2Q4YA

Ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
b'PPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein At1g77540
molecule tags Transferase
source organism Arabidopsis thaliana
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q4yA00
1Y7RA 1Z9UA 3QB8A 3GKRA 2G3AA 2AE6A 4PSXA 1CJWA 1I12A 3F5BA 2B58A 2G3TA 3S6FA 2VEZA 4Y49C 2ZW6A 4QUSA 1RXTA 4AVCA 1WWZA 2P6FA 1GHEA 3R95A 5C88A 1Q2CA 5IX3A 2FE7A 2REFA 2GE3A 3LD2A 5J8CA 5H86A 2Q4YA 4QB9A 1NE9A 2R1IA 3D3SA 4L89A 4DNCA 3ZJ0A 5H84A 4EVYA 4F6AA 1L0CA 4CRYB 4IUSA 2VQYA 1R57A 2JEVA 2QMLA 4KOWA 1I1DA 2Z0ZA 2FIAA 2X7BA 1M4IA 4NSQA 4B5PA 3PP9A 4AG9A 4II9A 3S6KA 2CNSA 3MGDA 4NEXA 2Q0YA 4NXYA 1OZPA 4OADA 1YREA 4IF5A 4UA3A 1IIDA 3SHPA 3IWGA 3B8GA 2DXQA 3FIXA 2CNMA 3SXOA 4Y49B 4AVBA 2B3UA 1XIXA 5F48A 1IYKA 3BJ8A 2K5TA 2O28A 4XNHC 1YX0A 2FSRA 4H89A 4CAVA 3R9EA 1CM0A 1LRZA 2J8MA 1V0CA 4B5PB 4YFJA 4HNWB 4UBRA 5F46A 3EO4A 2B4DA 1B87A 4M85A 5IV0A 5JQ4A 3GYAA 4U5YA 3FBUA 1XMTA 4PSWA 4KOVA 3D2PA 1YLEA 1VHSA 2RC4A 1IYLA 4OAEA 2J8NA 4E8OA 5J8FA 4K30A 4E2AA 2PC1A 4GS4A 2F5IA 1BO4A 4OLLA 4KVOE 1S7FA 2REEA 1PU9A 4BMHA 1M1DA 1S7KA 4LX9A 1ON0A 3W6SA 4KORA 3GY9A 2BSWA 4E0AA 2ZW5A 4KUAA 3P2HA 3SXNA 4YGOA 1IB1E 2BEIA 2Z11A 4AG7A 3TE4A 1MK4A 3WR7A 1XEBA 4KZTA 5JPHA 4MY3A 3FXTA 5ISVA 2Q4VA 3JUWA 2OZHA 4FD7A 3F0AA 2D4PA 4QVTA 2D4OA 3PGPA 4U9YA 2VZYA 2Z10A 2GIVA 4CAXA 4CS0B 4PV6A 1P4NA 2BUEA 3S6HA 1MJBA 2CNTA 1IICA 4U9ZA 3F8KA 2VBQA 4XNHB 1QSOA 4XPDC 1S60A 5HH1A 5FVJA 1QSNA 2VZZA 4MBUA 3TO9A 1S5KA 2Q04A 2JDCA 1XE4A 2BL1A 3DDDA 1Z4EA 2P6EA 4AB7A 3G8WA 3TO7A 5IB0A 1Q2YA 2VXKA 3DR8A 2OZUA 4NCZA 1M44A 3LODA 5KTDA 1N71A 3N7ZA 2C27A 3G3SA 4H6UA 1Q2DA 3JVNA 2R98A 4KVXA 3V8IA 2JDDA 4XPKA 4RS2A 3FB3A 1VKCA 3CXQA 4J3GA 3TTHA 1P0HA 3QAHA 1KZFA 2PR8A 4FD5A 3T9YA 4XPLA 3RYOA 1QSTA 2PR1A 1Y9KA 5KTCA 3H4QA 2B4DB 4FD6A 1Z4RA 2WPWA 1YVOA 2ZW4A 1PUAA 3E0KA 2CY2A 2HV2A 5E96A 4XPDB 2KCWA 2Q7BA 4R87A 1U6MA 2QIRA 3DR6A 3VWDA 3CXPA 1M4DA 1QSMA 4KOSA 5GCNA 2P6GA 3C26A 5F47A 3PZJA 1YVKA 4JD6A 2FL4A 2NMTA 3DNSA 2B3VA 2FCKA 3UY5A 4KOUA 3D2MA 3ZZIA 1Y9WA 3D8PA 4L8AA 1TIQA 4MHDA 2HUZA 2WPXA 4I49A 2PSWA 2R7HA 4ZBGA 2EVNA 1QSRA 1YGHA 1UFHA 3FYNA 4CRZB 5HMNA 4R3KA 2OB0A 3TFYA 2JLMA 4JWPA 1KUXA 1K4JA 1BOBA 2B5GA 3BLNA 3EXNA 2GANA 4QBJA 5DWMA 5I0CA 2I79A 4JXRA 4LUAA 2I00A 2OU2A 4PK3A 3BJ7A 2HQYA 3CXSA 4MI4A 3R96A 4UWJA 4AVAA 4JLYA 3R9FA 4R9MA 4MY0A 4X5KA 2J8RA 4H6ZA 3EFAA 3DSBA 5EBVA 4FD4A 3FRMA 1S3ZA 5DWNA 4JXQA 4HKFA 1SQHA 2FT0A 2B5GB 5EC4A 4F0YA 3FNCA 4KLVA 3IGRA 1FY7A 4ONUA 4PK2A 2ARHA 3OWCA 3EY5A 4KUBA 4HNXB 4CAWA 1NSLA 1M4GA 4YRHA 1MJAA 4NF1A 3K9UA 3TOAA 3TOBA 4M3SA 3W6XA 3TT2A 1RO5A 2P0WA 2ZPAA 4UWIA 1XF8A 3TO6A 2IL4A 4KOXA 2VI7A 2FIWA 1S7NA 3R9GA 5KTAA 3R1KA 2ZXVA 4KOYA 2ZW7A 2G0BA 4MJ8A 1S7LA 3TCVA 4ORFA 2Y0MA 5C82A 2AJ6A 3I9SA 1J4JA 2EUIA 3W91A 1NMTA 2H5MA 3T90A 2R8VA 1YK3A 1YR0A 3EC4A 3S6GA 1I21A 2PDOA 1KUVA 2B4BA 2QECA 4HNYB 2PQ8A 4R57A 4KOTA 3VWEA 3KKWA 2OZGA 2A4NA 4RI1A 2FS5A 3I3GA 2OH1A 4KLWA 3P2FA 4KVME 5F49A 4QC6A 2PRBA 1KUYA 1MJ9A 2FXFA 4JJXA 3NE7A 1B6BA 2ATRA 5CNPA 4B5OA 4R3LA 1WK4A 2Q44A
chains in the Genus database with same CATH superfamily
1Y7RA 1Z9UA 3FVLA 3QB8A 4KSFA 3GKRA 4MFKA 4EWTA 1ELMP 1AUGA 2RFHA 3FF3A 2QJ8A 2G3AA 4C2YA 2AE6A 4PSXA 1CJWA 1I12A 3F5BA 3VATA 2B58A 2YNEA 4C68A 1YMEA 3H8EA 3QNVA 2HC9A 4CYPA 2G3TA 1YW6A 3B3SA 1JQGA 1IOFA 4P4EA 3S6FA 2VEZA 1YLOA 1ZG7A 2GLFA 3HUVA 1DE4C 2IJZA 4Y49C 3D67A 2ZW6A 5HVFA 4BINA 4M6HA 4QUSA 5CPAA 1H8LA 1LFWA 3HLPA 4MFQA 1RXTA 2PJAA 4AVCA 3LWUA 1WWZA 1ZO0A 2P6FA 4P44A 1GHEA 2PJ4A 3R95A 2QVPA 4ZX8A 3L2NA 5C88A 1IU8A 1Q2CA 3V38A 1ZLIA 5IX3A 2FE7A 2REFA 2GE3A 3LD2A 1R3NA 2I3CA 5H86A 3KQZA 2Q4YA 2NYQA 3KHZA 1NE9A 4QB9A 4WJBA 3S9MA 2R1IA 3D3SA 4L89A 4DNCA 3ZJ0A 5H84A 3IEHA 4EVYA 4F6AA 2DF5A 2NSMA 2WUUA 1L0CA 4CRYB 4IUSA 4CGMA 2GFQA 3B3CA 4MMOA 4CYNA 2VQYA 1R57A 2JEVA 7CPAA 2QMLA 4KOWA 1I1DA 2Z0ZA 4DJLA 4NGMA 1BLLE 2FIAA 2O4HA 2X7BA 2XEFA 4DUKA 1M4IA 4NSQA 4B5PA 3SJEA 3PP9A 2GU2A 4AG9A 5LYFA 2JBKA 4NGQA 2ZEGA 4PXEA 3MRUA 2V8DA 4II9A 2G9DA 3S6KA 2CNSA 3MGDA 4NEXA 1X10A 5JH9A 2Q0YA 3FH4A 4NXYA 1OZPA 2ZEEA 5AGEA 2PJ3A 1YREA 4OADA 2V8HA 2DEAA 4IF5A 2EWBA 3SJXA 4UA3A 4P4JA 5HXDA 1IIDA 3ISZA 1ARMA 3SHPA 3LMSA 4FAIA 3IWGA 3B8GA 3PFEA 2DXQA 3FIXA 2CNMA 2ZEDA 3SXOA 3WC7A 4P45A 4OC5A 1JWQA 4Y49B 4A32A 4AVBA 1Q7LA 2B3UA 3D68A 1XIXA 1Z5RA 1IYKA 2PVVA 2PJ9A 3BJ8A 4NJQA 5F48A 2AFZA 3KHXA 3BI0A 5HVHA 1ELLP 2K5TA 3WC6A 2O28A 4XNHC 2CF4A 4A37A 4A94A 1YX0A 1LAMA 2FSRA 4H89A 4PXDA 4UIAA 4CAVA 4B14A 5JGFA 2V77A 4NFRA 5G22A 3R9EA 1TF8A 3SI0A 1CM0A 2GLJA 2J8MA 1LRZA 1IOIA 1Z8LA 1V0CA 3CZXA 4RN7A 4B5PB 4CYOA 4YFJA 3B35A 4HNWB 3PB6X 1CP7A 4NGTA 4CAEA 1TF9A 1Z2LA 4UBRA 5F46A 3GIUA 6CPAA 3IJ3A 3EO4A 1B87A 2B4DA 1HDQA 4M85A 5D8NA 1VHEA 5IV0A 5JQ4A 3GYAA 4U5YA 5HVGA 3KR4A 3FBUA 1XMTA 3RNZA 4PSWA 1XMBA 4KOVA 2RB7A 4Z65A 3D2PA 3A9LA 1YLEA 1VHSA 2RC4A 1IYLA 3H5ZA 3KZWA 1A2ZA 2J8NA 4MCPA 4OAEA 2Z3PA 1LCPA 3D4UA 4E8OA 5J8FA 1YQEA 1X12A 4K30A 4MHYA 3RZAA 4E2AA 1QQ9A 3PB7X 3WABA 2PC1A 2PVWA 4GS4A 1TXRA 2F5IA 1FT7A 1BO4A 2ZOGA 3D7GA 4KVOE 2OR4A 3B3WA 1BAVA 1S7FA 4OLLA 2IMOA 2REEA 2AFWA 2YNCA 2PJ1A 1IGBA 4PXBA 1PU9A 4BMHA 2XEJA 5LYLA 1M1DA 2PIYA 2POKA 1S7KA 3GB0A 4LX9A 3IO1A 1ON0A 3H8FA 3W6SA 4KORA 1AYEA 3GY9A 4MFZA 2BSWA 2WSAA 3WC5A 4P4BA 4E0AA 2EBJA 2ZW5A 4KUAA 2CTCA 5LYDA 3P2HA 3SXNA 4YGOA 1IB1E 5D29A 2BEIA 4CYQA 2Z11A 4AG7A 3TE4A 4OC2A 1Z8XA 5LRGA 1MK4A 4K3NA 2PJ2A 3IC1A 1Y0RA 3LACA 2PJ0A 4KSAA 1XEBA 4KZTA 3WR7A 3B3TA 5JPHA 4MY3A 4CPAA 2ODFA 3KR5A 3FXTA 1BPMA 5ISVA 5J8CA 2Q4VA 3JUWA 2OZHA 4FD7A 3F0AA 2D4PA 2EK8A 2ZEOA 1VGYA 2D4OA 3PGPA 4QVTA 2VZYA 1VHOA 2Z10A 4U9YA 2GIVA 3SJFA 4CAXA 4CS0B 4MCRA 4PV6A 5G21A 1P4NA 2XEIA 5AG5A 3QAYA 4UEFA 4OIWA 2JBJA 1CBXA 2BUEA 2ZEMA 3S6HA 4C2XA 1MJBA 2CNTA 1R43A 1TKJA 3IWWA 4CGNA 1IICA 4FBEA 4U9ZA 3F8KA 2VBQA 2ZENA 3PB9X 4KS9A 4XNHB 1QSOA 4XPDC 3T8WA 2WZNA 1S60A 5HH1A 5FVJA 8CPAA 1QSNA 5DS0A 5A28A 2F8HA 5BWAB 1VIXA 3NH8A 2VZZA 1CG2A 1CPSA 3BHXA 4MBUA 2ANPA 4NJRA 3TO9A 1S5KA 4JZ0A 1HDUA 4Q7AA 2Q04A 2GREA 2JDCA 2Q4ZA 1XE4A 2BL1A 2ZOFA 4NGPA 3DDDA 3KASA 4DYOA 1Z4EA 2P6EA 4AB7A 3G8WA 2PJ6A 4TWEA 3TO7A 3WT4A 5IB0A 4KSIA 1Q2YA 1XJOA 2VXKA 4NGSA 4B6ZA 2Z3OA 3DR8A 2BCOA 4OC3A 4ZY1A 3BXMA 2AFOA 3GLJA 1NSAA 2Q7SA 4WWVA 2OZUA 4X8IA 4NCZA 5A27A 4UCPA 3PB8X 3RO0A 1M44A 5JM6A 3LODA 5KTDA 1N71A 3N7ZA 2C27A 5IB9A 3G3SA 4H2KA 4EMEA 4H6UA 1Q2DA 3JVNA 5LRKA 5K8PA 2R98A 4KVXA 4PPZA 5K8MA 3V8IA 2JDDA 5AG4A 4XPKA 4RS2A 1KWMA 3FB3A 1VKCA 3CXQA 4J3GA 3TTHA 1LAPA 1P0HA 4MHPA 3QAHA 1KZFA 2PR8A 4FD5A 4P4DA 4OMEA 3B7IA 4XPLA 3T9YA 4A31A 3RYOA 1QSTA 5LRJA 2PR1A 1Y9KA 4C7IA 5KTCA 3S9NA 3H4QA 1ARLA 2B4DB 4UEZA 1GYTA 2BO9A 3FEEA 3PEIA 4FD6A 4MHNA 1Z4RA 2WPWA 4TNUA 3CDXA 4ZYQA 1YVOA 2ZW4A 1PUAA 3E0KA 2ZEPA 1TKFA 5AG7A 3D7FA 2YGWA 1Z8WA 1XRYA 3FX6A 2CY2A 4ZY0A 2HV2A 5E96A 1AMPA 4BBHA 2C1CA 4XPDB 2PJBA 1TKHA 2KCWA 5F09A 2Q7BA 2ZEFA 2ABZA 3RAMA 2O53A 4R87A 3IFEA 3D66A 1U6MA 2AFXA 3MN8A 2PJCA 3K2KA 4F9VA 2QIRA 3DR6A 3VWDA 3PRTA 3CXPA 1M4DA 1QSMA 4KOSA 5GCNA 2P6GA 3NH4A 3C26A 5F47A 3PZJA 4W9YA 4CGLA 4PXCA 1YVKA 2ZELA 4UFWA 4C7HA 4JD6A 4R6TA 4YU9A 3CT9A 2FL4A 2NMTA 2PJ8A 3I1UA 3RBUA 1ZG8A 4OC4A 3DNSA 2B3VA 2FCKA 3UY5A 4KOUA 3D2MA 4P10A 3ZZIA 1IY7A 1Y9WA 1DTDA 3D8PA 3IWEA 4L8AA 1TIQA 4MHDA 2HUZA 2WPXA 4I49A 2PSWA 1XBUA 5CBMA 2R7HA 4ZBGA 4F9UA 2JEWA 1OBRA 2EVNA 3B3VA 1QSRA 3IU2A 1YGHA 1UFHA 4M6GA 4Q36A 2Z3LA 3FYNA 2PJ5A 4UFVA 4CRZB 5HMNA 4GM5A 4R3KA 2DPSA 2PIZA 2OB0A 2J9AA 3TFYA 4AXVA 2JLMA 4IAVA 1LOKA 2EK9A 4JWPA 4MRIA 1KUXA 1K4JA 3PBBA 1BOBA 2B5GA 4B12A 4ONWA 3BLNA 3EXNA 2GANA 4A38A 4QBJA 3VH9A 5THWA 2WYRA 5DWMA 4IK2A 4MHZA 2I79A 4JXRA 5I0CA 4LUAA 2I00A 2OU2A 4NGRA 4PK3A 3BJ7A 3SJGA 2HQYA 3CPAA 3CXSA 4P4FA 3PBEA 2CTBA 4MI4A 4JYWA 3R96A 1CX8A 3KQXA 4UWJA 4AVAA 4UF4A 4JLYA 4MFJA 3R9FA 2QYVA 4R9MA 4MY0A 4X5KA 1XFOA 2J8RA 1F57A 4H6ZA 1Y0YA 3KL9A 3EFAA 4OC1A 5LYIA 3DSBA 5EBVA 2PJ7A 4B10A 5G1ZA 3SI2A 2OOTA 2BOAA 3IIBA 4OKOA 4FD4A 5G20A 3SI1A 2PCUA 5K8OA 2XEGA 2AFSA 4GXHA 1CPXA 3NE8A 3FRMA 1S3ZA 5DWNA 4JXQA 4HKFA 4ZY2A 1SQHA 2FT0A 2B5GB 4OC0A 5EC4A 3CPXA 4A30A 2EO8A 4IHMA 3IU1A 5K8NA 4F0YA 3FNCA 3JTKA 3BI1A 4KLVA 4A2ZA 2C6PA 3IGRA 2CIJA 2AFUA 1FY7A 3D7HA 4ONUA 4PK2A 2ARHA 3OWCA 4UEEA 3EY5A 4KUBA 4HNXB 4CAWA 4R8FA 1NSLA 1M4GA 4CAFA 1F2PA 4YRHA 1MJAA 4NF1A 3K9UA 3TOAA 1YSJA 4M3SA 4PQAA 3TOBA 3TT2A 3W6XA 2HB6A 3FEDA 2PE3A 1RO5A 2P0WA 4UCMA 4P4IA 2ZPAA 4X2TA 4UWIA 1FNOA 2Z3NA 3NH5A 1XF8A 4F8ZA 3TO6A 3TC8A 3FECA 2IL4A 4EFDA 2PRQA 3NFZA 3K9TA 4KOXA 1YW4A 3N5FA 2VI7A 1UWYA 2C6GA 4FWUA 4O23A 2FVGA 3B2YA 4MCSA 4UIBA 5AG6A 4YWYA 4MXUA 4C2ZA 4RUHA 2FIWA 1S7NA 3R9GA 5KTAA 2IQ6A 3R1KA 2Z3KA 2ZXVA 4KOYA 3H8GA 4Q38A 2Q43A 2Z3MA 2ZW7A 1EE3P 2CXAA 2G0BA 4MJ8A 4R76A 5I4MA 1S7LA 1XOVA 1PYTB 2AFMA 3TCVA 4LQ6A 4M6IA 1BPNA 4F0XA 4ORFA 4G1PA 2Y0MA 3ISXA 5C82A 2AJ6A 4UCNA 4CGPA 1Z8TA 3I9SA 1J4JA 2EUIA 4MFLA 4LQGA 3PFOA 4FUUA 3W91A 1NMTA 2H5MA 4NGNA 4R7MA 1M4LA 3T90A 3KI9A 2V8GA 2R8VA 5ELYA 1YK3A 1YR0A 4ZX9A 4A33A 3EC4A 3V7ZA 3S6GA 3DLJA 1I21A 2PDOA 1QMUA 3PB4X 1KUVA 3GUXA 1F2OA 1Y7EA 2B4BA 2QECA 3D7DA 2PQ8A 4HNYB 2ZEHA 3FMCA 4MCQA 4R57A 4B11A 2V8VA 4KOTA 3VWEA 3KKWA 1LANA 4A39A 2OZGA 2YNDA 4UFXA 1ZLHA 2A4NA 4ZGYB 4RI1A 3JRUA 4BD9A 2FS5A 2F7VA 4OIDA 4OP4A 3I3GA 4MFPA 2C6CA 2OH1A 4P6YA 4KLWA 5J1QA 2Q51A 4CGOA 3P2FA 3S9LA 3NA6A 4KVME 4X3RA 5F49A 4B13A 1CP6A 4QC6A 2PRBA 1KUYA 5EMIA 1MJ9A 2FXFA 1ZG9A 2YNCC 3FJUA 4JJXA 3NE7A 2DPTA 2VL1A 3TX8A 3KGQA 3VARA 1B6BA 2ATRA 1PCAA 5CNPA 4B5OA 4R3LA 1HEEA 3DGVA 4ZI6A 1RTQA 4A95A 1WK4A 2Q44A 4HPSA
chains in the Genus database with same CATH topology
1Y7RA 1Z9UA 3QB8A 4KSFA 3GKRA 4MFKA 2G3AA 4C2YA 2AE6A 4PSXA 1CJWA 1I12A 3F5BA 2B58A 2YNEA 4C68A 4CYPA 2G3TA 3S6FA 2VEZA 4Y49C 2ZW6A 4QUSA 4MFQA 1RXTA 4AVCA 1WWZA 1ZO0A 2P6FA 1GHEA 3R95A 5C88A 1Q2CA 5IX3A 2FE7A 2REFA 2GE3A 3LD2A 5J8CA 5H86A 2Q4YA 4QB9A 1NE9A 2R1IA 3D3SA 4L89A 4DNCA 3ZJ0A 5H84A 4EVYA 4F6AA 2WUUA 1L0CA 4CRYB 4IUSA 4CGMA 4CYNA 2VQYA 1R57A 2JEVA 2QMLA 4KOWA 1I1DA 2Z0ZA 2FIAA 2X7BA 1M4IA 4NSQA 4B5PA 3PP9A 4AG9A 4II9A 3S6KA 2CNSA 3MGDA 4NEXA 2Q0YA 4NXYA 1OZPA 5AGEA 4OADA 1YREA 4IF5A 4UA3A 1IIDA 3SHPA 3IWGA 3B8GA 2DXQA 3FIXA 2CNMA 3SXOA 4Y49B 4A32A 4AVBA 2B3UA 1XIXA 5F48A 1IYKA 3BJ8A 2K5TA 2O28A 4XNHC 1YX0A 2FSRA 4H89A 4CAVA 4B14A 5G22A 3R9EA 1CM0A 1LRZA 2J8MA 1V0CA 4B5PB 4CYOA 4YFJA 4HNWB 4CAEA 4UBRA 5F46A 3EO4A 2B4DA 1B87A 4M85A 5IV0A 5JQ4A 3GYAA 4U5YA 3FBUA 1XMTA 4PSWA 4KOVA 3D2PA 3A9LA 1YLEA 1VHSA 2RC4A 1IYLA 3H5ZA 4OAEA 2J8NA 2Z3PA 4E8OA 5J8FA 4K30A 4E2AA 2PC1A 4GS4A 2F5IA 1BO4A 4OLLA 4KVOE 1S7FA 2REEA 2YNCA 1PU9A 4BMHA 1M1DA 1S7KA 4LX9A 1ON0A 3W6SA 4KORA 3GY9A 4MFZA 2BSWA 2WSAA 4E0AA 2ZW5A 4KUAA 3P2HA 3SXNA 4YGOA 1IB1E 4CYQA 2BEIA 2Z11A 4AG7A 3TE4A 1MK4A 4KSAA 3WR7A 1XEBA 4KZTA 5JPHA 4MY3A 3FXTA 5ISVA 2Q4VA 3JUWA 2OZHA 4FD7A 3F0AA 2D4PA 4QVTA 2D4OA 3PGPA 4U9YA 2VZYA 2Z10A 2GIVA 4CAXA 4CS0B 4PV6A 5G21A 1P4NA 5AG5A 2BUEA 3S6HA 4C2XA 1MJBA 2CNTA 4CGNA 1IICA 4U9ZA 3F8KA 2VBQA 4KS9A 4XNHB 1QSOA 4XPDC 1S60A 5HH1A 5FVJA 1QSNA 5A28A 5BWAB 2VZZA 4MBUA 3TO9A 1S5KA 2Q04A 2JDCA 1XE4A 2BL1A 3DDDA 1Z4EA 2P6EA 4AB7A 3G8WA 3TO7A 5IB0A 1Q2YA 2VXKA 2Z3OA 3DR8A 2OZUA 4NCZA 5A27A 4UCPA 1M44A 3LODA 5KTDA 1N71A 3N7ZA 2C27A 3G3SA 4H6UA 1Q2DA 3JVNA 2R98A 4KVXA 3V8IA 2JDDA 5AG4A 4XPKA 4RS2A 3FB3A 1VKCA 3CXQA 4J3GA 3TTHA 1P0HA 3QAHA 1KZFA 2PR8A 4FD5A 3T9YA 4A31A 4XPLA 3RYOA 1QSTA 2PR1A 1Y9KA 4C7IA 5KTCA 3H4QA 2B4DB 4FD6A 1Z4RA 2WPWA 1YVOA 2ZW4A 1PUAA 3E0KA 5AG7A 2YGWA 2CY2A 2HV2A 5E96A 4BBHA 4XPDB 2KCWA 2Q7BA 4R87A 1U6MA 2QIRA 3DR6A 3VWDA 3CXPA 1M4DA 1QSMA 4KOSA 5GCNA 2P6GA 4CGLA 3C26A 5F47A 3PZJA 1YVKA 4C7HA 4UFWA 4JD6A 2FL4A 2NMTA 3DNSA 2B3VA 2FCKA 3UY5A 4KOUA 3D2MA 3ZZIA 1Y9WA 3D8PA 3IWEA 4L8AA 1TIQA 4MHDA 2HUZA 2WPXA 4I49A 2PSWA 2R7HA 4ZBGA 2EVNA 1QSRA 3IU2A 1YGHA 1UFHA 4Q36A 2Z3LA 3FYNA 4UFVA 4CRZB 5HMNA 4R3KA 2DPSA 2OB0A 3TFYA 2JLMA 4JWPA 1KUXA 1K4JA 1BOBA 2B5GA 4B12A 3BLNA 3EXNA 2GANA 4QBJA 5DWMA 5I0CA 2I79A 4JXRA 4LUAA 2I00A 2OU2A 4PK3A 3BJ7A 2HQYA 3CXSA 4MI4A 3R96A 4UWJA 4AVAA 4JLYA 4MFJA 3R9FA 4R9MA 4MY0A 4X5KA 2J8RA 4H6ZA 3EFAA 3DSBA 5EBVA 4B10A 5G1ZA 4FD4A 5G20A 3FRMA 1S3ZA 5DWNA 4JXQA 4HKFA 1SQHA 2FT0A 2B5GB 5EC4A 4A30A 3IU1A 4F0YA 3FNCA 3JTKA 4KLVA 4A2ZA 3IGRA 1FY7A 4ONUA 4PK2A 2ARHA 3OWCA 3EY5A 4KUBA 4HNXB 4CAWA 1NSLA 1M4GA 4CAFA 4YRHA 1MJAA 4NF1A 3K9UA 3TOAA 3TOBA 4M3SA 3W6XA 3TT2A 1RO5A 2P0WA 4UCMA 2ZPAA 4UWIA 2Z3NA 1XF8A 3TO6A 2IL4A 4KOXA 2VI7A 5AG6A 4C2ZA 2FIWA 1S7NA 3R9GA 5KTAA 3R1KA 2Z3KA 2ZXVA 4KOYA 4Q38A 2Z3MA 2ZW7A 2CXAA 2G0BA 4MJ8A 1S7LA 3TCVA 4F0XA 4ORFA 2Y0MA 5C82A 2AJ6A 4UCNA 4CGPA 3I9SA 1J4JA 2EUIA 4MFLA 3W91A 1NMTA 2H5MA 3T90A 2R8VA 1YK3A 1YR0A 4A33A 3EC4A 3S6GA 1I21A 2PDOA 1KUVA 2B4BA 2QECA 4HNYB 2PQ8A 4B11A 4R57A 4KOTA 3VWEA 3KKWA 2OZGA 2YNDA 4UFXA 2A4NA 4ZGYB 4RI1A 2FS5A 3I3GA 4MFPA 2OH1A 4KLWA 4CGOA 3P2FA 4KVME 5F49A 4B13A 4QC6A 2PRBA 1KUYA 1MJ9A 2FXFA 2YNCC 4JJXA 3NE7A 2DPTA 1B6BA 2ATRA 5CNPA 4B5OA 4R3LA 4A95A 1WK4A 2Q44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7R A;  1Z9U A;  3QB8 A;  3GKR A;  2G3A A;  2AE6 A;  4PSX A;  1CJW A;  1I12 A;  3F5B A;  2B58 A;  2G3T A;  3S6F A;  2VEZ A;  4Y49 C;  2ZW6 A;  4QUS A;  1RXT A;  4AVC A;  1WWZ A;  2P6F A;  1GHE A;  3R95 A;  5C88 A;  1Q2C A;  5IX3 A;  2FE7 A;  2REF A;  2GE3 A;  3LD2 A;  5J8C A;  5H86 A;  2Q4Y A;  4QB9 A;  1NE9 A;  2R1I A;  3D3S A;  4L89 A;  4DNC A;  3ZJ0 A;  5H84 A;  4EVY A;  4F6A A;  1L0C A;  4CRY B;  4IUS A;  2VQY A;  1R57 A;  2JEV A;  2QML A;  4KOW A;  1I1D A;  2Z0Z A;  2FIA A;  2X7B A;  1M4I A;  4NSQ A;  4B5P A;  3PP9 A;  4AG9 A;  4II9 A;  3S6K A;  2CNS A;  3MGD A;  4NEX A;  2Q0Y A;  4NXY A;  1OZP A;  4OAD A;  1YRE A;  4IF5 A;  4UA3 A;  1IID A;  3SHP A;  3IWG A;  3B8G A;  2DXQ A;  3FIX A;  2CNM A;  3SXO A;  4Y49 B;  4AVB A;  2B3U A;  1XIX A;  5F48 A;  1IYK A;  3BJ8 A;  2K5T A;  2O28 A;  4XNH C;  1YX0 A;  2FSR A;  4H89 A;  4CAV A;  3R9E A;  1CM0 A;  1LRZ A;  2J8M A;  1V0C A;  4B5P B;  4YFJ A;  4HNW B;  4UBR A;  5F46 A;  3EO4 A;  2B4D A;  1B87 A;  4M85 A;  5IV0 A;  5JQ4 A;  3GYA A;  4U5Y A;  3FBU A;  1XMT A;  4PSW A;  4KOV A;  3D2P A;  1YLE A;  1VHS A;  2RC4 A;  1IYL A;  4OAE A;  2J8N A;  4E8O A;  5J8F A;  4K30 A;  4E2A A;  2PC1 A;  4GS4 A;  2F5I A;  1BO4 A;  4OLL A;  4KVO E;  1S7F A;  2REE A;  1PU9 A;  4BMH A;  1M1D A;  1S7K A;  4LX9 A;  1ON0 A;  3W6S A;  4KOR A;  3GY9 A;  2BSW A;  4E0A A;  2ZW5 A;  4KUA A;  3P2H A;  3SXN A;  4YGO A;  1IB1 E;  2BEI A;  2Z11 A;  4AG7 A;  3TE4 A;  1MK4 A;  3WR7 A;  1XEB A;  4KZT A;  5JPH A;  4MY3 A;  3FXT A;  5ISV A;  2Q4V A;  3JUW A;  2OZH A;  4FD7 A;  3F0A A;  2D4P A;  4QVT A;  2D4O A;  3PGP A;  4U9Y A;  2VZY A;  2Z10 A;  2GIV A;  4CAX A;  4CS0 B;  4PV6 A;  1P4N A;  2BUE A;  3S6H A;  1MJB A;  2CNT A;  1IIC A;  4U9Z A;  3F8K A;  2VBQ A;  4XNH B;  1QSO A;  4XPD C;  1S60 A;  5HH1 A;  5FVJ A;  1QSN A;  2VZZ A;  4MBU A;  3TO9 A;  1S5K A;  2Q04 A;  2JDC A;  1XE4 A;  2BL1 A;  3DDD A;  1Z4E A;  2P6E A;  4AB7 A;  3G8W A;  3TO7 A;  5IB0 A;  1Q2Y A;  2VXK A;  3DR8 A;  2OZU A;  4NCZ A;  1M44 A;  3LOD A;  5KTD A;  1N71 A;  3N7Z A;  2C27 A;  3G3S A;  4H6U A;  1Q2D A;  3JVN A;  2R98 A;  4KVX A;  3V8I A;  2JDD A;  4XPK A;  4RS2 A;  3FB3 A;  1VKC A;  3CXQ A;  4J3G A;  3TTH A;  1P0H A;  3QAH A;  1KZF A;  2PR8 A;  4FD5 A;  3T9Y A;  4XPL A;  3RYO A;  1QST A;  2PR1 A;  1Y9K A;  5KTC A;  3H4Q A;  2B4D B;  4FD6 A;  1Z4R A;  2WPW A;  1YVO A;  2ZW4 A;  1PUA A;  3E0K A;  2CY2 A;  2HV2 A;  5E96 A;  4XPD B;  2KCW A;  2Q7B A;  4R87 A;  1U6M A;  2QIR A;  3DR6 A;  3VWD A;  3CXP A;  1M4D A;  1QSM A;  4KOS A;  5GCN A;  2P6G A;  3C26 A;  5F47 A;  3PZJ A;  1YVK A;  4JD6 A;  2FL4 A;  2NMT A;  3DNS A;  2B3V A;  2FCK A;  3UY5 A;  4KOU A;  3D2M A;  3ZZI A;  1Y9W A;  3D8P A;  4L8A A;  1TIQ A;  4MHD A;  2HUZ A;  2WPX A;  4I49 A;  2PSW A;  2R7H A;  4ZBG A;  2EVN A;  1QSR A;  1YGH A;  1UFH A;  3FYN A;  4CRZ B;  5HMN A;  4R3K A;  2OB0 A;  3TFY A;  2JLM A;  4JWP A;  1KUX A;  1K4J A;  1BOB A;  2B5G A;  3BLN A;  3EXN A;  2GAN A;  4QBJ A;  5DWM A;  5I0C A;  2I79 A;  4JXR A;  4LUA A;  2I00 A;  2OU2 A;  4PK3 A;  3BJ7 A;  2HQY A;  3CXS A;  4MI4 A;  3R96 A;  4UWJ A;  4AVA A;  4JLY A;  3R9F A;  4R9M A;  4MY0 A;  4X5K A;  2J8R A;  4H6Z A;  3EFA A;  3DSB A;  5EBV A;  4FD4 A;  3FRM A;  1S3Z A;  5DWN A;  4JXQ A;  4HKF A;  1SQH A;  2FT0 A;  2B5G B;  5EC4 A;  4F0Y A;  3FNC A;  4KLV A;  3IGR A;  1FY7 A;  4ONU A;  4PK2 A;  2ARH A;  3OWC A;  3EY5 A;  4KUB A;  4HNX B;  4CAW A;  1NSL A;  1M4G A;  4YRH A;  1MJA A;  4NF1 A;  3K9U A;  3TOA A;  3TOB A;  4M3S A;  3W6X A;  3TT2 A;  1RO5 A;  2P0W A;  2ZPA A;  4UWI A;  1XF8 A;  3TO6 A;  2IL4 A;  4KOX A;  2VI7 A;  2FIW A;  1S7N A;  3R9G A;  5KTA A;  3R1K A;  2ZXV A;  4KOY A;  2ZW7 A;  2G0B A;  4MJ8 A;  1S7L A;  3TCV A;  4ORF A;  2Y0M A;  5C82 A;  2AJ6 A;  3I9S A;  1J4J A;  2EUI A;  3W91 A;  1NMT A;  2H5M A;  3T90 A;  2R8V A;  1YK3 A;  1YR0 A;  3EC4 A;  3S6G A;  1I21 A;  2PDO A;  1KUV A;  2B4B A;  2QEC A;  4HNY B;  2PQ8 A;  4R57 A;  4KOT A;  3VWE A;  3KKW A;  2OZG A;  2A4N A;  4RI1 A;  2FS5 A;  3I3G A;  2OH1 A;  4KLW A;  3P2F A;  4KVM E;  5F49 A;  4QC6 A;  2PRB A;  1KUY A;  1MJ9 A;  2FXF A;  4JJX A;  3NE7 A;  1B6B A;  2ATR A;  5CNP A;  4B5O A;  4R3L A;  1WK4 A;  2Q44 A; 
#chains in the Genus database with same CATH topology
 1Y7R A;  1Z9U A;  3FVL A;  3QB8 A;  4KSF A;  3GKR A;  4MFK A;  4EWT A;  1ELM P;  1AUG A;  2RFH A;  3FF3 A;  2QJ8 A;  2G3A A;  4C2Y A;  2AE6 A;  4PSX A;  1CJW A;  1I12 A;  3F5B A;  3VAT A;  2B58 A;  2YNE A;  4C68 A;  1YME A;  3H8E A;  3QNV A;  2HC9 A;  4CYP A;  2G3T A;  1YW6 A;  3B3S A;  1JQG A;  1IOF A;  4P4E A;  3S6F A;  2VEZ A;  1YLO A;  1ZG7 A;  2GLF A;  3HUV A;  1DE4 C;  2IJZ A;  4Y49 C;  3D67 A;  2ZW6 A;  5HVF A;  4BIN A;  4M6H A;  4QUS A;  5CPA A;  1H8L A;  1LFW A;  3HLP A;  4MFQ A;  1RXT A;  2PJA A;  4AVC A;  3LWU A;  1WWZ A;  1ZO0 A;  2P6F A;  4P44 A;  1GHE A;  2PJ4 A;  3R95 A;  2QVP A;  4ZX8 A;  3L2N A;  5C88 A;  1IU8 A;  1Q2C A;  3V38 A;  1ZLI A;  5IX3 A;  2FE7 A;  2REF A;  2GE3 A;  3LD2 A;  1R3N A;  2I3C A;  5H86 A;  3KQZ A;  2Q4Y A;  2NYQ A;  3KHZ A;  1NE9 A;  4QB9 A;  4WJB A;  3S9M A;  2R1I A;  3D3S A;  4L89 A;  4DNC A;  3ZJ0 A;  5H84 A;  3IEH A;  4EVY A;  4F6A A;  2DF5 A;  2NSM A;  2WUU A;  1L0C A;  4CRY B;  4IUS A;  4CGM A;  2GFQ A;  3B3C A;  4MMO A;  4CYN A;  2VQY A;  1R57 A;  2JEV A;  7CPA A;  2QML A;  4KOW A;  1I1D A;  2Z0Z A;  4DJL A;  4NGM A;  1BLL E;  2FIA A;  2O4H A;  2X7B A;  2XEF A;  4DUK A;  1M4I A;  4NSQ A;  4B5P A;  3SJE A;  3PP9 A;  2GU2 A;  4AG9 A;  5LYF A;  2JBK A;  4NGQ A;  2ZEG A;  4PXE A;  3MRU A;  2V8D A;  4II9 A;  2G9D A;  3S6K A;  2CNS A;  3MGD A;  4NEX A;  1X10 A;  5JH9 A;  2Q0Y A;  3FH4 A;  4NXY A;  1OZP A;  2ZEE A;  5AGE A;  2PJ3 A;  1YRE A;  4OAD A;  2V8H A;  2DEA A;  4IF5 A;  2EWB A;  3SJX A;  4UA3 A;  4P4J A;  5HXD A;  1IID A;  3ISZ A;  1ARM A;  3SHP A;  3LMS A;  4FAI A;  3IWG A;  3B8G A;  3PFE A;  2DXQ A;  3FIX A;  2CNM A;  2ZED A;  3SXO A;  3WC7 A;  4P45 A;  4OC5 A;  1JWQ A;  4Y49 B;  4A32 A;  4AVB A;  1Q7L A;  2B3U A;  3D68 A;  1XIX A;  1Z5R A;  1IYK A;  2PVV A;  2PJ9 A;  3BJ8 A;  4NJQ A;  5F48 A;  2AFZ A;  3KHX A;  3BI0 A;  5HVH A;  1ELL P;  2K5T A;  3WC6 A;  2O28 A;  4XNH C;  2CF4 A;  4A37 A;  4A94 A;  1YX0 A;  1LAM A;  2FSR A;  4H89 A;  4PXD A;  4UIA A;  4CAV A;  4B14 A;  5JGF A;  2V77 A;  4NFR A;  5G22 A;  3R9E A;  1TF8 A;  3SI0 A;  1CM0 A;  2GLJ A;  2J8M A;  1LRZ A;  1IOI A;  1Z8L A;  1V0C A;  3CZX A;  4RN7 A;  4B5P B;  4CYO A;  4YFJ A;  3B35 A;  4HNW B;  3PB6 X;  1CP7 A;  4NGT A;  4CAE A;  1TF9 A;  1Z2L A;  4UBR A;  5F46 A;  3GIU A;  6CPA A;  3IJ3 A;  3EO4 A;  1B87 A;  2B4D A;  1HDQ A;  4M85 A;  5D8N A;  1VHE A;  5IV0 A;  5JQ4 A;  3GYA A;  4U5Y A;  5HVG A;  3KR4 A;  3FBU A;  1XMT A;  3RNZ A;  4PSW A;  1XMB A;  4KOV A;  2RB7 A;  4Z65 A;  3D2P A;  3A9L A;  1YLE A;  1VHS A;  2RC4 A;  1IYL A;  3H5Z A;  3KZW A;  1A2Z A;  2J8N A;  4MCP A;  4OAE A;  2Z3P A;  1LCP A;  3D4U A;  4E8O A;  5J8F A;  1YQE A;  1X12 A;  4K30 A;  4MHY A;  3RZA A;  4E2A A;  1QQ9 A;  3PB7 X;  3WAB A;  2PC1 A;  2PVW A;  4GS4 A;  1TXR A;  2F5I A;  1FT7 A;  1BO4 A;  2ZOG A;  3D7G A;  4KVO E;  2OR4 A;  3B3W A;  1BAV A;  1S7F A;  4OLL A;  2IMO A;  2REE A;  2AFW A;  2YNC A;  2PJ1 A;  1IGB A;  4PXB A;  1PU9 A;  4BMH A;  2XEJ A;  5LYL A;  1M1D A;  2PIY A;  2POK A;  1S7K A;  3GB0 A;  4LX9 A;  3IO1 A;  1ON0 A;  3H8F A;  3W6S A;  4KOR A;  1AYE A;  3GY9 A;  4MFZ A;  2BSW A;  2WSA A;  3WC5 A;  4P4B A;  4E0A A;  2EBJ A;  2ZW5 A;  4KUA A;  2CTC A;  5LYD A;  3P2H A;  3SXN A;  4YGO A;  1IB1 E;  5D29 A;  2BEI A;  4CYQ A;  2Z11 A;  4AG7 A;  3TE4 A;  4OC2 A;  1Z8X A;  5LRG A;  1MK4 A;  4K3N A;  2PJ2 A;  3IC1 A;  1Y0R A;  3LAC A;  2PJ0 A;  4KSA A;  1XEB A;  4KZT A;  3WR7 A;  3B3T A;  5JPH A;  4MY3 A;  4CPA A;  2ODF A;  3KR5 A;  3FXT A;  1BPM A;  5ISV A;  5J8C A;  2Q4V A;  3JUW A;  2OZH A;  4FD7 A;  3F0A A;  2D4P A;  2EK8 A;  2ZEO A;  1VGY A;  2D4O A;  3PGP A;  4QVT A;  2VZY A;  1VHO A;  2Z10 A;  4U9Y A;  2GIV A;  3SJF A;  4CAX A;  4CS0 B;  4MCR A;  4PV6 A;  5G21 A;  1P4N A;  2XEI A;  5AG5 A;  3QAY A;  4UEF A;  4OIW A;  2JBJ A;  1CBX A;  2BUE A;  2ZEM A;  3S6H A;  4C2X A;  1MJB A;  2CNT A;  1R43 A;  1TKJ A;  3IWW A;  4CGN A;  1IIC A;  4FBE A;  4U9Z A;  3F8K A;  2VBQ A;  2ZEN A;  3PB9 X;  4KS9 A;  4XNH B;  1QSO A;  4XPD C;  3T8W A;  2WZN A;  1S60 A;  5HH1 A;  5FVJ A;  8CPA A;  1QSN A;  5DS0 A;  5A28 A;  2F8H A;  5BWA B;  1VIX A;  3NH8 A;  2VZZ A;  1CG2 A;  1CPS A;  3BHX A;  4MBU A;  2ANP A;  4NJR A;  3TO9 A;  1S5K A;  4JZ0 A;  1HDU A;  4Q7A A;  2Q04 A;  2GRE A;  2JDC A;  2Q4Z A;  1XE4 A;  2BL1 A;  2ZOF A;  4NGP A;  3DDD A;  3KAS A;  4DYO A;  1Z4E A;  2P6E A;  4AB7 A;  3G8W A;  2PJ6 A;  4TWE A;  3TO7 A;  3WT4 A;  5IB0 A;  4KSI A;  1Q2Y A;  1XJO A;  2VXK A;  4NGS A;  4B6Z A;  2Z3O A;  3DR8 A;  2BCO A;  4OC3 A;  4ZY1 A;  3BXM A;  2AFO A;  3GLJ A;  1NSA A;  2Q7S A;  4WWV A;  2OZU A;  4X8I A;  4NCZ A;  5A27 A;  4UCP A;  3PB8 X;  3RO0 A;  1M44 A;  5JM6 A;  3LOD A;  5KTD A;  1N71 A;  3N7Z A;  2C27 A;  5IB9 A;  3G3S A;  4H2K A;  4EME A;  4H6U A;  1Q2D A;  3JVN A;  5LRK A;  5K8P A;  2R98 A;  4KVX A;  4PPZ A;  5K8M A;  3V8I A;  2JDD A;  5AG4 A;  4XPK A;  4RS2 A;  1KWM A;  3FB3 A;  1VKC A;  3CXQ A;  4J3G A;  3TTH A;  1LAP A;  1P0H A;  4MHP A;  3QAH A;  1KZF A;  2PR8 A;  4FD5 A;  4P4D A;  4OME A;  3B7I A;  4XPL A;  3T9Y A;  4A31 A;  3RYO A;  1QST A;  5LRJ A;  2PR1 A;  1Y9K A;  4C7I A;  5KTC A;  3S9N A;  3H4Q A;  1ARL A;  2B4D B;  4UEZ A;  1GYT A;  2BO9 A;  3FEE A;  3PEI A;  4FD6 A;  4MHN A;  1Z4R A;  2WPW A;  4TNU A;  3CDX A;  4ZYQ A;  1YVO A;  2ZW4 A;  1PUA A;  3E0K A;  2ZEP A;  1TKF A;  5AG7 A;  3D7F A;  2YGW A;  1Z8W A;  1XRY A;  3FX6 A;  2CY2 A;  4ZY0 A;  2HV2 A;  5E96 A;  1AMP A;  4BBH A;  2C1C A;  4XPD B;  2PJB A;  1TKH A;  2KCW A;  5F09 A;  2Q7B A;  2ZEF A;  2ABZ A;  3RAM A;  2O53 A;  4R87 A;  3IFE A;  3D66 A;  1U6M A;  2AFX A;  3MN8 A;  2PJC A;  3K2K A;  4F9V A;  2QIR A;  3DR6 A;  3VWD A;  3PRT A;  3CXP A;  1M4D A;  1QSM A;  4KOS A;  5GCN A;  2P6G A;  3NH4 A;  3C26 A;  5F47 A;  3PZJ A;  4W9Y A;  4CGL A;  4PXC A;  1YVK A;  2ZEL A;  4UFW A;  4C7H A;  4JD6 A;  4R6T A;  4YU9 A;  3CT9 A;  2FL4 A;  2NMT A;  2PJ8 A;  3I1U A;  3RBU A;  1ZG8 A;  4OC4 A;  3DNS A;  2B3V A;  2FCK A;  3UY5 A;  4KOU A;  3D2M A;  4P10 A;  3ZZI A;  1IY7 A;  1Y9W A;  1DTD A;  3D8P A;  3IWE A;  4L8A A;  1TIQ A;  4MHD A;  2HUZ A;  2WPX A;  4I49 A;  2PSW A;  1XBU A;  5CBM A;  2R7H A;  4ZBG A;  4F9U A;  2JEW A;  1OBR A;  2EVN A;  3B3V A;  1QSR A;  3IU2 A;  1YGH A;  1UFH A;  4M6G A;  4Q36 A;  2Z3L A;  3FYN A;  2PJ5 A;  4UFV A;  4CRZ B;  5HMN A;  4GM5 A;  4R3K A;  2DPS A;  2PIZ A;  2OB0 A;  2J9A A;  3TFY A;  4AXV A;  2JLM A;  4IAV A;  1LOK A;  2EK9 A;  4JWP A;  4MRI A;  1KUX A;  1K4J A;  3PBB A;  1BOB A;  2B5G A;  4B12 A;  4ONW A;  3BLN A;  3EXN A;  2GAN A;  4A38 A;  4QBJ A;  3VH9 A;  5THW A;  2WYR A;  5DWM A;  4IK2 A;  4MHZ A;  2I79 A;  4JXR A;  5I0C A;  4LUA A;  2I00 A;  2OU2 A;  4NGR A;  4PK3 A;  3BJ7 A;  3SJG A;  2HQY A;  3CPA A;  3CXS A;  4P4F A;  3PBE A;  2CTB A;  4MI4 A;  4JYW A;  3R96 A;  1CX8 A;  3KQX A;  4UWJ A;  4AVA A;  4UF4 A;  4JLY A;  4MFJ A;  3R9F A;  2QYV A;  4R9M A;  4MY0 A;  4X5K A;  1XFO A;  2J8R A;  1F57 A;  4H6Z A;  1Y0Y A;  3KL9 A;  3EFA A;  4OC1 A;  5LYI A;  3DSB A;  5EBV A;  2PJ7 A;  4B10 A;  5G1Z A;  3SI2 A;  2OOT A;  2BOA A;  3IIB A;  4OKO A;  4FD4 A;  5G20 A;  3SI1 A;  2PCU A;  5K8O A;  2XEG A;  2AFS A;  4GXH A;  1CPX A;  3NE8 A;  3FRM A;  1S3Z A;  5DWN A;  4JXQ A;  4HKF A;  4ZY2 A;  1SQH A;  2FT0 A;  2B5G B;  4OC0 A;  5EC4 A;  3CPX A;  4A30 A;  2EO8 A;  4IHM A;  3IU1 A;  5K8N A;  4F0Y A;  3FNC A;  3JTK A;  3BI1 A;  4KLV A;  4A2Z A;  2C6P A;  3IGR A;  2CIJ A;  2AFU A;  1FY7 A;  3D7H A;  4ONU A;  4PK2 A;  2ARH A;  3OWC A;  4UEE A;  3EY5 A;  4KUB A;  4HNX B;  4CAW A;  4R8F A;  1NSL A;  1M4G A;  4CAF A;  1F2P A;  4YRH A;  1MJA A;  4NF1 A;  3K9U A;  3TOA A;  1YSJ A;  4M3S A;  4PQA A;  3TOB A;  3TT2 A;  3W6X A;  2HB6 A;  3FED A;  2PE3 A;  1RO5 A;  2P0W A;  4UCM A;  4P4I A;  2ZPA A;  4X2T A;  4UWI A;  1FNO A;  2Z3N A;  3NH5 A;  1XF8 A;  4F8Z A;  3TO6 A;  3TC8 A;  3FEC A;  2IL4 A;  4EFD A;  2PRQ A;  3NFZ A;  3K9T A;  4KOX A;  1YW4 A;  3N5F A;  2VI7 A;  1UWY A;  2C6G A;  4FWU A;  4O23 A;  2FVG A;  3B2Y A;  4MCS A;  4UIB A;  5AG6 A;  4YWY A;  4MXU A;  4C2Z A;  4RUH A;  2FIW A;  1S7N A;  3R9G A;  5KTA A;  2IQ6 A;  3R1K A;  2Z3K A;  2ZXV A;  4KOY A;  3H8G A;  4Q38 A;  2Q43 A;  2Z3M A;  2ZW7 A;  1EE3 P;  2CXA A;  2G0B A;  4MJ8 A;  4R76 A;  5I4M A;  1S7L A;  1XOV A;  1PYT B;  2AFM A;  3TCV A;  4LQ6 A;  4M6I A;  1BPN A;  4F0X A;  4ORF A;  4G1P A;  2Y0M A;  3ISX A;  5C82 A;  2AJ6 A;  4UCN A;  4CGP A;  1Z8T A;  3I9S A;  1J4J A;  2EUI A;  4MFL A;  4LQG A;  3PFO A;  4FUU A;  3W91 A;  1NMT A;  2H5M A;  4NGN A;  4R7M A;  1M4L A;  3T90 A;  3KI9 A;  2V8G A;  2R8V A;  5ELY A;  1YK3 A;  1YR0 A;  4ZX9 A;  4A33 A;  3EC4 A;  3V7Z A;  3S6G A;  3DLJ A;  1I21 A;  2PDO A;  1QMU A;  3PB4 X;  1KUV A;  3GUX A;  1F2O A;  1Y7E A;  2B4B A;  2QEC A;  3D7D A;  2PQ8 A;  4HNY B;  2ZEH A;  3FMC A;  4MCQ A;  4R57 A;  4B11 A;  2V8V A;  4KOT A;  3VWE A;  3KKW A;  1LAN A;  4A39 A;  2OZG A;  2YND A;  4UFX A;  1ZLH A;  2A4N A;  4ZGY B;  4RI1 A;  3JRU A;  4BD9 A;  2FS5 A;  2F7V A;  4OID A;  4OP4 A;  3I3G A;  4MFP A;  2C6C A;  2OH1 A;  4P6Y A;  4KLW A;  5J1Q A;  2Q51 A;  4CGO A;  3P2F A;  3S9L A;  3NA6 A;  4KVM E;  4X3R A;  5F49 A;  4B13 A;  1CP6 A;  4QC6 A;  2PRB A;  1KUY A;  5EMI A;  1MJ9 A;  2FXF A;  1ZG9 A;  2YNC C;  3FJU A;  4JJX A;  3NE7 A;  2DPT A;  2VL1 A;  3TX8 A;  3KGQ A;  3VAR A;  1B6B A;  2ATR A;  1PCA A;  5CNP A;  4B5O A;  4R3L A;  1HEE A;  3DGV A;  4ZI6 A;  1RTQ A;  4A95 A;  1WK4 A;  2Q44 A;  4HPS A; 
#chains in the Genus database with same CATH homology
 1Y7R A;  1Z9U A;  3QB8 A;  4KSF A;  3GKR A;  4MFK A;  2G3A A;  4C2Y A;  2AE6 A;  4PSX A;  1CJW A;  1I12 A;  3F5B A;  2B58 A;  2YNE A;  4C68 A;  4CYP A;  2G3T A;  3S6F A;  2VEZ A;  4Y49 C;  2ZW6 A;  4QUS A;  4MFQ A;  1RXT A;  4AVC A;  1WWZ A;  1ZO0 A;  2P6F A;  1GHE A;  3R95 A;  5C88 A;  1Q2C A;  5IX3 A;  2FE7 A;  2REF A;  2GE3 A;  3LD2 A;  5J8C A;  5H86 A;  2Q4Y A;  4QB9 A;  1NE9 A;  2R1I A;  3D3S A;  4L89 A;  4DNC A;  3ZJ0 A;  5H84 A;  4EVY A;  4F6A A;  2WUU A;  1L0C A;  4CRY B;  4IUS A;  4CGM A;  4CYN A;  2VQY A;  1R57 A;  2JEV A;  2QML A;  4KOW A;  1I1D A;  2Z0Z A;  2FIA A;  2X7B A;  1M4I A;  4NSQ A;  4B5P A;  3PP9 A;  4AG9 A;  4II9 A;  3S6K A;  2CNS A;  3MGD A;  4NEX A;  2Q0Y A;  4NXY A;  1OZP A;  5AGE A;  4OAD A;  1YRE A;  4IF5 A;  4UA3 A;  1IID A;  3SHP A;  3IWG A;  3B8G A;  2DXQ A;  3FIX A;  2CNM A;  3SXO A;  4Y49 B;  4A32 A;  4AVB A;  2B3U A;  1XIX A;  5F48 A;  1IYK A;  3BJ8 A;  2K5T A;  2O28 A;  4XNH C;  1YX0 A;  2FSR A;  4H89 A;  4CAV A;  4B14 A;  5G22 A;  3R9E A;  1CM0 A;  1LRZ A;  2J8M A;  1V0C A;  4B5P B;  4CYO A;  4YFJ A;  4HNW B;  4CAE A;  4UBR A;  5F46 A;  3EO4 A;  2B4D A;  1B87 A;  4M85 A;  5IV0 A;  5JQ4 A;  3GYA A;  4U5Y A;  3FBU A;  1XMT A;  4PSW A;  4KOV A;  3D2P A;  3A9L A;  1YLE A;  1VHS A;  2RC4 A;  1IYL A;  3H5Z A;  4OAE A;  2J8N A;  2Z3P A;  4E8O A;  5J8F A;  4K30 A;  4E2A A;  2PC1 A;  4GS4 A;  2F5I A;  1BO4 A;  4OLL A;  4KVO E;  1S7F A;  2REE A;  2YNC A;  1PU9 A;  4BMH A;  1M1D A;  1S7K A;  4LX9 A;  1ON0 A;  3W6S A;  4KOR A;  3GY9 A;  4MFZ A;  2BSW A;  2WSA A;  4E0A A;  2ZW5 A;  4KUA A;  3P2H A;  3SXN A;  4YGO A;  1IB1 E;  4CYQ A;  2BEI A;  2Z11 A;  4AG7 A;  3TE4 A;  1MK4 A;  4KSA A;  3WR7 A;  1XEB A;  4KZT A;  5JPH A;  4MY3 A;  3FXT A;  5ISV A;  2Q4V A;  3JUW A;  2OZH A;  4FD7 A;  3F0A A;  2D4P A;  4QVT A;  2D4O A;  3PGP A;  4U9Y A;  2VZY A;  2Z10 A;  2GIV A;  4CAX A;  4CS0 B;  4PV6 A;  5G21 A;  1P4N A;  5AG5 A;  2BUE A;  3S6H A;  4C2X A;  1MJB A;  2CNT A;  4CGN A;  1IIC A;  4U9Z A;  3F8K A;  2VBQ A;  4KS9 A;  4XNH B;  1QSO A;  4XPD C;  1S60 A;  5HH1 A;  5FVJ A;  1QSN A;  5A28 A;  5BWA B;  2VZZ A;  4MBU A;  3TO9 A;  1S5K A;  2Q04 A;  2JDC A;  1XE4 A;  2BL1 A;  3DDD A;  1Z4E A;  2P6E A;  4AB7 A;  3G8W A;  3TO7 A;  5IB0 A;  1Q2Y A;  2VXK A;  2Z3O A;  3DR8 A;  2OZU A;  4NCZ A;  5A27 A;  4UCP A;  1M44 A;  3LOD A;  5KTD A;  1N71 A;  3N7Z A;  2C27 A;  3G3S A;  4H6U A;  1Q2D A;  3JVN A;  2R98 A;  4KVX A;  3V8I A;  2JDD A;  5AG4 A;  4XPK A;  4RS2 A;  3FB3 A;  1VKC A;  3CXQ A;  4J3G A;  3TTH A;  1P0H A;  3QAH A;  1KZF A;  2PR8 A;  4FD5 A;  3T9Y A;  4A31 A;  4XPL A;  3RYO A;  1QST A;  2PR1 A;  1Y9K A;  4C7I A;  5KTC A;  3H4Q A;  2B4D B;  4FD6 A;  1Z4R A;  2WPW A;  1YVO A;  2ZW4 A;  1PUA A;  3E0K A;  5AG7 A;  2YGW A;  2CY2 A;  2HV2 A;  5E96 A;  4BBH A;  4XPD B;  2KCW A;  2Q7B A;  4R87 A;  1U6M A;  2QIR A;  3DR6 A;  3VWD A;  3CXP A;  1M4D A;  1QSM A;  4KOS A;  5GCN A;  2P6G A;  4CGL A;  3C26 A;  5F47 A;  3PZJ A;  1YVK A;  4C7H A;  4UFW A;  4JD6 A;  2FL4 A;  2NMT A;  3DNS A;  2B3V A;  2FCK A;  3UY5 A;  4KOU A;  3D2M A;  3ZZI A;  1Y9W A;  3D8P A;  3IWE A;  4L8A A;  1TIQ A;  4MHD A;  2HUZ A;  2WPX A;  4I49 A;  2PSW A;  2R7H A;  4ZBG A;  2EVN A;  1QSR A;  3IU2 A;  1YGH A;  1UFH A;  4Q36 A;  2Z3L A;  3FYN A;  4UFV A;  4CRZ B;  5HMN A;  4R3K A;  2DPS A;  2OB0 A;  3TFY A;  2JLM A;  4JWP A;  1KUX A;  1K4J A;  1BOB A;  2B5G A;  4B12 A;  3BLN A;  3EXN A;  2GAN A;  4QBJ A;  5DWM A;  5I0C A;  2I79 A;  4JXR A;  4LUA A;  2I00 A;  2OU2 A;  4PK3 A;  3BJ7 A;  2HQY A;  3CXS A;  4MI4 A;  3R96 A;  4UWJ A;  4AVA A;  4JLY A;  4MFJ A;  3R9F A;  4R9M A;  4MY0 A;  4X5K A;  2J8R A;  4H6Z A;  3EFA A;  3DSB A;  5EBV A;  4B10 A;  5G1Z A;  4FD4 A;  5G20 A;  3FRM A;  1S3Z A;  5DWN A;  4JXQ A;  4HKF A;  1SQH A;  2FT0 A;  2B5G B;  5EC4 A;  4A30 A;  3IU1 A;  4F0Y A;  3FNC A;  3JTK A;  4KLV A;  4A2Z A;  3IGR A;  1FY7 A;  4ONU A;  4PK2 A;  2ARH A;  3OWC A;  3EY5 A;  4KUB A;  4HNX B;  4CAW A;  1NSL A;  1M4G A;  4CAF A;  4YRH A;  1MJA A;  4NF1 A;  3K9U A;  3TOA A;  3TOB A;  4M3S A;  3W6X A;  3TT2 A;  1RO5 A;  2P0W A;  4UCM A;  2ZPA A;  4UWI A;  2Z3N A;  1XF8 A;  3TO6 A;  2IL4 A;  4KOX A;  2VI7 A;  5AG6 A;  4C2Z A;  2FIW A;  1S7N A;  3R9G A;  5KTA A;  3R1K A;  2Z3K A;  2ZXV A;  4KOY A;  4Q38 A;  2Z3M A;  2ZW7 A;  2CXA A;  2G0B A;  4MJ8 A;  1S7L A;  3TCV A;  4F0X A;  4ORF A;  2Y0M A;  5C82 A;  2AJ6 A;  4UCN A;  4CGP A;  3I9S A;  1J4J A;  2EUI A;  4MFL A;  3W91 A;  1NMT A;  2H5M A;  3T90 A;  2R8V A;  1YK3 A;  1YR0 A;  4A33 A;  3EC4 A;  3S6G A;  1I21 A;  2PDO A;  1KUV A;  2B4B A;  2QEC A;  4HNY B;  2PQ8 A;  4B11 A;  4R57 A;  4KOT A;  3VWE A;  3KKW A;  2OZG A;  2YND A;  4UFX A;  2A4N A;  4ZGY B;  4RI1 A;  2FS5 A;  3I3G A;  4MFP A;  2OH1 A;  4KLW A;  4CGO A;  3P2F A;  4KVM E;  5F49 A;  4B13 A;  4QC6 A;  2PRB A;  1KUY A;  1MJ9 A;  2FXF A;  2YNC C;  4JJX A;  3NE7 A;  2DPT A;  1B6B A;  2ATR A;  5CNP A;  4B5O A;  4R3L A;  4A95 A;  1WK4 A;  2Q44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...