2Q4ZA

Ensemble refinement of the protein crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 89
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q4zA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q4zA01
4UEFA 5LRGA 2ABZA 2J9AA 3FEEA 4A38A 5F09A 2ZEFA 2PJ1A 4NGNA 3CDXA 2PVVA 4G1PA 3WC6A 4LQGA 2EK9A 4UIAA 2Q51A 1YW4A 2QJ8A 2PJ4A 2POKA 3WT4A 1Z2LA 3PBEA 2ZENA 3WC5A 5JGFA 3IJ3A 4UEZA 2OR4A 5D8NA 3FH4A 3BI1A 5D29A 1KWMA 5DS0A 2CF4A 3IEHA 4YWYA 4NFRA 4OIWA 4UF4A 2V8HA 1ZG8A 1IGBA 4MHPA 1QQ9A 2PJ6A 2PCUA 3S9MA 4R76A 1AYEA 4PXCA 2ZEPA 4O23A 3IWWA 2NYQA 3D66A 1NSAA 2DEAA 2C1CA 3T8WA 3NH4A 2QVPA 4IK2A 4EMEA 1HDUA 3BXMA 1F2OA 4P4FA 4OC1A 4ZY2A 3PFOA 4PXBA 5JM6A 1CBXA 3H8FA 4JZ0A 4X8IA 3IFEA 3SJXA 2AFXA 4OC4A 1H8LA 1ZLIA 3KL9A 1XBUA 4YU9A 3ISZA 3MRUA 1LFWA 4X3RA 4MCSA 4CPAA 4DUKA 3D67A 4RUHA 4NJQA 2QYVA 2BCOA 3HLPA 1PYTB 2HB6A 2C6CA 4OKOA 4IAVA 3NH5A 1FNOA 5K8OA 2C6PA 1ZLHA 4BD9A 1PCAA 4WWVA 2ZOFA 3B3TA 2F8HA 2ZEDA 2ZOGA 3CPXA 1F57A 3PB7X 5K8PA 1M4LA 4NJRA 4OC5A 2PJCA 2PRQA 1BPMA 3FX6A 3BHXA 4X2TA 3SJGA 3FMCA 5LYFA 1LOKA 1LAPA 2F7VA 1Y0YA 1TF8A 3SI2A 1TF9A 4OC3A 4P45A 5HXDA 1LAMA 3B3VA 3MN8A 1VHEA 2VL1A 2G9DA 2PJ5A 3I1UA 4ZX9A 2GLFA 4PPZA 2IJZA 1DTDA 1YLOA 3KI9A 1ELLP 4MMOA 4MCQA 4NGRA 2IQ6A 2PJAA 3KHZA 3JRUA 3VATA 4PXEA 1ZG7A 8CPAA 1UWYA 1YMEA 2JEWA 3FJUA 4F8ZA 3PB8X 4FUUA 4B6ZA 4PQAA 2EK8A 7CPAA 4R6TA 1CX8A 1Z5RA 4OC0A 1XMBA 3V7ZA 1LCPA 2I3CA 1IY7A 2ANPA 3B7IA 4TNUA 2WZNA 3IC1A 3PB4X 4R8FA 1OBRA 2FVGA 2ZEEA 5ELYA 3K2KA 1CG2A 2GLJA 1R3NA 4MCPA 3K9TA 4P4BA 3NFZA 3SI1A 1Z8LA 2GU2A 2XEJA 3L2NA 3S9LA 2C6GA 4NGPA 2Q43A 2XEIA 1BPNA 1ZG9A 3H8EA 4DYOA 5IB9A 3B3SA 3QNVA 1TXRA 4WJBA 3KHXA 2PJBA 1VIXA 3LMSA 3PBBA 3PEIA 4OP4A 3H8GA 3CPAA 2O4HA 4DJLA 5LRKA 1GYTA 1YW6A 3S9NA 1VHOA 3TC8A 3SJFA 3PB9X 2V8VA 3FVLA 3GLJA 4P4IA 1JQGA 2AFMA 4W9YA 2PJ3A 4MXUA 2BO9A 5I4MA 1ARMA 3IO1A 1BAVA 3VARA 2OOTA 3RAMA 1Y7EA 3LWUA 5CBMA 1EE3P 1TKJA 1CPSA 4EWTA 4FBEA 3FEDA 5LYLA 3IIBA 1ARLA 2PVWA 2PJ7A 4P10A 4MRIA 4P4EA 5HVGA 4GM5A 1CPXA 4ONWA 5K8MA 4PXDA 3N5FA 1XJOA 5LYIA 1AMPA 4P4DA 5K8NA 4EFDA 4NGQA 2V8DA 2V8GA 3D7FA 6CPAA 2PJ9A 2PJ8A 4A37A 2Q4ZA 3NH8A 3VH9A 4F9UA 4P44A 4OMEA 4A39A 4OIDA 3KGQA 3V38A 4ZY0A 5HVHA 3FECA 3TX8A 4ZI6A 2GREA 2CIJA 2V77A 5HVFA 3GB0A 5LYDA 2PIYA 4NGTA 3RZAA 4ZYQA 3RBUA 4R7MA 2JBJA 3BI0A 4TWEA 2AFSA 2CTCA 1RTQA 3PRTA 4NGMA 3HUVA 4FAIA 3ISXA 1BLLE 3KR5A 2PJ0A 4Q7AA 2ZEOA 3B35A 2BOAA 3PFEA 3SI0A 3NA6A 1Q7LA 1R43A 4AXVA 2PJ2A 4Z65A 3CT9A 1QMUA 2IMOA 4P4JA 2RFHA 1LANA 2AFZA 3GUXA 4FWUA 1TKFA 4UEEA 3PB6X 3KR4A 1HEEA 4P6YA 5J1QA 3KQZA 3WABA 4F9VA 4K3NA 2PE3A 2XEGA 2PIZA 1XRYA 5THWA 2AFWA 3B3CA 1XFOA 4MHYA 5JH9A 3KQXA 4MCRA 4IHMA 3D7GA 3DGVA 3KASA 1YSJA 2CTBA 1CP7A 5CPAA 3SJEA 3D7DA 1CP6A 2O53A 2ZELA 4ZX8A 3D4UA 3WC7A 3FF3A 4MHNA 2JBKA 1HDQA 4ZY1A 2AFUA 2RB7A 2HC9A 5LRJA 4A94A 2ZEMA 2XEFA 2NSMA 4H2KA 1DE4C 2ZEGA 4NGSA 4OC2A 3B2YA 2ZEHA 3D7HA 1Y0RA 1VGYA 2EWBA 4KSIA 3B3WA 4UIBA 2WYRA 4MHZA 1F2PA 3D68A 3KZWA 2AFOA 1ELMP 1FT7A 1TKHA 4JYWA 3DLJA
chains in the Genus database with same CATH superfamily
2J9AA 5F09A 1R9TI 2ZEFA 4NGNA 3CC7Z 1YIJ1 4UIAA 4B10A 2BJOA 2WPWA 3PZJA 4A3FI 1Z2LA 1I6HI 1RQFA 4E32A 1YHQZ 3WC5A 5FLXf 3H0GI 3GKRA 2CF4A 4NFRA 2BUEA 1QVGZ 1ZG8A 2PCUA 3CPWZ 2ATRA 2B58A 1X10A 4MFZA 2OTL1 3D66A 4B12A 1S72Z 2WB1A 5T6BA 2QVPA 4B5PA 1HDUA 1KZFA 3I561 1P0HA 4OC1A 2VZYA 3CMA1 2NVTI 5JM6A 1CBXA 4A95A 4JZ0A 3IFEA 3VMGA 4F0XA 4KSFA 1ZLIA 5HMNA 1KC82 3CC4Z 4A31A 2GTHA 4AVAA 3P5JB 1PYTB 2HB6A 2C6CA 1TWGI 4OKOA 4IAVA 3NH5A 1ZLHA 4WWVA 2J8NA 2NAPA 3B3TA 4Y49B 1M1K2 4YRHA 1MJBA 1M4LA 4A30A 1U6MA 4FD5A 1K8A1 3GTOI 3S1QI 2EBJA 4QUSA 2JIMA 3FX6A 2QEX1 4HPSA 1PU9A 1IYKA 3R96A 3G8WA 3SJGA 1JWHC 1LAPA 2FS5A 2VPZA 1TF8A 4NF1A 1TF9A 4E33A 5HXDA 2VI7A 3B3VA 3MN8A 1VHEA 2Z3NA 2Q4VA 4ZX9A 4UA3A 3I56Z 2JA8I 3CMAZ 1ML8A 1YLOA 3KI9A 4MMOA 4M85A 3FQMA 1KD11 2VEZA 4NH1C 1SIWA 3P2HA 3JRUA 3VATA 3QAYA 3FJUA 4F8ZA 3PB8X 3IGRA 2AKLA 7CPAA 2REEA 3EY5A 1CX8A 1K4JA 4OC0A 3H3VJ 5EC4A 5D1PA 3BLNA 1TWFI 4J3GA 1I3QI 4TNUA 2WZNA 4PSWA 4RV9A 3DR8A 2NVQI 1S7NA 2LFUA 4KOYA 2P6EA 3K2KA 5C4JI 1L1OC 4U5YA 4BY1I 1QF8A 3NFZA 3SI1A 1Z8LA 2OOXB 2QEXZ 3S1RI 3RO0A 3S6HA 2C6GA 2WPXA 1Z02A 4C2YA 2HF1A 3F3FC 5IB9A 1QSOA 4MD7A 2YADA 2PRBA 4NB9A 1A2ZA 5DWMA 3GIUA 4BXXI 1NSLA 2Y0MA 2YNCA 4RS4A 3H8GA 3W91A 4OLLA 2R7HA 1WCMI 1S7FA 4HKFA 1VHOA 4C2XA 2B4DA 3HOUI 2M48A 4H89A 2PJ3A 4MXUA 4NXYA 1Y8CA 4NBGA 2BO9A 5I4MA 3HOZI 4KS9A 5ISVA 3RAMA 1YJN1 4A93I 5CBMA 5T64A 1VQP1 2QR1B 2J8MA 1TWAI 3OW2Z 2HQYA 1YQEA 1NE9A 4L8AA 2PJ7A 4BBSI 3VB9A 5K8MA 3CPWY 1I1DA 5K8NA 3J80f 1QSRA 4NGQA 3CXCZ 1Q812 3HOYI 4CAVA 1NJI1 4AVBA 2JLMA 2JS4A 4OMEA 4OIDA 2JIOA 5HVHA 3TX8A 3ESWA 1Y7RA 2CIJA 5HVFA 3GB0A 5LYDA 1YVKA 3RBUA 3J81b 2JBJA 5AG6A 3LACA 1KQSZ 3PRTA 3TFYA 2PSWA 5F46A 3M4OI 3GTJI 2BOAA 2GTIA 1USPA 1X3WA 5IX3A 4M3SA 4AXVA 4B14A 2JA5I 4U9YA 2WAQA 3CT9A 1YX0A 1QMUA 4H6UA 4A3BI 1K732 2QLVB 4KOSA 1LANA 3GUXA 4FWUA 4C7IA 2OZUA 4UEEA 3KQZA 4JXRA 4E31A 4MI4A 4R3KA 3JVNA 1WK4A 3TO6A 4K3NA 5THWA 4I49A 3CCV1 4KZTA 4KORA 3S16I 1YGHA 2CTBA 4IUSA 1TIQA 2B5GA 3LUSA 3DSBA 4B5PB 3D7DA 3I4NI 3PP9A 2ZELA 3D4UA 4RS2A 3FF3A 4MHNA 2JBKA 1YK3A 3LODA 1FY7A 2HC9A 4KUBA 1M902 1P4NA 4A94A 3F8KA 4KSIA 5A2Qb 4UIBA 4MH4A 1F2PA 4CL1A 2AFOA 5G21A 2P28A 5LRGA 2V8KA 2FIWA 3BG1B 3T4NB 1KC81 4UFVA 3P2FA 1S5KA 3CDXA 2PVVA 1W2BZ 2RHBA 1M4GA 1KUVA 1YJW1 3I07A 4JXQA 1X3ZA 1MJAA 3IWEA 4NCZA 1Q16A 2POKA 3WT4A 1MJ9A 4A33A 3JUWA 4AVCA 5JGFA 1M1K1 2Q04A 2DXQA 2DE6A 2REFA 3MZLB 5DS0A 3G711 4MFJA 3CCVZ 2V8HA 1IGBA 1QSTA 2NMTA 4R76A 4O23A 5F47A 3IWWA 5J8FA 2NYQA 3HOWI 2DEAA 4EMEA 2E7ZA 4A3GI 4KOVA 2BL1A 4ZY2A 2G0BA 2JR6A 3FBUA 3IWGA 4KUAA 4X8IA 4H6ZA 3SJXA 4BY7I 2QKDA 2RBLA 3ISZA 3MRUA 2CNMA 4MCSA 4CPAA 5LL6f 3J81f 4CGNA 2R92I 3D67A 4JJXA 1ZH1A 2QYVA 2BCOA 2JDCA 1FNOA 2OZKA 1PCAA 1YJWZ 2ZOGA 3CXCY 3S17I 2FIAA 3FQQA 1OZPA 5C4XI 4MFQA 2PQ8A 4E2YA 3S2DI 2H5MA 2HV2A 5DWNA 4CGPA 3FMCA 3G71Z 4A3II 4XPLA 4MONA 2F7VA 4XPKA 3D9XA 4OC3A 4DNCA 1KQSY 1LAMA 2BEIA 3IU1A 2G9DA 3FIXA 4U9ZA 3I1UA 3PO2I 3CCUZ 2VQYA 4PPZA 1DTDA 2B4DB 3U50C 1ELLP 4NGRA 2J8RA 2IQ6A 2V8IA 1VQ61 2EUIA 1CM0A 1ZG7A 3R9GA 2A4NA 5IB0A 1JJ2Y 4FUUA 1SFOI 3CCM1 5KTCA 2IZ3A 1YLEA 2V3VA 3G4S1 3S2HI 2I3CA 5A2Qf 1IY7A 2ANPA 1Q2DA 3B7IA 4R8FA 3MGDA 2QREB 1OBRA 2FVGA 3S1NI 2AE6A 4RVFA 2R7ZI 1R3NA 2G3AA 4P4BA 2CNSA 3PO3I 3S15I 2IV2X 4NGPA 1IOFA 1ZG9A 2QRCB 3B3SA 1Q811 3QNVA 1Z4RA 1NUIA 2DE7A 3HOXI 2PJBA 4M6HA 1VIXA 3LMSA 3PEIA 2QIRA 4OP4A 3J80b 3CPAA 5LRKA 4II9A 1YW6A 3TOBA 3S14I 1USPB 3SJFA 2V8VA 1VQ6Z 4P4IA 1JQGA 1W2BY 2JEVA 4Q36A 4FD6A 5AG7A 4HNXB 1ARMA 4LQ6A 2PC1A 3BG0B 1Y7EA 3CCMZ 4JWPA 3IU2A 1EE3P 4KVOE 5CNPA 5IV0A 4UCMA 1TKJA 3D8PA 2D4OA 3G4SZ 1N71A 1KUXA 4FBEA 3IIBA 2YNCC 1ARLA 2Z3MA 1K731 1M4DA 4BMHA 4P10A 4MRIA 5F49A 2FXFA 2EVNA 4PXDA 3GTLI 1YJ91 2G3TA 3CXQA 3GTMS 6CPAA 5D1OA 2B5GB 2IL4A 3D3SA 1AUGA 2PJ8A 2Z3LA 4FD4A 4R87A 3J7A4 3EFAA 3NH8A 4F9UA 3EXNA 1M1DA 2Z3PA 3V38A 2R6MA 3RNZA 2V77A 2PIYA 4ZYQA 1ZO0A 4TWEA 3T90A 1J4JA 2AJ6A 4F0YA 2RC4A 1I50I 5H84A 1YUKA 1BLLE 1M901 3KR5A 3CCSZ 2ZEOA 3B35A 2PDOA 3PFEA 1Z8TA 4BBHA 4HH4A 2GANA 3R95A 3EO4A 2OZHA 1XOVA 2YNEA 4Z65A 1WZNA 4BBRI 4KOTA 1ON0A 2OU2A 2RFHA 4X6AI 4NBBA 3S6GA 2VF1A 4PSXA 1N8R1 4NSQA 1KRLA 3S6KA 2C27A 3PB6X 4RVDA 4QVTA 4E2AA 1Y9KA 3SXNA 4ONUA 4P6YA 4E8OA 3VMHA 3CC21 1R57A 1YJ9Z 2XEGA 3B3CA 3R9EA 4MBUA 2ZW7A 5JH9A 4OADA 3KQXA 4CYPA 2JIPA 4FD7A 3WR7A 4IHMA 3D7GA 4NB8A 4S1TA 1BOBA 2FL4A 3KASA 3DDDA 5CPAA 2JNYA 4ZX8A 3B8GA 2ZAEB 1Q2CA 3IFUA 4ZY1A 2JMOA 2AFUA 1PUAA 3R9FA 5LRJA 4CGLA 4CYQA 3CXSA 4MFKA 3ZZIA 3K9UA 2ZEGA 1QXFA 1FDOA 1Z01A 3PO3S 2WYRA 2FCKA 2B63I 3KZWA 2W04A 1Y1VI 2P3YA 1FT7A 5AG4A 4NBEA 4MY3A 3TDHB 4UEFA 2ABZA 3I9SA 4CGMA 2PJ1A 3WC6A 4LQGA 4AYBA 2AYDA 4GXHA 1VQM1 2QJ8A 3QB8A 2PJ4A 3PBEA 4UEZA 4NBFA 2OR4A 4QTTA 3CC2Z 3BI1A 1RO2A 4XPDC 1KWMA 3G6E1 4UF4A 1QVFY 1Q822 3DR6A 3S9MA 1AYEA 3IX0A 4PXCA 2ZEPA 4CGOA 5I0CA 2P6FA 1NSAA 2KCWA 2LIYA 3BJ7A 2C1CA 3NH4A 3BXMA 4DK1A 2YNDA 1F2OA 4P4FA 5IP9I 4KLVA 3PFOA 1JJ2Z 4UBRA 3CCQ1 3H8FA 5JPHA 2ZW5A 1B87A 4CRZB 1X12A 3CCL1 3GTQI 3TTHA 3D2LA 2Q7BA 1XBUA 4E2WA 1LFWA 5IT9b 2H85A 3QWUA 5FVJA 4DUKA 1TWHI 3K7AI 4RUHA 2FSRA 3HLPA 2C6PA 1VQ91 2F8HA 3TE4A 3CPXA 5C82A 1VQMZ 1L0CA 1LRZA 4BINA 5G22A 2Z10A 3I4MI 4NJRA 4OC5A 2I79A 1IU8A 1BPMA 3I3GA 3I551 3BHXA 1BO4A 1NMTA 4EWCA 3G6EZ 4AG9A 5AN9F 4CAWA 1Y0YA 3SI2A 1RNIA 1Y1WI 1N8R2 4M6IA 2R1IA 3KIFA 5AGEA 2GLFA 3C26A 2ZW6A 1QYPA 3CCQZ 4MCQA 5E96A 1M4IA 2PJAA 1S7KA 3CCLZ 5C88A 2ZPAA 1YMEA 2P0WA 1K83I 2WUUA 2CNTA 4A3MI 4B6ZA 4PQAA 2EK8A 4R6TA 2M6NA 3KIHA 1VQK1 2Z11A 1Z5RA 5EBVA 2OTJ1 1XIXA 4HNYB 4Y52I 3EERA 4EVYA 3IC1A 3PB4X 3CXPA 1VQ9Z 2WSAA 2O28A 2ZEEA 1LQLA 2I00A 3CCU1 3VWDA 3A9LA 1CG2A 1ZB9A 2Q0YA 4X5KA 4MCPA 1P9NA 5D1OB 2JUBA 5GCNA 4MHDA 3L2NA 3I55Z 3S9LA 2PMZA 4C7HA 3QAHA 3T9YA 4RN7A 1BPNA 1XF8A 3H8EA 1Q7Y2 1TFIA 4MFLA 3PBBA 1M44A 1VQ81 4MD9A 2V8JA 4RVGA 4L89A 4DJLA 2V45A 1GYTA 4AG7A 3VTNA 3S9NA 3PB9X 3PGPA 3NE7A 4E2XA 5CM2M 3GLJA 4ZBGA 2AFMA 2Z0ZA 4W9YA 1RO4A 2F4OA 4MJ8A 4UFXA 4YFJA 1VKCA 2VXKA 1S3ZA 2Q4YA 1BAVA 3LWUA 2ODFA 1VQKZ 2VZZA 4PK2A 1IOIA 3KKWA 2OTJZ 3DNSA 1MK4A 2F4MA 4EWTA 5IT9f 3S6FA 2QRDB 5H86A 3FEDA 2NVYI 4Q38A 2X7BA 5C3EI 3IF8A 2YGWA 2JA6I 1CPXA 4GM5A 3VMIA 1XJOA 1S7MA 5LYIA 4P4DA 4EFDA 1Q2YA 3RZDI 3GTPI 1Z8WA 1V0CA 2V8DA 1Q861 1YR0A 4B13A 3GYAA 3TT2A 4UCPA 2Q4ZA 5KTAA 3VH9A 2ARHA 4A39A 1VQ71 4ZY0A 3FECA 4ZI6A 2VPWA 2GREA 3JAMb 4CAXA 4NGTA 1VQ8Z 2W03A 4R7MA 3BI0A 4NBDA 3GTGI 2AFSA 2CTCA 3HUVA 1YI21 4FAIA 4Q7AA 4DGLA 5KTDA 2OH1A 3NA6A 1S7LA 2LEXA 4NBHA 2GE3A 1Q7LA 2PJ2A 1Y9WA 2Q7SA 4KVXA 3LD2A 3RYOA 1TKFA 2Z3OA 1N2FA 1QVFZ 2F5IA 3ZJ0A 3CD61 4LX9A 5J1QA 1RO0A 3WABA 4F9VA 2B3VA 1VQ41 3W6XA 1XRYA 2K3RA 2AFWA 3CCS1 1XFOA 4MHYA 2ZW4A 2FT0A 1IYLA 3DGVA 1K9M2 1YSJA 2JA7I 2J6AA 1CP6A 1Q821 4A3DI 1YIJZ 5C44I 1VQ7Z 4A32A 3WC7A 4MD8A 3FNCA 3H4QA 2PR8A 2NSMA 4K30A 2HU9A 3D7HA 2ZEHA 1CJWA 1VGYA 1VQ51 2B4BA 1YI2Z 3FB3A 2CY2A 4ORFA 4MHZA 3D68A 1ELMP 3MZKB 4HGZA 1YVOA 3E0KA 2XEFA 5IP7I 2OTLZ 3FEEA 4A38A 2KI7B 1VLAA 3TO9A 4G1PA 3NDJA 5EMIA 2EK9A 2Q51A 3Q87A 3UY5A 1YW4A 5J8CA 4E0AA 2PR1A 4XNHB 2BSWA 4QC6A 4IF5A 1YUAA 3CD6Z 2R8VA 2ZENA 5A27A 1Z4EA 3IJ3A 5D8NA 3FH4A 4XPDB 3FKII 5D29A 3IEHA 4YWYA 1VQ4Z 4M6GA 1WJ2A 2NVXI 4OIWA 4MHPA 1QQ9A 2PJ6A 2JDDA 3NE8A 4C2ZA 3TCVA 3NDIA 4MFPA 2RPRA 3T8WA 4IK2A 2EGTA 4PXBA 4A3LI 4NBAA 4CAFA 2QECA 4A3EI 2VBQA 2AFXA 4OC4A 2E2II 1H8LA 1Z9UA 3KL9A 3D6WA 1VQ5Z 4YU9A 1Q862 3JAMf 3CCE1 2K5TA 1YIT1 4X3RA 3GKQA 4NJQA 2VPYA 1XE4A 2E2JI 5K8OA 1UFHA 2GFQA 4CRYB 4BD9A 1WIIA 3EEDA 2ZOFA 2ZEDA 1F57A 1NP6A 4Y49C 3PB7X 5K8PA 3HKZA 1IB1E 1I12A 2ZXVA 1RO5A 3H5ZA 2PJCA 2PRQA 5T67A 2R93I 4X2TA 5G1ZA 2OOYB 3GY9A 5LYFA 4JLYA 1LOKA 1SQHA 1WW9A 2K5RA 2DPTA 3EC4A 2DPSA 4P45A 1YREA 4KOXA 1Q7Y1 2OZGA 2VL1A 1VQL1 1QVGY 2PJ5A 4Y7NI 2E9HA 2IJZA 3VWEA 1VQN1 3KHZA 4XNHC 3SXOA 4LUAA 2R98A 3W6SA 3SHPA 4PXEA 4RI1A 2EO8A 1UWYA 8CPAA 2JEWA 3D2MA 3CCR1 5HH1A 3CCEZ 1YITZ 2B3UA 2VUGA 4KVME 1XMBA 3V7ZA 1LCPA 4KLWA 5JQ4A 1TWCI 1K8A2 5AG5A 2CXAA 2JIRA 4B11A 5ELYA 4B5OA 3HOVI 5A28A 2GLJA 3F3PC 3K9TA 5G20A 3BJ8A 2VUMI 2GU2A 2XEJA 1QSNA 1YJNZ 3R1KA 2Q43A 2XEIA 3IR7A 4DYOA 1VQPZ 4QBJA 1XEBA 4UWIA 1TXRA 4WJBA 1B6BA 3KHXA 3S1MI 3RZOI 4CYOA 3TOAA 1KD12 2D4PA 2E2HI 1VQLZ 4CS0B 2O4HA 2IZ4A 3FRMA 4UWJA 1GHEA 1VQNZ 3TC8A 2QA41 3FVLA 3CCJ1 4R57A 4QB9A 4YGOA 3TO7A 3IO1A 3CCRZ 3VARA 2OOTA 3V8IA 4HGYA 1RLYA 3GTKI 1IIDA 2DE5A 3FYNA 5FLXb 3G3SA 1CPSA 4C68A 5LYLA 2PVWA 2GIVA 4P4EA 4RVHA 3FXTA 5HVGA 4ONWA 2HUZA 1I21A 1S60A 3N5FA 1X0TA 1AMPA 1IICA 3OWCA 3F0AA 1KUYA 2QMLA 1Z03A 1Z8XA 2V8GA 3D7FA 5FLMI 2PJ9A 4KOWA 4PV6A 4A37A 2Y0SA 1AA6A 1VQO1 4P44A 1FDIA 4KSAA 3KGQA 2G2KA 1K9M1 2RT9A 4E30A 4UFWA 4HNWB 3TE5B 3RZAA 4R9MA 3F5BA 4CYNA 2P6GA 2Z3KA 1XMTA 4JD6A 1RTQA 4NGMA 2QA4Z 3ISXA 4F6AA 2PJ0A 3CCJZ 3CME1 3SI0A 5BWAB 1QSMA 4NBCA 1VHSA 1R43A 1Y1VS 2Q44A 3M3YI 1PFTA 4NEXA 4A3JI 2PM9A 4MY0A 4R3LA 2IMOA 3CC71 4P4JA 2AFZA 1JWQA 1YHQ1 4E2ZA 3KR4A 1HEEA 4ZGYB 4A3KI 4DQYB 5F48A 3CZXA 3CQZI 3D2PA 3GTMI 3OW2Y 1NJI2 4PK3A 2PE3A 2PIZA 2JIQA 4A3CI 4MCRA 2PK7A 2VPXA 1CP7A 3N7ZA 3SJEA 1S721 4NOZA 4KOUA 1VQOZ 2O53A 1ZB8A 2FE7A 2RIQA 4CAEA 1WWZA 4AB7A 1HDQA 2RB7A 2OB0A 2ZEMA 4H2KA 1DE4C 4NGSA 4OC2A 3B2YA 4XX2A 1RXTA 4GS4A 1Y0RA 2KPIA 3MONA 2EWBA 3GCFA 4OAEA 1DL6A 3B3WA 4UCNA 3CC41 2YU9I 4A2ZA 3JTKA 3CMEZ 2DF5A 4QTUA 1TKHA 4JYWA 3DLJA
chains in the Genus database with same CATH topology
4UEFA 5IP7I 5LRGA 2OTLZ 2V8KA 2ABZA 2J9AA 3FEEA 4A38A 5F09A 1R9TI 2KI7B 3BG1B 3T4NB 1KC81 2PJ1A 2ZEFA 4NGNA 1VLAA 3CDXA 2PVVA 1W2BZ 2RHBA 4G1PA 3WC6A 3NDJA 3CC7Z 1YJW1 4LQGA 3I07A 1YIJ1 2EK9A 4AYBA 4UIAA 2Q51A 3Q87A 1X3ZA 1VQM1 1YW4A 2QJ8A 2BJOA 2PJ4A 2POKA 3WT4A 4A3FI 1Z2LA 3PBEA 1I6HI 1RQFA 1YUAA 4E32A 1YHQZ 3CD6Z 2ZENA 3WC5A 5JGFA 5FLXf 3IJ3A 4UEZA 4NBFA 2OR4A 5D8NA 1M1K1 4QTTA 3FH4A 2DE6A 3H0GI 3CC2Z 3BI1A 3FKII 3MZLB 1RO2A 5D29A 1KWMA 5DS0A 3G6E1 2CF4A 3IEHA 3G711 4YWYA 4NFRA 1VQ4Z 3CCVZ 2NVXI 4OIWA 4UF4A 1QVGZ 2V8HA 1QVFY 1Q822 1ZG8A 1IGBA 4MHPA 1QQ9A 2PJ6A 2PCUA 3S9MA 4R76A 1AYEA 3IX0A 3CPWZ 4PXCA 2ZEPA 4O23A 3IWWA 2OTL1 2NYQA 3NDIA 3D66A 1NSAA 2LIYA 1S72Z 3HOWI 2DEAA 2C1CA 2RPRA 2WB1A 3T8WA 3NH4A 5T6BA 2QVPA 4IK2A 4EMEA 2EGTA 1HDUA 3BXMA 4DK1A 1F2OA 3I561 4P4FA 4A3GI 5IP9I 4OC1A 4ZY2A 3CMA1 3PFOA 2NVTI 4A3LI 4PXBA 2JR6A 5JM6A 1JJ2Z 4NBAA 3CCQ1 1CBXA 3H8FA 4JZ0A 4X8IA 3IFEA 4A3EI 3SJXA 3VMGA 3CCL1 3GTQI 4BY7I 2AFXA 2QKDA 4OC4A 2E2II 1H8LA 1ZLIA 3KL9A 3D6WA 1XBUA 2RBLA 1VQ5Z 4YU9A 3ISZA 4E2WA 1Q862 3JAMf 3MRUA 3CCE1 1LFWA 5IT9b 1KC82 3CC4Z 1YIT1 4X3RA 2H85A 3QWUA 4MCSA 3GKQA 4CPAA 4DUKA 1TWHI 3K7AI 5LL6f 3J81f 2R92I 2GTHA 3D67A 1ZH1A 4RUHA 4NJQA 2QYVA 3P5JB 2BCOA 3HLPA 1PYTB 2HB6A 2C6CA 2E2JI 1TWGI 4OKOA 4IAVA 3NH5A 1FNOA 5K8OA 2C6PA 1ZLHA 2OZKA 1PCAA 4BD9A 4WWVA 1WIIA 3EEDA 1VQ91 1YJWZ 2F8HA 2ZEDA 2ZOFA 2ZOGA 3B3TA 3CPXA 1F57A 3CXCY 1NP6A 1VQMZ 1M1K2 3PB7X 3S17I 5K8PA 1M4LA 3FQQA 3HKZA 3I4MI 4NJRA 4OC5A 1K8A1 3GTOI 2PJCA 3S1QI 5C4XI 2PRQA 1BPMA 4E2YA 5T67A 3S2DI 3FX6A 2QEX1 2R93I 3I551 3BHXA 4X2TA 3SJGA 1JWHC 4EWCA 3FMCA 2OOYB 3G6EZ 3G71Z 4A3II 5LYFA 1LOKA 1LAPA 4MONA 2F7VA 1WW9A 3D9XA 5AN9F 2K5RA 1Y0YA 1TF8A 3SI2A 1RNIA 1TF9A 4E33A 4OC3A 4P45A 5HXDA 1KQSY 1LAMA 1Y1WI 1N8R2 3B3VA 1Q7Y1 3MN8A 1VHEA 2VL1A 2G9DA 1VQL1 1QVGY 2PJ5A 4Y7NI 2E9HA 3KIFA 3I1UA 3PO2I 4ZX9A 2GLFA 3CCUZ 3I56Z 4PPZA 2IJZA 2JA8I 1DTDA 3CMAZ 1VQN1 1ML8A 1QYPA 1YLOA 3KI9A 3U50C 1ELLP 4MMOA 3FQMA 3CCQZ 4MCQA 4NGRA 2IQ6A 1KD11 2V8IA 1VQ61 2PJAA 4JYWA 3KHZA 4NH1C 3CCLZ 3JRUA 3VATA 4PXEA 1ZG7A 8CPAA 1UWYA 1YMEA 2JEWA 1K83I 3FJUA 4F8ZA 3CCR1 3PB8X 4A3MI 1JJ2Y 3CCEZ 4FUUA 4B6ZA 4PQAA 1YITZ 1SFOI 2EK8A 3CCM1 2AKLA 7CPAA 4R6TA 2VUGA 2M6NA 3KIHA 1VQK1 2IZ3A 1CX8A 1Z5RA 4OC0A 1XMBA 2OTJ1 3H3VJ 3G4S1 4Y52I 3EERA 5D1PA 3S2HI 1LCPA 3V7ZA 1TWFI 2I3CA 5A2Qf 1IY7A 1I3QI 2ANPA 3B7IA 4TNUA 1TWCI 2WZNA 3IC1A 3PB4X 4RV9A 4R8FA 1K8A2 1VQ9Z 2QREB 2NVQI 1OBRA 2FVGA 3S1NI 2ZEEA 5ELYA 2LFUA 1LQLA 3HOVI 3CCU1 4RVFA 2R7ZI 3K2KA 1CG2A 2GLJA 1ZB9A 5C4JI 1R3NA 3F3PC 4MCPA 1L1OC 1P9NA 3K9TA 5D1OB 4P4BA 4BY1I 1QF8A 2JUBA 3NFZA 2VUMI 3SI1A 1Z8LA 2GU2A 2OOXB 2QEXZ 3PO3I 2XEJA 3L2NA 3I55Z 3S1RI 2PMZA 3S9LA 3S15I 2C6GA 4NGPA 1YJNZ 1Z02A 2Q43A 2XEIA 2HF1A 1BPNA 1ZG9A 3H8EA 3F3FC 2QRCB 4DYOA 1Q7Y2 5IB9A 3B3SA 1Q811 3QNVA 1VQPZ 4MD7A 1TXRA 1TFIA 2YADA 4WJBA 1NUIA 2DE7A 3HOXI 3S1MI 2PJBA 3KHXA 1VIXA 4NB9A 3RZOI 3LMSA 3PBBA 3PEIA 1VQ81 4OP4A 1KD12 4MD9A 2E2HI 1VQLZ 4BXXI 2V8JA 3J80b 4RVGA 4RS4A 3H8GA 3CPAA 2O4HA 2IZ4A 4DJLA 5LRKA 1WCMI 1GYTA 3VTNA 1YW6A 3S14I 1VHOA 3S9NA 1VQNZ 3TC8A 2QA41 1USPB 3SJFA 3PB9X 2V8VA 3HOUI 3CCJ1 1VQ6Z 3FVLA 2M48A 4E2XA 5CM2M 3GLJA 4P4IA 1JQGA 1W2BY 2AFMA 4W9YA 2PJ3A 4MXUA 1RO4A 2F4OA 4NBGA 2BO9A 5I4MA 1ARMA 3HOZI 3IO1A 3CCRZ 1BAVA 3VARA 3BG0B 2OOTA 3RAMA 1Y7EA 4HGYA 1YJN1 3CCMZ 4A93I 3LWUA 1RLYA 3GTKI 5T64A 5CBMA 1VQKZ 2DE5A 1EE3P 5FLXb 1VQP1 1CPSA 2QR1B 2OTJZ 1TKJA 3G4SZ 1TWAI 2F4MA 3OW2Z 4EWTA 5IT9f 2QRDB 4FBEA 3FEDA 2NVYI 5LYLA 3IIBA 1ARLA 2PVWA 1K731 2PJ7A 4P10A 5C3EI 4MRIA 4BBSI 3IF8A 4P4EA 4RVHA 3VB9A 2JA6I 1CPXA 4GM5A 4ONWA 3GTLI 4PXDA 5HVGA 3N5FA 1YJ91 3VMIA 3CPWY 1XJOA 1X0TA 1S7MA 5LYIA 1AMPA 4P4DA 5K8NA 3J80f 4EFDA 3GTMS 3RZDI 3GTPI 4NGQA 3CXCZ 2V8DA 1Q812 1Z03A 2V8GA 3D7FA 5FLMI 1Q861 5D1OA 3HOYI 2PJ9A 6CPAA 5K8MA 1NJI1 2PJ8A 4A37A 2Q4ZA 2Y0SA 3J7A4 3NH8A 1VQO1 3VH9A 2JS4A 4F9UA 4P44A 4OMEA 4A39A 1VQ71 4OIDA 3KGQA 3V38A 2G2KA 2R6MA 1K9M1 4ZY0A 5HVHA 2RT9A 4E30A 3FECA 3TX8A 3ESWA 4ZI6A 2GREA 3JAMb 2CIJA 2V77A 5HVFA 3GB0A 5LYDA 3TE5B 2PIYA 4NGTA 3RZAA 1VQ8Z 4ZYQA 3RBUA 2W03A 4R7MA 3J81b 2JBJA 3BI0A 4TWEA 4NBDA 1KQSZ 3GTGI 2AFSA 2CTCA 1RTQA 3PRTA 1I50I 4NGMA 3HUVA 1YI21 2QA4Z 4FAIA 3ISXA 1YUKA 1BLLE 1M901 3KR5A 2PJ0A 3CCSZ 4Q7AA 3CCJZ 4DGLA 3GTJI 3M4OI 2ZEOA 3B35A 3CME1 2GTIA 1USPA 2BOAA 3PFEA 3SI0A 3NA6A 4NBCA 1X3WA 4NBHA 4HH4A 1Q7LA 1R43A 1Y1VS 2PJ2A 4AXVA 3M3YI 1PFTA 4Z65A 4A3JI 2JA5I 2WAQA 3CT9A 2PM9A 1QMUA 2IMOA 4BBRI 4A3BI 3CC71 4P4JA 1K732 2QLVB 2RFHA 4X6AI 1LANA 4NBBA 2AFZA 2VF1A 3GUXA 4FWUA 1N8R1 1KRLA 1TKFA 4UEEA 1N2FA 3PB6X 1QVFZ 4RVDA 1YHQ1 3CD61 4E2ZA 3KR4A 1HEEA 4P6YA 4A3KI 5J1QA 1RO0A 4DQYB 3KQZA 3VMHA 3CQZI 4E31A 3WABA 3CC21 4F9VA 3GTMI 1YJ9Z 3OW2Y 1NJI2 4K3NA 1VQ41 2PE3A 2XEGA 2PIZA 1XRYA 5THWA 2K3RA 3CCV1 2AFWA 3B3CA 3CCS1 1XFOA 4MHYA 5JH9A 4A3CI 3KQXA 4MCRA 2PK7A 3D7GA 4NB8A 4IHMA 3DGVA 4S1TA 1K9M2 3S16I 3KASA 1YSJA 2CTBA 1CP7A 5CPAA 2JA7I 3SJEA 3LUSA 2J6AA 1S721 3D7DA 4NOZA 2JNYA 1CP6A 1Q821 4A3DI 1VQOZ 1YIJZ 3I4NI 2O53A 2ZELA 1ZB8A 5C44I 4ZX8A 2RIQA 1VQ7Z 3D4UA 2ZAEB 3WC7A 4MD8A 3FF3A 4MHNA 2JBKA 3IFUA 1HDQA 4ZY1A 2JMOA 2AFUA 2RB7A 2HC9A 5LRJA 1M902 4A94A 2ZEMA 2XEFA 2NSMA 4H2KA 2HU9A 1DE4C 2ZEGA 4NGSA 4OC2A 3B2YA 2ZEHA 3D7HA 4XX2A 1Z01A 1Y0RA 2KPIA 1VGYA 1VQ51 3MONA 2EWBA 3GCFA 3PO3S 4KSIA 1YI2Z 5A2Qb 1DL6A 3B3WA 4UIBA 2WYRA 3CC41 2YU9I 4MH4A 4MHZA 2B63I 1F2PA 3D68A 3KZWA 4CL1A 2W04A 1ELMP 3CMEZ 2AFOA 1Y1VI 3MZKB 2P3YA 4HGZA 4QTUA 1FT7A 2P28A 4NBEA 1TKHA 3TDHB 3DLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEF A;  5LRG A;  2ABZ A;  2J9A A;  3FEE A;  4A38 A;  5F09 A;  2ZEF A;  2PJ1 A;  4NGN A;  3CDX A;  2PVV A;  4G1P A;  3WC6 A;  4LQG A;  2EK9 A;  4UIA A;  2Q51 A;  1YW4 A;  2QJ8 A;  2PJ4 A;  2POK A;  3WT4 A;  1Z2L A;  3PBE A;  2ZEN A;  3WC5 A;  5JGF A;  3IJ3 A;  4UEZ A;  2OR4 A;  5D8N A;  3FH4 A;  3BI1 A;  5D29 A;  1KWM A;  5DS0 A;  2CF4 A;  3IEH A;  4YWY A;  4NFR A;  4OIW A;  4UF4 A;  2V8H A;  1ZG8 A;  1IGB A;  4MHP A;  1QQ9 A;  2PJ6 A;  2PCU A;  3S9M A;  4R76 A;  1AYE A;  4PXC A;  2ZEP A;  4O23 A;  3IWW A;  2NYQ A;  3D66 A;  1NSA A;  2DEA A;  2C1C A;  3T8W A;  3NH4 A;  2QVP A;  4IK2 A;  4EME A;  1HDU A;  3BXM A;  1F2O A;  4P4F A;  4OC1 A;  4ZY2 A;  3PFO A;  4PXB A;  5JM6 A;  1CBX A;  3H8F A;  4JZ0 A;  4X8I A;  3IFE A;  3SJX A;  2AFX A;  4OC4 A;  1H8L A;  1ZLI A;  3KL9 A;  1XBU A;  4YU9 A;  3ISZ A;  3MRU A;  1LFW A;  4X3R A;  4MCS A;  4CPA A;  4DUK A;  3D67 A;  4RUH A;  4NJQ A;  2QYV A;  2BCO A;  3HLP A;  1PYT B;  2HB6 A;  2C6C A;  4OKO A;  4IAV A;  3NH5 A;  1FNO A;  5K8O A;  2C6P A;  1ZLH A;  4BD9 A;  1PCA A;  4WWV A;  2ZOF A;  3B3T A;  2F8H A;  2ZED A;  2ZOG A;  3CPX A;  1F57 A;  3PB7 X;  5K8P A;  1M4L A;  4NJR A;  4OC5 A;  2PJC A;  2PRQ A;  1BPM A;  3FX6 A;  3BHX A;  4X2T A;  3SJG A;  3FMC A;  5LYF A;  1LOK A;  1LAP A;  2F7V A;  1Y0Y A;  1TF8 A;  3SI2 A;  1TF9 A;  4OC3 A;  4P45 A;  5HXD A;  1LAM A;  3B3V A;  3MN8 A;  1VHE A;  2VL1 A;  2G9D A;  2PJ5 A;  3I1U A;  4ZX9 A;  2GLF A;  4PPZ A;  2IJZ A;  1DTD A;  1YLO A;  3KI9 A;  1ELL P;  4MMO A;  4MCQ A;  4NGR A;  2IQ6 A;  2PJA A;  3KHZ A;  3JRU A;  3VAT A;  4PXE A;  1ZG7 A;  8CPA A;  1UWY A;  1YME A;  2JEW A;  3FJU A;  4F8Z A;  3PB8 X;  4FUU A;  4B6Z A;  4PQA A;  2EK8 A;  7CPA A;  4R6T A;  1CX8 A;  1Z5R A;  4OC0 A;  1XMB A;  3V7Z A;  1LCP A;  2I3C A;  1IY7 A;  2ANP A;  3B7I A;  4TNU A;  2WZN A;  3IC1 A;  3PB4 X;  4R8F A;  1OBR A;  2FVG A;  2ZEE A;  5ELY A;  3K2K A;  1CG2 A;  2GLJ A;  1R3N A;  4MCP A;  3K9T A;  4P4B A;  3NFZ A;  3SI1 A;  1Z8L A;  2GU2 A;  2XEJ A;  3L2N A;  3S9L A;  2C6G A;  4NGP A;  2Q43 A;  2XEI A;  1BPN A;  1ZG9 A;  3H8E A;  4DYO A;  5IB9 A;  3B3S A;  3QNV A;  1TXR A;  4WJB A;  3KHX A;  2PJB A;  1VIX A;  3LMS A;  3PBB A;  3PEI A;  4OP4 A;  3H8G A;  3CPA A;  2O4H A;  4DJL A;  5LRK A;  1GYT A;  1YW6 A;  3S9N A;  1VHO A;  3TC8 A;  3SJF A;  3PB9 X;  2V8V A;  3FVL A;  3GLJ A;  4P4I A;  1JQG A;  2AFM A;  4W9Y A;  2PJ3 A;  4MXU A;  2BO9 A;  5I4M A;  1ARM A;  3IO1 A;  1BAV A;  3VAR A;  2OOT A;  3RAM A;  1Y7E A;  3LWU A;  5CBM A;  1EE3 P;  1TKJ A;  1CPS A;  4EWT A;  4FBE A;  3FED A;  5LYL A;  3IIB A;  1ARL A;  2PVW A;  2PJ7 A;  4P10 A;  4MRI A;  4P4E A;  5HVG A;  4GM5 A;  1CPX A;  4ONW A;  5K8M A;  4PXD A;  3N5F A;  1XJO A;  5LYI A;  1AMP A;  4P4D A;  5K8N A;  4EFD A;  4NGQ A;  2V8D A;  2V8G A;  3D7F A;  6CPA A;  2PJ9 A;  2PJ8 A;  4A37 A;  2Q4Z A;  3NH8 A;  3VH9 A;  4F9U A;  4P44 A;  4OME A;  4A39 A;  4OID A;  3KGQ A;  3V38 A;  4ZY0 A;  5HVH A;  3FEC A;  3TX8 A;  4ZI6 A;  2GRE A;  2CIJ A;  2V77 A;  5HVF A;  3GB0 A;  5LYD A;  2PIY A;  4NGT A;  3RZA A;  4ZYQ A;  3RBU A;  4R7M A;  2JBJ A;  3BI0 A;  4TWE A;  2AFS A;  2CTC A;  1RTQ A;  3PRT A;  4NGM A;  3HUV A;  4FAI A;  3ISX A;  1BLL E;  3KR5 A;  2PJ0 A;  4Q7A A;  2ZEO A;  3B35 A;  2BOA A;  3PFE A;  3SI0 A;  3NA6 A;  1Q7L A;  1R43 A;  4AXV A;  2PJ2 A;  4Z65 A;  3CT9 A;  1QMU A;  2IMO A;  4P4J A;  2RFH A;  1LAN A;  2AFZ A;  3GUX A;  4FWU A;  1TKF A;  4UEE A;  3PB6 X;  3KR4 A;  1HEE A;  4P6Y A;  5J1Q A;  3KQZ A;  3WAB A;  4F9V A;  4K3N A;  2PE3 A;  2XEG A;  2PIZ A;  1XRY A;  5THW A;  2AFW A;  3B3C A;  1XFO A;  4MHY A;  5JH9 A;  3KQX A;  4MCR A;  4IHM A;  3D7G A;  3DGV A;  3KAS A;  1YSJ A;  2CTB A;  1CP7 A;  5CPA A;  3SJE A;  3D7D A;  1CP6 A;  2O53 A;  2ZEL A;  4ZX8 A;  3D4U A;  3WC7 A;  3FF3 A;  4MHN A;  2JBK A;  1HDQ A;  4ZY1 A;  2AFU A;  2RB7 A;  2HC9 A;  5LRJ A;  4A94 A;  2ZEM A;  2XEF A;  2NSM A;  4H2K A;  1DE4 C;  2ZEG A;  4NGS A;  4OC2 A;  3B2Y A;  2ZEH A;  3D7H A;  1Y0R A;  1VGY A;  2EWB A;  4KSI A;  3B3W A;  4UIB A;  2WYR A;  4MHZ A;  1F2P A;  3D68 A;  3KZW A;  2AFO A;  1ELM P;  1FT7 A;  1TKH A;  4JYW A;  3DLJ A; 
#chains in the Genus database with same CATH topology
 2J9A A;  5F09 A;  1R9T I;  2ZEF A;  4NGN A;  3CC7 Z;  1YIJ 1;  4UIA A;  4B10 A;  2BJO A;  2WPW A;  3PZJ A;  4A3F I;  1Z2L A;  1I6H I;  1RQF A;  4E32 A;  1YHQ Z;  3WC5 A;  5FLX f;  3H0G I;  3GKR A;  2CF4 A;  4NFR A;  2BUE A;  1QVG Z;  1ZG8 A;  2PCU A;  3CPW Z;  2ATR A;  2B58 A;  1X10 A;  4MFZ A;  2OTL 1;  3D66 A;  4B12 A;  1S72 Z;  2WB1 A;  5T6B A;  2QVP A;  4B5P A;  1HDU A;  1KZF A;  3I56 1;  1P0H A;  4OC1 A;  2VZY A;  3CMA 1;  2NVT I;  5JM6 A;  1CBX A;  4A95 A;  4JZ0 A;  3IFE A;  3VMG A;  4F0X A;  4KSF A;  1ZLI A;  5HMN A;  1KC8 2;  3CC4 Z;  4A31 A;  2GTH A;  4AVA A;  3P5J B;  1PYT B;  2HB6 A;  2C6C A;  1TWG I;  4OKO A;  4IAV A;  3NH5 A;  1ZLH A;  4WWV A;  2J8N A;  2NAP A;  3B3T A;  4Y49 B;  1M1K 2;  4YRH A;  1MJB A;  1M4L A;  4A30 A;  1U6M A;  4FD5 A;  1K8A 1;  3GTO I;  3S1Q I;  2EBJ A;  4QUS A;  2JIM A;  3FX6 A;  2QEX 1;  4HPS A;  1PU9 A;  1IYK A;  3R96 A;  3G8W A;  3SJG A;  1JWH C;  1LAP A;  2FS5 A;  2VPZ A;  1TF8 A;  4NF1 A;  1TF9 A;  4E33 A;  5HXD A;  2VI7 A;  3B3V A;  3MN8 A;  1VHE A;  2Z3N A;  2Q4V A;  4ZX9 A;  4UA3 A;  3I56 Z;  2JA8 I;  3CMA Z;  1ML8 A;  1YLO A;  3KI9 A;  4MMO A;  4M85 A;  3FQM A;  1KD1 1;  2VEZ A;  4NH1 C;  1SIW A;  3P2H A;  3JRU A;  3VAT A;  3QAY A;  3FJU A;  4F8Z A;  3PB8 X;  3IGR A;  2AKL A;  7CPA A;  2REE A;  3EY5 A;  1CX8 A;  1K4J A;  4OC0 A;  3H3V J;  5EC4 A;  5D1P A;  3BLN A;  1TWF I;  4J3G A;  1I3Q I;  4TNU A;  2WZN A;  4PSW A;  4RV9 A;  3DR8 A;  2NVQ I;  1S7N A;  2LFU A;  4KOY A;  2P6E A;  3K2K A;  5C4J I;  1L1O C;  4U5Y A;  4BY1 I;  1QF8 A;  3NFZ A;  3SI1 A;  1Z8L A;  2OOX B;  2QEX Z;  3S1R I;  3RO0 A;  3S6H A;  2C6G A;  2WPX A;  1Z02 A;  4C2Y A;  2HF1 A;  3F3F C;  5IB9 A;  1QSO A;  4MD7 A;  2YAD A;  2PRB A;  4NB9 A;  1A2Z A;  5DWM A;  3GIU A;  4BXX I;  1NSL A;  2Y0M A;  2YNC A;  4RS4 A;  3H8G A;  3W91 A;  4OLL A;  2R7H A;  1WCM I;  1S7F A;  4HKF A;  1VHO A;  4C2X A;  2B4D A;  3HOU I;  2M48 A;  4H89 A;  2PJ3 A;  4MXU A;  4NXY A;  1Y8C A;  4NBG A;  2BO9 A;  5I4M A;  3HOZ I;  4KS9 A;  5ISV A;  3RAM A;  1YJN 1;  4A93 I;  5CBM A;  5T64 A;  1VQP 1;  2QR1 B;  2J8M A;  1TWA I;  3OW2 Z;  2HQY A;  1YQE A;  1NE9 A;  4L8A A;  2PJ7 A;  4BBS I;  3VB9 A;  5K8M A;  3CPW Y;  1I1D A;  5K8N A;  3J80 f;  1QSR A;  4NGQ A;  3CXC Z;  1Q81 2;  3HOY I;  4CAV A;  1NJI 1;  4AVB A;  2JLM A;  2JS4 A;  4OME A;  4OID A;  2JIO A;  5HVH A;  3TX8 A;  3ESW A;  1Y7R A;  2CIJ A;  5HVF A;  3GB0 A;  5LYD A;  1YVK A;  3RBU A;  3J81 b;  2JBJ A;  5AG6 A;  3LAC A;  1KQS Z;  3PRT A;  3TFY A;  2PSW A;  5F46 A;  3M4O I;  3GTJ I;  2BOA A;  2GTI A;  1USP A;  1X3W A;  5IX3 A;  4M3S A;  4AXV A;  4B14 A;  2JA5 I;  4U9Y A;  2WAQ A;  3CT9 A;  1YX0 A;  1QMU A;  4H6U A;  4A3B I;  1K73 2;  2QLV B;  4KOS A;  1LAN A;  3GUX A;  4FWU A;  4C7I A;  2OZU A;  4UEE A;  3KQZ A;  4JXR A;  4E31 A;  4MI4 A;  4R3K A;  3JVN A;  1WK4 A;  3TO6 A;  4K3N A;  5THW A;  4I49 A;  3CCV 1;  4KZT A;  4KOR A;  3S16 I;  1YGH A;  2CTB A;  4IUS A;  1TIQ A;  2B5G A;  3LUS A;  3DSB A;  4B5P B;  3D7D A;  3I4N I;  3PP9 A;  2ZEL A;  3D4U A;  4RS2 A;  3FF3 A;  4MHN A;  2JBK A;  1YK3 A;  3LOD A;  1FY7 A;  2HC9 A;  4KUB A;  1M90 2;  1P4N A;  4A94 A;  3F8K A;  4KSI A;  5A2Q b;  4UIB A;  4MH4 A;  1F2P A;  4CL1 A;  2AFO A;  5G21 A;  2P28 A;  5LRG A;  2V8K A;  2FIW A;  3BG1 B;  3T4N B;  1KC8 1;  4UFV A;  3P2F A;  1S5K A;  3CDX A;  2PVV A;  1W2B Z;  2RHB A;  1M4G A;  1KUV A;  1YJW 1;  3I07 A;  4JXQ A;  1X3Z A;  1MJA A;  3IWE A;  4NCZ A;  1Q16 A;  2POK A;  3WT4 A;  1MJ9 A;  4A33 A;  3JUW A;  4AVC A;  5JGF A;  1M1K 1;  2Q04 A;  2DXQ A;  2DE6 A;  2REF A;  3MZL B;  5DS0 A;  3G71 1;  4MFJ A;  3CCV Z;  2V8H A;  1IGB A;  1QST A;  2NMT A;  4R76 A;  4O23 A;  5F47 A;  3IWW A;  5J8F A;  2NYQ A;  3HOW I;  2DEA A;  4EME A;  2E7Z A;  4A3G I;  4KOV A;  2BL1 A;  4ZY2 A;  2G0B A;  2JR6 A;  3FBU A;  3IWG A;  4KUA A;  4X8I A;  4H6Z A;  3SJX A;  4BY7 I;  2QKD A;  2RBL A;  3ISZ A;  3MRU A;  2CNM A;  4MCS A;  4CPA A;  5LL6 f;  3J81 f;  4CGN A;  2R92 I;  3D67 A;  4JJX A;  1ZH1 A;  2QYV A;  2BCO A;  2JDC A;  1FNO A;  2OZK A;  1PCA A;  1YJW Z;  2ZOG A;  3CXC Y;  3S17 I;  2FIA A;  3FQQ A;  1OZP A;  5C4X I;  4MFQ A;  2PQ8 A;  4E2Y A;  3S2D I;  2H5M A;  2HV2 A;  5DWN A;  4CGP A;  3FMC A;  3G71 Z;  4A3I I;  4XPL A;  4MON A;  2F7V A;  4XPK A;  3D9X A;  4OC3 A;  4DNC A;  1KQS Y;  1LAM A;  2BEI A;  3IU1 A;  2G9D A;  3FIX A;  4U9Z A;  3I1U A;  3PO2 I;  3CCU Z;  2VQY A;  4PPZ A;  1DTD A;  2B4D B;  3U50 C;  1ELL P;  4NGR A;  2J8R A;  2IQ6 A;  2V8I A;  1VQ6 1;  2EUI A;  1CM0 A;  1ZG7 A;  3R9G A;  2A4N A;  5IB0 A;  1JJ2 Y;  4FUU A;  1SFO I;  3CCM 1;  5KTC A;  2IZ3 A;  1YLE A;  2V3V A;  3G4S 1;  3S2H I;  2I3C A;  5A2Q f;  1IY7 A;  2ANP A;  1Q2D A;  3B7I A;  4R8F A;  3MGD A;  2QRE B;  1OBR A;  2FVG A;  3S1N I;  2AE6 A;  4RVF A;  2R7Z I;  1R3N A;  2G3A A;  4P4B A;  2CNS A;  3PO3 I;  3S15 I;  2IV2 X;  4NGP A;  1IOF A;  1ZG9 A;  2QRC B;  3B3S A;  1Q81 1;  3QNV A;  1Z4R A;  1NUI A;  2DE7 A;  3HOX I;  2PJB A;  4M6H A;  1VIX A;  3LMS A;  3PEI A;  2QIR A;  4OP4 A;  3J80 b;  3CPA A;  5LRK A;  4II9 A;  1YW6 A;  3TOB A;  3S14 I;  1USP B;  3SJF A;  2V8V A;  1VQ6 Z;  4P4I A;  1JQG A;  1W2B Y;  2JEV A;  4Q36 A;  4FD6 A;  5AG7 A;  4HNX B;  1ARM A;  4LQ6 A;  2PC1 A;  3BG0 B;  1Y7E A;  3CCM Z;  4JWP A;  3IU2 A;  1EE3 P;  4KVO E;  5CNP A;  5IV0 A;  4UCM A;  1TKJ A;  3D8P A;  2D4O A;  3G4S Z;  1N71 A;  1KUX A;  4FBE A;  3IIB A;  2YNC C;  1ARL A;  2Z3M A;  1K73 1;  1M4D A;  4BMH A;  4P10 A;  4MRI A;  5F49 A;  2FXF A;  2EVN A;  4PXD A;  3GTL I;  1YJ9 1;  2G3T A;  3CXQ A;  3GTM S;  6CPA A;  5D1O A;  2B5G B;  2IL4 A;  3D3S A;  1AUG A;  2PJ8 A;  2Z3L A;  4FD4 A;  4R87 A;  3J7A 4;  3EFA A;  3NH8 A;  4F9U A;  3EXN A;  1M1D A;  2Z3P A;  3V38 A;  2R6M A;  3RNZ A;  2V77 A;  2PIY A;  4ZYQ A;  1ZO0 A;  4TWE A;  3T90 A;  1J4J A;  2AJ6 A;  4F0Y A;  2RC4 A;  1I50 I;  5H84 A;  1YUK A;  1BLL E;  1M90 1;  3KR5 A;  3CCS Z;  2ZEO A;  3B35 A;  2PDO A;  3PFE A;  1Z8T A;  4BBH A;  4HH4 A;  2GAN A;  3R95 A;  3EO4 A;  2OZH A;  1XOV A;  2YNE A;  4Z65 A;  1WZN A;  4BBR I;  4KOT A;  1ON0 A;  2OU2 A;  2RFH A;  4X6A I;  4NBB A;  3S6G A;  2VF1 A;  4PSX A;  1N8R 1;  4NSQ A;  1KRL A;  3S6K A;  2C27 A;  3PB6 X;  4RVD A;  4QVT A;  4E2A A;  1Y9K A;  3SXN A;  4ONU A;  4P6Y A;  4E8O A;  3VMH A;  3CC2 1;  1R57 A;  1YJ9 Z;  2XEG A;  3B3C A;  3R9E A;  4MBU A;  2ZW7 A;  5JH9 A;  4OAD A;  3KQX A;  4CYP A;  2JIP A;  4FD7 A;  3WR7 A;  4IHM A;  3D7G A;  4NB8 A;  4S1T A;  1BOB A;  2FL4 A;  3KAS A;  3DDD A;  5CPA A;  2JNY A;  4ZX8 A;  3B8G A;  2ZAE B;  1Q2C A;  3IFU A;  4ZY1 A;  2JMO A;  2AFU A;  1PUA A;  3R9F A;  5LRJ A;  4CGL A;  4CYQ A;  3CXS A;  4MFK A;  3ZZI A;  3K9U A;  2ZEG A;  1QXF A;  1FDO A;  1Z01 A;  3PO3 S;  2WYR A;  2FCK A;  2B63 I;  3KZW A;  2W04 A;  1Y1V I;  2P3Y A;  1FT7 A;  5AG4 A;  4NBE A;  4MY3 A;  3TDH B;  4UEF A;  2ABZ A;  3I9S A;  4CGM A;  2PJ1 A;  3WC6 A;  4LQG A;  4AYB A;  2AYD A;  4GXH A;  1VQM 1;  2QJ8 A;  3QB8 A;  2PJ4 A;  3PBE A;  4UEZ A;  4NBF A;  2OR4 A;  4QTT A;  3CC2 Z;  3BI1 A;  1RO2 A;  4XPD C;  1KWM A;  3G6E 1;  4UF4 A;  1QVF Y;  1Q82 2;  3DR6 A;  3S9M A;  1AYE A;  3IX0 A;  4PXC A;  2ZEP A;  4CGO A;  5I0C A;  2P6F A;  1NSA A;  2KCW A;  2LIY A;  3BJ7 A;  2C1C A;  3NH4 A;  3BXM A;  4DK1 A;  2YND A;  1F2O A;  4P4F A;  5IP9 I;  4KLV A;  3PFO A;  1JJ2 Z;  4UBR A;  3CCQ 1;  3H8F A;  5JPH A;  2ZW5 A;  1B87 A;  4CRZ B;  1X12 A;  3CCL 1;  3GTQ I;  3TTH A;  3D2L A;  2Q7B A;  1XBU A;  4E2W A;  1LFW A;  5IT9 b;  2H85 A;  3QWU A;  5FVJ A;  4DUK A;  1TWH I;  3K7A I;  4RUH A;  2FSR A;  3HLP A;  2C6P A;  1VQ9 1;  2F8H A;  3TE4 A;  3CPX A;  5C82 A;  1VQM Z;  1L0C A;  1LRZ A;  4BIN A;  5G22 A;  2Z10 A;  3I4M I;  4NJR A;  4OC5 A;  2I79 A;  1IU8 A;  1BPM A;  3I3G A;  3I55 1;  3BHX A;  1BO4 A;  1NMT A;  4EWC A;  3G6E Z;  4AG9 A;  5AN9 F;  4CAW A;  1Y0Y A;  3SI2 A;  1RNI A;  1Y1W I;  1N8R 2;  4M6I A;  2R1I A;  3KIF A;  5AGE A;  2GLF A;  3C26 A;  2ZW6 A;  1QYP A;  3CCQ Z;  4MCQ A;  5E96 A;  1M4I A;  2PJA A;  1S7K A;  3CCL Z;  5C88 A;  2ZPA A;  1YME A;  2P0W A;  1K83 I;  2WUU A;  2CNT A;  4A3M I;  4B6Z A;  4PQA A;  2EK8 A;  4R6T A;  2M6N A;  3KIH A;  1VQK 1;  2Z11 A;  1Z5R A;  5EBV A;  2OTJ 1;  1XIX A;  4HNY B;  4Y52 I;  3EER A;  4EVY A;  3IC1 A;  3PB4 X;  3CXP A;  1VQ9 Z;  2WSA A;  2O28 A;  2ZEE A;  1LQL A;  2I00 A;  3CCU 1;  3VWD A;  3A9L A;  1CG2 A;  1ZB9 A;  2Q0Y A;  4X5K A;  4MCP A;  1P9N A;  5D1O B;  2JUB A;  5GCN A;  4MHD A;  3L2N A;  3I55 Z;  3S9L A;  2PMZ A;  4C7H A;  3QAH A;  3T9Y A;  4RN7 A;  1BPN A;  1XF8 A;  3H8E A;  1Q7Y 2;  1TFI A;  4MFL A;  3PBB A;  1M44 A;  1VQ8 1;  4MD9 A;  2V8J A;  4RVG A;  4L89 A;  4DJL A;  2V45 A;  1GYT A;  4AG7 A;  3VTN A;  3S9N A;  3PB9 X;  3PGP A;  3NE7 A;  4E2X A;  5CM2 M;  3GLJ A;  4ZBG A;  2AFM A;  2Z0Z A;  4W9Y A;  1RO4 A;  2F4O A;  4MJ8 A;  4UFX A;  4YFJ A;  1VKC A;  2VXK A;  1S3Z A;  2Q4Y A;  1BAV A;  3LWU A;  2ODF A;  1VQK Z;  2VZZ A;  4PK2 A;  1IOI A;  3KKW A;  2OTJ Z;  3DNS A;  1MK4 A;  2F4M A;  4EWT A;  5IT9 f;  3S6F A;  2QRD B;  5H86 A;  3FED A;  2NVY I;  4Q38 A;  2X7B A;  5C3E I;  3IF8 A;  2YGW A;  2JA6 I;  1CPX A;  4GM5 A;  3VMI A;  1XJO A;  1S7M A;  5LYI A;  4P4D A;  4EFD A;  1Q2Y A;  3RZD I;  3GTP I;  1Z8W A;  1V0C A;  2V8D A;  1Q86 1;  1YR0 A;  4B13 A;  3GYA A;  3TT2 A;  4UCP A;  2Q4Z A;  5KTA A;  3VH9 A;  2ARH A;  4A39 A;  1VQ7 1;  4ZY0 A;  3FEC A;  4ZI6 A;  2VPW A;  2GRE A;  3JAM b;  4CAX A;  4NGT A;  1VQ8 Z;  2W03 A;  4R7M A;  3BI0 A;  4NBD A;  3GTG I;  2AFS A;  2CTC A;  3HUV A;  1YI2 1;  4FAI A;  4Q7A A;  4DGL A;  5KTD A;  2OH1 A;  3NA6 A;  1S7L A;  2LEX A;  4NBH A;  2GE3 A;  1Q7L A;  2PJ2 A;  1Y9W A;  2Q7S A;  4KVX A;  3LD2 A;  3RYO A;  1TKF A;  2Z3O A;  1N2F A;  1QVF Z;  2F5I A;  3ZJ0 A;  3CD6 1;  4LX9 A;  5J1Q A;  1RO0 A;  3WAB A;  4F9V A;  2B3V A;  1VQ4 1;  3W6X A;  1XRY A;  2K3R A;  2AFW A;  3CCS 1;  1XFO A;  4MHY A;  2ZW4 A;  2FT0 A;  1IYL A;  3DGV A;  1K9M 2;  1YSJ A;  2JA7 I;  2J6A A;  1CP6 A;  1Q82 1;  4A3D I;  1YIJ Z;  5C44 I;  1VQ7 Z;  4A32 A;  3WC7 A;  4MD8 A;  3FNC A;  3H4Q A;  2PR8 A;  2NSM A;  4K30 A;  2HU9 A;  3D7H A;  2ZEH A;  1CJW A;  1VGY A;  1VQ5 1;  2B4B A;  1YI2 Z;  3FB3 A;  2CY2 A;  4ORF A;  4MHZ A;  3D68 A;  1ELM P;  3MZK B;  4HGZ A;  1YVO A;  3E0K A;  2XEF A;  5IP7 I;  2OTL Z;  3FEE A;  4A38 A;  2KI7 B;  1VLA A;  3TO9 A;  4G1P A;  3NDJ A;  5EMI A;  2EK9 A;  2Q51 A;  3Q87 A;  3UY5 A;  1YW4 A;  5J8C A;  4E0A A;  2PR1 A;  4XNH B;  2BSW A;  4QC6 A;  4IF5 A;  1YUA A;  3CD6 Z;  2R8V A;  2ZEN A;  5A27 A;  1Z4E A;  3IJ3 A;  5D8N A;  3FH4 A;  4XPD B;  3FKI I;  5D29 A;  3IEH A;  4YWY A;  1VQ4 Z;  4M6G A;  1WJ2 A;  2NVX I;  4OIW A;  4MHP A;  1QQ9 A;  2PJ6 A;  2JDD A;  3NE8 A;  4C2Z A;  3TCV A;  3NDI A;  4MFP A;  2RPR A;  3T8W A;  4IK2 A;  2EGT A;  4PXB A;  4A3L I;  4NBA A;  4CAF A;  2QEC A;  4A3E I;  2VBQ A;  2AFX A;  4OC4 A;  2E2I I;  1H8L A;  1Z9U A;  3KL9 A;  3D6W A;  1VQ5 Z;  4YU9 A;  1Q86 2;  3JAM f;  3CCE 1;  2K5T A;  1YIT 1;  4X3R A;  3GKQ A;  4NJQ A;  2VPY A;  1XE4 A;  2E2J I;  5K8O A;  1UFH A;  2GFQ A;  4CRY B;  4BD9 A;  1WII A;  3EED A;  2ZOF A;  2ZED A;  1F57 A;  1NP6 A;  4Y49 C;  3PB7 X;  5K8P A;  3HKZ A;  1IB1 E;  1I12 A;  2ZXV A;  1RO5 A;  3H5Z A;  2PJC A;  2PRQ A;  5T67 A;  2R93 I;  4X2T A;  5G1Z A;  2OOY B;  3GY9 A;  5LYF A;  4JLY A;  1LOK A;  1SQH A;  1WW9 A;  2K5R A;  2DPT A;  3EC4 A;  2DPS A;  4P45 A;  1YRE A;  4KOX A;  1Q7Y 1;  2OZG A;  2VL1 A;  1VQL 1;  1QVG Y;  2PJ5 A;  4Y7N I;  2E9H A;  2IJZ A;  3VWE A;  1VQN 1;  3KHZ A;  4XNH C;  3SXO A;  4LUA A;  2R98 A;  3W6S A;  3SHP A;  4PXE A;  4RI1 A;  2EO8 A;  1UWY A;  8CPA A;  2JEW A;  3D2M A;  3CCR 1;  5HH1 A;  3CCE Z;  1YIT Z;  2B3U A;  2VUG A;  4KVM E;  1XMB A;  3V7Z A;  1LCP A;  4KLW A;  5JQ4 A;  1TWC I;  1K8A 2;  5AG5 A;  2CXA A;  2JIR A;  4B11 A;  5ELY A;  4B5O A;  3HOV I;  5A28 A;  2GLJ A;  3F3P C;  3K9T A;  5G20 A;  3BJ8 A;  2VUM I;  2GU2 A;  2XEJ A;  1QSN A;  1YJN Z;  3R1K A;  2Q43 A;  2XEI A;  3IR7 A;  4DYO A;  1VQP Z;  4QBJ A;  1XEB A;  4UWI A;  1TXR A;  4WJB A;  1B6B A;  3KHX A;  3S1M I;  3RZO I;  4CYO A;  3TOA A;  1KD1 2;  2D4P A;  2E2H I;  1VQL Z;  4CS0 B;  2O4H A;  2IZ4 A;  3FRM A;  4UWJ A;  1GHE A;  1VQN Z;  3TC8 A;  2QA4 1;  3FVL A;  3CCJ 1;  4R57 A;  4QB9 A;  4YGO A;  3TO7 A;  3IO1 A;  3CCR Z;  3VAR A;  2OOT A;  3V8I A;  4HGY A;  1RLY A;  3GTK I;  1IID A;  2DE5 A;  3FYN A;  5FLX b;  3G3S A;  1CPS A;  4C68 A;  5LYL A;  2PVW A;  2GIV A;  4P4E A;  4RVH A;  3FXT A;  5HVG A;  4ONW A;  2HUZ A;  1I21 A;  1S60 A;  3N5F A;  1X0T A;  1AMP A;  1IIC A;  3OWC A;  3F0A A;  1KUY A;  2QML A;  1Z03 A;  1Z8X A;  2V8G A;  3D7F A;  5FLM I;  2PJ9 A;  4KOW A;  4PV6 A;  4A37 A;  2Y0S A;  1AA6 A;  1VQO 1;  4P44 A;  1FDI A;  4KSA A;  3KGQ A;  2G2K A;  1K9M 1;  2RT9 A;  4E30 A;  4UFW A;  4HNW B;  3TE5 B;  3RZA A;  4R9M A;  3F5B A;  4CYN A;  2P6G A;  2Z3K A;  1XMT A;  4JD6 A;  1RTQ A;  4NGM A;  2QA4 Z;  3ISX A;  4F6A A;  2PJ0 A;  3CCJ Z;  3CME 1;  3SI0 A;  5BWA B;  1QSM A;  4NBC A;  1VHS A;  1R43 A;  1Y1V S;  2Q44 A;  3M3Y I;  1PFT A;  4NEX A;  4A3J I;  2PM9 A;  4MY0 A;  4R3L A;  2IMO A;  3CC7 1;  4P4J A;  2AFZ A;  1JWQ A;  1YHQ 1;  4E2Z A;  3KR4 A;  1HEE A;  4ZGY B;  4A3K I;  4DQY B;  5F48 A;  3CZX A;  3CQZ I;  3D2P A;  3GTM I;  3OW2 Y;  1NJI 2;  4PK3 A;  2PE3 A;  2PIZ A;  2JIQ A;  4A3C I;  4MCR A;  2PK7 A;  2VPX A;  1CP7 A;  3N7Z A;  3SJE A;  1S72 1;  4NOZ A;  4KOU A;  1VQO Z;  2O53 A;  1ZB8 A;  2FE7 A;  2RIQ A;  4CAE A;  1WWZ A;  4AB7 A;  1HDQ A;  2RB7 A;  2OB0 A;  2ZEM A;  4H2K A;  1DE4 C;  4NGS A;  4OC2 A;  3B2Y A;  4XX2 A;  1RXT A;  4GS4 A;  1Y0R A;  2KPI A;  3MON A;  2EWB A;  3GCF A;  4OAE A;  1DL6 A;  3B3W A;  4UCN A;  3CC4 1;  2YU9 I;  4A2Z A;  3JTK A;  3CME Z;  2DF5 A;  4QTU A;  1TKH A;  4JYW A;  3DLJ A; 
#chains in the Genus database with same CATH homology
 4UEF A;  5IP7 I;  5LRG A;  2OTL Z;  2V8K A;  2ABZ A;  2J9A A;  3FEE A;  4A38 A;  5F09 A;  1R9T I;  2KI7 B;  3BG1 B;  3T4N B;  1KC8 1;  2PJ1 A;  2ZEF A;  4NGN A;  1VLA A;  3CDX A;  2PVV A;  1W2B Z;  2RHB A;  4G1P A;  3WC6 A;  3NDJ A;  3CC7 Z;  1YJW 1;  4LQG A;  3I07 A;  1YIJ 1;  2EK9 A;  4AYB A;  4UIA A;  2Q51 A;  3Q87 A;  1X3Z A;  1VQM 1;  1YW4 A;  2QJ8 A;  2BJO A;  2PJ4 A;  2POK A;  3WT4 A;  4A3F I;  1Z2L A;  3PBE A;  1I6H I;  1RQF A;  1YUA A;  4E32 A;  1YHQ Z;  3CD6 Z;  2ZEN A;  3WC5 A;  5JGF A;  5FLX f;  3IJ3 A;  4UEZ A;  4NBF A;  2OR4 A;  5D8N A;  1M1K 1;  4QTT A;  3FH4 A;  2DE6 A;  3H0G I;  3CC2 Z;  3BI1 A;  3FKI I;  3MZL B;  1RO2 A;  5D29 A;  1KWM A;  5DS0 A;  3G6E 1;  2CF4 A;  3IEH A;  3G71 1;  4YWY A;  4NFR A;  1VQ4 Z;  3CCV Z;  2NVX I;  4OIW A;  4UF4 A;  1QVG Z;  2V8H A;  1QVF Y;  1Q82 2;  1ZG8 A;  1IGB A;  4MHP A;  1QQ9 A;  2PJ6 A;  2PCU A;  3S9M A;  4R76 A;  1AYE A;  3IX0 A;  3CPW Z;  4PXC A;  2ZEP A;  4O23 A;  3IWW A;  2OTL 1;  2NYQ A;  3NDI A;  3D66 A;  1NSA A;  2LIY A;  1S72 Z;  3HOW I;  2DEA A;  2C1C A;  2RPR A;  2WB1 A;  3T8W A;  3NH4 A;  5T6B A;  2QVP A;  4IK2 A;  4EME A;  2EGT A;  1HDU A;  3BXM A;  4DK1 A;  1F2O A;  3I56 1;  4P4F A;  4A3G I;  5IP9 I;  4OC1 A;  4ZY2 A;  3CMA 1;  3PFO A;  2NVT I;  4A3L I;  4PXB A;  2JR6 A;  5JM6 A;  1JJ2 Z;  4NBA A;  3CCQ 1;  1CBX A;  3H8F A;  4JZ0 A;  4X8I A;  3IFE A;  4A3E I;  3SJX A;  3VMG A;  3CCL 1;  3GTQ I;  4BY7 I;  2AFX A;  2QKD A;  4OC4 A;  2E2I I;  1H8L A;  1ZLI A;  3KL9 A;  3D6W A;  1XBU A;  2RBL A;  1VQ5 Z;  4YU9 A;  3ISZ A;  4E2W A;  1Q86 2;  3JAM f;  3MRU A;  3CCE 1;  1LFW A;  5IT9 b;  1KC8 2;  3CC4 Z;  1YIT 1;  4X3R A;  2H85 A;  3QWU A;  4MCS A;  3GKQ A;  4CPA A;  4DUK A;  1TWH I;  3K7A I;  5LL6 f;  3J81 f;  2R92 I;  2GTH A;  3D67 A;  1ZH1 A;  4RUH A;  4NJQ A;  2QYV A;  3P5J B;  2BCO A;  3HLP A;  1PYT B;  2HB6 A;  2C6C A;  2E2J I;  1TWG I;  4OKO A;  4IAV A;  3NH5 A;  1FNO A;  5K8O A;  2C6P A;  1ZLH A;  2OZK A;  1PCA A;  4BD9 A;  4WWV A;  1WII A;  3EED A;  1VQ9 1;  1YJW Z;  2F8H A;  2ZED A;  2ZOF A;  2ZOG A;  3B3T A;  3CPX A;  1F57 A;  3CXC Y;  1NP6 A;  1VQM Z;  1M1K 2;  3PB7 X;  3S17 I;  5K8P A;  1M4L A;  3FQQ A;  3HKZ A;  3I4M I;  4NJR A;  4OC5 A;  1K8A 1;  3GTO I;  2PJC A;  3S1Q I;  5C4X I;  2PRQ A;  1BPM A;  4E2Y A;  5T67 A;  3S2D I;  3FX6 A;  2QEX 1;  2R93 I;  3I55 1;  3BHX A;  4X2T A;  3SJG A;  1JWH C;  4EWC A;  3FMC A;  2OOY B;  3G6E Z;  3G71 Z;  4A3I I;  5LYF A;  1LOK A;  1LAP A;  4MON A;  2F7V A;  1WW9 A;  3D9X A;  5AN9 F;  2K5R A;  1Y0Y A;  1TF8 A;  3SI2 A;  1RNI A;  1TF9 A;  4E33 A;  4OC3 A;  4P45 A;  5HXD A;  1KQS Y;  1LAM A;  1Y1W I;  1N8R 2;  3B3V A;  1Q7Y 1;  3MN8 A;  1VHE A;  2VL1 A;  2G9D A;  1VQL 1;  1QVG Y;  2PJ5 A;  4Y7N I;  2E9H A;  3KIF A;  3I1U A;  3PO2 I;  4ZX9 A;  2GLF A;  3CCU Z;  3I56 Z;  4PPZ A;  2IJZ A;  2JA8 I;  1DTD A;  3CMA Z;  1VQN 1;  1ML8 A;  1QYP A;  1YLO A;  3KI9 A;  3U50 C;  1ELL P;  4MMO A;  3FQM A;  3CCQ Z;  4MCQ A;  4NGR A;  2IQ6 A;  1KD1 1;  2V8I A;  1VQ6 1;  2PJA A;  4JYW A;  3KHZ A;  4NH1 C;  3CCL Z;  3JRU A;  3VAT A;  4PXE A;  1ZG7 A;  8CPA A;  1UWY A;  1YME A;  2JEW A;  1K83 I;  3FJU A;  4F8Z A;  3CCR 1;  3PB8 X;  4A3M I;  1JJ2 Y;  3CCE Z;  4FUU A;  4B6Z A;  4PQA A;  1YIT Z;  1SFO I;  2EK8 A;  3CCM 1;  2AKL A;  7CPA A;  4R6T A;  2VUG A;  2M6N A;  3KIH A;  1VQK 1;  2IZ3 A;  1CX8 A;  1Z5R A;  4OC0 A;  1XMB A;  2OTJ 1;  3H3V J;  3G4S 1;  4Y52 I;  3EER A;  5D1P A;  3S2H I;  1LCP A;  3V7Z A;  1TWF I;  2I3C A;  5A2Q f;  1IY7 A;  1I3Q I;  2ANP A;  3B7I A;  4TNU A;  1TWC I;  2WZN A;  3IC1 A;  3PB4 X;  4RV9 A;  4R8F A;  1K8A 2;  1VQ9 Z;  2QRE B;  2NVQ I;  1OBR A;  2FVG A;  3S1N I;  2ZEE A;  5ELY A;  2LFU A;  1LQL A;  3HOV I;  3CCU 1;  4RVF A;  2R7Z I;  3K2K A;  1CG2 A;  2GLJ A;  1ZB9 A;  5C4J I;  1R3N A;  3F3P C;  4MCP A;  1L1O C;  1P9N A;  3K9T A;  5D1O B;  4P4B A;  4BY1 I;  1QF8 A;  2JUB A;  3NFZ A;  2VUM I;  3SI1 A;  1Z8L A;  2GU2 A;  2OOX B;  2QEX Z;  3PO3 I;  2XEJ A;  3L2N A;  3I55 Z;  3S1R I;  2PMZ A;  3S9L A;  3S15 I;  2C6G A;  4NGP A;  1YJN Z;  1Z02 A;  2Q43 A;  2XEI A;  2HF1 A;  1BPN A;  1ZG9 A;  3H8E A;  3F3F C;  2QRC B;  4DYO A;  1Q7Y 2;  5IB9 A;  3B3S A;  1Q81 1;  3QNV A;  1VQP Z;  4MD7 A;  1TXR A;  1TFI A;  2YAD A;  4WJB A;  1NUI A;  2DE7 A;  3HOX I;  3S1M I;  2PJB A;  3KHX A;  1VIX A;  4NB9 A;  3RZO I;  3LMS A;  3PBB A;  3PEI A;  1VQ8 1;  4OP4 A;  1KD1 2;  4MD9 A;  2E2H I;  1VQL Z;  4BXX I;  2V8J A;  3J80 b;  4RVG A;  4RS4 A;  3H8G A;  3CPA A;  2O4H A;  2IZ4 A;  4DJL A;  5LRK A;  1WCM I;  1GYT A;  3VTN A;  1YW6 A;  3S14 I;  1VHO A;  3S9N A;  1VQN Z;  3TC8 A;  2QA4 1;  1USP B;  3SJF A;  3PB9 X;  2V8V A;  3HOU I;  3CCJ 1;  1VQ6 Z;  3FVL A;  2M48 A;  4E2X A;  5CM2 M;  3GLJ A;  4P4I A;  1JQG A;  1W2B Y;  2AFM A;  4W9Y A;  2PJ3 A;  4MXU A;  1RO4 A;  2F4O A;  4NBG A;  2BO9 A;  5I4M A;  1ARM A;  3HOZ I;  3IO1 A;  3CCR Z;  1BAV A;  3VAR A;  3BG0 B;  2OOT A;  3RAM A;  1Y7E A;  4HGY A;  1YJN 1;  3CCM Z;  4A93 I;  3LWU A;  1RLY A;  3GTK I;  5T64 A;  5CBM A;  1VQK Z;  2DE5 A;  1EE3 P;  5FLX b;  1VQP 1;  1CPS A;  2QR1 B;  2OTJ Z;  1TKJ A;  3G4S Z;  1TWA I;  2F4M A;  3OW2 Z;  4EWT A;  5IT9 f;  2QRD B;  4FBE A;  3FED A;  2NVY I;  5LYL A;  3IIB A;  1ARL A;  2PVW A;  1K73 1;  2PJ7 A;  4P10 A;  5C3E I;  4MRI A;  4BBS I;  3IF8 A;  4P4E A;  4RVH A;  3VB9 A;  2JA6 I;  1CPX A;  4GM5 A;  4ONW A;  3GTL I;  4PXD A;  5HVG A;  3N5F A;  1YJ9 1;  3VMI A;  3CPW Y;  1XJO A;  1X0T A;  1S7M A;  5LYI A;  1AMP A;  4P4D A;  5K8N A;  3J80 f;  4EFD A;  3GTM S;  3RZD I;  3GTP I;  4NGQ A;  3CXC Z;  2V8D A;  1Q81 2;  1Z03 A;  2V8G A;  3D7F A;  5FLM I;  1Q86 1;  5D1O A;  3HOY I;  2PJ9 A;  6CPA A;  5K8M A;  1NJI 1;  2PJ8 A;  4A37 A;  2Q4Z A;  2Y0S A;  3J7A 4;  3NH8 A;  1VQO 1;  3VH9 A;  2JS4 A;  4F9U A;  4P44 A;  4OME A;  4A39 A;  1VQ7 1;  4OID A;  3KGQ A;  3V38 A;  2G2K A;  2R6M A;  1K9M 1;  4ZY0 A;  5HVH A;  2RT9 A;  4E30 A;  3FEC A;  3TX8 A;  3ESW A;  4ZI6 A;  2GRE A;  3JAM b;  2CIJ A;  2V77 A;  5HVF A;  3GB0 A;  5LYD A;  3TE5 B;  2PIY A;  4NGT A;  3RZA A;  1VQ8 Z;  4ZYQ A;  3RBU A;  2W03 A;  4R7M A;  3J81 b;  2JBJ A;  3BI0 A;  4TWE A;  4NBD A;  1KQS Z;  3GTG I;  2AFS A;  2CTC A;  1RTQ A;  3PRT A;  1I50 I;  4NGM A;  3HUV A;  1YI2 1;  2QA4 Z;  4FAI A;  3ISX A;  1YUK A;  1BLL E;  1M90 1;  3KR5 A;  2PJ0 A;  3CCS Z;  4Q7A A;  3CCJ Z;  4DGL A;  3GTJ I;  3M4O I;  2ZEO A;  3B35 A;  3CME 1;  2GTI A;  1USP A;  2BOA A;  3PFE A;  3SI0 A;  3NA6 A;  4NBC A;  1X3W A;  4NBH A;  4HH4 A;  1Q7L A;  1R43 A;  1Y1V S;  2PJ2 A;  4AXV A;  3M3Y I;  1PFT A;  4Z65 A;  4A3J I;  2JA5 I;  2WAQ A;  3CT9 A;  2PM9 A;  1QMU A;  2IMO A;  4BBR I;  4A3B I;  3CC7 1;  4P4J A;  1K73 2;  2QLV B;  2RFH A;  4X6A I;  1LAN A;  4NBB A;  2AFZ A;  2VF1 A;  3GUX A;  4FWU A;  1N8R 1;  1KRL A;  1TKF A;  4UEE A;  1N2F A;  3PB6 X;  1QVF Z;  4RVD A;  1YHQ 1;  3CD6 1;  4E2Z A;  3KR4 A;  1HEE A;  4P6Y A;  4A3K I;  5J1Q A;  1RO0 A;  4DQY B;  3KQZ A;  3VMH A;  3CQZ I;  4E31 A;  3WAB A;  3CC2 1;  4F9V A;  3GTM I;  1YJ9 Z;  3OW2 Y;  1NJI 2;  4K3N A;  1VQ4 1;  2PE3 A;  2XEG A;  2PIZ A;  1XRY A;  5THW A;  2K3R A;  3CCV 1;  2AFW A;  3B3C A;  3CCS 1;  1XFO A;  4MHY A;  5JH9 A;  4A3C I;  3KQX A;  4MCR A;  2PK7 A;  3D7G A;  4NB8 A;  4IHM A;  3DGV A;  4S1T A;  1K9M 2;  3S16 I;  3KAS A;  1YSJ A;  2CTB A;  1CP7 A;  5CPA A;  2JA7 I;  3SJE A;  3LUS A;  2J6A A;  1S72 1;  3D7D A;  4NOZ A;  2JNY A;  1CP6 A;  1Q82 1;  4A3D I;  1VQO Z;  1YIJ Z;  3I4N I;  2O53 A;  2ZEL A;  1ZB8 A;  5C44 I;  4ZX8 A;  2RIQ A;  1VQ7 Z;  3D4U A;  2ZAE B;  3WC7 A;  4MD8 A;  3FF3 A;  4MHN A;  2JBK A;  3IFU A;  1HDQ A;  4ZY1 A;  2JMO A;  2AFU A;  2RB7 A;  2HC9 A;  5LRJ A;  1M90 2;  4A94 A;  2ZEM A;  2XEF A;  2NSM A;  4H2K A;  2HU9 A;  1DE4 C;  2ZEG A;  4NGS A;  4OC2 A;  3B2Y A;  2ZEH A;  3D7H A;  4XX2 A;  1Z01 A;  1Y0R A;  2KPI A;  1VGY A;  1VQ5 1;  3MON A;  2EWB A;  3GCF A;  3PO3 S;  4KSI A;  1YI2 Z;  5A2Q b;  1DL6 A;  3B3W A;  4UIB A;  2WYR A;  3CC4 1;  2YU9 I;  4MH4 A;  4MHZ A;  2B63 I;  1F2P A;  3D68 A;  3KZW A;  4CL1 A;  2W04 A;  1ELM P;  3CME Z;  2AFO A;  1Y1V I;  3MZK B;  2P3Y A;  4HGZ A;  4QTU A;  1FT7 A;  2P28 A;  4NBE A;  1TKH A;  3TDH B;  3DLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...