2Q4PA

Ensemble refinement of the crystal structure of protein from mus musculus mm.29898
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Protein RS21-C6
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q4pA00
1VMGA 2Q9LA 1Y6XA 2A3QA 1YVWA 2P06A 2Q73A 2OIGA 2A7WA 4QGPA 3CRAA 2YXHA 3CRCA 2Q4PA 3C90A 5IE9A 2GTAA 2OIEA 1YXBA 2Q5ZA
chains in the Genus database with same CATH superfamily
1IDSA 5LA6B 3TJTA 4L8JA 4B3TO 5IJ0B 2JS3A 4I4TB 2Q0AA 2DQ3A 4R50A 4DR7B 3OEEG 3RYIB 4MVRA 2IJKA 3OTOB 4MSWC 1R3KC 4WBNA 1O9GA 2UUAB 5LP6A 4JTCB 3S3WA 1XDCA 2YI8A 2Z0AA 3MDSA 3N2KA 4J7KA 4DV1B 3H9VA 1VQ9V 2C2AA 3K06A 3FB5C 2HFEC 3CC7V 1JJOA 4U3FH 4KHPO 2YICA 4OXSA 4X8AA 4GKKB 2XAFA 3ETGA 3ZN0A 4X1IB 4C7UA 5JH7A 3U0ZA 3CD6V 1JQ0A 1K4CC 3FFQA 5IY5C 1WP8A 4UCRA 2PTMA 3QNEA 5EBWC 2PGGA 5B1OA 4X1KA 2OWOA 4IIJA 3OR6C 1AI7A 1MOFA 2ZQMA 5KMGB 1N36O 4I0XA 3ZMTA 1SQPH 3FD9A 3L74H 2YIDA 1XNRO 5IWAO 1W2BU 1RSOA 4LH7A 2HHHO 4JI4B 1VEWA 5DECA 5CB4A 3CYOA 4WFHA 2YUAA 1I08A 1R73A 3F5TA 2JK5C 4DV3O 2CTQA 4NTYA 1K3EA 4JI7B 5BY1A 1X4TA 1FFTB 2HVKC 3D3IA 1HP8A 1XL6A 5LOVB 4FVMA 4PDMA 1NI8A 4D6TH 4JAAA 4BW5A 4JZGA 1QBZA 1YDXA 5EC2C 4RWUA 5KUKA 4DV7O 2PI4A 1XNQB 2EIKB 3AG4B 3HKBA 3T1YO 3RYHB 1OJHA 4X88A 2B1GA 4FFBB 5LMUB 4JZ2A 4DW1A 1K92A 3CCVV 2UXCB 1J95A 4GYCB 4X1YA 5IE9A 3RBZA 2IJIA 3JATA 3KG2A 1BCCH 2QWQB 1JX9A 3CE2A 4JI3B 1NQTA 2Y4TA 3K59A 1Y74B 3SYPA 3TXSA 4EEQA 3T2MA 4UB8Z 3BABA 3RW0A 3APQA 4DYLA 1NTKH 1IBMO 2WLLA 1OCRC 3CS5A 5JQGA 2Q6AA 5C8YB 5CA0B 4RQFA 3B40A 1KECA 3K08A 3D8CA 1VQ8V 1FPOA 1PM9A 3QVNA 1PL0A 1KKDA 1AROP 3AK1A 4X1KB 4CS2A 4FJCC 2IU3A 3CJHA 3HR0A 2JGDB 4JI8O 5FLXN 2UXBO 5BR8B 5IYCO 4I9WA 1PD3A 2YIBA 2DYSB 4FFKA 1K9MW 2IJJA 2F66C 2GTAA 4K8XA 3N2GB 5IDJA 3H1KH 2OIGA 2Q7HA 1PKXA 3R65A 4QNHB 1XMOO 3OE7G 1EZJA 3A8TA 3LSUA 4X65B 4JYAO 4NTXA 1EN5A 2BOBC 2B1IA 2ZM6B 3WB2A 2GDSA 2KG7B 3WG7B 2KKWA 1U96A 2IBZH 1AILA 2GV9A 2IH3C 2WSSG 2WAMA 2QGNA 5A2QN 4B3MB 4IIJB 1OV9A 4J7JA 2IM9A 3LNNA 2XT9A 5LOVA 3E22B 2WA3A 2X6AA 4DR1B 2R9IA 5EZYB 4KL1A 1HNZO 4JI2O 4LF9O 1N33B 1B3QA 1S76D 3WFVA 5JVDB 1N32O 4UXNA 3ZRVA 2DYRC 1VF7A 3ETDA 3JASA 1SESA 1RPRA 1SQVH 1H2LA 2CK3G 1S77D 5E79Z 3ZHRA 3H1LH 4ZI7A 3SYAA 4YJ3B 1B6QA 5K1XA 1EBOA 4TSFG 2EIJB 3CMEV 1YZBA 4PA4A 4DV2O 1I94B 1AJPA 4GX1A 2NN4A 4H0LB 1ZWIC 3K9SA 5IJ0A 2E76B 2B5UA 2O57A 2HLDG 4FMTA 1GH6A 4MVSA 4JYBA 1ZAUA 5LHHA 2OCHA 3E83A 5KUMA 5KHKA 3B2EE 2ZR2A 1MNGA 1UJWB 3C3TA 1FFXA 3ZMSA 4J41A 1F4NA 5CA1B 4O2BB 2QSAA 1I7FA 1H2MA 3BRCA 3CCEV 4R8CA 3K03A 2EIKC 3AG4C 4KP4A 3OW2U 5FPRA 4YIPA 1IVSA 5LHGA 3F7YC 1RP3B 1Y76A 1MZEA 2RNBA 4J11A 3ABMC 1R6KA 3ZHVA 3RYCB 1NR7A 3K0DA 4FLZA 2Y48A 2ZDIA 1FAFA 2ADQB 4CS3A 4CH5A 4DV2B 1I94O 4FLYA 3GWOA 4D7SA 1YJWV 3ZRWA 3IGAC 1DTOA 1I5YA 2Q4PA 3AEIA 1Q6IA 3OUFA 5LGNA 3QF7A 1YHQV 1XMQO 3E89A 3WU2Z 5IYZA 2P67A 3CXHF 1N33O 4JI2B 1HNZB 1K5SA 4O2BA 1AJNA 3QO5A 3CB2A 3DSQA 1LUWA 4UB6Z 5EBMC 4B3MO 3JAKA 4NTWA 1KP2A 4DV0O 1QLEC 1IZ3A 5IY5B 2ZE5A 3ZRSA 3I55V 5L3FA 5L3EA 4WF9V 4H44B 4UUJC 4JPRA 1VQ4V 1YI2V 3ASOB 3K04A 2ZM6O 4YJ3A 2N05A 2QTSA 3T1HB 4NVPA 2GUZA 4X65O 4WFBV 1XILA 3IAYA 1X59A 4PDRA 4ZI7B 3O65A 4RQEA 4U3JB 1WJZA 3CHXA 3G6EV 2GSMB 1AP5A 2QM4A 4U7OA 4B7EA 4DR4O 5H6QA 1K33A 5JCOC 4EB6A 5B1NA 3WB0A 2PY5A 5BR8O 1AI5A 1XQ8A 4R6ZA 5CBGA 4JI8B 2EX3A 1AVMA 1V55B 2ODMA 3CC2V 4ZHQA 5KA6A 4JI5B 1VQ7V 5FNVA 5EC1C 1VMGA 4P9PA 1KP3A 2ATKC 2H3OA 1Z5VA 4F6RA 5KA5A 2CE4A 1HNXO 4CH6A 2JIZG 5J2TB 3VQVA 1ZUQA 3JD1A 2HJDA 1GM8A 1GM9A 2ZD9A 1P7GA 3OUSA 5DM6V 4DR3O 2DWDC 2EULA 2EZOA 3UO2A 1MMMA 4QIWF 3LDEA 1SERA 5L3BA 2XUMA 3BAAA 1SQGA 5E1AC 2ZE7A 2UXCO 4FFBA 1SA0B 5LMUO 4HNAB 4X20B 5JJJB 3CCSV 1IBLB 2DE0X 2UXDB 2LJ2A 2UXXA 1VQPV 2Z5UA 4OGQB 3ABKC 1XNQO 2LO1A 5B66Z 1K97A 2F43G 2PUSA 3E35A 4DR5B 4DV7B 3OAAG 5B1AC 1XOUA 3K5OA 4DUZO 1RM1C 1H2GA 4JTDB 1PP9H 3AG3C 4YIOA 3FAVA 4FK5C 2XNDG 4HNAA 1MG1A 4X20A 1OCZC 1FJGO 3SPIA 4GKJO 1GN6A 1GK9A 3B4SA 4MVQA 1WA8B 4LC1A 4DK1A 4JI7O 1R6NA 1ROPA 1JJ2U 2WLJA 2D2CB 4MW3A 4ZBMA 1BGYH 1YXBA 5C8YA 3VQWA 5CA0A 2VQFB 1XL4A 3CSXA 3CCLV 3BA8A 3M8AA 4WCEV 1FD9A 1S72V 3ZBHA 2Q7GA 2ZDIC 1RFYA 3JARA 3E8BA 3T1CA 3CCRV 4B3RB 1L1FA 1S5HC 1ZSPA 3CRCA 1JCHA 2R70A 4O2AB 1BHBA 1ZL8B 1M56B 3CCQV 3CPWU 3BA9A 3ZN1A 4ABMA 3FAVB 3AG1B 1FXKC 1WP7A 3ZHSA 4BR6A 4BAYA 2VQEO 1NZ6A 2OYQA 3ABUA 1Y76B 1DF5A 2E75B 1J5EB 4JV5O 5CA3A 3J80N 2FKXA 2F95B 2XAGA 2F93B 3T4DA 3MAQA 1V55C 2QEXV 5J9PC 4E4EA 5J2UB 3EHBB 1ENVA 1JOYA 3BEHA 2EILB 2X0LA 4NXNO 4PHZA 5CB4B 1V54C 2PYJA 3VQXA 3ZX6A 2QE7G 4PD4F 1NH2B 2ZIOA 4DV1O 2ARHA 1NBMG 1FS0G 4MTXA 2WWWA 3LSQA 2XTAA 2CGNA 1AI4A 3THOA 4CC6A 3OTOO 2JJ1G 4LF7B 2YEVA 4DRXB 4GUNA 4P30A 1BHAA 4GX5A 2A3QA 5TISZ 2HG5C 4F6RB 1VQ5V 3W7UA 4RUFA 4J9YB 5KX5B 2DQ0A 4WFGA 2ETNA 4LF5O 2UUCB 3DC5A 5KMGA 1M5IA 1Z2GA 2Q8VA 3UQ8A 2QR4A 4DV5B 4O4HB 1M57B 2RJZA 2XAHA 5D5PA 4I55A 1VF5B 1YVWA 3M99B 4KFMA 2R9RB 2XHBA 4AHCA 1EN4A 1XHZA 3JALB 1N4CA 1AJQA 3ZHTA 5JH7B 1QVGU 3KCYA 3JSLA 1KB9F 3L70H 2E74B 3RN4A 3BHPA 3CWBH 2PYLA 5EYPB 2VWKA 3E22A 4O4HA 2QKCA 3RT3C 3SJAC 1XHXA 1HWYA 2OCCB 4HZ3A 3W7WA 3SPGA 5GONA 4X62B 4HYOA 3N27A 3E86A 4GCZA 4LF8O 2A06H 5LP6B 3UO3A 1VF6C 1Q8IA 4Z1VA 4LP8A 4NKGB 3G6BA 4B7KA 3J81N 4I4TA 2K9PA 3ABLC 4OX9B 4I50A 2UUBO 2PF4E 5L3DA 4DV6O 4RO2A 1HR0B 3TCUA 4X66O 1CEZA 4UCTA 4J80A 4LCUC 1WLEA 3QG5A 3PJSK 1G1XB 3GVMA 2F23A 1R3JC 4UFZA 4W4LA 3HKDB 3S3XA 2P7TC 1RM1B 1ORQC 1DLBA 2Q69A 4LH6A 4K0KB 4PA9A 2LW1A 1SQBH 4NYKA 1M93A 2FMLA 5LGUA 3D3QA 4FIPC 2HKOA 1JFFA 2Y4UA 2OTJV 4RAIA 4YHHO 3AK3A 1Y66A 5BZBA 1IURA 2CDYA 2HR3A 5FPOA 3H1JH 1NVPB 3W7TA 1FYJA 3HB3B 1KC8W 1I5XA 3K58A 3JCUZ 5JQGB 1M56C 2W0XA 4H37A 1B04A 5BMVA 5JJNB 1P84F 1M90W 1HNWO 1NKDA 2CH7A 1Y74A 2LW7A 2P5OA 1XEQA 3RGBA 1JPXA 2WLIB 3CRQA 5FL7G 1URFA 5DEDA 2BCCH 4L87A 2LP7A 3GB7C 1WAZA 4B08A 3I5DA 3JAMN 5H2FZ 2EILC 3OMNB 4QE9A 2WPDG 1TGOA 3SDLA 1DK1A 4LF6B 4U7NA 4BW9A 4DR6O 3HKCB 1Q7YW 2EBOA 2Q67A 4AQYB 4FM2A 1AB3A 1L0LH 4LWSB 3FX7A 5IJ9A 3DC6A 1QR8A 2QM7A 1SA0A 2ZNJA 4LFAO 2YIBD 1YCIA 1RPOA 1BE3H 4J42A 1R3IC 1IXMA 2CTPA 4GX0A 4Z1MG 2LFRA 1PNMA 2L6LA 3CP1A 2WLMA 1QCEA 4LFBO 2AGAA 3DTUB 1M57C 5LL6Y 1OCRB 2G38A 1F51A 4ICGA 1Y67A 4GLXA 4I0XB 1CPYA 3BCCH 3P3NA 3OFNG 2PZSA 2LFSA 4N21A 4FLTA 3SGIA 3TETA 3OMAB 4KXRA 1SQQH 3L71H 4CH3A 1SRYA 3FB6C 1UFIA 2Y0PA 3ICXA 4F6EA 4DO2A 2AXTZ 5CBHA 2D3OW 1D2DA 4O4IA 3U11A 4EB6B 4FZ1A 1QNMA 2OIEA 1N0NA 4FM0A 1EN6A 4R7CA 2WLKA 4QPKA 1FXVA 3B77A 4Q20A 4TV9B 3CCUV 1YEWA 4BIZA 3CRRA 3A2FA 4U3JA 3JATB 1JMKC 5EBLC 2W6IG 3HKEB 4JI6O 3ZEDA 5BMVB 4LWSA 2YS8A 2F4VB 3EVKA 4DR6B 3JD2A 4IL6Z 4JYYA 1Q3EA 3HKBB 5LGTA 2WLNA 4FPPA 4ASUG 4LF6O 4TOIA 3FKSG 2JGDA 1KQSU 1BQZA 3IC7A 3ML0A 4BIUA 3CJHB 1KD1W 3NR7A 3DXRA 1Y6XA 1QU7A 2P22C 3QO8A 3ASNC 1N34O 1QLNA 2M6YA 2QKSA 3TGUH 2DN9A 1PNKA 2WLLB 2Y69C 4DUYO 4I50B 1ZX3A 1V54B 1US6A 4UVAA 1Q43A 2A0LA 2HJFC 3JCZA 4LR3A 2EIJC 1TAEA 1TA8A 4N23A 5HFMA 1XBLA 1MSDA 4OPHA 3L9DA 2GTSA 1YTFD 4YHHB 5JJEB 2LGWA 4JYCA 2QKAA 2ITCC 4YY3B 5EK0A 4JI0O 1Q81W 2NR5A 1Q5OA 1K8AW 4PI0A 4DR2O 3ZMUA 3M7MX 2P4VA 4YJ2B 1T5EA 1DGSA 3G71V 2MK3A 3U10A 4HAMA 2QWRB 2ZE6A 1ZLZA 1Q6UA 2HVJC 1GM7A 2EZPA 3BVOA 3FB7C 3G67A 4X66B 1HR0O 3K5LA 4H13B 2BTOA 4TWKA 4RUEA 4EFEA 3UKMA 5LYJA 4OX9O 2A7WA 1OCCC 3X2QB 5A9GA 2E5LO 2JEXA 4BWAA 1VQLV 2YDEA 5LHIA 3W7SA 5KHHA 4DRXA 3VBBA 4MVZA 4UCVA 4ZIBA 1U97A 2ZIMA 1W59A 4PA7A 1KU9A 3E8GA 3APOA 3A0BZ 4JF3A 2YEVB 3JAKB 4G2KA 3K0GA 4IHJA 4PV1B 4LFCO 3ZRXA 3I56V 5JVDA 1CXZB 5B3SC 2P06A 4DV4O 1G4YB 2HEPA 4X1IA 1PL4A 2IH1C 2GBOA 4DV5O 4I55B 3JAWB 4H33A 3F7VC 1GO3F 1JA8A 2JGUA 2V4DA 3EXAA 4HBNA 3AG2B 2UUCO 4LF4O 1I0HA 3ZCCA 3ETEA 4PDLA 2JRIA 1ZL8A 2XOKG 5KX5A 4JGSA 1PV0A 2KG7A 2Y0IA 1MSWD 3KKYA 3LDDA 4JASA 2Q73A 5LMNO 5KLVH 4LF7O 3JARB 5L3CA 4EKWA 2ZINA 3G4SV 2ADPA 4TV8A 4J7ZA 5C93A 3LSSA 1HW7A 2Q5ZA 4Q6GA 4ZOLB 1TUEB 2DJVA 3ABTA 1YJNV 1K4DC 1NTZH 4D7TA 3AG1C 1FXKB 4AI8A 4CZZA 4JI1O 4LNUA 5DN6G 4WFAV 2R9AA 1BSMA 4X1YB 4BIOA 1YTFB 3OMIB 4NXNB 1SS3A 1FFXB 3AK2A 2UXNA 1AI6A 2BE3A 1TUBB 2YXLA 1J5EO 4JV5B 3VQYA 5CMUA 1AP6A 2AW9A 2VQEB 3LDCA 1OZ0A 3DXRB 2YC0A 1IBKO 4CBCA 3A0HZ 3O9OA 1M4UA 1DF4A 1FKAO 4NXMB 1H2KA 2QA4V 4QE7A 1W0JG 1Y4MA 3OT7A 4B3RO 4O4LA 4B3SB 2FYUH 2AHZA 1WNSA 1P4RA 4X64B 2CAZC 4UV9A 2M7WA 4TQFA 2QWPB 2VQFO 3JD3A 4Z2WA 1K34A 1H8HG 1R3LC 4NB5A 1AR4A 2X6BA 4I9QA 5IJ9B 4CS4A 1NS1A 4GKJB 3SYCA 4MVMA 2AHYA 2QWNB 1SZTA 1FJGB 5B1BB 3Q4HB 5B3SB 2ZNIA 3TK1A 5J2TA 3L73H 3P3PA 4DUZB 4FZ0A 4DR5O 1H38A 2CUGA 1KKCA 1IX9A 3SPHA 3FB8C 1R1BA 3BFRA 3CX5F 1OCZB 2EIMC 2UXDO 2BTQA 1IBLO 1LUVA 1Z5WA 5LP6C 1Q82W 1WPBA 2VWJA 4MT8A 1P7BA 4DR3B 4X64O 5ITZB 2VRZA 2Z3YA 4YXWG 2BTQB 4B3SO 3RVZA 3RYIA 4GZRB 4O4IB 3E8HA 1P49A 1QHTA 4PJ0Z 1HNXB 1F4MA 4I5SA 2A9HA 4NXMO 2ZCEA 4JI5O 1JFFB 3EFFK 1IBKB 2JEUA 2AZ0A 3RVYA 2RQ6A 2MW2B 5B1AB 2H8PC 4PELA 4IYHA 3OEHG 1VQKV 2B9ZA 3AG2C 1SF9A 1Q6HA 2OTLV 3JD0A 3BY6A 1BZKA 4DR4B 5GTIZ 1NTMH 2DYSC 5EIBC 1PPJH 4FM1A 3KZIZ 1GTOA 4JI1B 1F23A 1YITV 1O9HA 4MVOA 1JR9A 2FL4A 2QM8A 2YXHA 5D5QA 1K7DA 1NU1H 5LMNB 5IYDO 3T1HO 3HKCA 3WG7C 1VQMV 1E79G 1N0JA 4CH4A 2QWOB 2ZKOA 3H01A 4MTFA 5GONB 5LA6A 2N04A 1TUBA 4LF4B 4DV0B 2RDCA 1SC5B 2FB5A 3DGEA 4DXWA 3SJCC 3B8NA 1FXKA 4I7ZB 4DV4B 2WLIA 3J7AU 2WA4A 1XMQB 1EM1A 5CA1A 1L0NH 4IHJB 4LFCB 3CCMV 1LNQA 3K3WA 3OD4A 4CC5A 5KAFZ 4LNUB 5IYBO 2OT5A 3ABMB 3B8MA 4DW0A 1MABG 1TVKA 3B09A 2H94A 4KUMA 1OCCB 1S3JA 1VIBA 4FLWA 2LQTA 1KYOF 1K73W 3E2EA 1WB7A 2DMXA 2JS5A 5LBQA 5KHGA 4F4LA 3ABLB 1YJ9V 1CP9A 1E1QG 2E5LB 3JAWA 1D5NA 5LYJB 2A79B 4PA3A 2ZXWB 4QPJA 2WLHA 1BL8A 1VARA 1VP7A 3CCJV 4DK0A 4UCOA 1VQ6V 3HKDA 5B1BC 3JASB 3F5WC 4MW8A 1B06A 1R6TA 3SR2C 1A32A 1BMFG 4PDVA 1OCOB 2DW4A 3ZIAG 4DR2B 3PN1A 3P32A 3GWKC 2DWEC 3OGCC 4WBNB 4JI0B 4K8ZA 4YY3O 2NLJC 2Q7EA 2OCCC 3ZS8C 1JVMA 3ASOC 1UPGA 3RFRA 3SYQA 3MD0A 3ZJZA 2LGQA 3SPCA 1XI1A 4K3AA 4QGPA 3NXSA 1AR1B 1VF6A 4TUYB 2DOSA 4O4JA 2V7QG 2EINC 5CBFA 4UVBA 5KHJA 4FLVA 2YXYA 4PI2A 3CC4V 1N32B 2N74A 5ITZA 4DUYB 5EYPA 3TXQA 2E3CA 5J2UA 3G80A 4UVCA 3K9AA 2ITDC 4LF9B 3N2GA 2IW5A 4IYIA 1Q86W 2RMKB 4DR1O 1WA8A 1YF2A 4JTAB 4XBFA 4JAVA 5HFLA 1N34B 3OR7C 3ASNB 1N8RW 2Q9LA 1NVPD 2BOCC 2KQXA 1S5LZ 4AILC 4G27B 1NH2D 4YJ2A 4E2LA 3AG7A 4GT1A 3RYFA 1YIJV 1GRJA 5JWPA 3K57A 5F2VO 2QJ1A 2ZE8A 2NNUA 4FLUA 4O2AA 3T4ZA 3CEIA 1WPXA 4MS2A 1SZXA 2F4VO 4JYAB 4IGGA 1KMIZ 5KHIA 4P2ZA 1COWG 1XMOB 4JI6B 2YI9A 5LXTA 1TVKB 3HPLC 4MTOA 3SJBC 5IT9N 2BSKA 1LR1A 5LXTB 1WB8A 5L3GA 1XUQA 2P6JA 2QDOA 1QQCA 1H2NA 2ZXWC 2F1MA 4J9ZB 3VOUA 3W7XA 1G8MA 4O4LB 2W6JG 2UXBB 3ABKB 2EJRA 5H9CA 2R72A 2HP8A 3K5MA 1M1KW 3UM7A 4JAUA 4ZHQB 4FLXA 4NR1A 4PA6A 4GX2A 1ZTEA 1MZFA 5GTHZ 4XDJA 5H5NA 2IJHA 1M9NA 3L72H 3FYEB 1MA1A 3UCSC 3JYCA 2CGOA 5JCOA 4WFFA 1BT8A 2ILMA 4LFBB 4TV9A 1IBMB 2CTWA 1E1RG 5H6RA 3L75H 3HKEA 3QTCA 1PNLA 5CN0A 1YSCA 2JDIG 1W0KG 3OGIB 1SQXH 2P90A 5AG2A 4JI3O 2YSUB 2W0FC 3STZC 4LFAB 1S0VA 3D36C 1H8EG 4O4JB 2P4KA 3KCXA 4TUYA 1HDJA 3JSNA 1G6UA 3H1HH 2GUZB 2Q0OC 4AQYO 3UT5A 3SPJA 1GN4A 4UCUA 1GKFA 1RSOB 4P9OA 3ZHQA 4K35A 3T1YB 3RYHA 3LNMB 1F7YA 1BQ0A 2XAJA 5B5EZ 1D5AA 5FNVB 2CTRA 1NT2B 1WN7A 3AG3B 4WFEA 3RWRD 3RYFB 3Q4HA 4MTGA 3UT5B 4LBEC 1OCOC 4ZKIA 3MHHC 1SKVA 1OHHG 4TQDA 3C90A 4EFBA 3E8FA 1SETA 1QLEB 1BS3A 2ZR3A 2Q68A 4DV3B 1NR1A 3ZHUA 2RCVA 3ETQA 1V9PA 1Q90D 1HNWB 1K5QA 2EINB 2JJ2G 4XDLA 3IJ4A 4X89A 2L35A 1GAXA 3STLC 3D36A 3N2KB 4UV8A 2HHHB 4JI4O 3CRAA 2RN9A 5IWAB 3FYIB 1XNRB 3MHSC 1EFRG 3QO7A 3IFXA 2KSDA 3CXCU 2QTOA 1N36B 2XASA 3OTFA 4G28B 1L8DA 2EJ7A 1XREA 4XDKA 3CMAV 3JD4A 5KAIZ 4OPAA 4K0KO 3SJQC 2XAQA 2FTKA 1GN3A 4J10A 4X9QA 3ZMVA 2YIAA 2CH7B 1VQNV 4GKKO 4KHPB 1GMGA 1THZA 2DYRB 3CRMA 2BSKB 4QJFB 3ZMZA 2Y69B 4ZOLA 4MVUA 4DV6B 2UUBB 2ZT9B 2X7RB 3R66A 2AZ2A 3SYOA 3IC9A 2UUAO 4TV8B 1FXHA 4TT3G 2VS0A 1VQOV 2KB1A 3X2QC 2K1EA 4DR7O 4A5UB 3RYCA 3ZRWB 2IU0A 3LUTB 2JVDA 3P30A 5EIBD 5BXZA 4B3TB 2GHYA 4LF8B 4X62O 1AR5A 1QR9A 3A0RA 2V1DA 1GN2A 1H2SB 3C3SA 1KUQA 1EZVH 3K5NA 1QVFU 3JALA 2UU9O 3H1IH 5EZYA 2UU9B 2EIMB 5IYZB 1KBHA 3K79A 1IXBA 1NJIW 1SQFA 3OM3B 2PI5A 1S5JA 5GW7A 3WB1A 2X6CA 4IT5A 3BPZA 4UCSA 5K1PA 4W4KA 4LF5B
chains in the Genus database with same CATH topology
1VMGA 2Q9LA 1Y6XA 2A3QA 1YVWA 2P06A 2Q73A 2OIGA 2A7WA 4QGPA 3CRAA 2YXHA 3CRCA 2Q4PA 3C90A 5IE9A 2GTAA 2OIEA 1YXBA 2Q5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMG A;  2Q9L A;  1Y6X A;  2A3Q A;  1YVW A;  2P06 A;  2Q73 A;  2OIG A;  2A7W A;  4QGP A;  3CRA A;  2YXH A;  3CRC A;  2Q4P A;  3C90 A;  5IE9 A;  2GTA A;  2OIE A;  1YXB A;  2Q5Z A; 
#chains in the Genus database with same CATH topology
 1IDS A;  5LA6 B;  3TJT A;  4L8J A;  4B3T O;  5IJ0 B;  2JS3 A;  4I4T B;  2Q0A A;  2DQ3 A;  4R50 A;  4DR7 B;  3OEE G;  3RYI B;  4MVR A;  2IJK A;  3OTO B;  4MSW C;  1R3K C;  4WBN A;  1O9G A;  2UUA B;  5LP6 A;  4JTC B;  3S3W A;  1XDC A;  2YI8 A;  2Z0A A;  3MDS A;  3N2K A;  4J7K A;  4DV1 B;  3H9V A;  1VQ9 V;  2C2A A;  3K06 A;  3FB5 C;  2HFE C;  3CC7 V;  1JJO A;  4U3F H;  4KHP O;  2YIC A;  4OXS A;  4X8A A;  4GKK B;  2XAF A;  3ETG A;  3ZN0 A;  4X1I B;  4C7U A;  5JH7 A;  3U0Z A;  3CD6 V;  1JQ0 A;  1K4C C;  3FFQ A;  5IY5 C;  1WP8 A;  4UCR A;  2PTM A;  3QNE A;  5EBW C;  2PGG A;  5B1O A;  4X1K A;  2OWO A;  4IIJ A;  3OR6 C;  1AI7 A;  1MOF A;  2ZQM A;  5KMG B;  1N36 O;  4I0X A;  3ZMT A;  1SQP H;  3FD9 A;  3L74 H;  2YID A;  1XNR O;  5IWA O;  1W2B U;  1RSO A;  4LH7 A;  2HHH O;  4JI4 B;  1VEW A;  5DEC A;  5CB4 A;  3CYO A;  4WFH A;  2YUA A;  1I08 A;  1R73 A;  3F5T A;  2JK5 C;  4DV3 O;  2CTQ A;  4NTY A;  1K3E A;  4JI7 B;  5BY1 A;  1X4T A;  1FFT B;  2HVK C;  3D3I A;  1HP8 A;  1XL6 A;  5LOV B;  4FVM A;  4PDM A;  1NI8 A;  4D6T H;  4JAA A;  4BW5 A;  4JZG A;  1QBZ A;  1YDX A;  5EC2 C;  4RWU A;  5KUK A;  4DV7 O;  2PI4 A;  1XNQ B;  2EIK B;  3AG4 B;  3HKB A;  3T1Y O;  3RYH B;  1OJH A;  4X88 A;  2B1G A;  4FFB B;  5LMU B;  4JZ2 A;  4DW1 A;  1K92 A;  3CCV V;  2UXC B;  1J95 A;  4GYC B;  4X1Y A;  5IE9 A;  3RBZ A;  2IJI A;  3JAT A;  3KG2 A;  1BCC H;  2QWQ B;  1JX9 A;  3CE2 A;  4JI3 B;  1NQT A;  2Y4T A;  3K59 A;  1Y74 B;  3SYP A;  3TXS A;  4EEQ A;  3T2M A;  4UB8 Z;  3BAB A;  3RW0 A;  3APQ A;  4DYL A;  1NTK H;  1IBM O;  2WLL A;  1OCR C;  3CS5 A;  5JQG A;  2Q6A A;  5C8Y B;  5CA0 B;  4RQF A;  3B40 A;  1KEC A;  3K08 A;  3D8C A;  1VQ8 V;  1FPO A;  1PM9 A;  3QVN A;  1PL0 A;  1KKD A;  1ARO P;  3AK1 A;  4X1K B;  4CS2 A;  4FJC C;  2IU3 A;  3CJH A;  3HR0 A;  2JGD B;  4JI8 O;  5FLX N;  2UXB O;  5BR8 B;  5IYC O;  4I9W A;  1PD3 A;  2YIB A;  2DYS B;  4FFK A;  1K9M W;  2IJJ A;  2F66 C;  2GTA A;  4K8X A;  3N2G B;  5IDJ A;  3H1K H;  2OIG A;  2Q7H A;  1PKX A;  3R65 A;  4QNH B;  1XMO O;  3OE7 G;  1EZJ A;  3A8T A;  3LSU A;  4X65 B;  4JYA O;  4NTX A;  1EN5 A;  2BOB C;  2B1I A;  2ZM6 B;  3WB2 A;  2GDS A;  2KG7 B;  3WG7 B;  2KKW A;  1U96 A;  2IBZ H;  1AIL A;  2GV9 A;  2IH3 C;  2WSS G;  2WAM A;  2QGN A;  5A2Q N;  4B3M B;  4IIJ B;  1OV9 A;  4J7J A;  2IM9 A;  3LNN A;  2XT9 A;  5LOV A;  3E22 B;  2WA3 A;  2X6A A;  4DR1 B;  2R9I A;  5EZY B;  4KL1 A;  1HNZ O;  4JI2 O;  4LF9 O;  1N33 B;  1B3Q A;  1S76 D;  3WFV A;  5JVD B;  1N32 O;  4UXN A;  3ZRV A;  2DYR C;  1VF7 A;  3ETD A;  3JAS A;  1SES A;  1RPR A;  1SQV H;  1H2L A;  2CK3 G;  1S77 D;  5E79 Z;  3ZHR A;  3H1L H;  4ZI7 A;  3SYA A;  4YJ3 B;  1B6Q A;  5K1X A;  1EBO A;  4TSF G;  2EIJ B;  3CME V;  1YZB A;  4PA4 A;  4DV2 O;  1I94 B;  1AJP A;  4GX1 A;  2NN4 A;  4H0L B;  1ZWI C;  3K9S A;  5IJ0 A;  2E76 B;  2B5U A;  2O57 A;  2HLD G;  4FMT A;  1GH6 A;  4MVS A;  4JYB A;  1ZAU A;  5LHH A;  2OCH A;  3E83 A;  5KUM A;  5KHK A;  3B2E E;  2ZR2 A;  1MNG A;  1UJW B;  3C3T A;  1FFX A;  3ZMS A;  4J41 A;  1F4N A;  5CA1 B;  4O2B B;  2QSA A;  1I7F A;  1H2M A;  3BRC A;  3CCE V;  4R8C A;  3K03 A;  2EIK C;  3AG4 C;  4KP4 A;  3OW2 U;  5FPR A;  4YIP A;  1IVS A;  5LHG A;  3F7Y C;  1RP3 B;  1Y76 A;  1MZE A;  2RNB A;  4J11 A;  3ABM C;  1R6K A;  3ZHV A;  3RYC B;  1NR7 A;  3K0D A;  4FLZ A;  2Y48 A;  2ZDI A;  1FAF A;  2ADQ B;  4CS3 A;  4CH5 A;  4DV2 B;  1I94 O;  4FLY A;  3GWO A;  4D7S A;  1YJW V;  3ZRW A;  3IGA C;  1DTO A;  1I5Y A;  2Q4P A;  3AEI A;  1Q6I A;  3OUF A;  5LGN A;  3QF7 A;  1YHQ V;  1XMQ O;  3E89 A;  3WU2 Z;  5IYZ A;  2P67 A;  3CXH F;  1N33 O;  4JI2 B;  1HNZ B;  1K5S A;  4O2B A;  1AJN A;  3QO5 A;  3CB2 A;  3DSQ A;  1LUW A;  4UB6 Z;  5EBM C;  4B3M O;  3JAK A;  4NTW A;  1KP2 A;  4DV0 O;  1QLE C;  1IZ3 A;  5IY5 B;  2ZE5 A;  3ZRS A;  3I55 V;  5L3F A;  5L3E A;  4WF9 V;  4H44 B;  4UUJ C;  4JPR A;  1VQ4 V;  1YI2 V;  3ASO B;  3K04 A;  2ZM6 O;  4YJ3 A;  2N05 A;  2QTS A;  3T1H B;  4NVP A;  2GUZ A;  4X65 O;  4WFB V;  1XIL A;  3IAY A;  1X59 A;  4PDR A;  4ZI7 B;  3O65 A;  4RQE A;  4U3J B;  1WJZ A;  3CHX A;  3G6E V;  2GSM B;  1AP5 A;  2QM4 A;  4U7O A;  4B7E A;  4DR4 O;  5H6Q A;  1K33 A;  5JCO C;  4EB6 A;  5B1N A;  3WB0 A;  2PY5 A;  5BR8 O;  1AI5 A;  1XQ8 A;  4R6Z A;  5CBG A;  4JI8 B;  2EX3 A;  1AVM A;  1V55 B;  2ODM A;  3CC2 V;  4ZHQ A;  5KA6 A;  4JI5 B;  1VQ7 V;  5FNV A;  5EC1 C;  1VMG A;  4P9P A;  1KP3 A;  2ATK C;  2H3O A;  1Z5V A;  4F6R A;  5KA5 A;  2CE4 A;  1HNX O;  4CH6 A;  2JIZ G;  5J2T B;  3VQV A;  1ZUQ A;  3JD1 A;  2HJD A;  1GM8 A;  1GM9 A;  2ZD9 A;  1P7G A;  3OUS A;  5DM6 V;  4DR3 O;  2DWD C;  2EUL A;  2EZO A;  3UO2 A;  1MMM A;  4QIW F;  3LDE A;  1SER A;  5L3B A;  2XUM A;  3BAA A;  1SQG A;  5E1A C;  2ZE7 A;  2UXC O;  4FFB A;  1SA0 B;  5LMU O;  4HNA B;  4X20 B;  5JJJ B;  3CCS V;  1IBL B;  2DE0 X;  2UXD B;  2LJ2 A;  2UXX A;  1VQP V;  2Z5U A;  4OGQ B;  3ABK C;  1XNQ O;  2LO1 A;  5B66 Z;  1K97 A;  2F43 G;  2PUS A;  3E35 A;  4DR5 B;  4DV7 B;  3OAA G;  5B1A C;  1XOU A;  3K5O A;  4DUZ O;  1RM1 C;  1H2G A;  4JTD B;  1PP9 H;  3AG3 C;  4YIO A;  3FAV A;  4FK5 C;  2XND G;  4HNA A;  1MG1 A;  4X20 A;  1OCZ C;  1FJG O;  3SPI A;  4GKJ O;  1GN6 A;  1GK9 A;  3B4S A;  4MVQ A;  1WA8 B;  4LC1 A;  4DK1 A;  4JI7 O;  1R6N A;  1ROP A;  1JJ2 U;  2WLJ A;  2D2C B;  4MW3 A;  4ZBM A;  1BGY H;  1YXB A;  5C8Y A;  3VQW A;  5CA0 A;  2VQF B;  1XL4 A;  3CSX A;  3CCL V;  3BA8 A;  3M8A A;  4WCE V;  1FD9 A;  1S72 V;  3ZBH A;  2Q7G A;  2ZDI C;  1RFY A;  3JAR A;  3E8B A;  3T1C A;  3CCR V;  4B3R B;  1L1F A;  1S5H C;  1ZSP A;  3CRC A;  1JCH A;  2R70 A;  4O2A B;  1BHB A;  1ZL8 B;  1M56 B;  3CCQ V;  3CPW U;  3BA9 A;  3ZN1 A;  4ABM A;  3FAV B;  3AG1 B;  1FXK C;  1WP7 A;  3ZHS A;  4BR6 A;  4BAY A;  2VQE O;  1NZ6 A;  2OYQ A;  3ABU A;  1Y76 B;  1DF5 A;  2E75 B;  1J5E B;  4JV5 O;  5CA3 A;  3J80 N;  2FKX A;  2F95 B;  2XAG A;  2F93 B;  3T4D A;  3MAQ A;  1V55 C;  2QEX V;  5J9P C;  4E4E A;  5J2U B;  3EHB B;  1ENV A;  1JOY A;  3BEH A;  2EIL B;  2X0L A;  4NXN O;  4PHZ A;  5CB4 B;  1V54 C;  2PYJ A;  3VQX A;  3ZX6 A;  2QE7 G;  4PD4 F;  1NH2 B;  2ZIO A;  4DV1 O;  2ARH A;  1NBM G;  1FS0 G;  4MTX A;  2WWW A;  3LSQ A;  2XTA A;  2CGN A;  1AI4 A;  3THO A;  4CC6 A;  3OTO O;  2JJ1 G;  4LF7 B;  2YEV A;  4DRX B;  4GUN A;  4P30 A;  1BHA A;  4GX5 A;  2A3Q A;  5TIS Z;  2HG5 C;  4F6R B;  1VQ5 V;  3W7U A;  4RUF A;  4J9Y B;  5KX5 B;  2DQ0 A;  4WFG A;  2ETN A;  4LF5 O;  2UUC B;  3DC5 A;  5KMG A;  1M5I A;  1Z2G A;  2Q8V A;  3UQ8 A;  2QR4 A;  4DV5 B;  4O4H B;  1M57 B;  2RJZ A;  2XAH A;  5D5P A;  4I55 A;  1VF5 B;  1YVW A;  3M99 B;  4KFM A;  2R9R B;  2XHB A;  4AHC A;  1EN4 A;  1XHZ A;  3JAL B;  1N4C A;  1AJQ A;  3ZHT A;  5JH7 B;  1QVG U;  3KCY A;  3JSL A;  1KB9 F;  3L70 H;  2E74 B;  3RN4 A;  3BHP A;  3CWB H;  2PYL A;  5EYP B;  2VWK A;  3E22 A;  4O4H A;  2QKC A;  3RT3 C;  3SJA C;  1XHX A;  1HWY A;  2OCC B;  4HZ3 A;  3W7W A;  3SPG A;  5GON A;  4X62 B;  4HYO A;  3N27 A;  3E86 A;  4GCZ A;  4LF8 O;  2A06 H;  5LP6 B;  3UO3 A;  1VF6 C;  1Q8I A;  4Z1V A;  4LP8 A;  4NKG B;  3G6B A;  4B7K A;  3J81 N;  4I4T A;  2K9P A;  3ABL C;  4OX9 B;  4I50 A;  2UUB O;  2PF4 E;  5L3D A;  4DV6 O;  4RO2 A;  1HR0 B;  3TCU A;  4X66 O;  1CEZ A;  4UCT A;  4J80 A;  4LCU C;  1WLE A;  3QG5 A;  3PJS K;  1G1X B;  3GVM A;  2F23 A;  1R3J C;  4UFZ A;  4W4L A;  3HKD B;  3S3X A;  2P7T C;  1RM1 B;  1ORQ C;  1DLB A;  2Q69 A;  4LH6 A;  4K0K B;  4PA9 A;  2LW1 A;  1SQB H;  4NYK A;  1M93 A;  2FML A;  5LGU A;  3D3Q A;  4FIP C;  2HKO A;  1JFF A;  2Y4U A;  2OTJ V;  4RAI A;  4YHH O;  3AK3 A;  1Y66 A;  5BZB A;  1IUR A;  2CDY A;  2HR3 A;  5FPO A;  3H1J H;  1NVP B;  3W7T A;  1FYJ A;  3HB3 B;  1KC8 W;  1I5X A;  3K58 A;  3JCU Z;  5JQG B;  1M56 C;  2W0X A;  4H37 A;  1B04 A;  5BMV A;  5JJN B;  1P84 F;  1M90 W;  1HNW O;  1NKD A;  2CH7 A;  1Y74 A;  2LW7 A;  2P5O A;  1XEQ A;  3RGB A;  1JPX A;  2WLI B;  3CRQ A;  5FL7 G;  1URF A;  5DED A;  2BCC H;  4L87 A;  2LP7 A;  3GB7 C;  1WAZ A;  4B08 A;  3I5D A;  3JAM N;  5H2F Z;  2EIL C;  3OMN B;  4QE9 A;  2WPD G;  1TGO A;  3SDL A;  1DK1 A;  4LF6 B;  4U7N A;  4BW9 A;  4DR6 O;  3HKC B;  1Q7Y W;  2EBO A;  2Q67 A;  4AQY B;  4FM2 A;  1AB3 A;  1L0L H;  4LWS B;  3FX7 A;  5IJ9 A;  3DC6 A;  1QR8 A;  2QM7 A;  1SA0 A;  2ZNJ A;  4LFA O;  2YIB D;  1YCI A;  1RPO A;  1BE3 H;  4J42 A;  1R3I C;  1IXM A;  2CTP A;  4GX0 A;  4Z1M G;  2LFR A;  1PNM A;  2L6L A;  3CP1 A;  2WLM A;  1QCE A;  4LFB O;  2AGA A;  3DTU B;  1M57 C;  5LL6 Y;  1OCR B;  2G38 A;  1F51 A;  4ICG A;  1Y67 A;  4GLX A;  4I0X B;  1CPY A;  3BCC H;  3P3N A;  3OFN G;  2PZS A;  2LFS A;  4N21 A;  4FLT A;  3SGI A;  3TET A;  3OMA B;  4KXR A;  1SQQ H;  3L71 H;  4CH3 A;  1SRY A;  3FB6 C;  1UFI A;  2Y0P A;  3ICX A;  4F6E A;  4DO2 A;  2AXT Z;  5CBH A;  2D3O W;  1D2D A;  4O4I A;  3U11 A;  4EB6 B;  4FZ1 A;  1QNM A;  2OIE A;  1N0N A;  4FM0 A;  1EN6 A;  4R7C A;  2WLK A;  4QPK A;  1FXV A;  3B77 A;  4Q20 A;  4TV9 B;  3CCU V;  1YEW A;  4BIZ A;  3CRR A;  3A2F A;  4U3J A;  3JAT B;  1JMK C;  5EBL C;  2W6I G;  3HKE B;  4JI6 O;  3ZED A;  5BMV B;  4LWS A;  2YS8 A;  2F4V B;  3EVK A;  4DR6 B;  3JD2 A;  4IL6 Z;  4JYY A;  1Q3E A;  3HKB B;  5LGT A;  2WLN A;  4FPP A;  4ASU G;  4LF6 O;  4TOI A;  3FKS G;  2JGD A;  1KQS U;  1BQZ A;  3IC7 A;  3ML0 A;  4BIU A;  3CJH B;  1KD1 W;  3NR7 A;  3DXR A;  1Y6X A;  1QU7 A;  2P22 C;  3QO8 A;  3ASN C;  1N34 O;  1QLN A;  2M6Y A;  2QKS A;  3TGU H;  2DN9 A;  1PNK A;  2WLL B;  2Y69 C;  4DUY O;  4I50 B;  1ZX3 A;  1V54 B;  1US6 A;  4UVA A;  1Q43 A;  2A0L A;  2HJF C;  3JCZ A;  4LR3 A;  2EIJ C;  1TAE A;  1TA8 A;  4N23 A;  5HFM A;  1XBL A;  1MSD A;  4OPH A;  3L9D A;  2GTS A;  1YTF D;  4YHH B;  5JJE B;  2LGW A;  4JYC A;  2QKA A;  2ITC C;  4YY3 B;  5EK0 A;  4JI0 O;  1Q81 W;  2NR5 A;  1Q5O A;  1K8A W;  4PI0 A;  4DR2 O;  3ZMU A;  3M7M X;  2P4V A;  4YJ2 B;  1T5E A;  1DGS A;  3G71 V;  2MK3 A;  3U10 A;  4HAM A;  2QWR B;  2ZE6 A;  1ZLZ A;  1Q6U A;  2HVJ C;  1GM7 A;  2EZP A;  3BVO A;  3FB7 C;  3G67 A;  4X66 B;  1HR0 O;  3K5L A;  4H13 B;  2BTO A;  4TWK A;  4RUE A;  4EFE A;  3UKM A;  5LYJ A;  4OX9 O;  2A7W A;  1OCC C;  3X2Q B;  5A9G A;  2E5L O;  2JEX A;  4BWA A;  1VQL V;  2YDE A;  5LHI A;  3W7S A;  5KHH A;  4DRX A;  3VBB A;  4MVZ A;  4UCV A;  4ZIB A;  1U97 A;  2ZIM A;  1W59 A;  4PA7 A;  1KU9 A;  3E8G A;  3APO A;  3A0B Z;  4JF3 A;  2YEV B;  3JAK B;  4G2K A;  3K0G A;  4IHJ A;  4PV1 B;  4LFC O;  3ZRX A;  3I56 V;  5JVD A;  1CXZ B;  5B3S C;  2P06 A;  4DV4 O;  1G4Y B;  2HEP A;  4X1I A;  1PL4 A;  2IH1 C;  2GBO A;  4DV5 O;  4I55 B;  3JAW B;  4H33 A;  3F7V C;  1GO3 F;  1JA8 A;  2JGU A;  2V4D A;  3EXA A;  4HBN A;  3AG2 B;  2UUC O;  4LF4 O;  1I0H A;  3ZCC A;  3ETE A;  4PDL A;  2JRI A;  1ZL8 A;  2XOK G;  5KX5 A;  4JGS A;  1PV0 A;  2KG7 A;  2Y0I A;  1MSW D;  3KKY A;  3LDD A;  4JAS A;  2Q73 A;  5LMN O;  5KLV H;  4LF7 O;  3JAR B;  5L3C A;  4EKW A;  2ZIN A;  3G4S V;  2ADP A;  4TV8 A;  4J7Z A;  5C93 A;  3LSS A;  1HW7 A;  2Q5Z A;  4Q6G A;  4ZOL B;  1TUE B;  2DJV A;  3ABT A;  1YJN V;  1K4D C;  1NTZ H;  4D7T A;  3AG1 C;  1FXK B;  4AI8 A;  4CZZ A;  4JI1 O;  4LNU A;  5DN6 G;  4WFA V;  2R9A A;  1BSM A;  4X1Y B;  4BIO A;  1YTF B;  3OMI B;  4NXN B;  1SS3 A;  1FFX B;  3AK2 A;  2UXN A;  1AI6 A;  2BE3 A;  1TUB B;  2YXL A;  1J5E O;  4JV5 B;  3VQY A;  5CMU A;  1AP6 A;  2AW9 A;  2VQE B;  3LDC A;  1OZ0 A;  3DXR B;  2YC0 A;  1IBK O;  4CBC A;  3A0H Z;  3O9O A;  1M4U A;  1DF4 A;  1FKA O;  4NXM B;  1H2K A;  2QA4 V;  4QE7 A;  1W0J G;  1Y4M A;  3OT7 A;  4B3R O;  4O4L A;  4B3S B;  2FYU H;  2AHZ A;  1WNS A;  1P4R A;  4X64 B;  2CAZ C;  4UV9 A;  2M7W A;  4TQF A;  2QWP B;  2VQF O;  3JD3 A;  4Z2W A;  1K34 A;  1H8H G;  1R3L C;  4NB5 A;  1AR4 A;  2X6B A;  4I9Q A;  5IJ9 B;  4CS4 A;  1NS1 A;  4GKJ B;  3SYC A;  4MVM A;  2AHY A;  2QWN B;  1SZT A;  1FJG B;  5B1B B;  3Q4H B;  5B3S B;  2ZNI A;  3TK1 A;  5J2T A;  3L73 H;  3P3P A;  4DUZ B;  4FZ0 A;  4DR5 O;  1H38 A;  2CUG A;  1KKC A;  1IX9 A;  3SPH A;  3FB8 C;  1R1B A;  3BFR A;  3CX5 F;  1OCZ B;  2EIM C;  2UXD O;  2BTQ A;  1IBL O;  1LUV A;  1Z5W A;  5LP6 C;  1Q82 W;  1WPB A;  2VWJ A;  4MT8 A;  1P7B A;  4DR3 B;  4X64 O;  5ITZ B;  2VRZ A;  2Z3Y A;  4YXW G;  2BTQ B;  4B3S O;  3RVZ A;  3RYI A;  4GZR B;  4O4I B;  3E8H A;  1P49 A;  1QHT A;  4PJ0 Z;  1HNX B;  1F4M A;  4I5S A;  2A9H A;  4NXM O;  2ZCE A;  4JI5 O;  1JFF B;  3EFF K;  1IBK B;  2JEU A;  2AZ0 A;  3RVY A;  2RQ6 A;  2MW2 B;  5B1A B;  2H8P C;  4PEL A;  4IYH A;  3OEH G;  1VQK V;  2B9Z A;  3AG2 C;  1SF9 A;  1Q6H A;  2OTL V;  3JD0 A;  3BY6 A;  1BZK A;  4DR4 B;  5GTI Z;  1NTM H;  2DYS C;  5EIB C;  1PPJ H;  4FM1 A;  3KZI Z;  1GTO A;  4JI1 B;  1F23 A;  1YIT V;  1O9H A;  4MVO A;  1JR9 A;  2FL4 A;  2QM8 A;  2YXH A;  5D5Q A;  1K7D A;  1NU1 H;  5LMN B;  5IYD O;  3T1H O;  3HKC A;  3WG7 C;  1VQM V;  1E79 G;  1N0J A;  4CH4 A;  2QWO B;  2ZKO A;  3H01 A;  4MTF A;  5GON B;  5LA6 A;  2N04 A;  1TUB A;  4LF4 B;  4DV0 B;  2RDC A;  1SC5 B;  2FB5 A;  3DGE A;  4DXW A;  3SJC C;  3B8N A;  1FXK A;  4I7Z B;  4DV4 B;  2WLI A;  3J7A U;  2WA4 A;  1XMQ B;  1EM1 A;  5CA1 A;  1L0N H;  4IHJ B;  4LFC B;  3CCM V;  1LNQ A;  3K3W A;  3OD4 A;  4CC5 A;  5KAF Z;  4LNU B;  5IYB O;  2OT5 A;  3ABM B;  3B8M A;  4DW0 A;  1MAB G;  1TVK A;  3B09 A;  2H94 A;  4KUM A;  1OCC B;  1S3J A;  1VIB A;  4FLW A;  2LQT A;  1KYO F;  1K73 W;  3E2E A;  1WB7 A;  2DMX A;  2JS5 A;  5LBQ A;  5KHG A;  4F4L A;  3ABL B;  1YJ9 V;  1CP9 A;  1E1Q G;  2E5L B;  3JAW A;  1D5N A;  5LYJ B;  2A79 B;  4PA3 A;  2ZXW B;  4QPJ A;  2WLH A;  1BL8 A;  1VAR A;  1VP7 A;  3CCJ V;  4DK0 A;  4UCO A;  1VQ6 V;  3HKD A;  5B1B C;  3JAS B;  3F5W C;  4MW8 A;  1B06 A;  1R6T A;  3SR2 C;  1A32 A;  1BMF G;  4PDV A;  1OCO B;  2DW4 A;  3ZIA G;  4DR2 B;  3PN1 A;  3P32 A;  3GWK C;  2DWE C;  3OGC C;  4WBN B;  4JI0 B;  4K8Z A;  4YY3 O;  2NLJ C;  2Q7E A;  2OCC C;  3ZS8 C;  1JVM A;  3ASO C;  1UPG A;  3RFR A;  3SYQ A;  3MD0 A;  3ZJZ A;  2LGQ A;  3SPC A;  1XI1 A;  4K3A A;  4QGP A;  3NXS A;  1AR1 B;  1VF6 A;  4TUY B;  2DOS A;  4O4J A;  2V7Q G;  2EIN C;  5CBF A;  4UVB A;  5KHJ A;  4FLV A;  2YXY A;  4PI2 A;  3CC4 V;  1N32 B;  2N74 A;  5ITZ A;  4DUY B;  5EYP A;  3TXQ A;  2E3C A;  5J2U A;  3G80 A;  4UVC A;  3K9A A;  2ITD C;  4LF9 B;  3N2G A;  2IW5 A;  4IYI A;  1Q86 W;  2RMK B;  4DR1 O;  1WA8 A;  1YF2 A;  4JTA B;  4XBF A;  4JAV A;  5HFL A;  1N34 B;  3OR7 C;  3ASN B;  1N8R W;  2Q9L A;  1NVP D;  2BOC C;  2KQX A;  1S5L Z;  4AIL C;  4G27 B;  1NH2 D;  4YJ2 A;  4E2L A;  3AG7 A;  4GT1 A;  3RYF A;  1YIJ V;  1GRJ A;  5JWP A;  3K57 A;  5F2V O;  2QJ1 A;  2ZE8 A;  2NNU A;  4FLU A;  4O2A A;  3T4Z A;  3CEI A;  1WPX A;  4MS2 A;  1SZX A;  2F4V O;  4JYA B;  4IGG A;  1KMI Z;  5KHI A;  4P2Z A;  1COW G;  1XMO B;  4JI6 B;  2YI9 A;  5LXT A;  1TVK B;  3HPL C;  4MTO A;  3SJB C;  5IT9 N;  2BSK A;  1LR1 A;  5LXT B;  1WB8 A;  5L3G A;  1XUQ A;  2P6J A;  2QDO A;  1QQC A;  1H2N A;  2ZXW C;  2F1M A;  4J9Z B;  3VOU A;  3W7X A;  1G8M A;  4O4L B;  2W6J G;  2UXB B;  3ABK B;  2EJR A;  5H9C A;  2R72 A;  2HP8 A;  3K5M A;  1M1K W;  3UM7 A;  4JAU A;  4ZHQ B;  4FLX A;  4NR1 A;  4PA6 A;  4GX2 A;  1ZTE A;  1MZF A;  5GTH Z;  4XDJ A;  5H5N A;  2IJH A;  1M9N A;  3L72 H;  3FYE B;  1MA1 A;  3UCS C;  3JYC A;  2CGO A;  5JCO A;  4WFF A;  1BT8 A;  2ILM A;  4LFB B;  4TV9 A;  1IBM B;  2CTW A;  1E1R G;  5H6R A;  3L75 H;  3HKE A;  3QTC A;  1PNL A;  5CN0 A;  1YSC A;  2JDI G;  1W0K G;  3OGI B;  1SQX H;  2P90 A;  5AG2 A;  4JI3 O;  2YSU B;  2W0F C;  3STZ C;  4LFA B;  1S0V A;  3D36 C;  1H8E G;  4O4J B;  2P4K A;  3KCX A;  4TUY A;  1HDJ A;  3JSN A;  1G6U A;  3H1H H;  2GUZ B;  2Q0O C;  4AQY O;  3UT5 A;  3SPJ A;  1GN4 A;  4UCU A;  1GKF A;  1RSO B;  4P9O A;  3ZHQ A;  4K35 A;  3T1Y B;  3RYH A;  3LNM B;  1F7Y A;  1BQ0 A;  2XAJ A;  5B5E Z;  1D5A A;  5FNV B;  2CTR A;  1NT2 B;  1WN7 A;  3AG3 B;  4WFE A;  3RWR D;  3RYF B;  3Q4H A;  4MTG A;  3UT5 B;  4LBE C;  1OCO C;  4ZKI A;  3MHH C;  1SKV A;  1OHH G;  4TQD A;  3C90 A;  4EFB A;  3E8F A;  1SET A;  1QLE B;  1BS3 A;  2ZR3 A;  2Q68 A;  4DV3 B;  1NR1 A;  3ZHU A;  2RCV A;  3ETQ A;  1V9P A;  1Q90 D;  1HNW B;  1K5Q A;  2EIN B;  2JJ2 G;  4XDL A;  3IJ4 A;  4X89 A;  2L35 A;  1GAX A;  3STL C;  3D36 A;  3N2K B;  4UV8 A;  2HHH B;  4JI4 O;  3CRA A;  2RN9 A;  5IWA B;  3FYI B;  1XNR B;  3MHS C;  1EFR G;  3QO7 A;  3IFX A;  2KSD A;  3CXC U;  2QTO A;  1N36 B;  2XAS A;  3OTF A;  4G28 B;  1L8D A;  2EJ7 A;  1XRE A;  4XDK A;  3CMA V;  3JD4 A;  5KAI Z;  4OPA A;  4K0K O;  3SJQ C;  2XAQ A;  2FTK A;  1GN3 A;  4J10 A;  4X9Q A;  3ZMV A;  2YIA A;  2CH7 B;  1VQN V;  4GKK O;  4KHP B;  1GMG A;  1THZ A;  2DYR B;  3CRM A;  2BSK B;  4QJF B;  3ZMZ A;  2Y69 B;  4ZOL A;  4MVU A;  4DV6 B;  2UUB B;  2ZT9 B;  2X7R B;  3R66 A;  2AZ2 A;  3SYO A;  3IC9 A;  2UUA O;  4TV8 B;  1FXH A;  4TT3 G;  2VS0 A;  1VQO V;  2KB1 A;  3X2Q C;  2K1E A;  4DR7 O;  4A5U B;  3RYC A;  3ZRW B;  2IU0 A;  3LUT B;  2JVD A;  3P30 A;  5EIB D;  5BXZ A;  4B3T B;  2GHY A;  4LF8 B;  4X62 O;  1AR5 A;  1QR9 A;  3A0R A;  2V1D A;  1GN2 A;  1H2S B;  3C3S A;  1KUQ A;  1EZV H;  3K5N A;  1QVF U;  3JAL A;  2UU9 O;  3H1I H;  5EZY A;  2UU9 B;  2EIM B;  5IYZ B;  1KBH A;  3K79 A;  1IXB A;  1NJI W;  1SQF A;  3OM3 B;  2PI5 A;  1S5J A;  5GW7 A;  3WB1 A;  2X6C A;  4IT5 A;  3BPZ A;  4UCS A;  5K1P A;  4W4K A;  4LF5 B; 
#chains in the Genus database with same CATH homology
 1VMG A;  2Q9L A;  1Y6X A;  2A3Q A;  1YVW A;  2P06 A;  2Q73 A;  2OIG A;  2A7W A;  4QGP A;  3CRA A;  2YXH A;  3CRC A;  2Q4P A;  3C90 A;  5IE9 A;  2GTA A;  2OIE A;  1YXB A;  2Q5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...