2Q4ZA

Ensemble refinement of the protein crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 89
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q4zA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q4zA01
1ELLP 3KZWA 2VL1A 4ZY2A 1OBRA 2G9DA 4YWYA 3L2NA 2EK9A 4RUHA 4IK2A 3FF3A 1UWYA 2PJ5A 1AMPA 3D7GA 4NGPA 3V7ZA 1QQ9A 3D67A 3PBBA 4B6ZA 4A94A 3S9NA 2AFXA 4JZ0A 4A38A 3GB0A 2C6CA 4DUKA 2ABZA 3FEEA 4DJLA 3B2YA 5HXDA 1F57A 2OR4A 3H8EA 1CBXA 4R7MA 3SJGA 1DE4C 4LQGA 1DTDA 5K8MA 1BAVA 2ZELA 4OC4A 2GREA 3CT9A 1ZG8A 3WC7A 3BXMA 5D8NA 1FT7A 1KWMA 3SJXA 3IFEA 1XRYA 1LANA 4PQAA 2EK8A 4MCPA 1R43A 3HLPA 4EFDA 4ZY1A 1ARMA 5J1QA 3BI1A 3NA6A 4ZX8A 5CPAA 1BPMA 3GUXA 4NGSA 4OIDA 4IHMA 3PBEA 1XBUA 1IY7A 2I3CA 3D7FA 4F8ZA 2OOTA 5LRJA 4MHZA 3GLJA 3LWUA 4FWUA 4MHYA 5HVGA 2PE3A 1CP6A 4R8FA 1GYTA 2DEAA 1YW4A 3N5FA 3K9TA 4P10A 1Q7LA 4UIBA 4PXDA 4P45A 8CPAA 1CG2A 1XFOA 5JGFA 3NFZA 4P4JA 5DS0A 3ISXA 4KSIA 1Z8LA 2AFOA 3PEIA 4UIAA 3KL9A 5F09A 2ZENA 1ZLHA 1XMBA 3IJ3A 1HDUA 1EE3P 2CTBA 2QVPA 3IIBA 1YLOA 2O4HA 4NGQA 4H2KA 2JBJA 4MCQA 3RBUA 2RB7A 4TWEA 1Y0RA 2JEWA 3D7HA 4PPZA 4UEEA 2POKA 5LRKA 2AFWA 3T8WA 5K8NA 4O23A 3PFOA 3ISZA 2HB6A 5K8OA 2ZEHA 2XEFA 3SI2A 3DLJA 3PRTA 3H8FA 2V77A 3PB4X 3KHZA 1NSAA 4NGNA 2XEJA 4ZY0A 1VIXA 4EWTA 3VARA 2RFHA 3B35A 4YU9A 1JQGA 4WWVA 1Z5RA 4PXEA 2QJ8A 4R76A 2CTCA 3B3WA 1XJOA 2PJ4A 4OIWA 2V8VA 1YW6A 3B3TA 1TXRA 1HEEA 3WC6A 2BO9A 2WZNA 5THWA 3RAMA 4R6TA 2C6GA 5D29A 3KQZA 1ZG9A 3PB9X 4OC2A 4UF4A 2ZOFA 3PB8X 3FX6A 3S9MA 2JBKA 3DGVA 5LYDA 3SI1A 5JM6A 4W9YA 4AXVA 4DYOA 3V38A 2ZOGA 3SJEA 1QMUA 3HUVA 4ONWA 1TF8A 4OC1A 1ELMP 3D66A 4FBEA 2Q51A 2IMOA 4ZX9A 3NH5A 3D7DA 4Z65A 1YMEA 4NJRA 2PJ6A 2PJAA 4A39A 3KGQA 5LYFA 4JYWA 4BD9A 1LCPA 2NSMA 2PVWA 2ZEFA 3FMCA 4ZYQA 3B3VA 2GU2A 4X3RA 5IB9A 4OMEA 2BCOA 1TKFA 4PXCA 1M4LA 1CX8A 3I1UA 1ZG7A 2V8GA 1FNOA 3IC1A 2PJ8A 1ZLIA 3FEDA 1PCAA 3K2KA 3KR4A 4OKOA 2PCUA 1CPXA 3CPXA 2FVGA 3NH8A 3B3SA 5K8PA 5LYLA 2V8HA 2IJZA 2PIZA 1LAPA 2ZEPA 4F9UA 5I4MA 2ZEDA 1PYTB 4MXUA 3PB6X 4P4IA 1IGBA 3KI9A 2F8HA 5HVFA 3NH4A 2PJ0A 4MCSA 1RTQA 4OC3A 1F2PA 3MRUA 3KR5A 2GLFA 3VH9A 4GM5A 2BOAA 2PJ9A 1Y7EA 4UEFA 2PJ7A 4FUUA 4ZI6A 4MHPA 4NGMA 3D4UA 1CP7A 2HC9A 2PJ1A 3JRUA 4IAVA 2C1CA 3FECA 2PIYA 3WC5A 1AYEA 4NGTA 1Z2LA 2QYVA 2XEGA 2PRQA 2ZEGA 4NGRA 2NYQA 2O53A 2AFUA 3IEHA 1R3NA 4EMEA 2PJ3A 3BHXA 4P44A 4X2TA 3LMSA 1HDQA 3SJFA 4FAIA 3FVLA 1VGYA 3KASA 3B3CA 3PFEA 3QNVA 3D68A 4MRIA 2ZEMA 4NFRA 3FH4A 3IWWA 3B7IA 4P4FA 3WABA 2AFZA 1ARLA 4OC0A 4P4EA 3H8GA 2AFMA 3MN8A 3CDXA 4K3NA 1LFWA 2IQ6A 3VATA 1YSJA 5HVHA 1LAMA 1VHOA 4CPAA 2EWBA 3IO1A 4NJQA 3S9LA 2WYRA 2CIJA 3CPAA 7CPAA 4OC5A 3FJUA 2Q4ZA 4Q7AA 4MHNA 3KQXA 4F9VA 3RZAA 2F7VA 2XEIA 4X8IA 5ELYA 5CBMA 2ANPA 3WT4A 4UEZA 2ZEOA 1F2OA 4MMOA 2PJ2A 2GLJA 6CPAA 2PJBA 2J9AA 2V8DA 2PVVA 1VHEA 2ZEEA 4G1PA 4P4DA 3TC8A 5JH9A 4TNUA 1H8LA 2PJCA 4WJBA 5LRGA 3PB7X 4P6YA 3SI0A 5LYIA 4P4BA 1TKHA 1TF9A 4MCRA 3KHXA 1LOKA 4PXBA 3TX8A 1BLLE 2Q43A 1BPNA 1Y0YA 4A37A 2AFSA 2C6PA 1TKJA 3BI0A 2CF4A 4OP4A 1CPSA
chains in the Genus database with same CATH superfamily
1XIXA 2E2JI 1KQSZ 2DXQA 1Y8CA 3L2NA 1V0CA 4CYOA 1CJWA 1QQ9A 2K5RA 3PBBA 3S9NA 4MJ8A 4NBCA 2QR1B 3W6SA 1YI2Z 1QSNA 3SJGA 2ZW4A 3I9SA 4NB9A 4A95A 2R7ZI 2NAPA 2PDOA 4CYPA 5AG5A 2GREA 3CT9A 1ZG8A 2Q04A 5F47A 4CAFA 1FT7A 2AKLA 2H5MA 2Z3OA 4PQAA 1VQOZ 2CNTA 4MCPA 4BY7I 2B3VA 3BI1A 1B87A 5CPAA 3HOXI 1BPMA 3EXNA 1VQK1 3CCL1 3GKQA 4MONA 5F46A 1X3WA 2OZGA 1NSLA 1XBUA 2I3CA 4RVGA 1J4JA 2PE3A 3CCM1 1VQ9Z 1YW4A 3NE7A 4AVBA 1N2FA 2OZUA 2ZPAA 3N7ZA 1TWHI 1XFOA 4FD4A 2YU9I 4YRHA 4P4JA 1Q2CA 3S6KA 1VQ7Z 3ISXA 3F3FC 1XMBA 3IJ3A 1HDUA 2CTBA 3EO4A 4CGPA 3CCJZ 2QA4Z 4H2KA 3S1MI 4MCQA 1TWGI 3RBUA 2V8IA 3I07A 4TWEA 3D7HA 2WPWA 3M4OI 4UEEA 2POKA 5LRKA 2OH1A 2QEXZ 1KQSY 4AVCA 2GTIA 4MD8A 3FRMA 2JDDA 2JA6I 2HB6A 1MJAA 3GTMS 5EBVA 4A33A 2QREB 2VUMI 3PB4X 4HKFA 3J81b 3GTJI 3T90A 1NJI1 2PSWA 3EERA 4WWVA 2QJ8A 1USPA 4MBUA 3RZDI 1MK4A 4BBHA 1M4IA 2AYDA 4CYNA 1HEEA 4Q36A 5ISVA 2FIAA 4R6TA 2C6GA 4M6GA 2GFQA 4E2YA 4B10A 2ZOFA 2Z10A 3CXSA 5LYDA 1YIT1 2LEXA 1DL6A 5H86A 3CC4Z 2Q0YA 4OADA 1TF8A 3G4SZ 2Q51A 2IMOA 1YJWZ 5IV0A 3FQMA 3T9YA 3D7DA 4Z65A 2V3VA 2NMTA 1YMEA 2PJ6A 4HNWB 5LYFA 2QKDA 3JUWA 4ONUA 2W04A 1YUAA 2FSRA 4PXCA 2V8GA 2G3AA 2PJ8A 3CCQ1 4L89A 1KC82 1P4NA 3BG1B 3KR4A 5HMNA 2QEX1 2NVQI 5LYLA 2J8MA 2PIZA 2ZEPA 5I4MA 3VWEA 3FQQA 1Y1WI 4P4IA 2F8HA 4X6AI 2Q4YA 2JMOA 3NH4A 3CME1 3RYOA 1SFOI 3KR5A 4UFXA 4NCZA 3BLNA 3TOAA 2PJ9A 2V8JA 3ZZIA 1RO5A 1RQFA 2IV2X 3BJ7A 3GTPI 4DK1A 4BY1I 3HKZA 2PIYA 3I56Z 1S7MA 3P2HA 4MY0A 3NDIA 1VQ61 4NGRA 5G22A 1VQM1 4MFLA 1JWQA 2O53A 4NEXA 4NBDA 3IEHA 4YFJA 3BHXA 2VZYA 2X7BA 1VGYA 3PFEA 3QNVA 1Y1VS 2EVNA 3CCE1 4KVME 4UFWA 3VMHA 2AFZA 4OC0A 5KTDA 4NBGA 4AYBA 5HVHA 3CMAZ 3IO1A 3F5BA 4NJQA 5DWMA 4KOYA 1ML8A 2CIJA 3GY9A 4OC5A 2R93I 2I79A 4MHNA 3F8KA 4F9VA 2XEIA 1RO2A 4RS4A 4LUAA 1YX0A 5ELYA 2ANPA 1Z8TA 3WT4A 4UEZA 3GTOI 2EO8A 2Z3MA 4PSWA 4MMOA 2PJ2A 4CAVA 1Z4EA 1Q7Y1 1R9TI 4CRZB 2J9AA 2JEVA 1WK4A 1VHEA 4MD9A 2PJCA 2OTJZ 4XPDC 4AG9A 2OTL1 2YADA 4P4BA 1TKHA 3SXOA 1TF9A 4MCRA 2R1IA 3TDHB 3I55Z 3D2PA 2FIWA 2FE7A 1N71A 4H6UA 3S2HI 5J8CA 3NE8A 2VEZA 4A37A 3CC71 3I3GA 5IP7I 2C6PA 4E2AA 3GTLI 3R9FA 4KOXA 4ORFA 2JNYA 2VBQA 1CPSA 3D9XA 1VQLZ 2DPSA 1XEBA 3S16I 4NBEA 4RUHA 3FF3A 1UWYA 4NF1A 1AMPA 1YJNZ 1XMTA 3QB8A 3V7ZA 4HGYA 1YHQZ 3D3SA 2QRDB 4A94A 4A38A 1NJI2 3DR6A 2GE3A 3R1KA 4DUKA 3CD6Z 3B8GA 3GTQI 3DDDA 3PZJA 1CBXA 5G1ZA 5H84A 2YNCA 1DTDA 3DR8A 3J80b 2YGWA 2J6AA 5CM2M 3JAMb 1JWHC 1BAVA 2QLVB 4C2ZA 5F49A 1KUVA 4CL1A 3SJXA 2E9HA 2JA5I 1FDOA 1LANA 4KLVA 1CM0A 2EK8A 4NSQA 1R43A 1LRZA 5C3EI 4MFPA 4ZY1A 4KVOE 5J1QA 3VB9A 2QRCB 2VPWA 4B5PB 3TO9A 1N8R1 2Q7BA 4LX9A 2QIRA 4PK2A 4KOWA 5FVJA 1S7KA 1IY7A 4A2ZA 4UWJA 2OOTA 4CRYB 1SIWA 3CZXA 3CCV1 3G3SA 5LRJA 1K8A2 4MHZA 3GLJA 4UA3A 4MHYA 1CP6A 1S3ZA 4CYQA 2Z3LA 3IX0A 3H0GI 1Q7LA 4PXDA 1JJ2Y 1Z8WA 4MHDA 4P45A 2RC4A 8CPAA 5FLMI 5JGFA 4R87A 4KSIA 1WWZA 2AFOA 3TE5B 1VQ8Z 4UIAA 2ZENA 3KIHA 4K30A 4PV6A 2P0WA 2JBJA 3CCJ1 2VPZA 1Y0RA 2R7HA 2EGTA 2WUUA 5K8NA 3S15I 4O23A 2Z3NA 2XEFA 2JIQA 4C68A 3U50C 1M1K1 4ZBGA 4C2YA 4ZY0A 1VIXA 4EWTA 2ARHA 1VQP1 4EWCA 3VARA 2DF5A 1Q16A 2VUGA 2ZW6A 1JQGA 1YJW1 4QVTA 2K3RA 3LACA 2ODFA 2JA8I 3FNCA 2V8VA 4OIWA 2PM9A 3SXNA 4MD7A 4BXXI 4KOSA 2A4NA 2BO9A 2B63I 5THWA 2IL4A 2R98A 4NBFA 3BJ8A 1I6HI 3IF8A 4AVAA 3PB8X 2REFA 2B4BA 5C82A 4UFVA 3SI1A 5JM6A 4W9YA 3HOYI 2JDCA 1QXFA 2IZ4A 1QMUA 1TIQA 3HUVA 4ONWA 2LFUA 4A3GI 4OC1A 5LL6f 1PU9A 1ELMP 4J3GA 3D66A 1QSOA 1M1K2 4MFJA 4BBSI 4E2WA 4NBAA 2Z3KA 2E7ZA 1LCPA 2NSMA 2PVWA 3TO6A 1Y9KA 2B3UA 4ZYQA 2GU2A 3S2DI 2G3TA 1CX8A 4RS2A 1ZG7A 1FNOA 3FEDA 4KUAA 4OKOA 1Z8XA 2OU2A 5A27A 2OOYB 2W03A 2Y0MA 2QA41 3B3SA 4F6AA 3GTMI 1LAPA 4F9UA 1PYTB 1WZNA 2GIVA 1IGBA 1RNIA 5C88A 1RTQA 2PMZA 2VZZA 5IB0A 3CMEZ 1IU8A 2GLFA 1Q2DA 1U6MA 4I49A 4GM5A 1I12A 1Y7EA 4H6ZA 4HNYB 2NVXI 3D2LA 1VHSA 4FUUA 4AG7A 3IFUA 4A30A 3JRUA 1IIDA 4XX2A 4FD7A 3WC5A 1Z2LA 5IP9I 2QYVA 2PRQA 3HOUI 2JIRA 2NYQA 1VQ6Z 3EFAA 2YNCC 2B4DA 4EMEA 4U9ZA 4X2TA 3VWDA 3CXCY 3LMSA 3SJFA 3FVLA 1YK3A 3G8WA 2P6EA 1YQEA 4MRIA 4R3KA 3B7IA 4U5YA 3WABA 2AFMA 1QSTA 2VQYA 2WPXA 3FB3A 4K3NA 2VPXA 2IQ6A 1YSJA 4A3BI 1N8R2 1LAMA 2EWBA 1PFTA 2PR8A 4B12A 1OZPA 3IU2A 4RVDA 1K731 2Q7SA 4Q7AA 4JXQA 3DSBA 2C27A 2F7VA 1KUYA 4CAEA 1XF8A 3CCUZ 4X8IA 3TCVA 3CC7Z 1JJ2Z 3W91A 2OB0A 1X10A 1VQKZ 2PJBA 3TTHA 4UCPA 2PVVA 4G1PA 4TNUA 5T6BA 4JJXA 4WJBA 2RT9A 4KOUA 5FLXf 2KI7B 4KORA 3PP9A 3J80f 5IX3A 4PXBA 3TX8A 4A32A 3JAMf 1BLLE 1YUKA 1AA6A 1Y0YA 4C7IA 1VQPZ 3E0KA 1TKJA 4MY3A 3BI0A 5EC4A 1S5KA 3FKII 1ELLP 1ZO0A 3KZWA 4MH4A 2QECA 3JTKA 2G9DA 2PR1A 2AE6A 3J7A4 1VQ71 1VQ51 4NGPA 1Q811 3ZJ0A 5G21A 2BJOA 4JD6A 2HU9A 5BWAB 4B6ZA 4MI4A 3G711 2AFXA 4B5OA 1K4JA 1QVGZ 2ABZA 3FEEA 3B2YA 5HXDA 1F57A 2OR4A 4EVYA 4R7MA 4M6IA 1DE4C 4LQGA 1FDIA 3A9LA 2ZELA 1BOBA 3BXMA 4OAEA 2BSWA 4NB8A 3IFEA 2ZW7A 5KTCA 2I00A 2EUIA 1ZB9A 4E2ZA 3MGDA 3HLPA 1M4GA 1S7NA 2G2KA 3PGPA 1VQ81 3GUXA 3I4NI 2JS4A 5A2Qf 2HV2A 3D8PA 3LD2A 2R92I 3D7FA 2JIMA 1VLAA 4C7HA 3LWUA 5HVGA 4R8FA 1IB1E 3CCRZ 4B14A 1QVFY 2Y0SA 3TT2A 4IUSA 4KS9A 1CG2A 1KC81 3CCQZ 5HH1A 2E2II 3PEIA 4XPDB 4NBBA 4A3CI 1VQMZ 5F09A 4B5PA 4RV9A 1ZLHA 2WAQA 1EE3P 2QVPA 2GANA 3IIBA 3QAHA 1YLOA 1RO4A 4NGQA 1RLYA 5C44I 2RB7A 2JEWA 4BBRI 4PPZA 4UCNA 2IZ3A 1YJN1 3PFOA 4CGOA 3ISZA 5D1PA 5K8OA 3SI2A 3DLJA 3FXTA 4R57A 2VPYA 3H8FA 4NH1C 5D1OB 4NGNA 4KOTA 4Q38A 3UY5A 1M1DA 1I21A 4XPKA 1I1DA 4JLYA 4C2XA 3F3PC 4JWPA 1YIJ1 4Y49B 3GCFA 4A3II 2DE6A 4R76A 1Q861 2CTCA 3B3WA 3SHPA 4E8OA 3GKRA 3CCLZ 3WC6A 1YI21 4NOZA 5JQ4A 3HOZI 3KKWA 5D29A 3CCSZ 3PB9X 3CCMZ 4UF4A 3FX6A 2JBKA 3CCEZ 4A3KI 2FL4A 2K5TA 4KUBA 4MFQA 4AXVA 4DYOA 2D4OA 3RNZA 2VF1A 3V38A 1W2BY 2ZOGA 1X0TA 2Q44A 2Z11A 4F0YA 1TWAI 4QC6A 1PUAA 4E32A 4FBEA 3VTNA 3TO7A 1NE9A 4ZX9A 5G20A 1I50I 4KVXA 3NH5A 4Y7NI 4E0AA 4E30A 3CC41 4OLLA 2PJAA 4KSFA 3KGQA 1A2ZA 3PO3I 4FD6A 1NMTA 4QBJA 5AG6A 1KUXA 4OMEA 1M4LA 2F4MA 5E96A 1VQ5Z 1PCAA 5AGEA 1ZB8A 1RXTA 1CPXA 3CPXA 3FIXA 3CC2Z 5K8PA 1Z01A 5C4XI 4PK3A 2V8HA 2IJZA 2LIYA 1YR0A 3TOBA 4A31A 3PB6X 1K9M1 1UFHA 3ESWA 4M85A 1WJ2A 1Q862 5HVFA 4PSXA 1R57A 2HUZA 4QB9A 3GTGI 3CCU1 2BOAA 3I561 3JVNA 3IGRA 4UEFA 2PJ7A 3TE4A 4MHPA 4NGMA 3D4UA 4JXRA 1QVGY 1TWCI 2HC9A 4LQ6A 4AB7A 3FECA 2ZXVA 2JUBA 3CXQA 1AYEA 3S1NI 2BEIA 3HOWI 5CNPA 2ZEGA 2Z3PA 4QTTA 5IT9b 4M6HA 3IWEA 1X12A 2AFUA 3F0AA 2Z0ZA 1HDQA 2AJ6A 1I3QI 3P2FA 3D68A 4NFRA 2F4OA 2GTHA 4A3LI 4P4FA 3CCR1 1ARLA 3H8GA 5FLXb 2BUEA 3CDXA 1X3ZA 1VHOA 4XPLA 3H4QA 3FJUA 2Q4ZA 4CAXA 2B58A 1YJ91 1KZFA 5T67A 2B5GA 3G4S1 2JR6A 2CNMA 4KZTA 3GIUA 4DNCA 2B5GB 2ZEOA 3QWUA 1F2OA 2JA7I 4A3DI 4M3SA 3HOVI 2V8DA 4CGMA 3M3YI 1Q2YA 1L1OC 1KD12 5JH9A 4RVFA 3CCVZ 1H8LA 3H3VJ 4P6YA 5LYIA 2FS5A 3S6GA 3KHXA 1WCMI 3G71Z 4GXHA 3OWCA 5D1OA 2NVTI 3VMIA 1YREA 4B11A 1RO0A 2ATRA 3G6E1 4OP4A 2PRBA 1QSRA 3K7AI 3IR7A 2PQ8A 3I4MI 2VL1A 4ZY2A 1BO4A 1OBRA 4YWYA 3VMGA 2EK9A 4IK2A 2PJ5A 2YNDA 3D7GA 3P5JB 2RPRA 5A2Qb 2R8VA 2WB1A 1GHEA 1M4DA 3D67A 4JZ0A 1VQL1 2JLMA 3GB0A 2C6CA 3CXPA 2PK7A 4A3MI 5GCNA 3DNSA 2V45A 1YLEA 2VXKA 4DJLA 3H8EA 1IYLA 3T4NB 1YHQ1 4FD5A 5K8MA 3MONA 4OC4A 3KIFA 2DE7A 2FCKA 3WC7A 5D8NA 4R9MA 1VQ4Z 1NUIA 3GYAA 1KWMA 4GS4A 1XRYA 3D6WA 3S6HA 2EBJA 4EFDA 3LUSA 3S1RI 1S72Z 2YNEA 1ARMA 4R3LA 5KTAA 4DGLA 5C4JI 1VQ41 3NA6A 4ZX8A 1KRLA 4CGLA 4CS0B 1Z02A 4KSAA 5T64A 4NGSA 4OIDA 1M901 4IHMA 3PBEA 5J8FA 4F8ZA 2ZW5A 1VQ91 2OTJ1 2WSAA 5DWNA 4FWUA 3MZLB 4IF5A 4DQYB 1GYTA 2DEAA 1TWFI 3N5FA 3K9TA 4P10A 4UIBA 1VQO1 1YVOA 2J8NA 4KLWA 1W2BZ 2FT0A 4E31A 4RN7A 3NFZA 3C26A 5DS0A 1S60A 2P6FA 1Z8LA 4UBRA 3CXCZ 2BL1A 1K8A1 2RIQA 3KL9A 3Q87A 2O4HA 1S721 3CD61 4HGZA 5AN9F 3R9EA 4A3JI 3RO0A 2VI7A 2CNSA 2AFWA 3T8WA 3RZOI 2V8KA 1ZH1A 3OW2Y 2Q4VA 1Y9WA 2QMLA 1TFIA 2ZEHA 1XE4A 4H89A 4QUSA 3PRTA 2V77A 4RI1A 3CPWZ 2CXAA 3KHZA 1NSAA 4Y52I 2XEJA 2RFHA 2CY2A 3B35A 3IU1A 3K9UA 2OZKA 4YU9A 1YJ9Z 5A28A 3CC21 3FBUA 1Z5RA 3I551 4PXEA 1XJOA 2PJ4A 1YW6A 3B3TA 3FYNA 1TXRA 2HQYA 2J8RA 2WZNA 2O28A 1LQLA 3RAMA 2M6NA 2RBLA 1QYPA 3KQZA 3R95A 3TFYA 1ZG9A 2D4PA 4OC2A 5EMIA 4X5KA 3S9MA 3DGVA 4L8AA 1Z4RA 1AUGA 3SJEA 2OZHA 1FY7A 4MFZA 1XOVA 3OW2Z 4RVHA 4HPSA 2H85A 4KOVA 1S7FA 1KD11 4NJRA 4A39A 3J81f 3G6EZ 1K732 1B6BA 4JYWA 4BD9A 4BMHA 2ZEFA 4II9A 3FMCA 3WR7A 4A3FI 3B3VA 1ON0A 4X3RA 5IB9A 2BCOA 1TKFA 3I1UA 3IC1A 5IT9f 3PO3S 1ZLIA 4A3EI 3K2KA 4Y49C 4S1TA 3R9GA 2PCUA 1YIJZ 2FVGA 3NH8A 4UWIA 2B4DB 1USPB 2ZEDA 3S17I 4MXUA 1YVKA 3KI9A 3NDJA 4ZGYB 2PJ0A 4MCSA 2RHBA 2M48A 4OC3A 1F2PA 3R96A 3MRUA 2JIPA 3VH9A 4E2XA 1WIIA 2ZAEB 1MJ9A 1VQNZ 1Q7Y2 4MFKA 5JPHA 4U9YA 2KPIA 3BG0B 1WW9A 4HNXB 1Z9UA 4ZI6A 4CGNA 1K9M2 1CP7A 2PJ1A 5AG7A 4IAVA 2C1CA 1MJBA 2DE5A 2FXFA 4NGTA 3H5ZA 3IWGA 2XEGA 3EY5A 1P9NA 2NVYI 1VQN1 2DPTA 2F5IA 1SQHA 1Q812 1QSMA 1L0CA 1R3NA 2PJ3A 4P44A 3EEDA 4FAIA 3B3CA 3KASA 5AG4A 3V8IA 1Q821 2ZEMA 3FH4A 3IWWA 4XNHC 1QVFZ 2OOXB 4P4EA 4NXYA 3MN8A 1LFWA 3VATA 4B13A 1Y1VI 3CMA1 5F48A 4CPAA 4BINA 3S9LA 2WYRA 3S14I 1Q822 1S7LA 3CPAA 7CPAA 1NP6A 3KQXA 3RZAA 1YGHA 1P0HA 4UCMA 5CBMA 1Z03A 1M902 5I0CA 3EC4A 2P3YA 1IICA 2GLJA 6CPAA 2P28A 2P6GA 4CAWA 1M44A 4QTUA 1IOIA 2JIOA 3CQZI 2ZEEA 4P4DA 3TC8A 2KCWA 3D2MA 2HF1A 3MZKB 2OTLZ 1VKCA 5LRGA 4E33A 3PB7X 3SI0A 3S6FA 4NBHA 2E2HI 3S1QI 3GTKI 4A93I 3W6XA 1K83I 1IYKA 1LOKA 3LODA 2PC1A 1Y7RA 4HH4A 4YGOA 1QF8A 2Q43A 1BPNA 4XNHB 3PO2I 4F0XA 2REEA 2R6MA 1YITZ 3CPWY 2AFSA 3QAYA 2CF4A 2G0BA 1IOFA 3CCS1
chains in the Genus database with same CATH topology
3FKII 1VQLZ 1ELLP 3I4MI 3KZWA 2VL1A 4MH4A 2E2JI 1KQSZ 4ZY2A 1OBRA 2G9DA 3S16I 3L2NA 3VMGA 4YWYA 4NBEA 2EK9A 4RUHA 4IK2A 3FF3A 1UWYA 2PJ5A 3J7A4 1YJNZ 1AMPA 1VQ71 3P5JB 1VQ51 3D7GA 1Q811 4NGPA 2RPRA 3V7ZA 4HGYA 5A2Qb 1QQ9A 2BJOA 2WB1A 2K5RA 1YHQZ 2QRDB 3D67A 2HU9A 3PBBA 4B6ZA 4A94A 3S9NA 3G711 2AFXA 4JZ0A 1VQL1 4A38A 1NJI2 3GB0A 2C6CA 4DUKA 3CD6Z 2PK7A 1QVGZ 4A3MI 2ABZA 3GTQI 4NBCA 2QR1B 3FEEA 4DJLA 3B2YA 5HXDA 1F57A 2OR4A 3H8EA 1CBXA 1YI2Z 3T4NB 4R7MA 1YHQ1 3SJGA 1DE4C 4LQGA 1DTDA 4NB9A 3J80b 2R7ZI 2J6AA 3MONA 5CM2M 5K8MA 3JAMb 1JWHC 1BAVA 2QLVB 2ZELA 4OC4A 3KIFA 2DE7A 2GREA 3CT9A 1ZG8A 3WC7A 3BXMA 5D8NA 4CL1A 1VQ4Z 1NUIA 1FT7A 2AKLA 4NB8A 1KWMA 3IFEA 3SJXA 2E9HA 1XRYA 3D6WA 2JA5I 1LANA 4PQAA 1ZB9A 1VQOZ 4E2ZA 2EK8A 4MCPA 1R43A 3HLPA 4EFDA 3LUSA 2G2KA 5C3EI 4BY7I 3S1RI 4ZY1A 1S72Z 1ARMA 5J1QA 3BI1A 3VB9A 4DGLA 5C4JI 1VQ41 2QRCB 1VQ81 1KRLA 3NA6A 5CPAA 4ZX8A 3HOXI 1BPMA 3GUXA 3I4NI 1Z02A 1VQK1 2JS4A 5T64A 3CCL1 3GKQA 4NGSA 4OIDA 4MONA 5A2Qf 1M901 1X3WA 1N8R1 4IHMA 3PBEA 2R92I 1XBUA 1IY7A 2I3CA 3D7FA 1VLAA 4F8ZA 2OOTA 5LRJA 3CCV1 1K8A2 4MHZA 4RVGA 3GLJA 1VQ91 3LWUA 2OTJ1 4FWUA 4MHYA 5HVGA 2PE3A 3CCM1 3MZLB 1CP6A 4R8FA 4DQYB 1VQ9Z 1GYTA 3CCRZ 2DEAA 1YW4A 1TWFI 3H0GI 3IX0A 3N5FA 3K9TA 4P10A 1Q7LA 4UIBA 4PXDA 1VQO1 1JJ2Y 1QVFY 2Y0SA 4P45A 1N2FA 8CPAA 5FLMI 1TWHI 1CG2A 1W2BZ 1XFOA 2YU9I 4E31A 5JGFA 3NFZA 4P4JA 1KC81 5DS0A 1VQ7Z 3ISXA 4KSIA 3CCQZ 1Z8LA 2AFOA 3F3FC 3CXCZ 2E2II 3PEIA 1K8A1 2RIQA 4NBBA 3TE5B 1VQ8Z 1VQMZ 4A3CI 4UIAA 3KL9A 5F09A 2ZENA 4RV9A 1ZLHA 1XMBA 3IJ3A 2WAQA 1EE3P 1HDUA 3KIHA 2CTBA 2QVPA 3IIBA 3Q87A 1YLOA 3CCJZ 2O4HA 1S721 3CD61 1RO4A 2QA4Z 4NGQA 4HGZA 5AN9F 3S1MI 1TWGI 2JBJA 2V8IA 3I07A 1RLYA 3CCJ1 5C44I 4MCQA 4A3JI 3RBUA 2RB7A 4TWEA 1Y0RA 2JEWA 3D7HA 2EGTA 4BBRI 3M4OI 4PPZA 4UEEA 2POKA 5LRKA 2IZ3A 2AFWA 3T8WA 1YJN1 3RZOI 2QEXZ 1KQSY 5K8NA 2V8KA 2GTIA 3S15I 4MD8A 4O23A 3PFOA 1ZH1A 3OW2Y 3ISZA 2JA6I 2HB6A 5D1PA 1TFIA 5K8OA 2ZEHA 2XEFA 3SI2A 3GTMS 3DLJA 3PRTA 3H8FA 3U50C 2V77A 2QREB 1M1K1 4NH1C 2VUMI 3PB4X 3CPWZ 5D1OB 3KHZA 1NSAA 4Y52I 2XEJA 4NGNA 4ZY0A 1VIXA 4EWTA 1VQP1 3J81b 3GTJI 4EWCA 3VARA 2VUGA 2RFHA 1NJI1 3F3PC 3B35A 1YIJ1 2OZKA 4YU9A 1YJ9Z 1JQGA 3GCFA 3EERA 1YJW1 4WWVA 3CC21 1Z5RA 4A3II 3I551 4PXEA 2DE6A 2QJ8A 4R76A 1USPA 1Q861 2CTCA 3B3WA 2K3RA 1XJOA 2PJ4A 3RZDI 2JA8I 4OIWA 2V8VA 1YW6A 2PM9A 3B3TA 1TXRA 3CCLZ 4MD7A 1HEEA 4BXXI 3WC6A 2BO9A 2WZNA 1LQLA 2B63I 1YI21 5THWA 4NOZA 2M6NA 3RAMA 4R6TA 2RBLA 3HOZI 2C6GA 1QYPA 3KQZA 5D29A 4E2YA 4NBFA 3CCSZ 1I6HI 1ZG9A 3PB9X 3IF8A 3CCMZ 4OC2A 2ZOFA 3PB8X 3FX6A 4UF4A 2JBKA 3CCEZ 4A3KI 3DGVA 3S9MA 5LYDA 1YIT1 3SI1A 5JM6A 4W9YA 1DL6A 4AXVA 4DYOA 3HOYI 2VF1A 3CC4Z 3V38A 2IZ4A 1W2BY 2ZOGA 1X0TA 3SJEA 1QMUA 3HUVA 4ONWA 1TWAI 2LFUA 1TF8A 4A3GI 4OC1A 5LL6f 1ELMP 3D66A 4E32A 3G4SZ 4FBEA 3VTNA 3OW2Z 2Q51A 2IMOA 4RVHA 1YJWZ 4ZX9A 1M1K2 2H85A 1I50I 3FQMA 3NH5A 4BBSI 1KD11 4Y7NI 4E2WA 3D7DA 4Z65A 4E30A 3CC41 1YMEA 4NJRA 2PJ6A 2PJAA 4A39A 3J81f 3KGQA 3G6EZ 5LYFA 4NBAA 1K732 3PO3I 2QKDA 4JYWA 4BD9A 1LCPA 2NSMA 2PVWA 2ZEFA 3FMCA 2W04A 1YUAA 4ZYQA 4A3FI 2GU2A 3B3VA 4X3RA 4OMEA 3S2DI 5IB9A 2BCOA 1TKFA 4PXCA 1M4LA 1CX8A 3I1UA 2F4MA 1ZG7A 2V8GA 1FNOA 3IC1A 5IT9f 2PJ8A 3PO3S 3CCQ1 1ZLIA 4A3EI 1VQ5Z 1PCAA 3FEDA 3K2KA 1KC82 3BG1B 3KR4A 4OKOA 1ZB8A 4S1TA 2PCUA 2QEX1 1CPXA 2NVQI 3CPXA 1YIJZ 2FVGA 3NH8A 2OOYB 2W03A 3CC2Z 2QA41 3B3SA 1Z01A 5K8PA 5C4XI 5LYLA 2V8HA 3GTMI 2IJZA 2PIZA 2LIYA 1LAPA 2ZEPA 1USPB 2ZEDA 4F9UA 1PYTB 3FQQA 5I4MA 3S17I 1Y1WI 4MXUA 3PB6X 4P4IA 1IGBA 1RNIA 3KI9A 3NDJA 1K9M1 3ESWA 2F8HA 1Q862 4X6AI 5HVFA 2JMOA 3NH4A 2PJ0A 4MCSA 2RHBA 2M48A 1RTQA 2PMZA 4OC3A 1F2PA 3CME1 1SFOI 4H2KA 3MRUA 3KR5A 3CMEZ 2GLFA 3GTGI 3VH9A 4E2XA 4GM5A 3CCU1 2BOAA 2V8JA 1WIIA 2ZAEB 3I561 1Y7EA 2PJ9A 1VQNZ 4UEFA 1RQFA 1Q7Y2 2PJ7A 2NVXI 2KPIA 3BG0B 4FUUA 3GTPI 1WW9A 4ZI6A 4MHPA 4NGMA 3D4UA 1K9M2 1QVGY 1CP7A 1TWCI 2HC9A 2PJ1A 3IFUA 3JRUA 4IAVA 4DK1A 4XX2A 2C1CA 4BY1I 3HKZA 3FECA 2JUBA 2PIYA 3WC5A 2DE5A 1AYEA 3I56Z 4NGTA 1S7MA 1Z2LA 5IP9I 2QYVA 3S1NI 2XEGA 3NDIA 2PRQA 1P9NA 2NVYI 1VQN1 3HOWI 3HOUI 1VQ61 2ZEGA 4NGRA 2NYQA 4QTTA 5IT9b 1VQM1 1VQ6Z 2O53A 1Q812 4NBDA 2AFUA 3IEHA 1R3NA 4EMEA 2PJ3A 3BHXA 4P44A 4X2TA 3EEDA 3CXCY 3LMSA 1HDQA 3SJFA 4FAIA 3FVLA 1VGYA 3B3CA 3KASA 3PFEA 1I3QI 3QNVA 1Y1VS 3D68A 3CCE1 1Q821 4MRIA 2ZEMA 4NFRA 3FH4A 3IWWA 2F4OA 2GTHA 4A3LI 3B7IA 4P4FA 1QVFZ 3VMHA 3WABA 3CCR1 2AFZA 1ARLA 4OC0A 2OOXB 4P4EA 3H8GA 2AFMA 5FLXb 3MN8A 3CDXA 4K3NA 1LFWA 2IQ6A 3VATA 1Y1VI 4NBGA 4AYBA 1YSJA 5HVHA 4A3BI 3CMA1 1N8R2 1LAMA 1X3ZA 1VHOA 4CPAA 2EWBA 1PFTA 3CMAZ 3IO1A 4NJQA 3S9LA 4RVDA 2WYRA 3S14I 1Q822 1K731 1ML8A 2CIJA 3CPAA 7CPAA 4OC5A 2R93I 3FJUA 2Q4ZA 4Q7AA 4MHNA 1NP6A 1YJ91 3KQXA 4F9VA 3RZAA 2F7VA 2XEIA 1RO2A 5T67A 4RS4A 3G4S1 2JR6A 3CCUZ 4X8IA 5ELYA 5CBMA 3CC7Z 1Z03A 1M902 2ANPA 3WT4A 1JJ2Z 4UEZA 3GTOI 2ZEOA 3QWUA 1F2OA 4MMOA 2JA7I 2PJ2A 1VQKZ 2P3YA 2GLJA 6CPAA 2P28A 1Q7Y1 1R9TI 2PJBA 4A3DI 2J9AA 4QTUA 3HOVI 2V8DA 3CQZI 2PVVA 1VHEA 3M3YI 2ZEEA 1L1OC 1KD12 4G1PA 4P4DA 3TC8A 5JH9A 2HF1A 4RVFA 4TNUA 5T6BA 3CCVZ 1H8LA 3MZKB 4MD9A 2OTLZ 2OTJZ 3H3VJ 2PJCA 4WJBA 5LRGA 4E33A 3PB7X 4P6YA 3SI0A 2OTL1 2RT9A 5LYIA 2YADA 4NBHA 2E2HI 1TKHA 3S1QI 4P4BA 3GTKI 1TF9A 4A93I 5FLXf 2KI7B 4MCRA 3KHXA 1WCMI 1K83I 1LOKA 3G71Z 3J80f 4PXBA 3TX8A 3JAMf 3TDHB 1BLLE 1YUKA 4HH4A 5D1OA 3I55Z 1QF8A 2Q43A 2NVTI 1BPNA 3VMIA 3S2HI 3PO2I 1Y0YA 4A37A 3CC71 1RO0A 2R6MA 1YITZ 3CPWY 2AFSA 1VQPZ 5IP7I 2C6PA 3G6E1 1TKJA 3BI0A 2CF4A 4OP4A 3K7AI 3GTLI 2JNYA 1CPSA 3D9XA 3CCS1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELL P;  3KZW A;  2VL1 A;  4ZY2 A;  1OBR A;  2G9D A;  4YWY A;  3L2N A;  2EK9 A;  4RUH A;  4IK2 A;  3FF3 A;  1UWY A;  2PJ5 A;  1AMP A;  3D7G A;  4NGP A;  3V7Z A;  1QQ9 A;  3D67 A;  3PBB A;  4B6Z A;  4A94 A;  3S9N A;  2AFX A;  4JZ0 A;  4A38 A;  3GB0 A;  2C6C A;  4DUK A;  2ABZ A;  3FEE A;  4DJL A;  3B2Y A;  5HXD A;  1F57 A;  2OR4 A;  3H8E A;  1CBX A;  4R7M A;  3SJG A;  1DE4 C;  4LQG A;  1DTD A;  5K8M A;  1BAV A;  2ZEL A;  4OC4 A;  2GRE A;  3CT9 A;  1ZG8 A;  3WC7 A;  3BXM A;  5D8N A;  1FT7 A;  1KWM A;  3SJX A;  3IFE A;  1XRY A;  1LAN A;  4PQA A;  2EK8 A;  4MCP A;  1R43 A;  3HLP A;  4EFD A;  4ZY1 A;  1ARM A;  5J1Q A;  3BI1 A;  3NA6 A;  4ZX8 A;  5CPA A;  1BPM A;  3GUX A;  4NGS A;  4OID A;  4IHM A;  3PBE A;  1XBU A;  1IY7 A;  2I3C A;  3D7F A;  4F8Z A;  2OOT A;  5LRJ A;  4MHZ A;  3GLJ A;  3LWU A;  4FWU A;  4MHY A;  5HVG A;  2PE3 A;  1CP6 A;  4R8F A;  1GYT A;  2DEA A;  1YW4 A;  3N5F A;  3K9T A;  4P10 A;  1Q7L A;  4UIB A;  4PXD A;  4P45 A;  8CPA A;  1CG2 A;  1XFO A;  5JGF A;  3NFZ A;  4P4J A;  5DS0 A;  3ISX A;  4KSI A;  1Z8L A;  2AFO A;  3PEI A;  4UIA A;  3KL9 A;  5F09 A;  2ZEN A;  1ZLH A;  1XMB A;  3IJ3 A;  1HDU A;  1EE3 P;  2CTB A;  2QVP A;  3IIB A;  1YLO A;  2O4H A;  4NGQ A;  4H2K A;  2JBJ A;  4MCQ A;  3RBU A;  2RB7 A;  4TWE A;  1Y0R A;  2JEW A;  3D7H A;  4PPZ A;  4UEE A;  2POK A;  5LRK A;  2AFW A;  3T8W A;  5K8N A;  4O23 A;  3PFO A;  3ISZ A;  2HB6 A;  5K8O A;  2ZEH A;  2XEF A;  3SI2 A;  3DLJ A;  3PRT A;  3H8F A;  2V77 A;  3PB4 X;  3KHZ A;  1NSA A;  4NGN A;  2XEJ A;  4ZY0 A;  1VIX A;  4EWT A;  3VAR A;  2RFH A;  3B35 A;  4YU9 A;  1JQG A;  4WWV A;  1Z5R A;  4PXE A;  2QJ8 A;  4R76 A;  2CTC A;  3B3W A;  1XJO A;  2PJ4 A;  4OIW A;  2V8V A;  1YW6 A;  3B3T A;  1TXR A;  1HEE A;  3WC6 A;  2BO9 A;  2WZN A;  5THW A;  3RAM A;  4R6T A;  2C6G A;  5D29 A;  3KQZ A;  1ZG9 A;  3PB9 X;  4OC2 A;  4UF4 A;  2ZOF A;  3PB8 X;  3FX6 A;  3S9M A;  2JBK A;  3DGV A;  5LYD A;  3SI1 A;  5JM6 A;  4W9Y A;  4AXV A;  4DYO A;  3V38 A;  2ZOG A;  3SJE A;  1QMU A;  3HUV A;  4ONW A;  1TF8 A;  4OC1 A;  1ELM P;  3D66 A;  4FBE A;  2Q51 A;  2IMO A;  4ZX9 A;  3NH5 A;  3D7D A;  4Z65 A;  1YME A;  4NJR A;  2PJ6 A;  2PJA A;  4A39 A;  3KGQ A;  5LYF A;  4JYW A;  4BD9 A;  1LCP A;  2NSM A;  2PVW A;  2ZEF A;  3FMC A;  4ZYQ A;  3B3V A;  2GU2 A;  4X3R A;  5IB9 A;  4OME A;  2BCO A;  1TKF A;  4PXC A;  1M4L A;  1CX8 A;  3I1U A;  1ZG7 A;  2V8G A;  1FNO A;  3IC1 A;  2PJ8 A;  1ZLI A;  3FED A;  1PCA A;  3K2K A;  3KR4 A;  4OKO A;  2PCU A;  1CPX A;  3CPX A;  2FVG A;  3NH8 A;  3B3S A;  5K8P A;  5LYL A;  2V8H A;  2IJZ A;  2PIZ A;  1LAP A;  2ZEP A;  4F9U A;  5I4M A;  2ZED A;  1PYT B;  4MXU A;  3PB6 X;  4P4I A;  1IGB A;  3KI9 A;  2F8H A;  5HVF A;  3NH4 A;  2PJ0 A;  4MCS A;  1RTQ A;  4OC3 A;  1F2P A;  3MRU A;  3KR5 A;  2GLF A;  3VH9 A;  4GM5 A;  2BOA A;  2PJ9 A;  1Y7E A;  4UEF A;  2PJ7 A;  4FUU A;  4ZI6 A;  4MHP A;  4NGM A;  3D4U A;  1CP7 A;  2HC9 A;  2PJ1 A;  3JRU A;  4IAV A;  2C1C A;  3FEC A;  2PIY A;  3WC5 A;  1AYE A;  4NGT A;  1Z2L A;  2QYV A;  2XEG A;  2PRQ A;  2ZEG A;  4NGR A;  2NYQ A;  2O53 A;  2AFU A;  3IEH A;  1R3N A;  4EME A;  2PJ3 A;  3BHX A;  4P44 A;  4X2T A;  3LMS A;  1HDQ A;  3SJF A;  4FAI A;  3FVL A;  1VGY A;  3KAS A;  3B3C A;  3PFE A;  3QNV A;  3D68 A;  4MRI A;  2ZEM A;  4NFR A;  3FH4 A;  3IWW A;  3B7I A;  4P4F A;  3WAB A;  2AFZ A;  1ARL A;  4OC0 A;  4P4E A;  3H8G A;  2AFM A;  3MN8 A;  3CDX A;  4K3N A;  1LFW A;  2IQ6 A;  3VAT A;  1YSJ A;  5HVH A;  1LAM A;  1VHO A;  4CPA A;  2EWB A;  3IO1 A;  4NJQ A;  3S9L A;  2WYR A;  2CIJ A;  3CPA A;  7CPA A;  4OC5 A;  3FJU A;  2Q4Z A;  4Q7A A;  4MHN A;  3KQX A;  4F9V A;  3RZA A;  2F7V A;  2XEI A;  4X8I A;  5ELY A;  5CBM A;  2ANP A;  3WT4 A;  4UEZ A;  2ZEO A;  1F2O A;  4MMO A;  2PJ2 A;  2GLJ A;  6CPA A;  2PJB A;  2J9A A;  2V8D A;  2PVV A;  1VHE A;  2ZEE A;  4G1P A;  4P4D A;  3TC8 A;  5JH9 A;  4TNU A;  1H8L A;  2PJC A;  4WJB A;  5LRG A;  3PB7 X;  4P6Y A;  3SI0 A;  5LYI A;  4P4B A;  1TKH A;  1TF9 A;  4MCR A;  3KHX A;  1LOK A;  4PXB A;  3TX8 A;  1BLL E;  2Q43 A;  1BPN A;  1Y0Y A;  4A37 A;  2AFS A;  2C6P A;  1TKJ A;  3BI0 A;  2CF4 A;  4OP4 A;  1CPS A; 
#chains in the Genus database with same CATH topology
 1XIX A;  2E2J I;  1KQS Z;  2DXQ A;  1Y8C A;  3L2N A;  1V0C A;  4CYO A;  1CJW A;  1QQ9 A;  2K5R A;  3PBB A;  3S9N A;  4MJ8 A;  4NBC A;  2QR1 B;  3W6S A;  1YI2 Z;  1QSN A;  3SJG A;  2ZW4 A;  3I9S A;  4NB9 A;  4A95 A;  2R7Z I;  2NAP A;  2PDO A;  4CYP A;  5AG5 A;  2GRE A;  3CT9 A;  1ZG8 A;  2Q04 A;  5F47 A;  4CAF A;  1FT7 A;  2AKL A;  2H5M A;  2Z3O A;  4PQA A;  1VQO Z;  2CNT A;  4MCP A;  4BY7 I;  2B3V A;  3BI1 A;  1B87 A;  5CPA A;  3HOX I;  1BPM A;  3EXN A;  1VQK 1;  3CCL 1;  3GKQ A;  4MON A;  5F46 A;  1X3W A;  2OZG A;  1NSL A;  1XBU A;  2I3C A;  4RVG A;  1J4J A;  2PE3 A;  3CCM 1;  1VQ9 Z;  1YW4 A;  3NE7 A;  4AVB A;  1N2F A;  2OZU A;  2ZPA A;  3N7Z A;  1TWH I;  1XFO A;  4FD4 A;  2YU9 I;  4YRH A;  4P4J A;  1Q2C A;  3S6K A;  1VQ7 Z;  3ISX A;  3F3F C;  1XMB A;  3IJ3 A;  1HDU A;  2CTB A;  3EO4 A;  4CGP A;  3CCJ Z;  2QA4 Z;  4H2K A;  3S1M I;  4MCQ A;  1TWG I;  3RBU A;  2V8I A;  3I07 A;  4TWE A;  3D7H A;  2WPW A;  3M4O I;  4UEE A;  2POK A;  5LRK A;  2OH1 A;  2QEX Z;  1KQS Y;  4AVC A;  2GTI A;  4MD8 A;  3FRM A;  2JDD A;  2JA6 I;  2HB6 A;  1MJA A;  3GTM S;  5EBV A;  4A33 A;  2QRE B;  2VUM I;  3PB4 X;  4HKF A;  3J81 b;  3GTJ I;  3T90 A;  1NJI 1;  2PSW A;  3EER A;  4WWV A;  2QJ8 A;  1USP A;  4MBU A;  3RZD I;  1MK4 A;  4BBH A;  1M4I A;  2AYD A;  4CYN A;  1HEE A;  4Q36 A;  5ISV A;  2FIA A;  4R6T A;  2C6G A;  4M6G A;  2GFQ A;  4E2Y A;  4B10 A;  2ZOF A;  2Z10 A;  3CXS A;  5LYD A;  1YIT 1;  2LEX A;  1DL6 A;  5H86 A;  3CC4 Z;  2Q0Y A;  4OAD A;  1TF8 A;  3G4S Z;  2Q51 A;  2IMO A;  1YJW Z;  5IV0 A;  3FQM A;  3T9Y A;  3D7D A;  4Z65 A;  2V3V A;  2NMT A;  1YME A;  2PJ6 A;  4HNW B;  5LYF A;  2QKD A;  3JUW A;  4ONU A;  2W04 A;  1YUA A;  2FSR A;  4PXC A;  2V8G A;  2G3A A;  2PJ8 A;  3CCQ 1;  4L89 A;  1KC8 2;  1P4N A;  3BG1 B;  3KR4 A;  5HMN A;  2QEX 1;  2NVQ I;  5LYL A;  2J8M A;  2PIZ A;  2ZEP A;  5I4M A;  3VWE A;  3FQQ A;  1Y1W I;  4P4I A;  2F8H A;  4X6A I;  2Q4Y A;  2JMO A;  3NH4 A;  3CME 1;  3RYO A;  1SFO I;  3KR5 A;  4UFX A;  4NCZ A;  3BLN A;  3TOA A;  2PJ9 A;  2V8J A;  3ZZI A;  1RO5 A;  1RQF A;  2IV2 X;  3BJ7 A;  3GTP I;  4DK1 A;  4BY1 I;  3HKZ A;  2PIY A;  3I56 Z;  1S7M A;  3P2H A;  4MY0 A;  3NDI A;  1VQ6 1;  4NGR A;  5G22 A;  1VQM 1;  4MFL A;  1JWQ A;  2O53 A;  4NEX A;  4NBD A;  3IEH A;  4YFJ A;  3BHX A;  2VZY A;  2X7B A;  1VGY A;  3PFE A;  3QNV A;  1Y1V S;  2EVN A;  3CCE 1;  4KVM E;  4UFW A;  3VMH A;  2AFZ A;  4OC0 A;  5KTD A;  4NBG A;  4AYB A;  5HVH A;  3CMA Z;  3IO1 A;  3F5B A;  4NJQ A;  5DWM A;  4KOY A;  1ML8 A;  2CIJ A;  3GY9 A;  4OC5 A;  2R93 I;  2I79 A;  4MHN A;  3F8K A;  4F9V A;  2XEI A;  1RO2 A;  4RS4 A;  4LUA A;  1YX0 A;  5ELY A;  2ANP A;  1Z8T A;  3WT4 A;  4UEZ A;  3GTO I;  2EO8 A;  2Z3M A;  4PSW A;  4MMO A;  2PJ2 A;  4CAV A;  1Z4E A;  1Q7Y 1;  1R9T I;  4CRZ B;  2J9A A;  2JEV A;  1WK4 A;  1VHE A;  4MD9 A;  2PJC A;  2OTJ Z;  4XPD C;  4AG9 A;  2OTL 1;  2YAD A;  4P4B A;  1TKH A;  3SXO A;  1TF9 A;  4MCR A;  2R1I A;  3TDH B;  3I55 Z;  3D2P A;  2FIW A;  2FE7 A;  1N71 A;  4H6U A;  3S2H I;  5J8C A;  3NE8 A;  2VEZ A;  4A37 A;  3CC7 1;  3I3G A;  5IP7 I;  2C6P A;  4E2A A;  3GTL I;  3R9F A;  4KOX A;  4ORF A;  2JNY A;  2VBQ A;  1CPS A;  3D9X A;  1VQL Z;  2DPS A;  1XEB A;  3S16 I;  4NBE A;  4RUH A;  3FF3 A;  1UWY A;  4NF1 A;  1AMP A;  1YJN Z;  1XMT A;  3QB8 A;  3V7Z A;  4HGY A;  1YHQ Z;  3D3S A;  2QRD B;  4A94 A;  4A38 A;  1NJI 2;  3DR6 A;  2GE3 A;  3R1K A;  4DUK A;  3CD6 Z;  3B8G A;  3GTQ I;  3DDD A;  3PZJ A;  1CBX A;  5G1Z A;  5H84 A;  2YNC A;  1DTD A;  3DR8 A;  3J80 b;  2YGW A;  2J6A A;  5CM2 M;  3JAM b;  1JWH C;  1BAV A;  2QLV B;  4C2Z A;  5F49 A;  1KUV A;  4CL1 A;  3SJX A;  2E9H A;  2JA5 I;  1FDO A;  1LAN A;  4KLV A;  1CM0 A;  2EK8 A;  4NSQ A;  1R43 A;  1LRZ A;  5C3E I;  4MFP A;  4ZY1 A;  4KVO E;  5J1Q A;  3VB9 A;  2QRC B;  2VPW A;  4B5P B;  3TO9 A;  1N8R 1;  2Q7B A;  4LX9 A;  2QIR A;  4PK2 A;  4KOW A;  5FVJ A;  1S7K A;  1IY7 A;  4A2Z A;  4UWJ A;  2OOT A;  4CRY B;  1SIW A;  3CZX A;  3CCV 1;  3G3S A;  5LRJ A;  1K8A 2;  4MHZ A;  3GLJ A;  4UA3 A;  4MHY A;  1CP6 A;  1S3Z A;  4CYQ A;  2Z3L A;  3IX0 A;  3H0G I;  1Q7L A;  4PXD A;  1JJ2 Y;  1Z8W A;  4MHD A;  4P45 A;  2RC4 A;  8CPA A;  5FLM I;  5JGF A;  4R87 A;  4KSI A;  1WWZ A;  2AFO A;  3TE5 B;  1VQ8 Z;  4UIA A;  2ZEN A;  3KIH A;  4K30 A;  4PV6 A;  2P0W A;  2JBJ A;  3CCJ 1;  2VPZ A;  1Y0R A;  2R7H A;  2EGT A;  2WUU A;  5K8N A;  3S15 I;  4O23 A;  2Z3N A;  2XEF A;  2JIQ A;  4C68 A;  3U50 C;  1M1K 1;  4ZBG A;  4C2Y A;  4ZY0 A;  1VIX A;  4EWT A;  2ARH A;  1VQP 1;  4EWC A;  3VAR A;  2DF5 A;  1Q16 A;  2VUG A;  2ZW6 A;  1JQG A;  1YJW 1;  4QVT A;  2K3R A;  3LAC A;  2ODF A;  2JA8 I;  3FNC A;  2V8V A;  4OIW A;  2PM9 A;  3SXN A;  4MD7 A;  4BXX I;  4KOS A;  2A4N A;  2BO9 A;  2B63 I;  5THW A;  2IL4 A;  2R98 A;  4NBF A;  3BJ8 A;  1I6H I;  3IF8 A;  4AVA A;  3PB8 X;  2REF A;  2B4B A;  5C82 A;  4UFV A;  3SI1 A;  5JM6 A;  4W9Y A;  3HOY I;  2JDC A;  1QXF A;  2IZ4 A;  1QMU A;  1TIQ A;  3HUV A;  4ONW A;  2LFU A;  4A3G I;  4OC1 A;  5LL6 f;  1PU9 A;  1ELM P;  4J3G A;  3D66 A;  1QSO A;  1M1K 2;  4MFJ A;  4BBS I;  4E2W A;  4NBA A;  2Z3K A;  2E7Z A;  1LCP A;  2NSM A;  2PVW A;  3TO6 A;  1Y9K A;  2B3U A;  4ZYQ A;  2GU2 A;  3S2D I;  2G3T A;  1CX8 A;  4RS2 A;  1ZG7 A;  1FNO A;  3FED A;  4KUA A;  4OKO A;  1Z8X A;  2OU2 A;  5A27 A;  2OOY B;  2W03 A;  2Y0M A;  2QA4 1;  3B3S A;  4F6A A;  3GTM I;  1LAP A;  4F9U A;  1PYT B;  1WZN A;  2GIV A;  1IGB A;  1RNI A;  5C88 A;  1RTQ A;  2PMZ A;  2VZZ A;  5IB0 A;  3CME Z;  1IU8 A;  2GLF A;  1Q2D A;  1U6M A;  4I49 A;  4GM5 A;  1I12 A;  1Y7E A;  4H6Z A;  4HNY B;  2NVX I;  3D2L A;  1VHS A;  4FUU A;  4AG7 A;  3IFU A;  4A30 A;  3JRU A;  1IID A;  4XX2 A;  4FD7 A;  3WC5 A;  1Z2L A;  5IP9 I;  2QYV A;  2PRQ A;  3HOU I;  2JIR A;  2NYQ A;  1VQ6 Z;  3EFA A;  2YNC C;  2B4D A;  4EME A;  4U9Z A;  4X2T A;  3VWD A;  3CXC Y;  3LMS A;  3SJF A;  3FVL A;  1YK3 A;  3G8W A;  2P6E A;  1YQE A;  4MRI A;  4R3K A;  3B7I A;  4U5Y A;  3WAB A;  2AFM A;  1QST A;  2VQY A;  2WPX A;  3FB3 A;  4K3N A;  2VPX A;  2IQ6 A;  1YSJ A;  4A3B I;  1N8R 2;  1LAM A;  2EWB A;  1PFT A;  2PR8 A;  4B12 A;  1OZP A;  3IU2 A;  4RVD A;  1K73 1;  2Q7S A;  4Q7A A;  4JXQ A;  3DSB A;  2C27 A;  2F7V A;  1KUY A;  4CAE A;  1XF8 A;  3CCU Z;  4X8I A;  3TCV A;  3CC7 Z;  1JJ2 Z;  3W91 A;  2OB0 A;  1X10 A;  1VQK Z;  2PJB A;  3TTH A;  4UCP A;  2PVV A;  4G1P A;  4TNU A;  5T6B A;  4JJX A;  4WJB A;  2RT9 A;  4KOU A;  5FLX f;  2KI7 B;  4KOR A;  3PP9 A;  3J80 f;  5IX3 A;  4PXB A;  3TX8 A;  4A32 A;  3JAM f;  1BLL E;  1YUK A;  1AA6 A;  1Y0Y A;  4C7I A;  1VQP Z;  3E0K A;  1TKJ A;  4MY3 A;  3BI0 A;  5EC4 A;  1S5K A;  3FKI I;  1ELL P;  1ZO0 A;  3KZW A;  4MH4 A;  2QEC A;  3JTK A;  2G9D A;  2PR1 A;  2AE6 A;  3J7A 4;  1VQ7 1;  1VQ5 1;  4NGP A;  1Q81 1;  3ZJ0 A;  5G21 A;  2BJO A;  4JD6 A;  2HU9 A;  5BWA B;  4B6Z A;  4MI4 A;  3G71 1;  2AFX A;  4B5O A;  1K4J A;  1QVG Z;  2ABZ A;  3FEE A;  3B2Y A;  5HXD A;  1F57 A;  2OR4 A;  4EVY A;  4R7M A;  4M6I A;  1DE4 C;  4LQG A;  1FDI A;  3A9L A;  2ZEL A;  1BOB A;  3BXM A;  4OAE A;  2BSW A;  4NB8 A;  3IFE A;  2ZW7 A;  5KTC A;  2I00 A;  2EUI A;  1ZB9 A;  4E2Z A;  3MGD A;  3HLP A;  1M4G A;  1S7N A;  2G2K A;  3PGP A;  1VQ8 1;  3GUX A;  3I4N I;  2JS4 A;  5A2Q f;  2HV2 A;  3D8P A;  3LD2 A;  2R92 I;  3D7F A;  2JIM A;  1VLA A;  4C7H A;  3LWU A;  5HVG A;  4R8F A;  1IB1 E;  3CCR Z;  4B14 A;  1QVF Y;  2Y0S A;  3TT2 A;  4IUS A;  4KS9 A;  1CG2 A;  1KC8 1;  3CCQ Z;  5HH1 A;  2E2I I;  3PEI A;  4XPD B;  4NBB A;  4A3C I;  1VQM Z;  5F09 A;  4B5P A;  4RV9 A;  1ZLH A;  2WAQ A;  1EE3 P;  2QVP A;  2GAN A;  3IIB A;  3QAH A;  1YLO A;  1RO4 A;  4NGQ A;  1RLY A;  5C44 I;  2RB7 A;  2JEW A;  4BBR I;  4PPZ A;  4UCN A;  2IZ3 A;  1YJN 1;  3PFO A;  4CGO A;  3ISZ A;  5D1P A;  5K8O A;  3SI2 A;  3DLJ A;  3FXT A;  4R57 A;  2VPY A;  3H8F A;  4NH1 C;  5D1O B;  4NGN A;  4KOT A;  4Q38 A;  3UY5 A;  1M1D A;  1I21 A;  4XPK A;  1I1D A;  4JLY A;  4C2X A;  3F3P C;  4JWP A;  1YIJ 1;  4Y49 B;  3GCF A;  4A3I I;  2DE6 A;  4R76 A;  1Q86 1;  2CTC A;  3B3W A;  3SHP A;  4E8O A;  3GKR A;  3CCL Z;  3WC6 A;  1YI2 1;  4NOZ A;  5JQ4 A;  3HOZ I;  3KKW A;  5D29 A;  3CCS Z;  3PB9 X;  3CCM Z;  4UF4 A;  3FX6 A;  2JBK A;  3CCE Z;  4A3K I;  2FL4 A;  2K5T A;  4KUB A;  4MFQ A;  4AXV A;  4DYO A;  2D4O A;  3RNZ A;  2VF1 A;  3V38 A;  1W2B Y;  2ZOG A;  1X0T A;  2Q44 A;  2Z11 A;  4F0Y A;  1TWA I;  4QC6 A;  1PUA A;  4E32 A;  4FBE A;  3VTN A;  3TO7 A;  1NE9 A;  4ZX9 A;  5G20 A;  1I50 I;  4KVX A;  3NH5 A;  4Y7N I;  4E0A A;  4E30 A;  3CC4 1;  4OLL A;  2PJA A;  4KSF A;  3KGQ A;  1A2Z A;  3PO3 I;  4FD6 A;  1NMT A;  4QBJ A;  5AG6 A;  1KUX A;  4OME A;  1M4L A;  2F4M A;  5E96 A;  1VQ5 Z;  1PCA A;  5AGE A;  1ZB8 A;  1RXT A;  1CPX A;  3CPX A;  3FIX A;  3CC2 Z;  5K8P A;  1Z01 A;  5C4X I;  4PK3 A;  2V8H A;  2IJZ A;  2LIY A;  1YR0 A;  3TOB A;  4A31 A;  3PB6 X;  1K9M 1;  1UFH A;  3ESW A;  4M85 A;  1WJ2 A;  1Q86 2;  5HVF A;  4PSX A;  1R57 A;  2HUZ A;  4QB9 A;  3GTG I;  3CCU 1;  2BOA A;  3I56 1;  3JVN A;  3IGR A;  4UEF A;  2PJ7 A;  3TE4 A;  4MHP A;  4NGM A;  3D4U A;  4JXR A;  1QVG Y;  1TWC I;  2HC9 A;  4LQ6 A;  4AB7 A;  3FEC A;  2ZXV A;  2JUB A;  3CXQ A;  1AYE A;  3S1N I;  2BEI A;  3HOW I;  5CNP A;  2ZEG A;  2Z3P A;  4QTT A;  5IT9 b;  4M6H A;  3IWE A;  1X12 A;  2AFU A;  3F0A A;  2Z0Z A;  1HDQ A;  2AJ6 A;  1I3Q I;  3P2F A;  3D68 A;  4NFR A;  2F4O A;  2GTH A;  4A3L I;  4P4F A;  3CCR 1;  1ARL A;  3H8G A;  5FLX b;  2BUE A;  3CDX A;  1X3Z A;  1VHO A;  4XPL A;  3H4Q A;  3FJU A;  2Q4Z A;  4CAX A;  2B58 A;  1YJ9 1;  1KZF A;  5T67 A;  2B5G A;  3G4S 1;  2JR6 A;  2CNM A;  4KZT A;  3GIU A;  4DNC A;  2B5G B;  2ZEO A;  3QWU A;  1F2O A;  2JA7 I;  4A3D I;  4M3S A;  3HOV I;  2V8D A;  4CGM A;  3M3Y I;  1Q2Y A;  1L1O C;  1KD1 2;  5JH9 A;  4RVF A;  3CCV Z;  1H8L A;  3H3V J;  4P6Y A;  5LYI A;  2FS5 A;  3S6G A;  3KHX A;  1WCM I;  3G71 Z;  4GXH A;  3OWC A;  5D1O A;  2NVT I;  3VMI A;  1YRE A;  4B11 A;  1RO0 A;  2ATR A;  3G6E 1;  4OP4 A;  2PRB A;  1QSR A;  3K7A I;  3IR7 A;  2PQ8 A;  3I4M I;  2VL1 A;  4ZY2 A;  1BO4 A;  1OBR A;  4YWY A;  3VMG A;  2EK9 A;  4IK2 A;  2PJ5 A;  2YND A;  3D7G A;  3P5J B;  2RPR A;  5A2Q b;  2R8V A;  2WB1 A;  1GHE A;  1M4D A;  3D67 A;  4JZ0 A;  1VQL 1;  2JLM A;  3GB0 A;  2C6C A;  3CXP A;  2PK7 A;  4A3M I;  5GCN A;  3DNS A;  2V45 A;  1YLE A;  2VXK A;  4DJL A;  3H8E A;  1IYL A;  3T4N B;  1YHQ 1;  4FD5 A;  5K8M A;  3MON A;  4OC4 A;  3KIF A;  2DE7 A;  2FCK A;  3WC7 A;  5D8N A;  4R9M A;  1VQ4 Z;  1NUI A;  3GYA A;  1KWM A;  4GS4 A;  1XRY A;  3D6W A;  3S6H A;  2EBJ A;  4EFD A;  3LUS A;  3S1R I;  1S72 Z;  2YNE A;  1ARM A;  4R3L A;  5KTA A;  4DGL A;  5C4J I;  1VQ4 1;  3NA6 A;  4ZX8 A;  1KRL A;  4CGL A;  4CS0 B;  1Z02 A;  4KSA A;  5T64 A;  4NGS A;  4OID A;  1M90 1;  4IHM A;  3PBE A;  5J8F A;  4F8Z A;  2ZW5 A;  1VQ9 1;  2OTJ 1;  2WSA A;  5DWN A;  4FWU A;  3MZL B;  4IF5 A;  4DQY B;  1GYT A;  2DEA A;  1TWF I;  3N5F A;  3K9T A;  4P10 A;  4UIB A;  1VQO 1;  1YVO A;  2J8N A;  4KLW A;  1W2B Z;  2FT0 A;  4E31 A;  4RN7 A;  3NFZ A;  3C26 A;  5DS0 A;  1S60 A;  2P6F A;  1Z8L A;  4UBR A;  3CXC Z;  2BL1 A;  1K8A 1;  2RIQ A;  3KL9 A;  3Q87 A;  2O4H A;  1S72 1;  3CD6 1;  4HGZ A;  5AN9 F;  3R9E A;  4A3J I;  3RO0 A;  2VI7 A;  2CNS A;  2AFW A;  3T8W A;  3RZO I;  2V8K A;  1ZH1 A;  3OW2 Y;  2Q4V A;  1Y9W A;  2QML A;  1TFI A;  2ZEH A;  1XE4 A;  4H89 A;  4QUS A;  3PRT A;  2V77 A;  4RI1 A;  3CPW Z;  2CXA A;  3KHZ A;  1NSA A;  4Y52 I;  2XEJ A;  2RFH A;  2CY2 A;  3B35 A;  3IU1 A;  3K9U A;  2OZK A;  4YU9 A;  1YJ9 Z;  5A28 A;  3CC2 1;  3FBU A;  1Z5R A;  3I55 1;  4PXE A;  1XJO A;  2PJ4 A;  1YW6 A;  3B3T A;  3FYN A;  1TXR A;  2HQY A;  2J8R A;  2WZN A;  2O28 A;  1LQL A;  3RAM A;  2M6N A;  2RBL A;  1QYP A;  3KQZ A;  3R95 A;  3TFY A;  1ZG9 A;  2D4P A;  4OC2 A;  5EMI A;  4X5K A;  3S9M A;  3DGV A;  4L8A A;  1Z4R A;  1AUG A;  3SJE A;  2OZH A;  1FY7 A;  4MFZ A;  1XOV A;  3OW2 Z;  4RVH A;  4HPS A;  2H85 A;  4KOV A;  1S7F A;  1KD1 1;  4NJR A;  4A39 A;  3J81 f;  3G6E Z;  1K73 2;  1B6B A;  4JYW A;  4BD9 A;  4BMH A;  2ZEF A;  4II9 A;  3FMC A;  3WR7 A;  4A3F I;  3B3V A;  1ON0 A;  4X3R A;  5IB9 A;  2BCO A;  1TKF A;  3I1U A;  3IC1 A;  5IT9 f;  3PO3 S;  1ZLI A;  4A3E I;  3K2K A;  4Y49 C;  4S1T A;  3R9G A;  2PCU A;  1YIJ Z;  2FVG A;  3NH8 A;  4UWI A;  2B4D B;  1USP B;  2ZED A;  3S17 I;  4MXU A;  1YVK A;  3KI9 A;  3NDJ A;  4ZGY B;  2PJ0 A;  4MCS A;  2RHB A;  2M48 A;  4OC3 A;  1F2P A;  3R96 A;  3MRU A;  2JIP A;  3VH9 A;  4E2X A;  1WII A;  2ZAE B;  1MJ9 A;  1VQN Z;  1Q7Y 2;  4MFK A;  5JPH A;  4U9Y A;  2KPI A;  3BG0 B;  1WW9 A;  4HNX B;  1Z9U A;  4ZI6 A;  4CGN A;  1K9M 2;  1CP7 A;  2PJ1 A;  5AG7 A;  4IAV A;  2C1C A;  1MJB A;  2DE5 A;  2FXF A;  4NGT A;  3H5Z A;  3IWG A;  2XEG A;  3EY5 A;  1P9N A;  2NVY I;  1VQN 1;  2DPT A;  2F5I A;  1SQH A;  1Q81 2;  1QSM A;  1L0C A;  1R3N A;  2PJ3 A;  4P44 A;  3EED A;  4FAI A;  3B3C A;  3KAS A;  5AG4 A;  3V8I A;  1Q82 1;  2ZEM A;  3FH4 A;  3IWW A;  4XNH C;  1QVF Z;  2OOX B;  4P4E A;  4NXY A;  3MN8 A;  1LFW A;  3VAT A;  4B13 A;  1Y1V I;  3CMA 1;  5F48 A;  4CPA A;  4BIN A;  3S9L A;  2WYR A;  3S14 I;  1Q82 2;  1S7L A;  3CPA A;  7CPA A;  1NP6 A;  3KQX A;  3RZA A;  1YGH A;  1P0H A;  4UCM A;  5CBM A;  1Z03 A;  1M90 2;  5I0C A;  3EC4 A;  2P3Y A;  1IIC A;  2GLJ A;  6CPA A;  2P28 A;  2P6G A;  4CAW A;  1M44 A;  4QTU A;  1IOI A;  2JIO A;  3CQZ I;  2ZEE A;  4P4D A;  3TC8 A;  2KCW A;  3D2M A;  2HF1 A;  3MZK B;  2OTL Z;  1VKC A;  5LRG A;  4E33 A;  3PB7 X;  3SI0 A;  3S6F A;  4NBH A;  2E2H I;  3S1Q I;  3GTK I;  4A93 I;  3W6X A;  1K83 I;  1IYK A;  1LOK A;  3LOD A;  2PC1 A;  1Y7R A;  4HH4 A;  4YGO A;  1QF8 A;  2Q43 A;  1BPN A;  4XNH B;  3PO2 I;  4F0X A;  2REE A;  2R6M A;  1YIT Z;  3CPW Y;  2AFS A;  3QAY A;  2CF4 A;  2G0B A;  1IOF A;  3CCS 1; 
#chains in the Genus database with same CATH homology
 3FKI I;  1VQL Z;  1ELL P;  3I4M I;  3KZW A;  2VL1 A;  4MH4 A;  2E2J I;  1KQS Z;  4ZY2 A;  1OBR A;  2G9D A;  3S16 I;  3L2N A;  3VMG A;  4YWY A;  4NBE A;  2EK9 A;  4RUH A;  4IK2 A;  3FF3 A;  1UWY A;  2PJ5 A;  3J7A 4;  1YJN Z;  1AMP A;  1VQ7 1;  3P5J B;  1VQ5 1;  3D7G A;  1Q81 1;  4NGP A;  2RPR A;  3V7Z A;  4HGY A;  5A2Q b;  1QQ9 A;  2BJO A;  2WB1 A;  2K5R A;  1YHQ Z;  2QRD B;  3D67 A;  2HU9 A;  3PBB A;  4B6Z A;  4A94 A;  3S9N A;  3G71 1;  2AFX A;  4JZ0 A;  1VQL 1;  4A38 A;  1NJI 2;  3GB0 A;  2C6C A;  4DUK A;  3CD6 Z;  2PK7 A;  1QVG Z;  4A3M I;  2ABZ A;  3GTQ I;  4NBC A;  2QR1 B;  3FEE A;  4DJL A;  3B2Y A;  5HXD A;  1F57 A;  2OR4 A;  3H8E A;  1CBX A;  1YI2 Z;  3T4N B;  4R7M A;  1YHQ 1;  3SJG A;  1DE4 C;  4LQG A;  1DTD A;  4NB9 A;  3J80 b;  2R7Z I;  2J6A A;  3MON A;  5CM2 M;  5K8M A;  3JAM b;  1JWH C;  1BAV A;  2QLV B;  2ZEL A;  4OC4 A;  3KIF A;  2DE7 A;  2GRE A;  3CT9 A;  1ZG8 A;  3WC7 A;  3BXM A;  5D8N A;  4CL1 A;  1VQ4 Z;  1NUI A;  1FT7 A;  2AKL A;  4NB8 A;  1KWM A;  3IFE A;  3SJX A;  2E9H A;  1XRY A;  3D6W A;  2JA5 I;  1LAN A;  4PQA A;  1ZB9 A;  1VQO Z;  4E2Z A;  2EK8 A;  4MCP A;  1R43 A;  3HLP A;  4EFD A;  3LUS A;  2G2K A;  5C3E I;  4BY7 I;  3S1R I;  4ZY1 A;  1S72 Z;  1ARM A;  5J1Q A;  3BI1 A;  3VB9 A;  4DGL A;  5C4J I;  1VQ4 1;  2QRC B;  1VQ8 1;  1KRL A;  3NA6 A;  5CPA A;  4ZX8 A;  3HOX I;  1BPM A;  3GUX A;  3I4N I;  1Z02 A;  1VQK 1;  2JS4 A;  5T64 A;  3CCL 1;  3GKQ A;  4NGS A;  4OID A;  4MON A;  5A2Q f;  1M90 1;  1X3W A;  1N8R 1;  4IHM A;  3PBE A;  2R92 I;  1XBU A;  1IY7 A;  2I3C A;  3D7F A;  1VLA A;  4F8Z A;  2OOT A;  5LRJ A;  3CCV 1;  1K8A 2;  4MHZ A;  4RVG A;  3GLJ A;  1VQ9 1;  3LWU A;  2OTJ 1;  4FWU A;  4MHY A;  5HVG A;  2PE3 A;  3CCM 1;  3MZL B;  1CP6 A;  4R8F A;  4DQY B;  1VQ9 Z;  1GYT A;  3CCR Z;  2DEA A;  1YW4 A;  1TWF I;  3H0G I;  3IX0 A;  3N5F A;  3K9T A;  4P10 A;  1Q7L A;  4UIB A;  4PXD A;  1VQO 1;  1JJ2 Y;  1QVF Y;  2Y0S A;  4P45 A;  1N2F A;  8CPA A;  5FLM I;  1TWH I;  1CG2 A;  1W2B Z;  1XFO A;  2YU9 I;  4E31 A;  5JGF A;  3NFZ A;  4P4J A;  1KC8 1;  5DS0 A;  1VQ7 Z;  3ISX A;  4KSI A;  3CCQ Z;  1Z8L A;  2AFO A;  3F3F C;  3CXC Z;  2E2I I;  3PEI A;  1K8A 1;  2RIQ A;  4NBB A;  3TE5 B;  1VQ8 Z;  1VQM Z;  4A3C I;  4UIA A;  3KL9 A;  5F09 A;  2ZEN A;  4RV9 A;  1ZLH A;  1XMB A;  3IJ3 A;  2WAQ A;  1EE3 P;  1HDU A;  3KIH A;  2CTB A;  2QVP A;  3IIB A;  3Q87 A;  1YLO A;  3CCJ Z;  2O4H A;  1S72 1;  3CD6 1;  1RO4 A;  2QA4 Z;  4NGQ A;  4HGZ A;  5AN9 F;  3S1M I;  1TWG I;  2JBJ A;  2V8I A;  3I07 A;  1RLY A;  3CCJ 1;  5C44 I;  4MCQ A;  4A3J I;  3RBU A;  2RB7 A;  4TWE A;  1Y0R A;  2JEW A;  3D7H A;  2EGT A;  4BBR I;  3M4O I;  4PPZ A;  4UEE A;  2POK A;  5LRK A;  2IZ3 A;  2AFW A;  3T8W A;  1YJN 1;  3RZO I;  2QEX Z;  1KQS Y;  5K8N A;  2V8K A;  2GTI A;  3S15 I;  4MD8 A;  4O23 A;  3PFO A;  1ZH1 A;  3OW2 Y;  3ISZ A;  2JA6 I;  2HB6 A;  5D1P A;  1TFI A;  5K8O A;  2ZEH A;  2XEF A;  3SI2 A;  3GTM S;  3DLJ A;  3PRT A;  3H8F A;  3U50 C;  2V77 A;  2QRE B;  1M1K 1;  4NH1 C;  2VUM I;  3PB4 X;  3CPW Z;  5D1O B;  3KHZ A;  1NSA A;  4Y52 I;  2XEJ A;  4NGN A;  4ZY0 A;  1VIX A;  4EWT A;  1VQP 1;  3J81 b;  3GTJ I;  4EWC A;  3VAR A;  2VUG A;  2RFH A;  1NJI 1;  3F3P C;  3B35 A;  1YIJ 1;  2OZK A;  4YU9 A;  1YJ9 Z;  1JQG A;  3GCF A;  3EER A;  1YJW 1;  4WWV A;  3CC2 1;  1Z5R A;  4A3I I;  3I55 1;  4PXE A;  2DE6 A;  2QJ8 A;  4R76 A;  1USP A;  1Q86 1;  2CTC A;  3B3W A;  2K3R A;  1XJO A;  2PJ4 A;  3RZD I;  2JA8 I;  4OIW A;  2V8V A;  1YW6 A;  2PM9 A;  3B3T A;  1TXR A;  3CCL Z;  4MD7 A;  1HEE A;  4BXX I;  3WC6 A;  2BO9 A;  2WZN A;  1LQL A;  2B63 I;  1YI2 1;  5THW A;  4NOZ A;  2M6N A;  3RAM A;  4R6T A;  2RBL A;  3HOZ I;  2C6G A;  1QYP A;  3KQZ A;  5D29 A;  4E2Y A;  4NBF A;  3CCS Z;  1I6H I;  1ZG9 A;  3PB9 X;  3IF8 A;  3CCM Z;  4OC2 A;  2ZOF A;  3PB8 X;  3FX6 A;  4UF4 A;  2JBK A;  3CCE Z;  4A3K I;  3DGV A;  3S9M A;  5LYD A;  1YIT 1;  3SI1 A;  5JM6 A;  4W9Y A;  1DL6 A;  4AXV A;  4DYO A;  3HOY I;  2VF1 A;  3CC4 Z;  3V38 A;  2IZ4 A;  1W2B Y;  2ZOG A;  1X0T A;  3SJE A;  1QMU A;  3HUV A;  4ONW A;  1TWA I;  2LFU A;  1TF8 A;  4A3G I;  4OC1 A;  5LL6 f;  1ELM P;  3D66 A;  4E32 A;  3G4S Z;  4FBE A;  3VTN A;  3OW2 Z;  2Q51 A;  2IMO A;  4RVH A;  1YJW Z;  4ZX9 A;  1M1K 2;  2H85 A;  1I50 I;  3FQM A;  3NH5 A;  4BBS I;  1KD1 1;  4Y7N I;  4E2W A;  3D7D A;  4Z65 A;  4E30 A;  3CC4 1;  1YME A;  4NJR A;  2PJ6 A;  2PJA A;  4A39 A;  3J81 f;  3KGQ A;  3G6E Z;  5LYF A;  4NBA A;  1K73 2;  3PO3 I;  2QKD A;  4JYW A;  4BD9 A;  1LCP A;  2NSM A;  2PVW A;  2ZEF A;  3FMC A;  2W04 A;  1YUA A;  4ZYQ A;  4A3F I;  2GU2 A;  3B3V A;  4X3R A;  4OME A;  3S2D I;  5IB9 A;  2BCO A;  1TKF A;  4PXC A;  1M4L A;  1CX8 A;  3I1U A;  2F4M A;  1ZG7 A;  2V8G A;  1FNO A;  3IC1 A;  5IT9 f;  2PJ8 A;  3PO3 S;  3CCQ 1;  1ZLI A;  4A3E I;  1VQ5 Z;  1PCA A;  3FED A;  3K2K A;  1KC8 2;  3BG1 B;  3KR4 A;  4OKO A;  1ZB8 A;  4S1T A;  2PCU A;  2QEX 1;  1CPX A;  2NVQ I;  3CPX A;  1YIJ Z;  2FVG A;  3NH8 A;  2OOY B;  2W03 A;  3CC2 Z;  2QA4 1;  3B3S A;  1Z01 A;  5K8P A;  5C4X I;  5LYL A;  2V8H A;  3GTM I;  2IJZ A;  2PIZ A;  2LIY A;  1LAP A;  2ZEP A;  1USP B;  2ZED A;  4F9U A;  1PYT B;  3FQQ A;  5I4M A;  3S17 I;  1Y1W I;  4MXU A;  3PB6 X;  4P4I A;  1IGB A;  1RNI A;  3KI9 A;  3NDJ A;  1K9M 1;  3ESW A;  2F8H A;  1Q86 2;  4X6A I;  5HVF A;  2JMO A;  3NH4 A;  2PJ0 A;  4MCS A;  2RHB A;  2M48 A;  1RTQ A;  2PMZ A;  4OC3 A;  1F2P A;  3CME 1;  1SFO I;  4H2K A;  3MRU A;  3KR5 A;  3CME Z;  2GLF A;  3GTG I;  3VH9 A;  4E2X A;  4GM5 A;  3CCU 1;  2BOA A;  2V8J A;  1WII A;  2ZAE B;  3I56 1;  1Y7E A;  2PJ9 A;  1VQN Z;  4UEF A;  1RQF A;  1Q7Y 2;  2PJ7 A;  2NVX I;  2KPI A;  3BG0 B;  4FUU A;  3GTP I;  1WW9 A;  4ZI6 A;  4MHP A;  4NGM A;  3D4U A;  1K9M 2;  1QVG Y;  1CP7 A;  1TWC I;  2HC9 A;  2PJ1 A;  3IFU A;  3JRU A;  4IAV A;  4DK1 A;  4XX2 A;  2C1C A;  4BY1 I;  3HKZ A;  3FEC A;  2JUB A;  2PIY A;  3WC5 A;  2DE5 A;  1AYE A;  3I56 Z;  4NGT A;  1S7M A;  1Z2L A;  5IP9 I;  2QYV A;  3S1N I;  2XEG A;  3NDI A;  2PRQ A;  1P9N A;  2NVY I;  1VQN 1;  3HOW I;  3HOU I;  1VQ6 1;  2ZEG A;  4NGR A;  2NYQ A;  4QTT A;  5IT9 b;  1VQM 1;  1VQ6 Z;  2O53 A;  1Q81 2;  4NBD A;  2AFU A;  3IEH A;  1R3N A;  4EME A;  2PJ3 A;  3BHX A;  4P44 A;  4X2T A;  3EED A;  3CXC Y;  3LMS A;  1HDQ A;  3SJF A;  4FAI A;  3FVL A;  1VGY A;  3B3C A;  3KAS A;  3PFE A;  1I3Q I;  3QNV A;  1Y1V S;  3D68 A;  3CCE 1;  1Q82 1;  4MRI A;  2ZEM A;  4NFR A;  3FH4 A;  3IWW A;  2F4O A;  2GTH A;  4A3L I;  3B7I A;  4P4F A;  1QVF Z;  3VMH A;  3WAB A;  3CCR 1;  2AFZ A;  1ARL A;  4OC0 A;  2OOX B;  4P4E A;  3H8G A;  2AFM A;  5FLX b;  3MN8 A;  3CDX A;  4K3N A;  1LFW A;  2IQ6 A;  3VAT A;  1Y1V I;  4NBG A;  4AYB A;  1YSJ A;  5HVH A;  4A3B I;  3CMA 1;  1N8R 2;  1LAM A;  1X3Z A;  1VHO A;  4CPA A;  2EWB A;  1PFT A;  3CMA Z;  3IO1 A;  4NJQ A;  3S9L A;  4RVD A;  2WYR A;  3S14 I;  1Q82 2;  1K73 1;  1ML8 A;  2CIJ A;  3CPA A;  7CPA A;  4OC5 A;  2R93 I;  3FJU A;  2Q4Z A;  4Q7A A;  4MHN A;  1NP6 A;  1YJ9 1;  3KQX A;  4F9V A;  3RZA A;  2F7V A;  2XEI A;  1RO2 A;  5T67 A;  4RS4 A;  3G4S 1;  2JR6 A;  3CCU Z;  4X8I A;  5ELY A;  5CBM A;  3CC7 Z;  1Z03 A;  1M90 2;  2ANP A;  3WT4 A;  1JJ2 Z;  4UEZ A;  3GTO I;  2ZEO A;  3QWU A;  1F2O A;  4MMO A;  2JA7 I;  2PJ2 A;  1VQK Z;  2P3Y A;  2GLJ A;  6CPA A;  2P28 A;  1Q7Y 1;  1R9T I;  2PJB A;  4A3D I;  2J9A A;  4QTU A;  3HOV I;  2V8D A;  3CQZ I;  2PVV A;  1VHE A;  3M3Y I;  2ZEE A;  1L1O C;  1KD1 2;  4G1P A;  4P4D A;  3TC8 A;  5JH9 A;  2HF1 A;  4RVF A;  4TNU A;  5T6B A;  3CCV Z;  1H8L A;  3MZK B;  4MD9 A;  2OTL Z;  2OTJ Z;  3H3V J;  2PJC A;  4WJB A;  5LRG A;  4E33 A;  3PB7 X;  4P6Y A;  3SI0 A;  2OTL 1;  2RT9 A;  5LYI A;  2YAD A;  4NBH A;  2E2H I;  1TKH A;  3S1Q I;  4P4B A;  3GTK I;  1TF9 A;  4A93 I;  5FLX f;  2KI7 B;  4MCR A;  3KHX A;  1WCM I;  1K83 I;  1LOK A;  3G71 Z;  3J80 f;  4PXB A;  3TX8 A;  3JAM f;  3TDH B;  1BLL E;  1YUK A;  4HH4 A;  5D1O A;  3I55 Z;  1QF8 A;  2Q43 A;  2NVT I;  1BPN A;  3VMI A;  3S2H I;  3PO2 I;  1Y0Y A;  4A37 A;  3CC7 1;  1RO0 A;  2R6M A;  1YIT Z;  3CPW Y;  2AFS A;  1VQP Z;  5IP7 I;  2C6P A;  3G6E 1;  1TKJ A;  3BI0 A;  2CF4 A;  4OP4 A;  3K7A I;  3GTL I;  2JNY A;  1CPS A;  3D9X A;  3CCS 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...