ZHS A;  1BCC H;  4U3F H;  1MA1 A;  5DM6 V;  1U97 A;  3M7M X;  1WB7 A;  4U3J B;  3DGE A;  5LP6 A;  3T1H B;  3K9S A;  3L71 H;  1THZ A;  5CA3 A;  2ZD9 A;  4DV4 O;  3T1Y B;  4AI8 A;  4X89 A;  3B09 A;  2Z0A A;  3O9O A;  4CS3 A;  4JI4 O;  3BCC H;  2A79 B;  2XAQ A;  1K33 A;  4XDK A;  2QSA A;  1FS0 G;  4H44 B;  1S76 D;  5FNV B;  4JI3 B;  4G2K A;  1JCH A;  2Q5Z A;  2YUA A;  2IJI A;  3H1K H;  3RYF B;  1LUW A;  2AXT Z;  2A9H A;  1NTK H;  3RVY A;  4YIP A;  4LF5 O;  1UFI A;  3E8F A;  2HG5 C;  1CXZ B;  2HFE C;  1AJN A;  5IYZ A;  1JR9 A;  1ZTE A;  3OR7 C;  4QE7 A;  4PI2 A;  3AG1 C;  4LNU A;  4H33 A;  1VMG A;  2WPD G;  4JI0 O;  4RO2 A;  4UV8 A;  4E4E A;  1TGO A;  2NLJ C;  1E1R G;  2OIE A;  1Q5O A;  3QO8 A;  4DUY O;  3ZMS A;  1SA0 B;  3HKC B;  3C3T A;  1XL4 A;  4MVS A;  1U96 A;  2JGD B;  5FPR A;  1TVK A;  4LF6 B;  4B7K A;  3CRA A;  1HNZ B;  2AHZ A;  4DV5 B;  2X6B A;  2UXN A;  4YJ2 A;  3OMA B;  5CMU A;  4B08 A;  1WA8 A;  1PNL A;  2LP7 A;  4UXN A;  2BTO A;  4JI2 O;  1J95 A;  2BTQ B;  2YSU B;  4MTO A;  3RYC A;  4R8C A;  1MG1 A;  3Q4H B;  2F4V B;  2B1I A;  2Q7E A;  1KD1 W;  3E22 A;  3L72 H;  2OWO A;  4BW9 A;  2Y0P A;  5EZY A;  3ZED A;  4DRX B;  5B66 Z;  5IDJ A;  4FLU A;  4JI6 B;  1VF5 B;  4MSW C;  3O65 A;  3ZHR A;  4TWK A;  5JJN B;  3HKE B;  3T4D A;  2EBO A;  3VQV A;  2PF4 E;  4G28 B;  1MZF A;  1RFY A;  2ZM6 B;  1MMM A;  4O4L A;  5LP6 C;  1AR5 A;  2M6Y A;  3T1Y O;  4HNA B;  4FIP C;  3P30 A;  2BOB C;  2QTS A;  4OXS A;  3MD0 A;  4JI3 O;  3SYA A;  3N27 A;  2P5O A;  4YY3 O;  4WFF A;  1HDJ A;  5L3G A;  5LYJ B;  5C93 A;  1VQ6 V;  5BR8 B;  1N32 B;  4FM0 A;  1AR1 B;  5B1B B;  2A3Q A;  4PDM A;  4Z1V A;  1NR1 A;  4LR3 A;  3D36 A;  1SQF A;  4DR2 O;  1SQP H;  2UXC B;  1VQN V;  1NTM H;  3AG3 B;  3OGI B;  1B3Q A;  3U10 A;  1Q81 W;  3SGI A;  3FAV B;  4Z1M G;  4DV2 O;  2GV9 A;  2OCC C;  4ZHQ B;  3E8B A;  3K5L A;  5LA6 A;  5LGT A;  2P90 A;  1YXB A;  4QNH B;  3M8A A;  2WLI A;  1GKF A;  1YZB A;  4LF6 O;  4UV9 A;  1LR1 A;  4BW5 A;  4GCZ A;  4O2B A;  4DV5 O;  4BIZ A;  3JAK B;  3UO2 A;  1B06 A;  4CC6 A;  1PKX A;  3ETG A;  4HNA A;  5IJ0 B;  4PD4 F;  2MK3 A;  4K8Z A;  1H2G A;  4G27 B;  1NJI W;  1VP7 A;  3W7W A;  3W7U A;  3HR0 A;  3RBZ A;  3G71 V;  1GN3 A;  3L9D A;  2CAZ C;  2Q0A A;  3H1J H;  4X9Q A;  4AQY B;  1BGY H;  3FX7 A;  2UUB B;  2QKS A;  4ZOL B;  2EIL C;  2F4V O;  5L3D A;  2VWK A;  4GLX A;  1K5S A;  4UB8 Z;  3DC6 A;  3ZN0 A;  4QGP A;  5KHH A;  2BSK B;  2ITC C;  1HW7 A;  4J41 A;  1KMI Z;  4DR3 O;  3JAW A;  5KX5 B;  3OEH G;  1RP3 B;  1A32 A;  1BSM A;  2ZKO A;  2FTK A;  2LW1 A;  3G80 A;  3SYP A;  4X64 O;  1V54 B;  2P22 C;  2HJF C;  4NTY A;  3R65 A;  4I4T B;  2ZM6 O;  3T1C A;  1VAR A;  2Y69 B;  4DYL A;  4RAI A;  5FPO A;  1R6K A;  1I5X A;  3LDE A;  2DYR B;  2JEX A;  1XNR B;  4K0K B;  1XL6 A;  4KL1 A;  4EFB A;  1S5H C;  3AG2 B;  3SYC A;  3ZRW B;  3ZRV A;  1COW G;  4FFB A;  4JTA B;  3ABL B;  1OCO B;  4NTX A;  1N0N A;  4O4I B;  3A2F A;  2B5U A;  3BY6 A;  1PM9 A;  3CX5 F;  1GM9 A;  3K0G A;  5BR8 O;  4TT3 G;  3J80 N;  1N32 O;  3UKM A;  1AJP A;  1S5J A;  4GKJ O;  2Q69 A;  4MVQ A;  1XEQ A;  4X20 B;  5F2V O;  3ASO B;  2CH7 B;  3QF7 A;  3S3X A;  3L74 H;  4PA6 A;  1JA8 A;  1T5E A;  5BY1 A;  3WB2 A;  2PTM A;  3JCU Z;  2ZXW C;  3F7Y C;  4OPH A;  1KB9 F;  4IHJ B;  4H0L B;  5DEC A;  3K5N A;  2DE0 X;  5CA1 A;  5A2Q N;  4O4J A;  1VIB A;  1G1X B;  1BQZ A;  1OHH G;  2QWP B;  1Q6U A;  3H1I H;  4UVC A;  4U7N A;  4ASU G;  3I5D A;  4LF8 B;  2PI5 A;  5JJE B;  2HHH B;  1QLN A;  2GDS A;  3OE7 G;  1J5E B;  1LNQ A;  2N04 A;  4FMT A;  1PD3 A;  4WF9 V;  4MTG A;  4AQY O;  1HNX B;  2Q6A A;  4O4H B;  3CMA V;  4C7U A;  2D3O W;  2CGN A;  4UUJ C;  3HKB B;  2RDC A;  4EB6 B;  1MAB G;  4QIW F;  3SPJ A;  1FKA O;  1CEZ A;  4N21 A;  2JJ1 G;  4TV9 B;  3MHS C;  3CXH F;  1SQB H;  3ZN1 A;  1OJH A;  4DO2 A;  1FXH A;  3RYI B;  1AR4 A;  1QU7 A;  4GX2 A;  5B1B C;  3E86 A;  3A0B Z;  4JTD B;  1HP8 A;  4WFB V;  1CP9 A;  5K1P A;  4WBN B;  1KU9 A;  4Q6G A;  5KUM A;  1L8D A;  3SJA C;  1Q6H A;  4ZI7 A;  4DR1 B;  4YIO A;  3ZJZ A;  2GTS A;  1XMQ O;  4K0K O;  1ZL8 B;  2ZDI C;  4X1K A;  2H8P C;  4ZIB A;  2R70 A;  1GM8 A;  2Y0I A;  2JK5 C;  1E1Q G;  2A7W A;  2OCH A;  3D8C A;  2R9I A;  4GX1 A;  3W7S A;  5H6R A;  5J2U A;  2ZQM A;  3ABK C;  1M90 W;  1PNK A;  1Q3E A;  4R50 A;  1MZE A;  3N2G A;  1F4N A;  1D5A A;  1NVP B;  4PDL A;  3I55 V;  4FLT A;  1M9N A;  1EZV H;  3JAS A;  4U7O A;  1FXV A;  4NXM O;  5KHK A;  4EB6 A;  2EJR A;  3BA9 A;  3UT5 A;  4FLV A;  3BHP A;  5CB4 A;  1K9M W;  2E3C A;  1OZ0 A;  3ZRX A;  2N74 A;  1NT2 B;  3CXC U;  5DED A;  2ZIN A;  4IL6 Z;  3ZMZ A;  5L3E A;  4D6T H;  3ETD A;  2OT5 A;  1WNS A;  5BMV A;  5J9P C;  3H1L H;  4J80 A;  4FZ0 A;  1Q7Y W;  1PP9 H;  3OTO O;  2PZS A;  2ZIM A;  4MS2 A;  2YIA A;  2C2A A;  4JI5 B;  2CDY A;  4TQD A;  3MHH C;  1E79 G;  4LFA B;  1N4C A;  3OGC C;  3ETQ A;  1BZK A;  1HNW O;  4LFB B;  2DWD C;  4JI8 B;  4AIL C;  1N36 B;  3KCY A;  2EIJ C;  1QR9 A;  4LF8 O;  1DLB A;  1JFF A;  2YXH A;  4CBC A;  4BAY A;  4PHZ A;  4FM2 A;  1O9G A;  2N05 A;  3BEH A;  2DYR C;  2ADQ B;  1IXM A;  5LP6 B;  4TQF A;  1MOF A;  2F95 B;  4R7C A;  3CCQ V;  1HNX O;  4GUN A;  2HEP A;  1IUR A;  3B4S A;  3ABL C;  3IC7 A;  2F66 C;  4WFE A;  5KAI Z;  3N2K A;  3J81 N;  2XAG A;  1ARO P;  4X62 B;  4JV5 B;  3OMI B;  5KMG A;  3KZI Z;  5C8Y A;  1X59 A;  1IBL B;  4LH7 A;  4F6R A;  1W0K G;  3G67 A;  3ZHV A;  4PI0 A;  3G6E V;  1SKV A;  1XHX A;  1NQT A;  2UXD O;  3ASO C;  4FFK A;  4QPJ A;  3OFN G;  4JTC B;  1GTO A;  2IU3 A;  5KUK A;  3AK2 A;  3SPH A;  3C3S A;  1JPX A;  4LNU B;  4DV0 O;  3ZHT A;  1G6U A;  1OCZ C;  1M56 B;  5KHI A;  3AK1 A;  2YID A;  1Q43 A;  1XUQ A;  4JI1 B;  4JYB A;  3OW2 U;  2RN9 A;  4TV8 A;  4J7K A;  3BAB A;  4QE9 A;  3MAQ A;  5A9G A;  4UCV A;  5B1A B;  2VRZ A;  2P6J A;  4MVU A;  2E74 B;  5IY5 C;  2LW7 A;  1TVK B;  2XAF A;  4E2L A;  3FFQ A;  3OD4 A;  4H37 A;  4DV1 B;  1WAZ A;  1NVP D;  2IM9 A;  1SF9 A;  1D2D A;  4YJ2 B;  2B1G A;  4GYC B;  4LF4 B;  2RJZ A;  2WLK A;  1P49 A;  1KC8 W;  1BS3 A;  3RFR A;  2YIB D;  1WA8 B;  2EIL B;  3UO3 A;  4CH5 A;  2FYU H;  4O2A A;  3RYC B;  2HLD G;  1ROP A;  1I5Y A;  2QJ1 A;  4IGG A;  1RPO A;  1Y66 A;  1BHA A;  3P3N A;  1WP8 A;  3E22 B;  4JI5 O;  1TAE A;  5LGN A;  3LDD A;  5EZY B;  5KHG A;  1JJO A;  4LFB O;  1KKC A;  5LGU A;  1N36 O;  2M7W A;  2YI9 A;  1US6 A;  5E79 Z;  1KBH A;  1Y76 A;  4DK0 A;  4JPR A;  3HPL C;  2EJ7 A;  1VQL V;  2Q8V A;  3RWR D;  4I9Q A;  4PDV A;  1QHT A;  1FPO A;  4AHC A;  4O4L B;  3AG7 A;  2CK3 G;  1XDC A;  2QKC A;  4J10 A;  2WLL B;  4YXW G;  2DQ0 A;  1SQX H;  1YTF B;  4JV5 O;  4CZZ A;  1EFR G;  2LGW A;  1IBL O;  2VQF B;  3EFF K;  3H9V A;  3SR2 C;  3ABM B;  5EYP B;  4RWU A;  3G4S V;  1QNM A;  3IC9 A;  1EBO A;  4UCO A;  1Y6X A;  1VF6 C;  2VQE B;  4YHH O;  3VQY A;  2KG7 A;  4L8J A;  1ZX3 A;  1ZLZ A;  2YC0 A;  5H2F Z;  5LHI A;  4LC1 A;  5HFM A;  1B6Q A;  3CC4 V;  3IAY A;  3BFR A;  5E1A C;  3E35 A;  3ZBH A;  3CC2 V;  1VQM V;  4ICG A;  2QE7 G;  4PA7 A;  4XDJ A;  4DR4 B;  4KHP O;  4FZ1 A;  1RSO A;  4X8A A;  2ZXW B;  3K9A A;  4JI1 O;  1XNQ O;  2F23 A;  4IIJ A;  3AK3 A;  3BVO A;  2XT9 A;  1K5Q A;  2DN9 A;  3MDS A;  1KEC A;  3E89 A;  3OR6 C;  5LA6 B;  3JAT A;  5KLV H;  1M5I A;  3AEI A;  3JSN A;  3ABU A;  4PA9 A;  2WLI B;  3T1H O;  5B1N A;  2ZR2 A;  1K92 A;  3FYI B;  4O2B B;  2L6L A;  4X66 B;  4W4L A;  2WLL A;  4JAU A;  1BHB A;  3ZMT A;  1AVM A;  2EZP A;  5EC2 C;  5TIS Z;  5IYB O;  5EYP A;  4WFA V;  2JJ2 G;  2GUZ A;  4DK1 A;  1YF2 A;  4XBF A;  5JCO A;  1VQO V;  2JEU A;  1AI6 A;  1H2M A;  1SQG A;  3TXS A;  4HBN A;  2JGU A;  3ZHU A;  1N0J A;  2FKX A;  4CC5 A;  2XTA A;  3ASN C;  3LSU A;  1NKD A;  3JAW B;  5IWA B;  1Y74 A;  1KYO F;  1BQ0 A;  1M56 C;  3JD3 A;  3K79 A;  1H38 A;  4DV3 B;  2AZ2 A;  2X7R B;  2P7T C;  2JDI G;  4B3M B;  1F7Y A;  3RGB A;  2LO1 A;  4CH4 A;  3UM7 A;  3GB7 C;  3ABK B;  3ZMU A;  4GKK B;  2VQF O;  4FFB B;  2CGO A;  1HNZ O;  5B1A C;  3L73 H;  5LMN B;  1SZX A;  1AJQ A;  3X2Q C;  1YTF D;  1SC5 B;  4DV7 B;  2VQE O;  3CB2 A;  1S0V A;  3KG2 A;  3EXA A;  1ZWI C;  2AGA A;  2OTL V;  3UCS C;  3LNM B;  1FFX A;  2IJJ A;  3EHB B;  2UU9 B;  3BRC A;  1YJN V;  1R3K C;  3K06 A;  1BT8 A;  4DR4 O;  3VQW A;  4TSF G;  1K3E A;  4JZ2 A;  3OMN B;  1KP2 A;  1GM7 A;  4JI6 O;  3ZCC A;  2IH3 C;  4MVM A;  1K4D C;  3WFV A;  4NXN B;  1DF4 A;  1H2L A;  1WPX A;  3HB3 B;  4P9P A;  1L0N H;  3CPW U;  5CA1 B;  1YDX A;  2WLH A;  4O4J B;  4IT5 A;  2EIJ B;  4DW1 A;  1PL4 A;  4UVB A;  4X66 O;  4N23 A;  4LF9 B;  1M57 B;  5J2T A;  3PJS K;  2XND G;  2ZIO A;  3B40 A;  1YJW V;  4B7E A;  2YXY A;  3QG5 A;  2P4K A;  1XIL A;  1XHZ A;  1R3J C;  3A0H Z;  2XHB A;  3FB7 C;  1AIL A;  1IBM B;  3CJH A;  2EIM B;  4K8X A;  1JX9 A;  4K35 A;  5JVD A;  2V7Q G;  4I55 A;  1FXK A;  1I0H A;  3AG4 B;  3FYE B;  5JQG A;  1H2N A;  3K58 A;  2CE4 A;  1SET A;  3ABM C;  2R9R B;  4B3R B;  4MW3 A;  2X0L A;  5JCO C;  1GO3 F;  5LBQ A;  4EFE A;  4DUZ B;  2QWR B;  2AW9 A;  4B3T B;  2ZNJ A;  3K03 A;  2UXC O;  1F51 A;  4JYY A;  3ZMV A;  3SJQ C;  2EX3 A;  1EN5 A;  2OIG A;  3D36 C;  1YCI A;  5IWA O;  4HZ3 A;  5HFL A;  1WB8 A;  3DSQ A;  2QEX V;  3R66 A;  3CD6 V;  5GW7 A;  2QDO A;  2EIN C;  5EIB D;  2O57 A;  2PY5 A;  4JYC A;  4ZI7 B;  5IYC O;  1OCZ B;  4NB5 A;  4X1K B;  2GBO A;  4B3M O;  1K4C C;  3SYO A;  4DV6 B; 
#chains in the Genus database with same CATH homology
 1YVW A;  2OIG A;  5IE9 A;  1VMG A;  3CRA A;  2YXH A;  2Q5Z A;  3CRC A;  2Q9L A;  2Q73 A;  2GTA A;  2OIE A;  1Y6X A;  4QGP A;  3C90 A;  2A3Q A;  1YXB A;  2P06 A;  2Q4P A;  2A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...