2Q4YA

Ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At1g77540
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q4yA00
4IF5A 3S6KA 3BJ7A 4CAXA 4YFJA 1FY7A 3QB8A 1M4IA 1BO4A 1QSNA 4IUSA 2FT0A 4U5YA 4HNWB 4XPDB 4E0AA 4NF1A 3R9FA 1WK4A 2PRBA 5EC4A 1N71A 1Y9WA 1U6MA 3P2FA 1QSRA 1QSOA 4JWPA 4F6AA 3TE4A 2GIVA 4AB7A 4Y49C 3SHPA 4AG7A 3E0KA 3PP9A 2PQ8A 3CXQA 2GANA 5GCNA 5ISVA 2I00A 3T9YA 3I9SA 3SXOA 3FYNA 2B4DA 3DR8A 5JPHA 3B8GA 3TFYA 2HUZA 2JDDA 1MJ9A 4M3SA 2AE6A 3FRMA 1Z4RA 2DXQA 2O28A 1NMTA 2C27A 2Z10A 3EC4A 2GE3A 1PU9A 4AVCA 1S3ZA 5DWMA 1KUXA 4HNYB 3FXTA 4KORA 3EO4A 5CNPA 1IIDA 1SQHA 4U9YA 1I1DA 3JVNA 5HH1A 2ZW5A 1XMTA 4RI1A 2B5GA 2P6GA 2J8MA 5DWNA 3W6SA 3FBUA 4AG9A 2FSRA 2FIAA 2PR1A 2OH1A 4BMHA 1P0HA 2JDCA 2VZYA 4F0YA 4LX9A 1V0CA 4R57A 2H5MA 2ZPAA 4ZBGA 4AVAA 1S7KA 2FCKA 2OZUA 2OU2A 2B3UA 2PC1A 1M4GA 5C88A 4NCZA 4UWJA 1R57A 2PSWA 3FNCA 4RS2A 4PSXA 3S6FA 4YRHA 2HQYA 1YLEA 3FB3A 4OLLA 4MY0A 2QIRA 1RO5A 4J3GA 4E8OA 3VWEA 1KUYA 2CNMA 4CRYB 4Y49B 2G3TA 2Y0MA 2B4DB 3P2HA 1XIXA 2AJ6A 4B5OA 5F48A 5J8FA 4PK3A 5H86A 2P6FA 5F46A 2Q4YA 5F49A 2R1IA 4KUAA 4HNXB 1CJWA 2ZW7A 3D2PA 3KKWA 2WPWA 1YVKA 3QAHA 4KZTA 4KVXA 2BEIA 4I49A 2D4OA 3GY9A 3BJ8A 3IWGA 1IYLA 3EY5A 3LODA 4CAWA 2J8RA 4EVYA 1XE4A 4KVME 4PSWA 2R7HA 2B58A 3C26A 2R98A 3JUWA 3GYAA 2OZHA 4X5KA 1VHSA 1L0CA 1M44A 1QSMA 1KZFA 2QMLA 4K30A 4XNHC 3S6HA 2NMTA 2FE7A 2FS5A 2PR8A 1S7LA 4UA3A 2Q7BA 1QSTA 1BOBA 2ARHA 4CRZB 1OZPA 3DDDA 1I21A 4E2AA 2BSWA 4ONUA 3TOAA 4YGOA 3VWDA 4KOXA 1YK3A 1B6BA 2KCWA 3TT2A 2Z11A 4MI4A 2EVNA 4XPLA 4MJ8A 1YVOA 4QBJA 3G8WA 1YREA 2FL4A 4B5PB 3F5BA 4NSQA 3R1KA 4UWIA 4ORFA 3H4QA 4GS4A 2QECA 2RC4A 2Q0YA 3DNSA 3V8IA 3R96A 1Y7RA 4KOWA 2IL4A 4QB9A 5E96A 1Y9KA 5C82A 4QVTA 1Q2YA 3OWCA 4KOYA 4H89A 1S7NA 1CM0A 3BLNA 3FIXA 3EXNA 2BL1A 1I12A 1RXTA 3T90A 1M4DA 4OAEA 3GKRA 5FVJA 2G3AA 3DSBA 3TCVA 4L8AA 3TO9A 4FD5A 3W6XA 3TOBA 1IB1E 3CXPA 3K9UA 2OZGA 1GHEA 2K5TA 2REEA 4CS0B 4QUSA 2VI7A 2JLMA 1YX0A 1IICA 5IX3A 2R8VA 1Z9UA 2Q4VA 3EFAA 1B87A 1NE9A 3TO6A 4R3KA 5IV0A 2EUIA 2CNTA 2CY2A 2ZW6A 2VZZA 4KVOE 4M85A 1XF8A 4R87A 1KUVA 1MJBA 1TIQA 4JXQA 2ATRA 4H6ZA 3NE7A 1VKCA 4XNHB 2Q04A 3I3GA 3F0AA 1Q2CA 1WWZA 1NSLA 4L89A 2B3VA 4U9ZA 4MHDA 3N7ZA 2PDOA 4QC6A 1YGHA 3G3SA 2G0BA 2OB0A 2B5GB 3DR6A 5IB0A 2VQYA 4XPDC 5H84A 2FXFA 4R3LA 4UBRA 4II9A 3ZZIA 1PUAA 1P4NA 4CAVA 2I79A 4JLYA 5KTDA 4JJXA 3TTHA 4KOVA 2FIWA 4FD4A 3ZJ0A 5I0CA 5KTAA 4KOTA 3R95A 5J8CA 1S60A 3F8KA 1MJAA 2ZW4A 3D2MA 2Q44A 2ZXVA 4KLVA 1Z4EA 3CXSA 2HV2A 2VEZA 1LRZA 4PK2A 1IYKA 5JQ4A 4NEXA 1Q2DA 2D4PA 1J4JA 4JXRA 3R9EA 3PGPA 2P0WA 2VXKA 2WPXA 2VBQA 4KLWA 4MBUA 3LD2A 4KUBA 3TO7A 3WR7A 4KOSA 2B4BA 2CNSA 2REFA 4KOUA 1MK4A 4OADA 1S7FA 5F47A 2BUEA 4NXYA 1YR0A 2JEVA 3W91A 3D3SA 2X7BA 3RYOA 2Z0ZA 4LUAA 4DNCA 1M1DA 1ON0A 4FD6A 4HKFA 3UY5A 1K4JA 5KTCA 3R9GA 4MY3A 4B5PA 1UFHA 4XPKA 4AVBA 4PV6A 4R9MA 3S6GA 5HMNA 3MGDA 2J8NA 4JD6A 4FD7A 3SXNA 3D8PA 1S5KA 2A4NA 3PZJA 1XEBA 2P6EA 3IGRA 4H6UA 5EBVA 2F5IA
chains in the Genus database with same CATH superfamily
1TXRA 4IF5A 1CP6A 3S6KA 3DLJA 5LYLA 2Z3MA 1JQGA 3BJ7A 2PJ3A 4CAXA 4YFJA 4MFKA 1FY7A 2CF4A 4P4JA 3QB8A 1M4IA 1BO4A 4OMEA 5LRJA 1LAMA 4NGQA 3T8WA 4CGOA 1QSNA 3IJ3A 5D29A 1A2ZA 4K3NA 1ARLA 1CBXA 3KHZA 3PEIA 4F9UA 4Q36A 4IUSA 4RN7A 2FT0A 5K8OA 4U5YA 3PB4X 4HNWB 4XPDB 2XEIA 1IU8A 4E0AA 2Z3NA 4NF1A 3R9FA 1WK4A 2PRBA 2BOAA 3PB8X 4B6ZA 6CPAA 3PB6X 1N71A 1Y9WA 1U6MA 3D67A 2PIZA 5EC4A 4KS9A 3P2FA 1QSRA 1QSOA 3JRUA 4JWPA 4F6AA 3H5ZA 3BI0A 4R7MA 3SI1A 2GIVA 1KWMA 2CIJA 2EK9A 3B2YA 1PCAA 3D7HA 4Y49C 4AB7A 3SHPA 5AG4A 4UCNA 4AG7A 3E0KA 3PP9A 2PQ8A 3CXQA 2GANA 4ZX9A 2GREA 5GCNA 4C7HA 2I00A 5ISVA 3T9YA 3I9SA 3SXOA 3FYNA 1AUGA 2B4DA 2ZELA 3DR8A 3FECA 5JPHA 2PJ4A 3PBBA 2V8HA 5AG5A 3B8GA 3D7DA 3TFYA 2HUZA 2JDDA 4A37A 3ISZA 1VIXA 4G1PA 1YLOA 1MJ9A 5K8PA 3KZWA 4M3SA 2BO9A 2DPSA 1YW4A 2ANPA 4C68A 2AE6A 3FRMA 3LACA 4DJLA 2EWBA 2NSMA 2O28A 1Z4RA 2DXQA 1NMTA 2WUUA 3D68A 4OC3A 3RNZA 4CGPA 2C27A 2V8GA 2Z10A 3EC4A 2GE3A 1PU9A 1HDQA 1ARMA 2ZENA 2QVPA 4OC5A 3CPXA 4B14A 4AVCA 4ZY1A 1S3ZA 5DWMA 3KR5A 1KUXA 2Q7SA 1Y7EA 4HNYB 4F0XA 5G20A 1R3NA 1XOVA 3FXTA 3KL9A 4KORA 4MCSA 3EO4A 3IU2A 1IIDA 1SQHA 4HPSA 5CNPA 4A2ZA 3B3WA 3S9MA 4NGSA 1DTDA 4U9YA 3FH4A 4ZI6A 5A27A 1I1DA 3JVNA 5HH1A 2ZW5A 1XMTA 4RI1A 5HVGA 2B5GA 2P6GA 2ZEDA 5LRGA 3IEHA 2ZEEA 2J8MA 5DWNA 3W6SA 3FBUA 3KI9A 4AG9A 1ZLIA 4MRIA 1IOFA 1XBUA 2FSRA 2AFZA 2FIAA 4C7IA 2CTBA 2PR1A 5CBMA 1Y0RA 5JGFA 4W9YA 2OH1A 4BMHA 1P0HA 2JDCA 1BLLE 2VZYA 4M6IA 4F0YA 2ODFA 4LX9A 2PCUA 4R6TA 1Z2LA 4YU9A 3SI0A 4DYOA 2ZEPA 1TKFA 2AFMA 3H8EA 1V0CA 4CYOA 3KR4A 4R57A 2H5MA 2ZPAA 4OC1A 4ZBGA 3BI1A 1S7KA 2FCKA 3KASA 4AVAA 2XEGA 2OZUA 2OU2A 4DUKA 4CAEA 5BWAB 2B3UA 2G9DA 2PC1A 1IY7A 4PQAA 4M6HA 1M4GA 4MHNA 3IC1A 5C88A 4NCZA 3K9TA 4UWJA 2OR4A 1R57A 2YNDA 4NGTA 1FT7A 2F8HA 2PSWA 1QQ9A 2Q51A 3FEEA 3FNCA 2EBJA 4RS2A 2JBJA 3MRUA 4PSXA 4OP4A 4YRHA 2HQYA 3S6FA 4ZX8A 2RB7A 1YLEA 1XJOA 3FB3A 4Q38A 4OLLA 2PE3A 4MCQA 5JH9A 4LQGA 2IQ6A 4MY0A 4P4FA 2PJ0A 2QIRA 3PFOA 1RO5A 4GM5A 4J3GA 4E8OA 2IJZA 4CGNA 3NH5A 3VWEA 1FNOA 5HVFA 2C6GA 4OC2A 4PXDA 1KUYA 2YGWA 2OOTA 2CNMA 3N5FA 2PRQA 4CRYB 3WC6A 2GLJA 4R8FA 5JM6A 4Y49B 2G3TA 5LYDA 3GB0A 4LQ6A 4C2XA 1X10A 4R76A 5AGEA 2F7VA 4YWYA 1Z8TA 2Y0MA 2B4DB 4KSAA 3P2HA 1XIXA 2AJ6A 4NGMA 4B5OA 5IB9A 4A95A 5F48A 5J8FA 4A32A 4PK3A 5H86A 3PBEA 2P6FA 1TKJA 5F46A 2Q4YA 2CXAA 1CG2A 1NSAA 4UEZA 5F49A 2ABZA 2R1IA 3HUVA 3KQZA 4KUAA 5G21A 4HNXB 1CJWA 4NGRA 1RTQA 4RUHA 2ZW7A 1F57A 4TNUA 2NYQA 1XMBA 3D2PA 5AG6A 3KKWA 2WPWA 1YVKA 3QAHA 2JBKA 4KZTA 3PFEA 4KVXA 4IAVA 2BEIA 1TKHA 2D4OA 4I49A 4MCPA 3GY9A 4ONWA 2PJAA 3BJ8A 3IWGA 1F2PA 2HB6A 2PIYA 1IYLA 4CGLA 3EY5A 4MHZA 4B12A 2ZEMA 3LODA 4CAWA 1JWQA 2J8RA 4EVYA 1XE4A 2C6CA 4KVME 4PSWA 2V8VA 2R7HA 2B58A 3S9LA 3C26A 2R98A 3JUWA 5D8NA 3GYAA 2OZHA 5K8NA 4X5KA 3QNVA 1VHSA 1L0CA 4OIWA 3B3SA 1M44A 1QSMA 1KZFA 2GLFA 2GFQA 2PJ1A 2QMLA 4K30A 3I1UA 2NMTA 4XNHC 3S6HA 2ZOGA 2FE7A 2FS5A 3B35A 2PR8A 1S7LA 3BHXA 4UA3A 2Q7BA 4MFJA 1QSTA 1XFOA 1BOBA 2ARHA 4CRZB 4MHPA 2FVGA 2CTCA 1OZPA 3DDDA 1I21A 3JTKA 2BSWA 2PJ2A 3FX6A 4OC4A 4UCPA 4E2AA 1QMUA 4ONUA 3TOAA 3DGVA 4YGOA 5A28A 3VWDA 3IO1A 4UIBA 4KOXA 1YK3A 1B6BA 2KCWA 4M6GA 2PVVA 2PJCA 1HDUA 1VHEA 5CPAA 1LCPA 3V38A 1Z5RA 1H8LA 4FUUA 1BPMA 3KGQA 4KSFA 3TT2A 2Z11A 2WZNA 3QAYA 4MI4A 2EVNA 1EE3P 1ZO0A 5I4MA 4ZY0A 4XPLA 4MJ8A 1YVOA 4BBHA 1DE4C 5G22A 4QBJA 3G8WA 3WABA 5DS0A 1YREA 2FL4A 2ZEHA 4B5PB 3F5BA 3SI2A 2HC9A 3B3CA 4NSQA 5LYIA 3R1KA 4ZYQA 4ZY2A 4UWIA 1HEEA 4ORFA 4ZGYB 4UEEA 3D66A 3H4QA 4GS4A 2ZEOA 4BD9A 4EWTA 1IGBA 2PJ8A 2QECA 2RC4A 2Q0YA 2JEWA 1ZG8A 3DNSA 4F9VA 3V8IA 3R96A 1Y7RA 4KOWA 3H8FA 2IL4A 4QB9A 5E96A 1Y9KA 1XRYA 5C82A 4QVTA 1Q2YA 3OWCA 1VGYA 4KOYA 4PXCA 2AFSA 4H89A 1S7NA 1CM0A 3HLPA 3BLNA 3FIXA 3EXNA 2QJ8A 2AFXA 4P10A 2PJBA 2BL1A 2PJ6A 4IHMA 4MFPA 1I12A 3SJXA 1RXTA 3T90A 1M4DA 1TF8A 4OAEA 4UFXA 2EK8A 4Q7AA 3SJGA 3GKRA 5FVJA 2G3AA 3NFZA 3DSBA 3TCVA 4A38A 3NH4A 4L8AA 4A39A 1ZG7A 3KHXA 4FAIA 3TE4A 2V77A 3TO9A 4BINA 4FD5A 3W6XA 3TOBA 3FF3A 3B7IA 2AFOA 4P4DA 1IB1E 3CXPA 3K9UA 2OZGA 5HXDA 4JZ0A 1GHEA 2POKA 4CYNA 2PVWA 3PRTA 1Z8XA 2K5TA 3GUXA 2REEA 1CX8A 3IWWA 4TWEA 4A31A 3BXMA 1ELMP 2O53A 4QUSA 4CS0B 4NFRA 2V8DA 2VI7A 4F8ZA 1YQEA 1CPSA 2JLMA 1YX0A 5LRKA 1IICA 2YNCA 5IX3A 2Q4ZA 2R8VA 3B3TA 1Z9UA 2Q4VA 3EFAA 1X12A 2EO8A 3L2NA 4B13A 1B87A 1NE9A 3TO6A 4NGPA 4R3KA 1M4LA 5IV0A 2EUIA 2AFUA 1YW6A 2CNTA 1AYEA 4CAFA 4P4BA 3VATA 3IFEA 4NJQA 2XEFA 2CY2A 2ZW6A 2WYRA 2VZZA 4KVOE 4M85A 1XF8A 2Z3KA 3FMCA 4R87A 4UEFA 4UIAA 2VL1A 1LFWA 2DEAA 2DF5A 3TX8A 1KUVA 1MJBA 1UWYA 3GIUA 3TC8A 2IMOA 4CYPA 1TIQA 4JXQA 3WC7A 2PJ5A 2ATRA 1ZLHA 2Z3LA 4H6ZA 1R43A 4C2ZA 3NE7A 1VKCA 4XNHB 4MFLA 2Q04A 3I3GA 2WSAA 4WJBA 4X3RA 8CPAA 3F0AA 1Q2CA 5ELYA 1WWZA 1NSLA 4L89A 4O23A 4P4IA 4P45A 3RAMA 4FBEA 2B3VA 1CP7A 4CYQA 4U9ZA 2RFHA 2YNEA 1ZG9A 4MHDA 3N7ZA 2PDOA 4QC6A 1YGHA 3H8GA 4MFZA 2XEJA 3V7ZA 3G3SA 4AXVA 4B11A 2G0BA 2OB0A 2B5GB 2ZEGA 3DR6A 3PB9X 2AFWA 3NA6A 1IOIA 4NJRA 5IB0A 1LAPA 2VQYA 4XPDC 1Z8WA 5H84A 2PJ7A 2FXFA 4R3LA 2Z3PA 4MXUA 4UBRA 3SJFA 4MHYA 4II9A 4UCMA 1YSJA 3ZZIA 4A33A 1PUAA 1P4NA 4X8IA 4CAVA 2DPTA 2I79A 2PJ9A 4JLYA 4KSIA 5KTDA 4JJXA 7CPAA 4MFQA 3RO0A 1LOKA 1YMEA 1Y0YA 5THWA 4B10A 3TTHA 4KOVA 2FIWA 3FVLA 4FD4A 3ZJ0A 2Z3OA 4KOTA 3R95A 3RBUA 5I0CA 5J8CA 5KTAA 4H2KA 2Q43A 2I3CA 1S60A 3RZAA 4A30A 3KQXA 3F8KA 1MJAA 2ZW4A 3D2MA 3LWUA 4FWUA 3NE8A 4Z65A 2Q44A 2QYVA 2ZXVA 3NH8A 4KLVA 4MCRA 2C6PA 1Z4EA 4X2TA 3VH9A 5HVHA 3CXSA 3FJUA 4PPZA 4UF4A 3D7FA 2J9AA 4OKOA 5K8MA 2HV2A 2VEZA 1LRZA 4PK2A 1ELLP 1IYKA 5JQ4A 4NEXA 1Q2DA 2D4PA 1J4JA 4WWVA 3FEDA 4JXRA 3R9EA 3IU1A 4CGMA 3PGPA 3B3VA 2P0WA 3IWEA 2VXKA 4PXEA 4GXHA 2WPXA 4P44A 1Z8LA 2O4HA 4UFVA 3MN8A 3K2KA 3PB7X 2VBQA 5AG7A 1BAVA 4KLWA 4MBUA 3D7GA 3LD2A 4CPAA 3A9LA 1BPNA 4KUBA 3D4UA 3TO7A 3WR7A 2ZEFA 2B4BA 4KOSA 2CNSA 1F2OA 2REFA 4KOUA 3ISXA 1MK4A 4PXBA 3VARA 5J1QA 4OADA 1S7FA 4IK2A 4EFDA 4A94A 5F47A 3S9NA 5EMIA 2BUEA 4NXYA 1YR0A 4MMOA 2JEVA 3WC5A 3W91A 4OC0A 3D3SA 2X7BA 3RYOA 2C1CA 2Z0ZA 4LUAA 4DNCA 4EMEA 2BCOA 5F09A 1M1DA 1ON0A 3CT9A 4NGNA 4UFWA 3CZXA 4FD6A 4HKFA 3CPAA 3UY5A 4OIDA 4P4EA 1K4JA 4P6YA 2YNCC 1OBRA 1VHOA 5KTCA 3IIBA 1CPXA 3R9GA 4MY3A 4B5PA 1UFHA 4XPKA 4AVBA 5LYFA 4JYWA 1AMPA 4C2YA 1PYTB 4PV6A 4R9MA 3S6GA 3WT4A 5HMNA 3MGDA 2J8NA 3LMSA 1Q7LA 4JD6A 3CDXA 2GU2A 4FD7A 5G1ZA 3SXNA 1TF9A 1GYTA 3D8PA 2ZOFA 3GLJA 3SJEA 1S5KA 2A4NA 3PZJA 1XEBA 2P6EA 3IGRA 1LANA 4H6UA 5EBVA 2F5IA
chains in the Genus database with same CATH topology
4IF5A 3S6KA 2Z3MA 3BJ7A 4CAXA 4YFJA 4MFKA 1FY7A 3QB8A 1M4IA 1BO4A 4CGOA 1QSNA 4Q36A 4IUSA 2FT0A 4U5YA 4HNWB 4XPDB 4E0AA 2Z3NA 4NF1A 3R9FA 1WK4A 2PRBA 5EC4A 1N71A 1Y9WA 1U6MA 4KS9A 3P2FA 1QSRA 1QSOA 4JWPA 4F6AA 3H5ZA 3TE4A 2GIVA 4AB7A 4Y49C 3SHPA 5AG4A 4UCNA 4AG7A 3E0KA 3PP9A 2PQ8A 3CXQA 2GANA 5GCNA 4C7HA 5ISVA 2I00A 3T9YA 3I9SA 3SXOA 3FYNA 2B4DA 3DR8A 5JPHA 5AG5A 3B8GA 3TFYA 2HUZA 2JDDA 1MJ9A 4M3SA 2DPSA 4C68A 2AE6A 3FRMA 4CGPA 1Z4RA 2DXQA 2O28A 1NMTA 2WUUA 2C27A 2Z10A 3EC4A 2GE3A 1PU9A 4B14A 4AVCA 1S3ZA 5DWMA 1KUXA 4HNYB 4F0XA 5G20A 3FXTA 4KORA 3EO4A 3IU2A 1IIDA 1SQHA 5CNPA 4A2ZA 4U9YA 5A27A 1I1DA 3JVNA 5HH1A 2ZW5A 1XMTA 4RI1A 2B5GA 2P6GA 2J8MA 5DWNA 3W6SA 3FBUA 4AG9A 2FSRA 2FIAA 4C7IA 2PR1A 2OH1A 4BMHA 1P0HA 2JDCA 2VZYA 4F0YA 4LX9A 1V0CA 4CYOA 4R57A 2H5MA 2ZPAA 4ZBGA 4AVAA 1S7KA 2FCKA 2OZUA 2OU2A 4CAEA 5BWAB 2B3UA 2PC1A 1M4GA 5C88A 4NCZA 4UWJA 1R57A 2YNDA 2PSWA 3FNCA 4RS2A 4PSXA 3S6FA 4YRHA 2HQYA 1YLEA 3FB3A 4Q38A 4OLLA 4MY0A 2QIRA 1RO5A 4J3GA 4E8OA 4CGNA 3VWEA 1KUYA 2YGWA 2CNMA 4CRYB 4Y49B 2G3TA 4C2XA 5AGEA 2Y0MA 4KSAA 2B4DB 3P2HA 1XIXA 2AJ6A 4B5OA 4A95A 5F48A 5J8FA 4A32A 4PK3A 5H86A 2P6FA 5F46A 2Q4YA 2CXAA 5F49A 2R1IA 5G21A 4KUAA 4HNXB 1CJWA 2ZW7A 3D2PA 5AG6A 3KKWA 2WPWA 1YVKA 3QAHA 4KZTA 4KVXA 2BEIA 4I49A 2D4OA 3GY9A 3BJ8A 3IWGA 1IYLA 4CGLA 3EY5A 4B12A 3LODA 4CAWA 2J8RA 4EVYA 1XE4A 4KVME 4PSWA 2R7HA 2B58A 3C26A 2R98A 3JUWA 3GYAA 2OZHA 4X5KA 1VHSA 1L0CA 1M44A 1QSMA 1KZFA 2QMLA 4K30A 4XNHC 3S6HA 2NMTA 2FE7A 2FS5A 2PR8A 1S7LA 4UA3A 2Q7BA 4MFJA 1QSTA 1BOBA 2ARHA 4CRZB 1OZPA 3DDDA 1I21A 3JTKA 2BSWA 4E2AA 4UCPA 4ONUA 3TOAA 4YGOA 5A28A 3VWDA 4KOXA 1YK3A 1B6BA 2KCWA 4KSFA 3TT2A 2Z11A 4MI4A 2EVNA 1ZO0A 4XPLA 4MJ8A 1YVOA 4BBHA 5G22A 4QBJA 3G8WA 1YREA 2FL4A 4B5PB 3F5BA 4NSQA 3R1KA 4UWIA 4ORFA 4ZGYB 3H4QA 4GS4A 2QECA 2RC4A 2Q0YA 3DNSA 3V8IA 3R96A 1Y7RA 4KOWA 2IL4A 4QB9A 5E96A 1Y9KA 5C82A 4QVTA 1Q2YA 3OWCA 4KOYA 4H89A 1S7NA 1CM0A 3BLNA 3FIXA 3EXNA 2BL1A 4MFPA 1I12A 1RXTA 3T90A 1M4DA 4UFXA 4OAEA 3GKRA 5FVJA 2G3AA 3DSBA 3TCVA 4L8AA 3TO9A 4FD5A 3W6XA 3TOBA 1IB1E 3CXPA 3K9UA 2OZGA 1GHEA 4CYNA 2K5TA 2REEA 4A31A 4CS0B 4QUSA 2VI7A 2JLMA 1YX0A 1IICA 2YNCA 5IX3A 2R8VA 1Z9UA 2Q4VA 3EFAA 4B13A 1B87A 1NE9A 3TO6A 4R3KA 5IV0A 2EUIA 2CNTA 4CAFA 2CY2A 2ZW6A 2VZZA 4KVOE 4M85A 1XF8A 2Z3KA 4R87A 1KUVA 1MJBA 4CYPA 1TIQA 4JXQA 2ATRA 2Z3LA 4H6ZA 4C2ZA 3NE7A 1VKCA 4XNHB 4MFLA 2Q04A 3I3GA 2WSAA 3F0AA 1Q2CA 1WWZA 1NSLA 4L89A 2B3VA 4CYQA 4U9ZA 2YNEA 4MHDA 3N7ZA 2PDOA 4QC6A 1YGHA 4MFZA 3G3SA 4B11A 2G0BA 2OB0A 2B5GB 3DR6A 5IB0A 2VQYA 4XPDC 5H84A 2FXFA 4R3LA 2Z3PA 4UBRA 4II9A 4UCMA 3ZZIA 4A33A 1PUAA 1P4NA 4CAVA 2DPTA 2I79A 4JLYA 5KTDA 4JJXA 4MFQA 4B10A 3TTHA 4KOVA 2FIWA 4FD4A 3ZJ0A 5I0CA 2Z3OA 4KOTA 3R95A 5J8CA 5KTAA 1S60A 4A30A 3F8KA 1MJAA 2ZW4A 3D2MA 2Q44A 2ZXVA 4KLVA 1Z4EA 3CXSA 2HV2A 2VEZA 1LRZA 4PK2A 1IYKA 5JQ4A 4NEXA 1Q2DA 2D4PA 1J4JA 4JXRA 3R9EA 3IU1A 4CGMA 3PGPA 2P0WA 3IWEA 2VXKA 2WPXA 4UFVA 2VBQA 5AG7A 4KLWA 4MBUA 3LD2A 3A9LA 4KUBA 3TO7A 3WR7A 2B4BA 4KOSA 2CNSA 2REFA 4KOUA 1MK4A 4OADA 1S7FA 5F47A 2BUEA 4NXYA 1YR0A 2JEVA 3W91A 3D3SA 2X7BA 3RYOA 2Z0ZA 4LUAA 4DNCA 1M1DA 1ON0A 4UFWA 4FD6A 4HKFA 3UY5A 1K4JA 2YNCC 5KTCA 3R9GA 4MY3A 4B5PA 1UFHA 4XPKA 4AVBA 4C2YA 4PV6A 4R9MA 3S6GA 5HMNA 3MGDA 2J8NA 4JD6A 4FD7A 5G1ZA 3SXNA 3D8PA 1S5KA 2A4NA 3PZJA 1XEBA 2P6EA 3IGRA 4H6UA 5EBVA 2F5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF5 A;  3S6K A;  3BJ7 A;  4CAX A;  4YFJ A;  1FY7 A;  3QB8 A;  1M4I A;  1BO4 A;  1QSN A;  4IUS A;  2FT0 A;  4U5Y A;  4HNW B;  4XPD B;  4E0A A;  4NF1 A;  3R9F A;  1WK4 A;  2PRB A;  5EC4 A;  1N71 A;  1Y9W A;  1U6M A;  3P2F A;  1QSR A;  1QSO A;  4JWP A;  4F6A A;  3TE4 A;  2GIV A;  4AB7 A;  4Y49 C;  3SHP A;  4AG7 A;  3E0K A;  3PP9 A;  2PQ8 A;  3CXQ A;  2GAN A;  5GCN A;  5ISV A;  2I00 A;  3T9Y A;  3I9S A;  3SXO A;  3FYN A;  2B4D A;  3DR8 A;  5JPH A;  3B8G A;  3TFY A;  2HUZ A;  2JDD A;  1MJ9 A;  4M3S A;  2AE6 A;  3FRM A;  1Z4R A;  2DXQ A;  2O28 A;  1NMT A;  2C27 A;  2Z10 A;  3EC4 A;  2GE3 A;  1PU9 A;  4AVC A;  1S3Z A;  5DWM A;  1KUX A;  4HNY B;  3FXT A;  4KOR A;  3EO4 A;  5CNP A;  1IID A;  1SQH A;  4U9Y A;  1I1D A;  3JVN A;  5HH1 A;  2ZW5 A;  1XMT A;  4RI1 A;  2B5G A;  2P6G A;  2J8M A;  5DWN A;  3W6S A;  3FBU A;  4AG9 A;  2FSR A;  2FIA A;  2PR1 A;  2OH1 A;  4BMH A;  1P0H A;  2JDC A;  2VZY A;  4F0Y A;  4LX9 A;  1V0C A;  4R57 A;  2H5M A;  2ZPA A;  4ZBG A;  4AVA A;  1S7K A;  2FCK A;  2OZU A;  2OU2 A;  2B3U A;  2PC1 A;  1M4G A;  5C88 A;  4NCZ A;  4UWJ A;  1R57 A;  2PSW A;  3FNC A;  4RS2 A;  4PSX A;  3S6F A;  4YRH A;  2HQY A;  1YLE A;  3FB3 A;  4OLL A;  4MY0 A;  2QIR A;  1RO5 A;  4J3G A;  4E8O A;  3VWE A;  1KUY A;  2CNM A;  4CRY B;  4Y49 B;  2G3T A;  2Y0M A;  2B4D B;  3P2H A;  1XIX A;  2AJ6 A;  4B5O A;  5F48 A;  5J8F A;  4PK3 A;  5H86 A;  2P6F A;  5F46 A;  2Q4Y A;  5F49 A;  2R1I A;  4KUA A;  4HNX B;  1CJW A;  2ZW7 A;  3D2P A;  3KKW A;  2WPW A;  1YVK A;  3QAH A;  4KZT A;  4KVX A;  2BEI A;  4I49 A;  2D4O A;  3GY9 A;  3BJ8 A;  3IWG A;  1IYL A;  3EY5 A;  3LOD A;  4CAW A;  2J8R A;  4EVY A;  1XE4 A;  4KVM E;  4PSW A;  2R7H A;  2B58 A;  3C26 A;  2R98 A;  3JUW A;  3GYA A;  2OZH A;  4X5K A;  1VHS A;  1L0C A;  1M44 A;  1QSM A;  1KZF A;  2QML A;  4K30 A;  4XNH C;  3S6H A;  2NMT A;  2FE7 A;  2FS5 A;  2PR8 A;  1S7L A;  4UA3 A;  2Q7B A;  1QST A;  1BOB A;  2ARH A;  4CRZ B;  1OZP A;  3DDD A;  1I21 A;  4E2A A;  2BSW A;  4ONU A;  3TOA A;  4YGO A;  3VWD A;  4KOX A;  1YK3 A;  1B6B A;  2KCW A;  3TT2 A;  2Z11 A;  4MI4 A;  2EVN A;  4XPL A;  4MJ8 A;  1YVO A;  4QBJ A;  3G8W A;  1YRE A;  2FL4 A;  4B5P B;  3F5B A;  4NSQ A;  3R1K A;  4UWI A;  4ORF A;  3H4Q A;  4GS4 A;  2QEC A;  2RC4 A;  2Q0Y A;  3DNS A;  3V8I A;  3R96 A;  1Y7R A;  4KOW A;  2IL4 A;  4QB9 A;  5E96 A;  1Y9K A;  5C82 A;  4QVT A;  1Q2Y A;  3OWC A;  4KOY A;  4H89 A;  1S7N A;  1CM0 A;  3BLN A;  3FIX A;  3EXN A;  2BL1 A;  1I12 A;  1RXT A;  3T90 A;  1M4D A;  4OAE A;  3GKR A;  5FVJ A;  2G3A A;  3DSB A;  3TCV A;  4L8A A;  3TO9 A;  4FD5 A;  3W6X A;  3TOB A;  1IB1 E;  3CXP A;  3K9U A;  2OZG A;  1GHE A;  2K5T A;  2REE A;  4CS0 B;  4QUS A;  2VI7 A;  2JLM A;  1YX0 A;  1IIC A;  5IX3 A;  2R8V A;  1Z9U A;  2Q4V A;  3EFA A;  1B87 A;  1NE9 A;  3TO6 A;  4R3K A;  5IV0 A;  2EUI A;  2CNT A;  2CY2 A;  2ZW6 A;  2VZZ A;  4KVO E;  4M85 A;  1XF8 A;  4R87 A;  1KUV A;  1MJB A;  1TIQ A;  4JXQ A;  2ATR A;  4H6Z A;  3NE7 A;  1VKC A;  4XNH B;  2Q04 A;  3I3G A;  3F0A A;  1Q2C A;  1WWZ A;  1NSL A;  4L89 A;  2B3V A;  4U9Z A;  4MHD A;  3N7Z A;  2PDO A;  4QC6 A;  1YGH A;  3G3S A;  2G0B A;  2OB0 A;  2B5G B;  3DR6 A;  5IB0 A;  2VQY A;  4XPD C;  5H84 A;  2FXF A;  4R3L A;  4UBR A;  4II9 A;  3ZZI A;  1PUA A;  1P4N A;  4CAV A;  2I79 A;  4JLY A;  5KTD A;  4JJX A;  3TTH A;  4KOV A;  2FIW A;  4FD4 A;  3ZJ0 A;  5I0C A;  5KTA A;  4KOT A;  3R95 A;  5J8C A;  1S60 A;  3F8K A;  1MJA A;  2ZW4 A;  3D2M A;  2Q44 A;  2ZXV A;  4KLV A;  1Z4E A;  3CXS A;  2HV2 A;  2VEZ A;  1LRZ A;  4PK2 A;  1IYK A;  5JQ4 A;  4NEX A;  1Q2D A;  2D4P A;  1J4J A;  4JXR A;  3R9E A;  3PGP A;  2P0W A;  2VXK A;  2WPX A;  2VBQ A;  4KLW A;  4MBU A;  3LD2 A;  4KUB A;  3TO7 A;  3WR7 A;  4KOS A;  2B4B A;  2CNS A;  2REF A;  4KOU A;  1MK4 A;  4OAD A;  1S7F A;  5F47 A;  2BUE A;  4NXY A;  1YR0 A;  2JEV A;  3W91 A;  3D3S A;  2X7B A;  3RYO A;  2Z0Z A;  4LUA A;  4DNC A;  1M1D A;  1ON0 A;  4FD6 A;  4HKF A;  3UY5 A;  1K4J A;  5KTC A;  3R9G A;  4MY3 A;  4B5P A;  1UFH A;  4XPK A;  4AVB A;  4PV6 A;  4R9M A;  3S6G A;  5HMN A;  3MGD A;  2J8N A;  4JD6 A;  4FD7 A;  3SXN A;  3D8P A;  1S5K A;  2A4N A;  3PZJ A;  1XEB A;  2P6E A;  3IGR A;  4H6U A;  5EBV A;  2F5I A; 
#chains in the Genus database with same CATH topology
 1TXR A;  4IF5 A;  1CP6 A;  3S6K A;  3DLJ A;  5LYL A;  2Z3M A;  1JQG A;  3BJ7 A;  2PJ3 A;  4CAX A;  4YFJ A;  4MFK A;  1FY7 A;  2CF4 A;  4P4J A;  3QB8 A;  1M4I A;  1BO4 A;  4OME A;  5LRJ A;  1LAM A;  4NGQ A;  3T8W A;  4CGO A;  1QSN A;  3IJ3 A;  5D29 A;  1A2Z A;  4K3N A;  1ARL A;  1CBX A;  3KHZ A;  3PEI A;  4F9U A;  4Q36 A;  4IUS A;  4RN7 A;  2FT0 A;  5K8O A;  4U5Y A;  3PB4 X;  4HNW B;  4XPD B;  2XEI A;  1IU8 A;  4E0A A;  2Z3N A;  4NF1 A;  3R9F A;  1WK4 A;  2PRB A;  2BOA A;  3PB8 X;  4B6Z A;  6CPA A;  3PB6 X;  1N71 A;  1Y9W A;  1U6M A;  3D67 A;  2PIZ A;  5EC4 A;  4KS9 A;  3P2F A;  1QSR A;  1QSO A;  3JRU A;  4JWP A;  4F6A A;  3H5Z A;  3BI0 A;  4R7M A;  3SI1 A;  2GIV A;  1KWM A;  2CIJ A;  2EK9 A;  3B2Y A;  1PCA A;  3D7H A;  4Y49 C;  4AB7 A;  3SHP A;  5AG4 A;  4UCN A;  4AG7 A;  3E0K A;  3PP9 A;  2PQ8 A;  3CXQ A;  2GAN A;  4ZX9 A;  2GRE A;  5GCN A;  4C7H A;  2I00 A;  5ISV A;  3T9Y A;  3I9S A;  3SXO A;  3FYN A;  1AUG A;  2B4D A;  2ZEL A;  3DR8 A;  3FEC A;  5JPH A;  2PJ4 A;  3PBB A;  2V8H A;  5AG5 A;  3B8G A;  3D7D A;  3TFY A;  2HUZ A;  2JDD A;  4A37 A;  3ISZ A;  1VIX A;  4G1P A;  1YLO A;  1MJ9 A;  5K8P A;  3KZW A;  4M3S A;  2BO9 A;  2DPS A;  1YW4 A;  2ANP A;  4C68 A;  2AE6 A;  3FRM A;  3LAC A;  4DJL A;  2EWB A;  2NSM A;  2O28 A;  1Z4R A;  2DXQ A;  1NMT A;  2WUU A;  3D68 A;  4OC3 A;  3RNZ A;  4CGP A;  2C27 A;  2V8G A;  2Z10 A;  3EC4 A;  2GE3 A;  1PU9 A;  1HDQ A;  1ARM A;  2ZEN A;  2QVP A;  4OC5 A;  3CPX A;  4B14 A;  4AVC A;  4ZY1 A;  1S3Z A;  5DWM A;  3KR5 A;  1KUX A;  2Q7S A;  1Y7E A;  4HNY B;  4F0X A;  5G20 A;  1R3N A;  1XOV A;  3FXT A;  3KL9 A;  4KOR A;  4MCS A;  3EO4 A;  3IU2 A;  1IID A;  1SQH A;  4HPS A;  5CNP A;  4A2Z A;  3B3W A;  3S9M A;  4NGS A;  1DTD A;  4U9Y A;  3FH4 A;  4ZI6 A;  5A27 A;  1I1D A;  3JVN A;  5HH1 A;  2ZW5 A;  1XMT A;  4RI1 A;  5HVG A;  2B5G A;  2P6G A;  2ZED A;  5LRG A;  3IEH A;  2ZEE A;  2J8M A;  5DWN A;  3W6S A;  3FBU A;  3KI9 A;  4AG9 A;  1ZLI A;  4MRI A;  1IOF A;  1XBU A;  2FSR A;  2AFZ A;  2FIA A;  4C7I A;  2CTB A;  2PR1 A;  5CBM A;  1Y0R A;  5JGF A;  4W9Y A;  2OH1 A;  4BMH A;  1P0H A;  2JDC A;  1BLL E;  2VZY A;  4M6I A;  4F0Y A;  2ODF A;  4LX9 A;  2PCU A;  4R6T A;  1Z2L A;  4YU9 A;  3SI0 A;  4DYO A;  2ZEP A;  1TKF A;  2AFM A;  3H8E A;  1V0C A;  4CYO A;  3KR4 A;  4R57 A;  2H5M A;  2ZPA A;  4OC1 A;  4ZBG A;  3BI1 A;  1S7K A;  2FCK A;  3KAS A;  4AVA A;  2XEG A;  2OZU A;  2OU2 A;  4DUK A;  4CAE A;  5BWA B;  2B3U A;  2G9D A;  2PC1 A;  1IY7 A;  4PQA A;  4M6H A;  1M4G A;  4MHN A;  3IC1 A;  5C88 A;  4NCZ A;  3K9T A;  4UWJ A;  2OR4 A;  1R57 A;  2YND A;  4NGT A;  1FT7 A;  2F8H A;  2PSW A;  1QQ9 A;  2Q51 A;  3FEE A;  3FNC A;  2EBJ A;  4RS2 A;  2JBJ A;  3MRU A;  4PSX A;  4OP4 A;  4YRH A;  2HQY A;  3S6F A;  4ZX8 A;  2RB7 A;  1YLE A;  1XJO A;  3FB3 A;  4Q38 A;  4OLL A;  2PE3 A;  4MCQ A;  5JH9 A;  4LQG A;  2IQ6 A;  4MY0 A;  4P4F A;  2PJ0 A;  2QIR A;  3PFO A;  1RO5 A;  4GM5 A;  4J3G A;  4E8O A;  2IJZ A;  4CGN A;  3NH5 A;  3VWE A;  1FNO A;  5HVF A;  2C6G A;  4OC2 A;  4PXD A;  1KUY A;  2YGW A;  2OOT A;  2CNM A;  3N5F A;  2PRQ A;  4CRY B;  3WC6 A;  2GLJ A;  4R8F A;  5JM6 A;  4Y49 B;  2G3T A;  5LYD A;  3GB0 A;  4LQ6 A;  4C2X A;  1X10 A;  4R76 A;  5AGE A;  2F7V A;  4YWY A;  1Z8T A;  2Y0M A;  2B4D B;  4KSA A;  3P2H A;  1XIX A;  2AJ6 A;  4NGM A;  4B5O A;  5IB9 A;  4A95 A;  5F48 A;  5J8F A;  4A32 A;  4PK3 A;  5H86 A;  3PBE A;  2P6F A;  1TKJ A;  5F46 A;  2Q4Y A;  2CXA A;  1CG2 A;  1NSA A;  4UEZ A;  5F49 A;  2ABZ A;  2R1I A;  3HUV A;  3KQZ A;  4KUA A;  5G21 A;  4HNX B;  1CJW A;  4NGR A;  1RTQ A;  4RUH A;  2ZW7 A;  1F57 A;  4TNU A;  2NYQ A;  1XMB A;  3D2P A;  5AG6 A;  3KKW A;  2WPW A;  1YVK A;  3QAH A;  2JBK A;  4KZT A;  3PFE A;  4KVX A;  4IAV A;  2BEI A;  1TKH A;  2D4O A;  4I49 A;  4MCP A;  3GY9 A;  4ONW A;  2PJA A;  3BJ8 A;  3IWG A;  1F2P A;  2HB6 A;  2PIY A;  1IYL A;  4CGL A;  3EY5 A;  4MHZ A;  4B12 A;  2ZEM A;  3LOD A;  4CAW A;  1JWQ A;  2J8R A;  4EVY A;  1XE4 A;  2C6C A;  4KVM E;  4PSW A;  2V8V A;  2R7H A;  2B58 A;  3S9L A;  3C26 A;  2R98 A;  3JUW A;  5D8N A;  3GYA A;  2OZH A;  5K8N A;  4X5K A;  3QNV A;  1VHS A;  1L0C A;  4OIW A;  3B3S A;  1M44 A;  1QSM A;  1KZF A;  2GLF A;  2GFQ A;  2PJ1 A;  2QML A;  4K30 A;  3I1U A;  2NMT A;  4XNH C;  3S6H A;  2ZOG A;  2FE7 A;  2FS5 A;  3B35 A;  2PR8 A;  1S7L A;  3BHX A;  4UA3 A;  2Q7B A;  4MFJ A;  1QST A;  1XFO A;  1BOB A;  2ARH A;  4CRZ B;  4MHP A;  2FVG A;  2CTC A;  1OZP A;  3DDD A;  1I21 A;  3JTK A;  2BSW A;  2PJ2 A;  3FX6 A;  4OC4 A;  4UCP A;  4E2A A;  1QMU A;  4ONU A;  3TOA A;  3DGV A;  4YGO A;  5A28 A;  3VWD A;  3IO1 A;  4UIB A;  4KOX A;  1YK3 A;  1B6B A;  2KCW A;  4M6G A;  2PVV A;  2PJC A;  1HDU A;  1VHE A;  5CPA A;  1LCP A;  3V38 A;  1Z5R A;  1H8L A;  4FUU A;  1BPM A;  3KGQ A;  4KSF A;  3TT2 A;  2Z11 A;  2WZN A;  3QAY A;  4MI4 A;  2EVN A;  1EE3 P;  1ZO0 A;  5I4M A;  4ZY0 A;  4XPL A;  4MJ8 A;  1YVO A;  4BBH A;  1DE4 C;  5G22 A;  4QBJ A;  3G8W A;  3WAB A;  5DS0 A;  1YRE A;  2FL4 A;  2ZEH A;  4B5P B;  3F5B A;  3SI2 A;  2HC9 A;  3B3C A;  4NSQ A;  5LYI A;  3R1K A;  4ZYQ A;  4ZY2 A;  4UWI A;  1HEE A;  4ORF A;  4ZGY B;  4UEE A;  3D66 A;  3H4Q A;  4GS4 A;  2ZEO A;  4BD9 A;  4EWT A;  1IGB A;  2PJ8 A;  2QEC A;  2RC4 A;  2Q0Y A;  2JEW A;  1ZG8 A;  3DNS A;  4F9V A;  3V8I A;  3R96 A;  1Y7R A;  4KOW A;  3H8F A;  2IL4 A;  4QB9 A;  5E96 A;  1Y9K A;  1XRY A;  5C82 A;  4QVT A;  1Q2Y A;  3OWC A;  1VGY A;  4KOY A;  4PXC A;  2AFS A;  4H89 A;  1S7N A;  1CM0 A;  3HLP A;  3BLN A;  3FIX A;  3EXN A;  2QJ8 A;  2AFX A;  4P10 A;  2PJB A;  2BL1 A;  2PJ6 A;  4IHM A;  4MFP A;  1I12 A;  3SJX A;  1RXT A;  3T90 A;  1M4D A;  1TF8 A;  4OAE A;  4UFX A;  2EK8 A;  4Q7A A;  3SJG A;  3GKR A;  5FVJ A;  2G3A A;  3NFZ A;  3DSB A;  3TCV A;  4A38 A;  3NH4 A;  4L8A A;  4A39 A;  1ZG7 A;  3KHX A;  4FAI A;  3TE4 A;  2V77 A;  3TO9 A;  4BIN A;  4FD5 A;  3W6X A;  3TOB A;  3FF3 A;  3B7I A;  2AFO A;  4P4D A;  1IB1 E;  3CXP A;  3K9U A;  2OZG A;  5HXD A;  4JZ0 A;  1GHE A;  2POK A;  4CYN A;  2PVW A;  3PRT A;  1Z8X A;  2K5T A;  3GUX A;  2REE A;  1CX8 A;  3IWW A;  4TWE A;  4A31 A;  3BXM A;  1ELM P;  2O53 A;  4QUS A;  4CS0 B;  4NFR A;  2V8D A;  2VI7 A;  4F8Z A;  1YQE A;  1CPS A;  2JLM A;  1YX0 A;  5LRK A;  1IIC A;  2YNC A;  5IX3 A;  2Q4Z A;  2R8V A;  3B3T A;  1Z9U A;  2Q4V A;  3EFA A;  1X12 A;  2EO8 A;  3L2N A;  4B13 A;  1B87 A;  1NE9 A;  3TO6 A;  4NGP A;  4R3K A;  1M4L A;  5IV0 A;  2EUI A;  2AFU A;  1YW6 A;  2CNT A;  1AYE A;  4CAF A;  4P4B A;  3VAT A;  3IFE A;  4NJQ A;  2XEF A;  2CY2 A;  2ZW6 A;  2WYR A;  2VZZ A;  4KVO E;  4M85 A;  1XF8 A;  2Z3K A;  3FMC A;  4R87 A;  4UEF A;  4UIA A;  2VL1 A;  1LFW A;  2DEA A;  2DF5 A;  3TX8 A;  1KUV A;  1MJB A;  1UWY A;  3GIU A;  3TC8 A;  2IMO A;  4CYP A;  1TIQ A;  4JXQ A;  3WC7 A;  2PJ5 A;  2ATR A;  1ZLH A;  2Z3L A;  4H6Z A;  1R43 A;  4C2Z A;  3NE7 A;  1VKC A;  4XNH B;  4MFL A;  2Q04 A;  3I3G A;  2WSA A;  4WJB A;  4X3R A;  8CPA A;  3F0A A;  1Q2C A;  5ELY A;  1WWZ A;  1NSL A;  4L89 A;  4O23 A;  4P4I A;  4P45 A;  3RAM A;  4FBE A;  2B3V A;  1CP7 A;  4CYQ A;  4U9Z A;  2RFH A;  2YNE A;  1ZG9 A;  4MHD A;  3N7Z A;  2PDO A;  4QC6 A;  1YGH A;  3H8G A;  4MFZ A;  2XEJ A;  3V7Z A;  3G3S A;  4AXV A;  4B11 A;  2G0B A;  2OB0 A;  2B5G B;  2ZEG A;  3DR6 A;  3PB9 X;  2AFW A;  3NA6 A;  1IOI A;  4NJR A;  5IB0 A;  1LAP A;  2VQY A;  4XPD C;  1Z8W A;  5H84 A;  2PJ7 A;  2FXF A;  4R3L A;  2Z3P A;  4MXU A;  4UBR A;  3SJF A;  4MHY A;  4II9 A;  4UCM A;  1YSJ A;  3ZZI A;  4A33 A;  1PUA A;  1P4N A;  4X8I A;  4CAV A;  2DPT A;  2I79 A;  2PJ9 A;  4JLY A;  4KSI A;  5KTD A;  4JJX A;  7CPA A;  4MFQ A;  3RO0 A;  1LOK A;  1YME A;  1Y0Y A;  5THW A;  4B10 A;  3TTH A;  4KOV A;  2FIW A;  3FVL A;  4FD4 A;  3ZJ0 A;  2Z3O A;  4KOT A;  3R95 A;  3RBU A;  5I0C A;  5J8C A;  5KTA A;  4H2K A;  2Q43 A;  2I3C A;  1S60 A;  3RZA A;  4A30 A;  3KQX A;  3F8K A;  1MJA A;  2ZW4 A;  3D2M A;  3LWU A;  4FWU A;  3NE8 A;  4Z65 A;  2Q44 A;  2QYV A;  2ZXV A;  3NH8 A;  4KLV A;  4MCR A;  2C6P A;  1Z4E A;  4X2T A;  3VH9 A;  5HVH A;  3CXS A;  3FJU A;  4PPZ A;  4UF4 A;  3D7F A;  2J9A A;  4OKO A;  5K8M A;  2HV2 A;  2VEZ A;  1LRZ A;  4PK2 A;  1ELL P;  1IYK A;  5JQ4 A;  4NEX A;  1Q2D A;  2D4P A;  1J4J A;  4WWV A;  3FED A;  4JXR A;  3R9E A;  3IU1 A;  4CGM A;  3PGP A;  3B3V A;  2P0W A;  3IWE A;  2VXK A;  4PXE A;  4GXH A;  2WPX A;  4P44 A;  1Z8L A;  2O4H A;  4UFV A;  3MN8 A;  3K2K A;  3PB7 X;  2VBQ A;  5AG7 A;  1BAV A;  4KLW A;  4MBU A;  3D7G A;  3LD2 A;  4CPA A;  3A9L A;  1BPN A;  4KUB A;  3D4U A;  3TO7 A;  3WR7 A;  2ZEF A;  2B4B A;  4KOS A;  2CNS A;  1F2O A;  2REF A;  4KOU A;  3ISX A;  1MK4 A;  4PXB A;  3VAR A;  5J1Q A;  4OAD A;  1S7F A;  4IK2 A;  4EFD A;  4A94 A;  5F47 A;  3S9N A;  5EMI A;  2BUE A;  4NXY A;  1YR0 A;  4MMO A;  2JEV A;  3WC5 A;  3W91 A;  4OC0 A;  3D3S A;  2X7B A;  3RYO A;  2C1C A;  2Z0Z A;  4LUA A;  4DNC A;  4EME A;  2BCO A;  5F09 A;  1M1D A;  1ON0 A;  3CT9 A;  4NGN A;  4UFW A;  3CZX A;  4FD6 A;  4HKF A;  3CPA A;  3UY5 A;  4OID A;  4P4E A;  1K4J A;  4P6Y A;  2YNC C;  1OBR A;  1VHO A;  5KTC A;  3IIB A;  1CPX A;  3R9G A;  4MY3 A;  4B5P A;  1UFH A;  4XPK A;  4AVB A;  5LYF A;  4JYW A;  1AMP A;  4C2Y A;  1PYT B;  4PV6 A;  4R9M A;  3S6G A;  3WT4 A;  5HMN A;  3MGD A;  2J8N A;  3LMS A;  1Q7L A;  4JD6 A;  3CDX A;  2GU2 A;  4FD7 A;  5G1Z A;  3SXN A;  1TF9 A;  1GYT A;  3D8P A;  2ZOF A;  3GLJ A;  3SJE A;  1S5K A;  2A4N A;  3PZJ A;  1XEB A;  2P6E A;  3IGR A;  1LAN A;  4H6U A;  5EBV A;  2F5I A; 
#chains in the Genus database with same CATH homology
 4IF5 A;  3S6K A;  2Z3M A;  3BJ7 A;  4CAX A;  4YFJ A;  4MFK A;  1FY7 A;  3QB8 A;  1M4I A;  1BO4 A;  4CGO A;  1QSN A;  4Q36 A;  4IUS A;  2FT0 A;  4U5Y A;  4HNW B;  4XPD B;  4E0A A;  2Z3N A;  4NF1 A;  3R9F A;  1WK4 A;  2PRB A;  5EC4 A;  1N71 A;  1Y9W A;  1U6M A;  4KS9 A;  3P2F A;  1QSR A;  1QSO A;  4JWP A;  4F6A A;  3H5Z A;  3TE4 A;  2GIV A;  4AB7 A;  4Y49 C;  3SHP A;  5AG4 A;  4UCN A;  4AG7 A;  3E0K A;  3PP9 A;  2PQ8 A;  3CXQ A;  2GAN A;  5GCN A;  4C7H A;  5ISV A;  2I00 A;  3T9Y A;  3I9S A;  3SXO A;  3FYN A;  2B4D A;  3DR8 A;  5JPH A;  5AG5 A;  3B8G A;  3TFY A;  2HUZ A;  2JDD A;  1MJ9 A;  4M3S A;  2DPS A;  4C68 A;  2AE6 A;  3FRM A;  4CGP A;  1Z4R A;  2DXQ A;  2O28 A;  1NMT A;  2WUU A;  2C27 A;  2Z10 A;  3EC4 A;  2GE3 A;  1PU9 A;  4B14 A;  4AVC A;  1S3Z A;  5DWM A;  1KUX A;  4HNY B;  4F0X A;  5G20 A;  3FXT A;  4KOR A;  3EO4 A;  3IU2 A;  1IID A;  1SQH A;  5CNP A;  4A2Z A;  4U9Y A;  5A27 A;  1I1D A;  3JVN A;  5HH1 A;  2ZW5 A;  1XMT A;  4RI1 A;  2B5G A;  2P6G A;  2J8M A;  5DWN A;  3W6S A;  3FBU A;  4AG9 A;  2FSR A;  2FIA A;  4C7I A;  2PR1 A;  2OH1 A;  4BMH A;  1P0H A;  2JDC A;  2VZY A;  4F0Y A;  4LX9 A;  1V0C A;  4CYO A;  4R57 A;  2H5M A;  2ZPA A;  4ZBG A;  4AVA A;  1S7K A;  2FCK A;  2OZU A;  2OU2 A;  4CAE A;  5BWA B;  2B3U A;  2PC1 A;  1M4G A;  5C88 A;  4NCZ A;  4UWJ A;  1R57 A;  2YND A;  2PSW A;  3FNC A;  4RS2 A;  4PSX A;  3S6F A;  4YRH A;  2HQY A;  1YLE A;  3FB3 A;  4Q38 A;  4OLL A;  4MY0 A;  2QIR A;  1RO5 A;  4J3G A;  4E8O A;  4CGN A;  3VWE A;  1KUY A;  2YGW A;  2CNM A;  4CRY B;  4Y49 B;  2G3T A;  4C2X A;  5AGE A;  2Y0M A;  4KSA A;  2B4D B;  3P2H A;  1XIX A;  2AJ6 A;  4B5O A;  4A95 A;  5F48 A;  5J8F A;  4A32 A;  4PK3 A;  5H86 A;  2P6F A;  5F46 A;  2Q4Y A;  2CXA A;  5F49 A;  2R1I A;  5G21 A;  4KUA A;  4HNX B;  1CJW A;  2ZW7 A;  3D2P A;  5AG6 A;  3KKW A;  2WPW A;  1YVK A;  3QAH A;  4KZT A;  4KVX A;  2BEI A;  4I49 A;  2D4O A;  3GY9 A;  3BJ8 A;  3IWG A;  1IYL A;  4CGL A;  3EY5 A;  4B12 A;  3LOD A;  4CAW A;  2J8R A;  4EVY A;  1XE4 A;  4KVM E;  4PSW A;  2R7H A;  2B58 A;  3C26 A;  2R98 A;  3JUW A;  3GYA A;  2OZH A;  4X5K A;  1VHS A;  1L0C A;  1M44 A;  1QSM A;  1KZF A;  2QML A;  4K30 A;  4XNH C;  3S6H A;  2NMT A;  2FE7 A;  2FS5 A;  2PR8 A;  1S7L A;  4UA3 A;  2Q7B A;  4MFJ A;  1QST A;  1BOB A;  2ARH A;  4CRZ B;  1OZP A;  3DDD A;  1I21 A;  3JTK A;  2BSW A;  4E2A A;  4UCP A;  4ONU A;  3TOA A;  4YGO A;  5A28 A;  3VWD A;  4KOX A;  1YK3 A;  1B6B A;  2KCW A;  4KSF A;  3TT2 A;  2Z11 A;  4MI4 A;  2EVN A;  1ZO0 A;  4XPL A;  4MJ8 A;  1YVO A;  4BBH A;  5G22 A;  4QBJ A;  3G8W A;  1YRE A;  2FL4 A;  4B5P B;  3F5B A;  4NSQ A;  3R1K A;  4UWI A;  4ORF A;  4ZGY B;  3H4Q A;  4GS4 A;  2QEC A;  2RC4 A;  2Q0Y A;  3DNS A;  3V8I A;  3R96 A;  1Y7R A;  4KOW A;  2IL4 A;  4QB9 A;  5E96 A;  1Y9K A;  5C82 A;  4QVT A;  1Q2Y A;  3OWC A;  4KOY A;  4H89 A;  1S7N A;  1CM0 A;  3BLN A;  3FIX A;  3EXN A;  2BL1 A;  4MFP A;  1I12 A;  1RXT A;  3T90 A;  1M4D A;  4UFX A;  4OAE A;  3GKR A;  5FVJ A;  2G3A A;  3DSB A;  3TCV A;  4L8A A;  3TO9 A;  4FD5 A;  3W6X A;  3TOB A;  1IB1 E;  3CXP A;  3K9U A;  2OZG A;  1GHE A;  4CYN A;  2K5T A;  2REE A;  4A31 A;  4CS0 B;  4QUS A;  2VI7 A;  2JLM A;  1YX0 A;  1IIC A;  2YNC A;  5IX3 A;  2R8V A;  1Z9U A;  2Q4V A;  3EFA A;  4B13 A;  1B87 A;  1NE9 A;  3TO6 A;  4R3K A;  5IV0 A;  2EUI A;  2CNT A;  4CAF A;  2CY2 A;  2ZW6 A;  2VZZ A;  4KVO E;  4M85 A;  1XF8 A;  2Z3K A;  4R87 A;  1KUV A;  1MJB A;  4CYP A;  1TIQ A;  4JXQ A;  2ATR A;  2Z3L A;  4H6Z A;  4C2Z A;  3NE7 A;  1VKC A;  4XNH B;  4MFL A;  2Q04 A;  3I3G A;  2WSA A;  3F0A A;  1Q2C A;  1WWZ A;  1NSL A;  4L89 A;  2B3V A;  4CYQ A;  4U9Z A;  2YNE A;  4MHD A;  3N7Z A;  2PDO A;  4QC6 A;  1YGH A;  4MFZ A;  3G3S A;  4B11 A;  2G0B A;  2OB0 A;  2B5G B;  3DR6 A;  5IB0 A;  2VQY A;  4XPD C;  5H84 A;  2FXF A;  4R3L A;  2Z3P A;  4UBR A;  4II9 A;  4UCM A;  3ZZI A;  4A33 A;  1PUA A;  1P4N A;  4CAV A;  2DPT A;  2I79 A;  4JLY A;  5KTD A;  4JJX A;  4MFQ A;  4B10 A;  3TTH A;  4KOV A;  2FIW A;  4FD4 A;  3ZJ0 A;  5I0C A;  2Z3O A;  4KOT A;  3R95 A;  5J8C A;  5KTA A;  1S60 A;  4A30 A;  3F8K A;  1MJA A;  2ZW4 A;  3D2M A;  2Q44 A;  2ZXV A;  4KLV A;  1Z4E A;  3CXS A;  2HV2 A;  2VEZ A;  1LRZ A;  4PK2 A;  1IYK A;  5JQ4 A;  4NEX A;  1Q2D A;  2D4P A;  1J4J A;  4JXR A;  3R9E A;  3IU1 A;  4CGM A;  3PGP A;  2P0W A;  3IWE A;  2VXK A;  2WPX A;  4UFV A;  2VBQ A;  5AG7 A;  4KLW A;  4MBU A;  3LD2 A;  3A9L A;  4KUB A;  3TO7 A;  3WR7 A;  2B4B A;  4KOS A;  2CNS A;  2REF A;  4KOU A;  1MK4 A;  4OAD A;  1S7F A;  5F47 A;  2BUE A;  4NXY A;  1YR0 A;  2JEV A;  3W91 A;  3D3S A;  2X7B A;  3RYO A;  2Z0Z A;  4LUA A;  4DNC A;  1M1D A;  1ON0 A;  4UFW A;  4FD6 A;  4HKF A;  3UY5 A;  1K4J A;  2YNC C;  5KTC A;  3R9G A;  4MY3 A;  4B5P A;  1UFH A;  4XPK A;  4AVB A;  4C2Y A;  4PV6 A;  4R9M A;  3S6G A;  5HMN A;  3MGD A;  2J8N A;  4JD6 A;  4FD7 A;  5G1Z A;  3SXN A;  3D8P A;  1S5K A;  2A4N A;  3PZJ A;  1XEB A;  2P6E A;  3IGR A;  4H6U A;  5EBV A;  2F5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...