2Q4ZA

Ensemble refinement of the protein crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
307
structure length
307
Chain Sequence
b'CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 89
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q4zA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q4zA01
1HDQA 4UEZA 2ZEDA 3D7GA 4OMEA 3CDXA 4UF4A 2DEAA 4IK2A 1AYEA 5K8PA 2AFMA 1VGYA 3RBUA 3DLJA 4DUKA 2ZEHA 3KR5A 2CF4A 3TX8A 1VHOA 4F9VA 3SI1A 2PJ9A 4ZY2A 4OIDA 4R7MA 1ARMA 2JBKA 2WZNA 2C6PA 3NH8A 3IIBA 4MXUA 2AFSA 3PB4X 4YWYA 1CX8A 1BLLE 3D7HA 2HB6A 4P4FA 5J1QA 7CPAA 2RFHA 2Q51A 3MRUA 4NFRA 3SJGA 2XEJA 3S9LA 2FVGA 1IY7A 3L2NA 4UEEA 2XEFA 2XEGA 1LFWA 1TXRA 3K9TA 4P4DA 5JM6A 3V7ZA 2ZOFA 1NSAA 5K8NA 4PPZA 2OR4A 3PEIA 4OC3A 3WABA 1ZG9A 4GM5A 4OP4A 2WYRA 2PVVA 3KHZA 4A37A 1Y7EA 3FMCA 1FNOA 5K8MA 2ABZA 5HVGA 5F09A 3KQZA 2ZOGA 1F57A 1FT7A 5CBMA 1EE3P 2AFXA 2O53A 3IC1A 4W9YA 3PB8X 3D68A 1BAVA 4OC4A 2F8HA 3B7IA 3FF3A 1F2PA 1BPMA 3S9MA 4R6TA 3WC5A 2PCUA 3TC8A 3B3TA 1TF9A 1DE4C 2C6CA 4R76A 4P4IA 3PBEA 2PJ1A 4UIBA 2PJ5A 3WT4A 3CPAA 3HLPA 4ZX9A 1R3NA 2IMOA 1Z8LA 3BHXA 3HUVA 4NGNA 4PXDA 2ZEPA 2O4HA 2VL1A 2GLFA 5LYDA 1HEEA 4JZ0A 3KHXA 2AFOA 3VARA 3NH5A 4IHMA 4RUHA 4G1PA 2PJ3A 3VATA 1CPSA 4P45A 3IEHA 4ZY0A 5THWA 3IFEA 1RTQA 4ZYQA 4OC1A 5K8OA 2GU2A 1QMUA 4A94A 3S9NA 1TKFA 3D4UA 4P4EA 2C6GA 5IB9A 2PJAA 3LMSA 4MCSA 3FECA 3PBBA 4X3RA 4NGTA 1BPNA 4PQAA 1H8LA 3QNVA 1JQGA 1KWMA 2EK9A 3IWWA 1Q7LA 4DYOA 3D7DA 1YW6A 2QVPA 3N5FA 5LYIA 5HXDA 4Z65A 4OC2A 2C1CA 3SI0A 1UWYA 4ZY1A 4ZX8A 4A38A 6CPAA 3FEDA 4MCQA 3BI1A 2AFUA 3JRUA 3B3SA 1VHEA 1CPXA 2CIJA 4X2TA 1R43A 2ZEEA 1LOKA 4P44A 4PXCA 3KASA 3V38A 2AFWA 3GUXA 2CTCA 3PB6X 4F9UA 3FEEA 3NFZA 4OC0A 2GREA 1XBUA 4NGMA 2NSMA 3IJ3A 2PJ7A 4EWTA 1QQ9A 2V8HA 1ELLP 2AFZA 4A39A 5LYLA 1YSJA 3PFEA 1Y0YA 3LWUA 4ONWA 1XRYA 1TF8A 4WJBA 5HVFA 4P10A 1HDUA 4MMOA 2V8DA 4F8ZA 3GLJA 4K3NA 3VH9A 3BI0A 4KSIA 1ARLA 1TKHA 1CG2A 3T8WA 2BOAA 1LAPA 4X8IA 5D29A 5D8NA 3B35A 1Z2LA 2V8GA 1ZG8A 3KR4A 2NYQA 1ELMP 4NJQA 4OIWA 1XFOA 4NGQA 4AXVA 1ZG7A 3SJXA 3RAMA 4MCPA 3FH4A 5HVHA 3GB0A 4UIAA 2Q43A 2PJCA 4FWUA 4LQGA 4OC5A 4TNUA 2ZELA 3PRTA 4BD9A 3PFOA 5LRKA 3KQXA 3B3WA 2QYVA 4P4BA 2GLJA 3D67A 3SI2A 4DJLA 1PYTB 2RB7A 3I1UA 2EK8A 1YW4A 1GYTA 2CTBA 2HC9A 3IO1A 4Q7AA 3CT9A 5JGFA 3NA6A 4O23A 3B3CA 3D66A 5JH9A 4TWEA 2ANPA 2PIZA 2V77A 2G9DA 2V8VA 4CPAA 3KZWA 1Z5RA 4PXEA 4MCRA 1LAMA 2Q4ZA 1DTDA 1F2OA 3NH4A 3H8FA 5I4MA 3KI9A 1LANA 2J9AA 3B2YA 1AMPA 3FVLA 2I3CA 4MRIA 1ZLHA 2IQ6A 4YU9A 1Y0RA 2IJZA 4UEFA 3ISXA 4NGSA 2PJ4A 4WWVA 2ZEGA 5DS0A 2OOTA 4B6ZA 1LCPA 4MHZA 4R8FA 2JBJA 3SJFA 3KGQA 4EMEA 2POKA 1CP6A 4P4JA 8CPAA 5LYFA 2PVWA 2F7VA 3H8EA 5LRJA 3KL9A 3MN8A 4NGRA 3PB9X 3H8GA 3DGVA 4NJRA 5LRGA 1PCAA 3WC6A 4IAVA 2JEWA 4ZI6A 1IGBA 4EFDA 1VIXA 1YLOA 2PRQA 4OKOA 5CPAA 3FJUA 1M4LA 3PB7X 5ELYA 3ISZA 4JYWA 4MHYA 3D7FA 2ZENA 2BO9A 3WC7A 2XEIA 4FAIA 4MHNA 2ZEMA 3CPXA 4FUUA 1TKJA 3BXMA 2PJ0A 1CBXA 1XMBA 2PJ6A 3RZAA 3FX6A 4MHPA 4NGPA 4PXBA 2PJ8A 2BCOA 1ZLIA 1OBRA 3B3VA 3SJEA 1CP7A 4H2KA 2ZEOA 4P6YA 2QJ8A 2EWBA 3K2KA 4FBEA 2PE3A 2PIYA 1YMEA 2ZEFA 1XJOA 2PJ2A 2PJBA
chains in the Genus database with same CATH superfamily
3BJ8A 4UEZA 3RO0A 1RO2A 2ZEDA 5DWMA 4A3CI 3PZJA 4MFPA 1VQMZ 4UF4A 2HU9A 2EGTA 2AFMA 1VGYA 3RBUA 1KC82 4A3KI 1JWHC 4CYOA 2W04A 2EBJA 2YNEA 3TO6A 4OIDA 5KTDA 2WZNA 1RO0A 1N8R2 2W03A 2REFA 1I6HI 1M1K2 1BLLE 5C82A 3PGPA 3CME1 4P4FA 7CPAA 1YI2Z 3GKQA 3MRUA 1S7FA 3CXSA 3SJGA 2XEJA 4JLYA 3S9LA 2P0WA 1IY7A 1QXFA 2XEFA 4XPDC 1Q2CA 3K9TA 1JWQA 1Y7RA 5IP9I 2ZAEB 3PP9A 4OC3A 3WABA 1ZG9A 1A2ZA 4OP4A 3HOZI 1MK4A 4NBGA 1Y7EA 5IB0A 1FNOA 3ZJ0A 1Q821 2JA8I 4CAWA 1FT7A 1QSRA 3HOXI 5CBMA 2AFXA 1CJWA 2G2KA 2NAPA 2VZYA 4B13A 3D68A 1BAVA 3JUWA 4HGYA 3B7IA 2RPRA 2JIOA 2OU2A 2R7HA 4F0YA 1M1DA 4R6TA 2PCUA 1K83I 1PUAA 4R76A 3FKII 2PM9A 3W6SA 3FXTA 4UIBA 4R9MA 1S721 3R9FA 2B3VA 3P5JB 2KI7B 2V45A 1Z8LA 4PXDA 1BOBA 4KOYA 2IZ4A 1PFTA 5LYDA 4YRHA 1HEEA 2JA5I 4CL1A 5T6BA 5C3EI 4CRYB 1QF8A 1KUXA 4M6HA 4XPDB 4G1PA 2PJ3A 3MGDA 1CPSA 1B6BA 3IF8A 1Z8WA 3PO3I 1YUAA 2WB1A 5THWA 1KQSZ 2JEVA 5K8OA 1UFHA 2Q7SA 1QMUA 1SIWA 4J3GA 1CM0A 3T90A 3I561 5AG6A 3S1NI 2RC4A 5AGEA 2PQ8A 4P4EA 4KORA 3LMSA 3EEDA 4MCSA 3GTGI 2VQYA 1VQ51 1KUVA 4NGTA 1BPNA 3QNVA 1S72Z 1P4NA 1KWMA 2EK9A 2R7ZI 2Q7BA 1Q7LA 4OAEA 1IICA 1Z4EA 2C1CA 4A38A 2REEA 3FEDA 2P6FA 1K732 3BI1A 1VHSA 2VF1A 2LEXA 4NF1A 3CXPA 3TE4A 1I50I 3V38A 4B5OA 5F49A 3PB6X 3K7AI 2R8VA 2R93I 5G20A 1XBUA 3SHPA 4NGMA 3D2PA 3I56Z 3R1KA 2YU9I 1KUYA 3S17I 3VB9A 2K3RA 1KC81 1YLEA 1VQ5Z 3VMIA 3S6FA 4LX9A 4HNYB 5I0CA 4DGLA 5D1OA 3BI0A 2M6NA 3EO4A 4JWPA 4RS2A 1TKHA 1USPA 3T8WA 5D29A 3T9YA 1N8R1 4FD7A 4R3KA 2VPYA 1LRZA 2NYQA 1ELMP 1M1K1 4NJQA 3F8KA 5C4XI 4HGZA 1XFOA 4FD6A 4PK2A 1ZG7A 4XNHC 4R87A 2WSAA 3CQZI 4MCPA 4H6UA 4M6GA 3GB0A 2Q43A 1VQ81 4FWUA 2VZZA 2ZELA 3CC2Z 2F4MA 4EWCA 1DL6A 3OW2Z 2CY2A 4BD9A 5C4JI 3TOAA 3B3WA 1K4JA 2GLJA 3D67A 3SI2A 4DJLA 1YJN1 1PYTB 4BBRI 4DQYB 2RB7A 2WPXA 2EK8A 4E2YA 1GYTA 5EC4A 3CT9A 3NA6A 4O23A 5T64A 1I1DA 5JH9A 2OOYB 2OZKA 1NJI2 5AG7A 4A3JI 3BJ7A 2P28A 1XF8A 4PXEA 2CNTA 1LAMA 3OWCA 3MZLB 5IP7I 1LANA 1VQ9Z 4QTUA 2DXQA 3GTMI 4JJXA 2IQ6A 4UEFA 4Y49C 4NGSA 1IYKA 1VQN1 1YGHA 4NH1C 5AG5A 3BLNA 3WR7A 4R8FA 1VQ8Z 2YNDA 2J8RA 4UA3A 2POKA 1CP6A 1Q7Y2 8CPAA 1BO4A 4XNHB 3H8EA 4CYNA 3KL9A 1XOVA 1WW9A 2EO8A 3PB9X 3DGVA 2JEWA 1FDIA 4NBCA 1YJNZ 2PRQA 1QSOA 3S14I 2RIQA 3PB7X 3ISZA 2Z3LA 4MHYA 4PK3A 4U9YA 4GXHA 4MHNA 3D8PA 1QSTA 4KS9A 3S6GA 1VQO1 3I9SA 1K8A2 1CBXA 1RO4A 4A31A 3RZAA 4A2ZA 1PU9A 3CCR1 4RS4A 4DNCA 1TWAI 4C68A 3G4SZ 2BCOA 5JQ4A 2EUIA 1CP7A 4F0XA 4B12A 1Q822 1VQNZ 4H2KA 2ZEOA 3UY5A 2CXAA 2EWBA 2PE3A 2PIYA 2C27A 4KOXA 2O28A 2ZEFA 1XJOA 2PJ2A 4RI1A 1Y8CA 4Y49B 3CXCY 2HF1A 4E2AA 1M44A 5G1ZA 4CGMA 4MFJA 1VQK1 4A3MI 3CDXA 4NB9A 1VQ41 2FS5A 1AYEA 1K731 3DLJA 3P2HA 4MJ8A 2VBQA 2Y0MA 3TX8A 2QMLA 3SI1A 4R7MA 3RNZA 4FD5A 2C6PA 3GY9A 3NH8A 4NOZA 4MXUA 4NBAA 3PB4X 1NE9A 5KTAA 3VTNA 4A30A 2RFHA 3CCRZ 3F3FC 1MJ9A 3HOVI 4KOTA 4NFRA 5H86A 4CAFA 5E96A 1LFWA 2A4NA 2GTIA 4UCPA 2OR4A 2QIRA 4B5PB 2HV2A 1VQKZ 3S2HI 4MD7A 2RBLA 2PVVA 4E33A 1VQ4Z 1YREA 4KVME 3MONA 5HVGA 3CMA1 3G3SA 1YIJ1 5F09A 2ZOGA 2AKLA 1TWGI 2PMZA 2O53A 3IC1A 3HOWI 4OC4A 3FF3A 4B14A 1BPMA 3DDDA 3WC5A 1NUIA 3CZXA 3TC8A 3B3TA 4NBDA 2PJ1A 4X6AI 3NDIA 3WT4A 3HLPA 4KZTA 4NGNA 1NJI1 4MFZA 2VL1A 1L1OC 4ZBGA 3I07A 4HNWB 4IHMA 3VATA 5C88A 2OZHA 4C2ZA 3F0AA 2B5GA 1M4GA 3CMAZ 3IFEA 1YIJZ 3P2FA 1YUKA 4RVGA 4QB9A 3CD61 4AVCA 2VPWA 4A94A 5BWAB 1Q7Y1 3CC71 4ORFA 1QSNA 1TWFI 3D4UA 2C6GA 1KQSY 3PBBA 4X3RA 1VQ71 1H8LA 3IGRA 3IWWA 4UFVA 2E2II 2ARHA 1YHQ1 4DYOA 1Q861 3H0GI 2R1IA 2IZ3A 4BBSI 1K8A1 5ISVA 2GTHA 2V8JA 1UWYA 5F47A 6CPAA 3J80f 3B3SA 4KLWA 4PSXA 3GKRA 1R43A 2QRDB 2ZEEA 3G8WA 1S7KA 1VQ61 5FVJA 4P44A 1WIIA 3HOYI 2Z3MA 3KASA 2AFWA 3CCQ1 3GUXA 3CD6Z 4E2XA 4OC0A 1YJW1 4QC6A 3JVNA 3CC7Z 3Q87A 4AG7A 2V8IA 1XE4A 2RT9A 2V8HA 3TOBA 1ELLP 3A9LA 4MFQA 3JAMb 3TDHB 5LYLA 1Y0YA 2R98A 4CGPA 4E8OA 3CMEZ 4HH4A 1TF8A 5HVFA 3DR6A 4P10A 4OADA 1VQ7Z 3K9UA 2FL4A 4CGOA 3VH9A 2V3VA 4KLVA 1Y1VI 4RVHA 1YHQZ 1CG2A 2BOAA 4XPKA 5D8NA 1ZB8A 3TFYA 1Z2LA 1ZG8A 1QVGZ 5LL6f 4CAVA 3SJXA 2QA41 3S1RI 1Z9UA 4H89A 5IV0A 5IX3A 1JJ2Z 4MD9A 2PJCA 4OC5A 4TNUA 4E31A 1VQ6Z 4KOVA 3H4QA 4QVTA 3PFOA 3KQXA 4QTTA 4P4BA 1YJWZ 3GTJI 2JDDA 3JTKA 2QRCB 3FQMA 1VQP1 4MY3A 1YW4A 2OTL1 3D66A 1R9TI 3OW2Y 1FY7A 2V77A 1Z02A 3C26A 2Z3PA 3H3VJ 1Z01A 2VI7A 4CYPA 4MBUA 4NEXA 2Q4ZA 2QR1B 1DTDA 1Z8XA 4KSFA 5I4MA 2NVYI 4RVFA 2QEX1 1ZLHA 2IJZA 2B4DA 3ISXA 2E7ZA 2EVNA 2PJ4A 4MFKA 2ZEGA 2QA4Z 4B5PA 5CM2M 2P6GA 4B6ZA 4R3LA 2B3UA 3FRMA 2F7VA 3I4MI 3EY5A 2B4BA 5FLXf 3LODA 3H8GA 3TO9A 2JIMA 4ZI6A 1IGBA 1TFIA 3PO2I 2P3YA 3DSBA 1VQPZ 4A3FI 5ELYA 3J80b 2OTLZ 2OH1A 4YFJA 4FAIA 3CPXA 1QYPA 5GCNA 1MJBA 3BXMA 3HOUI 5A28A 2PJ0A 1WWZA 1XMBA 1RNIA 3CCE1 2I00A 1IIDA 3FBUA 4PXBA 2PJ8A 4JD6A 1TWCI 1ZLIA 4CGLA 1OBRA 3S15I 2QEXZ 1KD12 3SJEA 4A3DI 4KSAA 2J6AA 4P6YA 1OZPA 1YMEA 1KRLA 1M4DA 2JIQA 3NDJA 2FCKA 5H84A 4OMEA 1YR0A 2CNSA 2VPXA 3IU2A 4IK2A 5K8PA 1S60A 1TWHI 2ZEHA 1X12A 2CF4A 2FXFA 2KCWA 4F9VA 2PJ9A 4ZY2A 1I12A 1RO5A 1ARMA 2JBKA 2IL4A 3IIBA 2AFSA 4YWYA 1CX8A 2E9HA 3M3YI 1SQHA 3CCEZ 2HB6A 2Q4YA 5J1QA 4Q36A 2DE7A 4KOUA 4Y7NI 1YIT1 2FVGA 3QAHA 4KUAA 4HPSA 3FNCA 2XEGA 4UFWA 1TXRA 4P4DA 5JPHA 2ZOFA 3S16I 3S6KA 4E2ZA 4IUSA 4PPZA 2BSWA 2Z3KA 2ZW6A 4E32A 2VUGA 4GM5A 1P0HA 4A3EI 4A3BI 3IFUA 3D9XA 3FMCA 1VQL1 1F57A 4A95A 2JS4A 1Q16A 2F5IA 5DWNA 4DK1A 3BG0B 1M902 1Q862 1WCMI 2F8HA 1LQLA 4Y52I 4BY7I 5A27A 1F2PA 3LUSA 1I3QI 2C6CA 5FLXb 3PBEA 4XX2A 2QKDA 4QUSA 2VEZA 1YITZ 3CPAA 4ZX9A 3BHXA 3HUVA 4OLLA 3TE5B 2O4HA 3BG1B 2NVTI 3KHXA 2OTJ1 1Z4RA 3T4NB 4I49A 3VARA 3VMGA 4U9ZA 2ZW5A 3NH5A 4RUHA 1Y9KA 1K9M2 3TCVA 3IEHA 1YK3A 4ZY0A 1VQLZ 4CGNA 4A93I 1V0CA 4OC1A 4BBHA 2GU2A 4NBBA 2AYDA 1TKFA 4LQ6A 3GTPI 1VQOZ 3IU1A 4PSWA 3H5ZA 5IB9A 1YVKA 1I21A 4UFXA 4E0AA 4BXXI 1Q2DA 3R9GA 4BY1I 1YX0A 2BEIA 1W2BZ 3MZKB 3CCJ1 1QVFZ 2JDCA 1YW6A 2QVPA 3N5FA 3TT2A 4Z65A 3I4NI 3JAMf 3SI0A 1XIXA 4K30A 4ZX8A 2OTJZ 2YNCC 5F48A 3CCV1 3TO7A 2AFUA 3JRUA 1VHEA 2CIJA 4KVXA 3FQQA 3D3SA 1KD11 4CAEA 4CRZB 2JMOA 3I3GA 4PXCA 1LOKA 1S3ZA 3RZOI 2CTCA 2D4OA 4F9UA 1S7NA 2FT0A 4QBJA 3R9EA 2RHBA 3KIHA 2B63I 4E30A 2QREB 2Q4VA 2OZUA 4BMHA 4EWTA 1QQ9A 2AFZA 3VMHA 3PFEA 3LD2A 4ONWA 4RV9A 1XRYA 2PR1A 4WJBA 5F46A 3CPWZ 2DE6A 2V8DA 3IX0A 3GLJA 2KPIA 4K3NA 3CCJZ 1ARLA 2OZGA 1LAPA 3B35A 3W6XA 2V8GA 4KVOE 3CCVZ 2Q04A 5KTCA 3RAMA 4MFLA 5HVHA 3TTHA 3PO3S 1XEBA 3CCU1 4CYQA 4S1TA 1GHEA 1M4IA 2J8NA 1QVGY 2Z3NA 5LRKA 2QYVA 5D1PA 3LACA 4C2XA 2R6MA 4Q38A 3B8GA 2DE5A 1JJ2Y 2F4OA 1RXTA 3GCFA 3I551 4A32A 4M85A 3GTQI 3M4OI 2M48A 4F6AA 2E2HI 3CC41 1VLAA 2K5RA 1R57A 2PIZA 2V8VA 2G9DA 1FDOA 3KZWA 1M901 4MCRA 5G22A 1IOIA 1F2OA 2HUZA 3KI9A 2J9AA 3B2YA 1AMPA 1KZFA 3FVLA 4L89A 2I3CA 2BJOA 4YGOA 1Y0RA 4PV6A 4CAXA 3ESWA 1IB1E 4WWVA 5DS0A 2OOTA 2K5TA 4LUAA 1Z8TA 1LCPA 2JBJA 3SJFA 3KGQA 3CCUZ 4A3LI 4EMEA 3N7ZA 4P4JA 2X7BA 5LYFA 2HQYA 4A33A 2JA7I 3MN8A 2FIAA 4NGRA 1N2FA 3J81f 5LRGA 4B11A 4EFDA 1VIXA 1L0CA 1YLOA 2G0BA 4ZGYB 5CPAA 4KOWA 1M4LA 5FLMI 1K9M1 2AJ6A 3I55Z 3F3PC 1ZB9A 3NE7A 4JYWA 3D2LA 2ZENA 3D7FA 3CC4Z 3WC7A 2XEIA 1Q2YA 3F5BA 3IWEA 4UCNA 5CNPA 2ZEMA 4FUUA 1TKJA 5G21A 1Z03A 2JIRA 2PJ6A 2PRBA 3S6HA 2NVXI 4MHPA 4NGPA 2H5MA 3CXQA 2I79A 3RYOA 1B87A 2V8KA 2QJ8A 3IR7A 3K2KA 5A2Qb 4MI4A 2H85A 1YVOA 4II9A 2Z0ZA 1NSLA 1RLYA 1HDQA 1N71A 3CCQZ 3D7GA 2DPTA 3S1MI 4R57A 3CCS1 1Y9WA 2B58A 2DEAA 3HKZA 2NVQI 2Q0YA 2PK7A 4DUKA 3KR5A 1VHOA 4GS4A 3SXNA 2JIPA 4MY0A 2VPZA 4CS0B 5IT9f 4E2WA 3D7HA 4HNXB 4B10A 2Q51A 3GTMS 3DR8A 2Y0SA 4RVDA 5T67A 2PDOA 4NB8A 2LFUA 4NCZA 3L2NA 4UEEA 3J7A4 1S7MA 5JM6A 3V7ZA 4BINA 1NSAA 5K8NA 3D6WA 3CCL1 3PEIA 1J4JA 4A3II 3CCSZ 2GE3A 1X3WA 2ATRA 4C2YA 2WYRA 3KHZA 2JNYA 2Z3OA 3GTLI 4A37A 5K8MA 2ABZA 2G3AA 1ON0A 2R92I 1YQEA 3KQZA 3CC21 1ZH1A 1XMTA 2LIYA 1WK4A 1P9NA 1EE3P 1Q812 4A3GI 1AA6A 4JXQA 5HMNA 4W9YA 3PB8X 1S5KA 5AN9F 2P6EA 1IYLA 2QLVB 1U6MA 3S9MA 1TF9A 1X0TA 1DE4C 2ODFA 4P4IA 3J81b 2PJ5A 4AYBA 1R3NA 2IMOA 2Q44A 1WZNA 2ZEPA 2OB0A 2GLFA 4JZ0A 4NBHA 1VQ91 2IV2X 2DPSA 4JXRA 2AFOA 3CCLZ 2JLMA 2YNCA 4IF5A 2BUEA 5AG4A 4P45A 5J8FA 1RTQA 4ZYQA 1WJ2A 4EVYA 4ONUA 2G3TA 4C7IA 4M6IA 3S9NA 2WPWA 3GIUA 1NP6A 2B5GB 3QB8A 3DNSA 2D4PA 1ML8A 3GTKI 2JUBA 4NBFA 3G711 2PJAA 3FECA 3G6E1 4PQAA 1JQGA 4UBRA 1IOFA 4NXYA 4UWJA 1SFOI 1X10A 3R95A 4MD8A 3D7DA 3V8IA 5LYIA 5HXDA 1ZO0A 4OC2A 3R96A 2JR6A 3G4S1 4ZY1A 4NSQA 4MCQA 4MHDA 5J8CA 5IT9b 1W2BY 1CPXA 4X2TA 2Z11A 1IU8A 2ZW7A 1QVFY 3EXNA 1X3ZA 3SXOA 3GTOI 2GIVA 5HH1A 3QWUA 3FEEA 1RQFA 3NFZA 4UWIA 4HKFA 4FD4A 2GREA 3D2MA 3NE8A 2NSMA 3IJ3A 1MJAA 2PJ7A 3EFAA 4A39A 1YSJA 2NMTA 3LWUA 3G71Z 2AE6A 1HDUA 4MMOA 3IWGA 4AVAA 3G6EZ 4F8ZA 4M3SA 4KSIA 2YGWA 4RN7A 4MONA 4X8IA 4C7HA 3KR4A 2JA6I 2ZPAA 2PSWA 3CPWY 2GFQA 4OIWA 4NGQA 4AXVA 2YADA 3FH4A 4UIAA 4LQGA 4L8AA 3ZZIA 2WUUA 3PRTA 5EMIA 1Y1WI 1NMTA 2WAQA 4KOSA 3EC4A 4XPLA 3I1UA 4NBEA 4KUBA 2CTBA 2HC9A 4AB7A 3IO1A 4Q7AA 2Z10A 5JGFA 2BL1A 3B3CA 3E0KA 2ZW4A 3FIXA 4TWEA 2ANPA 2GANA 3QAYA 4U5YA 4CPAA 1YJ91 1Q811 1Z5RA 1TIQA 2PC1A 2VXKA 4AVBA 3NH4A 3H8FA 2QECA 5C44I 2CNMA 1S7LA 4MRIA 3FYNA 4YU9A 2FE7A 2J8MA 3EERA 3VWEA 3CCM1 4MHZA 3S2DI 2DF5A 2B4DB 3KKWA 2PVWA 4H6ZA 2FIWA 2E2JI 5LRJA 3U50C 1VQM1 4NJRA 3W91A 3S1QI 1PCAA 3WC6A 4IAVA 5EBVA 4OKOA 3FJUA 3KIFA 5A2Qf 1AUGA 4MH4A 2BO9A 2PR8A 2OOXB 3GYAA 1YJ9Z 1Y1VS 4AG9A 3CXCZ 1YI21 3FB3A 3FX6A 2ZXVA 1VKCA 5D1OB 3B3VA 3RZDI 1USPB 2FSRA 4FBEA 4X5KA 3CCMZ 1QSMA 2VUMI 3VWDA 2PJBA 4UCMA
chains in the Genus database with same CATH topology
3CXCY 1RLYA 3NDJA 1HDQA 1RO2A 2HF1A 3CCQZ 2ZEDA 3D7GA 3S1MI 4UEZA 4A3CI 4OMEA 3CCS1 1VQK1 4A3MI 3CDXA 4NB9A 1VQMZ 1VQ41 2HU9A 4UF4A 2DEAA 4IK2A 3HKZA 1AYEA 2EGTA 5K8PA 1K731 1VGYA 2AFMA 2NVQI 3RBUA 1TWHI 3DLJA 2PK7A 4DUKA 2ZEHA 1KC82 4A3KI 3KR5A 1JWHC 2CF4A 2W04A 3TX8A 1VHOA 4F9VA 3SI1A 2PJ9A 4ZY2A 4OIDA 4R7MA 1ARMA 2JBKA 2WZNA 1RO0A 1N8R2 2C6PA 3NH8A 4NOZA 2W03A 3IIBA 5IT9f 1I6HI 4MXUA 4NBAA 1M1K2 4E2WA 2AFSA 3PB4X 4YWYA 1CX8A 2E9HA 3M3YI 1BLLE 3D7HA 3CCEZ 2HB6A 3CME1 4P4FA 5J1QA 3VTNA 7CPAA 1YI2Z 3GKQA 2RFHA 2Q51A 3CCRZ 3F3FC 3GTMS 2DE7A 2Y0SA 3HOVI 3MRUA 4NFRA 3SJGA 4Y7NI 2XEJA 3S9LA 4RVDA 1YIT1 2FVGA 5T67A 1IY7A 4NB8A 2LFUA 3L2NA 4UEEA 2XEFA 2XEGA 1LFWA 1TXRA 3J7A4 1S7MA 3K9TA 4P4DA 5JM6A 2GTIA 3V7ZA 2ZOFA 5IP9I 3S16I 1NSAA 5K8NA 2ZAEB 4E2ZA 4PPZA 3D6WA 3CCL1 2OR4A 3PEIA 4OC3A 3WABA 1ZG9A 4E32A 2VUGA 4A3II 3CCSZ 4GM5A 1X3WA 4OP4A 1VQKZ 3HOZI 2WYRA 3S2HI 4MD7A 2RBLA 2PVVA 3KHZA 4E33A 2JNYA 4NBGA 3GTLI 4A3EI 1VQ4Z 4A3BI 3IFUA 4A37A 3D9XA 1Y7EA 3FMCA 1FNOA 5K8MA 3MONA 1Q821 1VQL1 2ABZA 5HVGA 2JA8I 2R92I 3CMA1 1YIJ1 3KQZA 2ZOGA 5F09A 1F57A 3CC21 1ZH1A 2LIYA 1FT7A 2AKLA 1TWGI 3HOXI 1P9NA 5CBMA 2JS4A 2PMZA 1EE3P 2AFXA 1Q812 2G2KA 2O53A 3IC1A 4DK1A 4A3GI 3BG0B 1M902 4W9YA 3PB8X 3D68A 5AN9F 1Q862 3HOWI 1WCMI 1BAVA 4OC4A 4HGYA 2F8HA 3B7IA 1LQLA 4Y52I 4BY7I 3FF3A 2RPRA 2QLVB 3LUSA 1F2PA 1BPMA 1I3QI 3S9MA 4R6TA 3WC5A 2PCUA 1NUIA 1K83I 3TC8A 3B3TA 1TF9A 1X0TA 1DE4C 4NBDA 2C6CA 5FLXb 4R76A 4P4IA 3PBEA 2PJ1A 3FKII 2PM9A 3J81b 4UIBA 4X6AI 3NDIA 4XX2A 2QKDA 2PJ5A 1S721 1YITZ 4AYBA 3P5JB 3CPAA 3HLPA 4ZX9A 3WT4A 2KI7B 1R3NA 2IMOA 1Z8LA 3BHXA 1NJI1 3HUVA 4NGNA 4PXDA 2ZEPA 3TE5B 2IZ4A 2O4HA 1PFTA 3BG1B 2VL1A 2GLFA 5LYDA 1L1OC 1HEEA 4JZ0A 2JA5I 4NBHA 1VQ91 2NVTI 3KHXA 4CL1A 5T6BA 5C3EI 2OTJ1 2AFOA 3T4NB 3CCLZ 1QF8A 3VARA 3VMGA 3I07A 3NH5A 4IHMA 4RUHA 4G1PA 2PJ3A 1K9M2 3VATA 1CPSA 4P45A 3IEHA 3IF8A 3PO3I 1YUAA 2WB1A 4ZY0A 1VQLZ 5THWA 1KQSZ 3CMAZ 3IFEA 1YIJZ 1RTQA 4ZYQA 4A93I 1YUKA 4OC1A 5K8OA 4RVGA 3CD61 2GU2A 1QMUA 4NBBA 4A94A 3S9NA 1Q7Y1 3CC71 1TKFA 1NP6A 3GTPI 3I561 1ML8A 1VQOZ 3S1NI 3GTKI 1TWFI 2JUBA 4NBFA 3D4UA 4P4EA 3G711 2C6GA 5IB9A 2PJAA 3LMSA 1KQSY 3EEDA 4MCSA 3GTGI 3FECA 4BXXI 3PBBA 1VQ51 4X3RA 4NGTA 1BPNA 1VQ71 3G6E1 4BY1I 1H8LA 4PQAA 1W2BZ 3QNVA 1S72Z 1JQGA 1KWMA 2EK9A 2R7ZI 3IWWA 3MZKB 2E2II 1Q7LA 3CCJ1 1YHQ1 4DYOA 1SFOI 1QVFZ 1Q861 3H0GI 4MD8A 2IZ3A 3D7DA 1YW6A 4BBSI 2QVPA 3N5FA 5LYIA 1K8A1 5HXDA 4Z65A 2GTHA 4OC2A 2JR6A 2C1CA 3I4NI 3JAMf 3SI0A 2V8JA 3G4S1 1UWYA 4ZX8A 4A38A 2OTJZ 4ZY1A 6CPAA 3FEDA 4MCQA 3CCV1 1K732 3BI1A 3J80f 2AFUA 3JRUA 3B3SA 5IT9b 1W2BY 1VHEA 1CPXA 2CIJA 4X2TA 2VF1A 3FQQA 1KD11 1R43A 2QRDB 2JMOA 1QVFY 2ZEEA 1X3ZA 1VQ61 3GTOI 1WIIA 3HOYI 1I50I 1LOKA 3KASA 4P44A 4PXCA 3RZOI 3V38A 2AFWA 3CCQ1 3GUXA 2CTCA 3PB6X 3QWUA 4F9UA 3CD6Z 1RQFA 3FEEA 4E2XA 3K7AI 3NFZA 4OC0A 1YJW1 2R93I 2GREA 1XBUA 3CC7Z 2RHBA 3KIHA 4NGMA 3Q87A 2B63I 2NSMA 4E30A 2QREB 3IJ3A 2V8IA 3I56Z 2PJ7A 2RT9A 1QQ9A 2V8HA 4EWTA 1ELLP 2AFZA 4A39A 2YU9I 3VMHA 3JAMb 3TDHB 5LYLA 1YSJA 3PFEA 1Y0YA 3LWUA 4ONWA 3G71Z 3CMEZ 4RV9A 1XRYA 4HH4A 3S17I 1TF8A 3VB9A 4WJBA 2K3RA 5HVFA 3CPWZ 4P10A 1KC81 1HDUA 1VQ5Z 2DE6A 4MMOA 2V8DA 3VMIA 3IX0A 1VQ7Z 4F8ZA 3G6EZ 3GLJA 2KPIA 4K3NA 3VH9A 4DGLA 5D1OA 3BI0A 2M6NA 4KSIA 1Y1VI 4RVHA 3CCJZ 1ARLA 1TKHA 1YHQZ 1CG2A 1USPA 4MONA 2BOAA 1LAPA 4X8IA 5D29A 5D8NA 1N8R1 3T8WA 3B35A 1ZB8A 1Z2LA 2V8GA 1ZG8A 3KR4A 2NYQA 2JA6I 1QVGZ 1ELMP 1M1K1 4NJQA 3CPWY 4OIWA 5LL6f 5C4XI 4HGZA 1XFOA 4NGQA 4AXVA 1ZG7A 3CCVZ 2YADA 3SJXA 2QA41 3S1RI 3RAMA 3CQZI 4MCPA 3FH4A 5HVHA 1JJ2Z 3GB0A 2Q43A 4UIAA 4MD9A 3PO3S 1VQ81 2PJCA 4FWUA 4LQGA 4OC5A 3CCU1 4S1TA 4TNUA 4E31A 1VQ6Z 2ZELA 3CC2Z 2F4MA 3PRTA 4EWCA 1DL6A 3OW2Z 1QVGY 4BD9A 3PFOA 1Y1WI 5LRKA 5C4JI 3KQXA 3B3WA 4QTTA 2QYVA 4P4BA 1YJWZ 2WAQA 3GTJI 2GLJA 5D1PA 3D67A 2QRCB 3SI2A 4DJLA 2R6MA 1YJN1 2DE5A 3FQMA 1PYTB 1VQP1 1JJ2Y 2F4OA 3GCFA 4BBRI 4NBEA 4DQYB 2RB7A 3I1UA 2EK8A 4E2YA 3I551 1GYTA 1YW4A 2CTBA 2HC9A 3GTQI 3IO1A 3M4OI 3CT9A 4Q7AA 5JGFA 2M48A 3NA6A 2E2HI 3B3CA 3CC41 4O23A 5T64A 2OTL1 3D66A 1VLAA 1R9TI 5JH9A 2OOYB 3OW2Y 2OZKA 2K5RA 1NJI2 4TWEA 2ANPA 4A3JI 2PIZA 2V77A 2G9DA 2V8VA 1Z02A 4CPAA 1YJ91 2P28A 1Q811 3KZWA 1Z5RA 4PXEA 1M901 4MCRA 3H3VJ 1Z01A 1LAMA 2Q4ZA 2QR1B 1DTDA 1F2OA 3NH4A 3H8FA 5I4MA 3KI9A 3MZLB 5IP7I 2NVYI 1LANA 1VQ9Z 2J9AA 4QTUA 5C44I 4RVFA 3B2YA 1AMPA 3FVLA 3GTMI 2I3CA 4MRIA 2QEX1 1ZLHA 2BJOA 2IQ6A 1Y0RA 2IJZA 4UEFA 4YU9A 3ISXA 4NGSA 3ESWA 1VQN1 2PJ4A 4WWVA 3EERA 2ZEGA 2QA4Z 5CM2M 4NH1C 3CCM1 5DS0A 2OOTA 4B6ZA 1LCPA 4MHZA 1VQ8Z 4R8FA 2JBJA 3SJFA 3KGQA 3S2DI 3CCUZ 4A3LI 4EMEA 2POKA 1CP6A 1Q7Y2 4P4JA 8CPAA 5LYFA 2PVWA 2F7VA 3I4MI 2E2JI 2JA7I 3H8EA 5LRJA 3KL9A 5FLXf 3MN8A 1WW9A 4NGRA 3U50C 3PB9X 3H8GA 1VQM1 3DGVA 4NJRA 1N2FA 3J81f 3S1QI 1PCAA 5LRGA 4IAVA 2JEWA 3WC6A 4ZI6A 1IGBA 4EFDA 1VIXA 4NBCA 1TFIA 3PO2I 2P3YA 1YJNZ 1YLOA 2PRQA 4OKOA 3S14I 5CPAA 2RIQA 3FJUA 1VQPZ 4A3FI 1M4LA 3KIFA 5FLMI 1K9M1 5A2Qf 3PB7X 3I55Z 5ELYA 3F3PC 1ZB9A 3ISZA 4JYWA 4MH4A 4MHYA 3J80b 3D7FA 2ZENA 3CC4Z 2OTLZ 2BO9A 3WC7A 2XEIA 4FAIA 4MHNA 2OOXB 2ZEMA 3CPXA 1QYPA 4FUUA 1TKJA 3BXMA 3HOUI 1YJ9Z 1VQO1 2PJ0A 1Y1VS 1K8A2 1Z03A 1CBXA 1XMBA 1RNIA 2PJ6A 1RO4A 3CCE1 3RZAA 2NVXI 3CXCZ 1YI21 3FX6A 4MHPA 4NGPA 3CCR1 4RS4A 4PXBA 2PJ8A 1TWAI 3G4SZ 2BCOA 1TWCI 5D1OB 1ZLIA 1OBRA 3S15I 3B3VA 2QEXZ 3RZDI 1KD12 3SJEA 4A3DI 1CP7A 1Q822 2J6AA 1USPB 1VQNZ 2V8KA 4H2KA 2ZEOA 4P6YA 2QJ8A 2EWBA 3K2KA 4FBEA 2PE3A 3CCMZ 2PIYA 5A2Qb 1YMEA 2H85A 2VUMI 2ZEFA 1XJOA 2PJ2A 1KRLA 2PJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDQ A;  4UEZ A;  2ZED A;  3D7G A;  4OME A;  3CDX A;  4UF4 A;  2DEA A;  4IK2 A;  1AYE A;  5K8P A;  2AFM A;  1VGY A;  3RBU A;  3DLJ A;  4DUK A;  2ZEH A;  3KR5 A;  2CF4 A;  3TX8 A;  1VHO A;  4F9V A;  3SI1 A;  2PJ9 A;  4ZY2 A;  4OID A;  4R7M A;  1ARM A;  2JBK A;  2WZN A;  2C6P A;  3NH8 A;  3IIB A;  4MXU A;  2AFS A;  3PB4 X;  4YWY A;  1CX8 A;  1BLL E;  3D7H A;  2HB6 A;  4P4F A;  5J1Q A;  7CPA A;  2RFH A;  2Q51 A;  3MRU A;  4NFR A;  3SJG A;  2XEJ A;  3S9L A;  2FVG A;  1IY7 A;  3L2N A;  4UEE A;  2XEF A;  2XEG A;  1LFW A;  1TXR A;  3K9T A;  4P4D A;  5JM6 A;  3V7Z A;  2ZOF A;  1NSA A;  5K8N A;  4PPZ A;  2OR4 A;  3PEI A;  4OC3 A;  3WAB A;  1ZG9 A;  4GM5 A;  4OP4 A;  2WYR A;  2PVV A;  3KHZ A;  4A37 A;  1Y7E A;  3FMC A;  1FNO A;  5K8M A;  2ABZ A;  5HVG A;  5F09 A;  3KQZ A;  2ZOG A;  1F57 A;  1FT7 A;  5CBM A;  1EE3 P;  2AFX A;  2O53 A;  3IC1 A;  4W9Y A;  3PB8 X;  3D68 A;  1BAV A;  4OC4 A;  2F8H A;  3B7I A;  3FF3 A;  1F2P A;  1BPM A;  3S9M A;  4R6T A;  3WC5 A;  2PCU A;  3TC8 A;  3B3T A;  1TF9 A;  1DE4 C;  2C6C A;  4R76 A;  4P4I A;  3PBE A;  2PJ1 A;  4UIB A;  2PJ5 A;  3WT4 A;  3CPA A;  3HLP A;  4ZX9 A;  1R3N A;  2IMO A;  1Z8L A;  3BHX A;  3HUV A;  4NGN A;  4PXD A;  2ZEP A;  2O4H A;  2VL1 A;  2GLF A;  5LYD A;  1HEE A;  4JZ0 A;  3KHX A;  2AFO A;  3VAR A;  3NH5 A;  4IHM A;  4RUH A;  4G1P A;  2PJ3 A;  3VAT A;  1CPS A;  4P45 A;  3IEH A;  4ZY0 A;  5THW A;  3IFE A;  1RTQ A;  4ZYQ A;  4OC1 A;  5K8O A;  2GU2 A;  1QMU A;  4A94 A;  3S9N A;  1TKF A;  3D4U A;  4P4E A;  2C6G A;  5IB9 A;  2PJA A;  3LMS A;  4MCS A;  3FEC A;  3PBB A;  4X3R A;  4NGT A;  1BPN A;  4PQA A;  1H8L A;  3QNV A;  1JQG A;  1KWM A;  2EK9 A;  3IWW A;  1Q7L A;  4DYO A;  3D7D A;  1YW6 A;  2QVP A;  3N5F A;  5LYI A;  5HXD A;  4Z65 A;  4OC2 A;  2C1C A;  3SI0 A;  1UWY A;  4ZY1 A;  4ZX8 A;  4A38 A;  6CPA A;  3FED A;  4MCQ A;  3BI1 A;  2AFU A;  3JRU A;  3B3S A;  1VHE A;  1CPX A;  2CIJ A;  4X2T A;  1R43 A;  2ZEE A;  1LOK A;  4P44 A;  4PXC A;  3KAS A;  3V38 A;  2AFW A;  3GUX A;  2CTC A;  3PB6 X;  4F9U A;  3FEE A;  3NFZ A;  4OC0 A;  2GRE A;  1XBU A;  4NGM A;  2NSM A;  3IJ3 A;  2PJ7 A;  4EWT A;  1QQ9 A;  2V8H A;  1ELL P;  2AFZ A;  4A39 A;  5LYL A;  1YSJ A;  3PFE A;  1Y0Y A;  3LWU A;  4ONW A;  1XRY A;  1TF8 A;  4WJB A;  5HVF A;  4P10 A;  1HDU A;  4MMO A;  2V8D A;  4F8Z A;  3GLJ A;  4K3N A;  3VH9 A;  3BI0 A;  4KSI A;  1ARL A;  1TKH A;  1CG2 A;  3T8W A;  2BOA A;  1LAP A;  4X8I A;  5D29 A;  5D8N A;  3B35 A;  1Z2L A;  2V8G A;  1ZG8 A;  3KR4 A;  2NYQ A;  1ELM P;  4NJQ A;  4OIW A;  1XFO A;  4NGQ A;  4AXV A;  1ZG7 A;  3SJX A;  3RAM A;  4MCP A;  3FH4 A;  5HVH A;  3GB0 A;  4UIA A;  2Q43 A;  2PJC A;  4FWU A;  4LQG A;  4OC5 A;  4TNU A;  2ZEL A;  3PRT A;  4BD9 A;  3PFO A;  5LRK A;  3KQX A;  3B3W A;  2QYV A;  4P4B A;  2GLJ A;  3D67 A;  3SI2 A;  4DJL A;  1PYT B;  2RB7 A;  3I1U A;  2EK8 A;  1YW4 A;  1GYT A;  2CTB A;  2HC9 A;  3IO1 A;  4Q7A A;  3CT9 A;  5JGF A;  3NA6 A;  4O23 A;  3B3C A;  3D66 A;  5JH9 A;  4TWE A;  2ANP A;  2PIZ A;  2V77 A;  2G9D A;  2V8V A;  4CPA A;  3KZW A;  1Z5R A;  4PXE A;  4MCR A;  1LAM A;  2Q4Z A;  1DTD A;  1F2O A;  3NH4 A;  3H8F A;  5I4M A;  3KI9 A;  1LAN A;  2J9A A;  3B2Y A;  1AMP A;  3FVL A;  2I3C A;  4MRI A;  1ZLH A;  2IQ6 A;  4YU9 A;  1Y0R A;  2IJZ A;  4UEF A;  3ISX A;  4NGS A;  2PJ4 A;  4WWV A;  2ZEG A;  5DS0 A;  2OOT A;  4B6Z A;  1LCP A;  4MHZ A;  4R8F A;  2JBJ A;  3SJF A;  3KGQ A;  4EME A;  2POK A;  1CP6 A;  4P4J A;  8CPA A;  5LYF A;  2PVW A;  2F7V A;  3H8E A;  5LRJ A;  3KL9 A;  3MN8 A;  4NGR A;  3PB9 X;  3H8G A;  3DGV A;  4NJR A;  5LRG A;  1PCA A;  3WC6 A;  4IAV A;  2JEW A;  4ZI6 A;  1IGB A;  4EFD A;  1VIX A;  1YLO A;  2PRQ A;  4OKO A;  5CPA A;  3FJU A;  1M4L A;  3PB7 X;  5ELY A;  3ISZ A;  4JYW A;  4MHY A;  3D7F A;  2ZEN A;  2BO9 A;  3WC7 A;  2XEI A;  4FAI A;  4MHN A;  2ZEM A;  3CPX A;  4FUU A;  1TKJ A;  3BXM A;  2PJ0 A;  1CBX A;  1XMB A;  2PJ6 A;  3RZA A;  3FX6 A;  4MHP A;  4NGP A;  4PXB A;  2PJ8 A;  2BCO A;  1ZLI A;  1OBR A;  3B3V A;  3SJE A;  1CP7 A;  4H2K A;  2ZEO A;  4P6Y A;  2QJ8 A;  2EWB A;  3K2K A;  4FBE A;  2PE3 A;  2PIY A;  1YME A;  2ZEF A;  1XJO A;  2PJ2 A;  2PJB A; 
#chains in the Genus database with same CATH topology
 3BJ8 A;  4UEZ A;  3RO0 A;  1RO2 A;  2ZED A;  5DWM A;  4A3C I;  3PZJ A;  4MFP A;  1VQM Z;  4UF4 A;  2HU9 A;  2EGT A;  2AFM A;  1VGY A;  3RBU A;  1KC8 2;  4A3K I;  1JWH C;  4CYO A;  2W04 A;  2EBJ A;  2YNE A;  3TO6 A;  4OID A;  5KTD A;  2WZN A;  1RO0 A;  1N8R 2;  2W03 A;  2REF A;  1I6H I;  1M1K 2;  1BLL E;  5C82 A;  3PGP A;  3CME 1;  4P4F A;  7CPA A;  1YI2 Z;  3GKQ A;  3MRU A;  1S7F A;  3CXS A;  3SJG A;  2XEJ A;  4JLY A;  3S9L A;  2P0W A;  1IY7 A;  1QXF A;  2XEF A;  4XPD C;  1Q2C A;  3K9T A;  1JWQ A;  1Y7R A;  5IP9 I;  2ZAE B;  3PP9 A;  4OC3 A;  3WAB A;  1ZG9 A;  1A2Z A;  4OP4 A;  3HOZ I;  1MK4 A;  4NBG A;  1Y7E A;  5IB0 A;  1FNO A;  3ZJ0 A;  1Q82 1;  2JA8 I;  4CAW A;  1FT7 A;  1QSR A;  3HOX I;  5CBM A;  2AFX A;  1CJW A;  2G2K A;  2NAP A;  2VZY A;  4B13 A;  3D68 A;  1BAV A;  3JUW A;  4HGY A;  3B7I A;  2RPR A;  2JIO A;  2OU2 A;  2R7H A;  4F0Y A;  1M1D A;  4R6T A;  2PCU A;  1K83 I;  1PUA A;  4R76 A;  3FKI I;  2PM9 A;  3W6S A;  3FXT A;  4UIB A;  4R9M A;  1S72 1;  3R9F A;  2B3V A;  3P5J B;  2KI7 B;  2V45 A;  1Z8L A;  4PXD A;  1BOB A;  4KOY A;  2IZ4 A;  1PFT A;  5LYD A;  4YRH A;  1HEE A;  2JA5 I;  4CL1 A;  5T6B A;  5C3E I;  4CRY B;  1QF8 A;  1KUX A;  4M6H A;  4XPD B;  4G1P A;  2PJ3 A;  3MGD A;  1CPS A;  1B6B A;  3IF8 A;  1Z8W A;  3PO3 I;  1YUA A;  2WB1 A;  5THW A;  1KQS Z;  2JEV A;  5K8O A;  1UFH A;  2Q7S A;  1QMU A;  1SIW A;  4J3G A;  1CM0 A;  3T90 A;  3I56 1;  5AG6 A;  3S1N I;  2RC4 A;  5AGE A;  2PQ8 A;  4P4E A;  4KOR A;  3LMS A;  3EED A;  4MCS A;  3GTG I;  2VQY A;  1VQ5 1;  1KUV A;  4NGT A;  1BPN A;  3QNV A;  1S72 Z;  1P4N A;  1KWM A;  2EK9 A;  2R7Z I;  2Q7B A;  1Q7L A;  4OAE A;  1IIC A;  1Z4E A;  2C1C A;  4A38 A;  2REE A;  3FED A;  2P6F A;  1K73 2;  3BI1 A;  1VHS A;  2VF1 A;  2LEX A;  4NF1 A;  3CXP A;  3TE4 A;  1I50 I;  3V38 A;  4B5O A;  5F49 A;  3PB6 X;  3K7A I;  2R8V A;  2R93 I;  5G20 A;  1XBU A;  3SHP A;  4NGM A;  3D2P A;  3I56 Z;  3R1K A;  2YU9 I;  1KUY A;  3S17 I;  3VB9 A;  2K3R A;  1KC8 1;  1YLE A;  1VQ5 Z;  3VMI A;  3S6F A;  4LX9 A;  4HNY B;  5I0C A;  4DGL A;  5D1O A;  3BI0 A;  2M6N A;  3EO4 A;  4JWP A;  4RS2 A;  1TKH A;  1USP A;  3T8W A;  5D29 A;  3T9Y A;  1N8R 1;  4FD7 A;  4R3K A;  2VPY A;  1LRZ A;  2NYQ A;  1ELM P;  1M1K 1;  4NJQ A;  3F8K A;  5C4X I;  4HGZ A;  1XFO A;  4FD6 A;  4PK2 A;  1ZG7 A;  4XNH C;  4R87 A;  2WSA A;  3CQZ I;  4MCP A;  4H6U A;  4M6G A;  3GB0 A;  2Q43 A;  1VQ8 1;  4FWU A;  2VZZ A;  2ZEL A;  3CC2 Z;  2F4M A;  4EWC A;  1DL6 A;  3OW2 Z;  2CY2 A;  4BD9 A;  5C4J I;  3TOA A;  3B3W A;  1K4J A;  2GLJ A;  3D67 A;  3SI2 A;  4DJL A;  1YJN 1;  1PYT B;  4BBR I;  4DQY B;  2RB7 A;  2WPX A;  2EK8 A;  4E2Y A;  1GYT A;  5EC4 A;  3CT9 A;  3NA6 A;  4O23 A;  5T64 A;  1I1D A;  5JH9 A;  2OOY B;  2OZK A;  1NJI 2;  5AG7 A;  4A3J I;  3BJ7 A;  2P28 A;  1XF8 A;  4PXE A;  2CNT A;  1LAM A;  3OWC A;  3MZL B;  5IP7 I;  1LAN A;  1VQ9 Z;  4QTU A;  2DXQ A;  3GTM I;  4JJX A;  2IQ6 A;  4UEF A;  4Y49 C;  4NGS A;  1IYK A;  1VQN 1;  1YGH A;  4NH1 C;  5AG5 A;  3BLN A;  3WR7 A;  4R8F A;  1VQ8 Z;  2YND A;  2J8R A;  4UA3 A;  2POK A;  1CP6 A;  1Q7Y 2;  8CPA A;  1BO4 A;  4XNH B;  3H8E A;  4CYN A;  3KL9 A;  1XOV A;  1WW9 A;  2EO8 A;  3PB9 X;  3DGV A;  2JEW A;  1FDI A;  4NBC A;  1YJN Z;  2PRQ A;  1QSO A;  3S14 I;  2RIQ A;  3PB7 X;  3ISZ A;  2Z3L A;  4MHY A;  4PK3 A;  4U9Y A;  4GXH A;  4MHN A;  3D8P A;  1QST A;  4KS9 A;  3S6G A;  1VQO 1;  3I9S A;  1K8A 2;  1CBX A;  1RO4 A;  4A31 A;  3RZA A;  4A2Z A;  1PU9 A;  3CCR 1;  4RS4 A;  4DNC A;  1TWA I;  4C68 A;  3G4S Z;  2BCO A;  5JQ4 A;  2EUI A;  1CP7 A;  4F0X A;  4B12 A;  1Q82 2;  1VQN Z;  4H2K A;  2ZEO A;  3UY5 A;  2CXA A;  2EWB A;  2PE3 A;  2PIY A;  2C27 A;  4KOX A;  2O28 A;  2ZEF A;  1XJO A;  2PJ2 A;  4RI1 A;  1Y8C A;  4Y49 B;  3CXC Y;  2HF1 A;  4E2A A;  1M44 A;  5G1Z A;  4CGM A;  4MFJ A;  1VQK 1;  4A3M I;  3CDX A;  4NB9 A;  1VQ4 1;  2FS5 A;  1AYE A;  1K73 1;  3DLJ A;  3P2H A;  4MJ8 A;  2VBQ A;  2Y0M A;  3TX8 A;  2QML A;  3SI1 A;  4R7M A;  3RNZ A;  4FD5 A;  2C6P A;  3GY9 A;  3NH8 A;  4NOZ A;  4MXU A;  4NBA A;  3PB4 X;  1NE9 A;  5KTA A;  3VTN A;  4A30 A;  2RFH A;  3CCR Z;  3F3F C;  1MJ9 A;  3HOV I;  4KOT A;  4NFR A;  5H86 A;  4CAF A;  5E96 A;  1LFW A;  2A4N A;  2GTI A;  4UCP A;  2OR4 A;  2QIR A;  4B5P B;  2HV2 A;  1VQK Z;  3S2H I;  4MD7 A;  2RBL A;  2PVV A;  4E33 A;  1VQ4 Z;  1YRE A;  4KVM E;  3MON A;  5HVG A;  3CMA 1;  3G3S A;  1YIJ 1;  5F09 A;  2ZOG A;  2AKL A;  1TWG I;  2PMZ A;  2O53 A;  3IC1 A;  3HOW I;  4OC4 A;  3FF3 A;  4B14 A;  1BPM A;  3DDD A;  3WC5 A;  1NUI A;  3CZX A;  3TC8 A;  3B3T A;  4NBD A;  2PJ1 A;  4X6A I;  3NDI A;  3WT4 A;  3HLP A;  4KZT A;  4NGN A;  1NJI 1;  4MFZ A;  2VL1 A;  1L1O C;  4ZBG A;  3I07 A;  4HNW B;  4IHM A;  3VAT A;  5C88 A;  2OZH A;  4C2Z A;  3F0A A;  2B5G A;  1M4G A;  3CMA Z;  3IFE A;  1YIJ Z;  3P2F A;  1YUK A;  4RVG A;  4QB9 A;  3CD6 1;  4AVC A;  2VPW A;  4A94 A;  5BWA B;  1Q7Y 1;  3CC7 1;  4ORF A;  1QSN A;  1TWF I;  3D4U A;  2C6G A;  1KQS Y;  3PBB A;  4X3R A;  1VQ7 1;  1H8L A;  3IGR A;  3IWW A;  4UFV A;  2E2I I;  2ARH A;  1YHQ 1;  4DYO A;  1Q86 1;  3H0G I;  2R1I A;  2IZ3 A;  4BBS I;  1K8A 1;  5ISV A;  2GTH A;  2V8J A;  1UWY A;  5F47 A;  6CPA A;  3J80 f;  3B3S A;  4KLW A;  4PSX A;  3GKR A;  1R43 A;  2QRD B;  2ZEE A;  3G8W A;  1S7K A;  1VQ6 1;  5FVJ A;  4P44 A;  1WII A;  3HOY I;  2Z3M A;  3KAS A;  2AFW A;  3CCQ 1;  3GUX A;  3CD6 Z;  4E2X A;  4OC0 A;  1YJW 1;  4QC6 A;  3JVN A;  3CC7 Z;  3Q87 A;  4AG7 A;  2V8I A;  1XE4 A;  2RT9 A;  2V8H A;  3TOB A;  1ELL P;  3A9L A;  4MFQ A;  3JAM b;  3TDH B;  5LYL A;  1Y0Y A;  2R98 A;  4CGP A;  4E8O A;  3CME Z;  4HH4 A;  1TF8 A;  5HVF A;  3DR6 A;  4P10 A;  4OAD A;  1VQ7 Z;  3K9U A;  2FL4 A;  4CGO A;  3VH9 A;  2V3V A;  4KLV A;  1Y1V I;  4RVH A;  1YHQ Z;  1CG2 A;  2BOA A;  4XPK A;  5D8N A;  1ZB8 A;  3TFY A;  1Z2L A;  1ZG8 A;  1QVG Z;  5LL6 f;  4CAV A;  3SJX A;  2QA4 1;  3S1R I;  1Z9U A;  4H89 A;  5IV0 A;  5IX3 A;  1JJ2 Z;  4MD9 A;  2PJC A;  4OC5 A;  4TNU A;  4E31 A;  1VQ6 Z;  4KOV A;  3H4Q A;  4QVT A;  3PFO A;  3KQX A;  4QTT A;  4P4B A;  1YJW Z;  3GTJ I;  2JDD A;  3JTK A;  2QRC B;  3FQM A;  1VQP 1;  4MY3 A;  1YW4 A;  2OTL 1;  3D66 A;  1R9T I;  3OW2 Y;  1FY7 A;  2V77 A;  1Z02 A;  3C26 A;  2Z3P A;  3H3V J;  1Z01 A;  2VI7 A;  4CYP A;  4MBU A;  4NEX A;  2Q4Z A;  2QR1 B;  1DTD A;  1Z8X A;  4KSF A;  5I4M A;  2NVY I;  4RVF A;  2QEX 1;  1ZLH A;  2IJZ A;  2B4D A;  3ISX A;  2E7Z A;  2EVN A;  2PJ4 A;  4MFK A;  2ZEG A;  2QA4 Z;  4B5P A;  5CM2 M;  2P6G A;  4B6Z A;  4R3L A;  2B3U A;  3FRM A;  2F7V A;  3I4M I;  3EY5 A;  2B4B A;  5FLX f;  3LOD A;  3H8G A;  3TO9 A;  2JIM A;  4ZI6 A;  1IGB A;  1TFI A;  3PO2 I;  2P3Y A;  3DSB A;  1VQP Z;  4A3F I;  5ELY A;  3J80 b;  2OTL Z;  2OH1 A;  4YFJ A;  4FAI A;  3CPX A;  1QYP A;  5GCN A;  1MJB A;  3BXM A;  3HOU I;  5A28 A;  2PJ0 A;  1WWZ A;  1XMB A;  1RNI A;  3CCE 1;  2I00 A;  1IID A;  3FBU A;  4PXB A;  2PJ8 A;  4JD6 A;  1TWC I;  1ZLI A;  4CGL A;  1OBR A;  3S15 I;  2QEX Z;  1KD1 2;  3SJE A;  4A3D I;  4KSA A;  2J6A A;  4P6Y A;  1OZP A;  1YME A;  1KRL A;  1M4D A;  2JIQ A;  3NDJ A;  2FCK A;  5H84 A;  4OME A;  1YR0 A;  2CNS A;  2VPX A;  3IU2 A;  4IK2 A;  5K8P A;  1S60 A;  1TWH I;  2ZEH A;  1X12 A;  2CF4 A;  2FXF A;  2KCW A;  4F9V A;  2PJ9 A;  4ZY2 A;  1I12 A;  1RO5 A;  1ARM A;  2JBK A;  2IL4 A;  3IIB A;  2AFS A;  4YWY A;  1CX8 A;  2E9H A;  3M3Y I;  1SQH A;  3CCE Z;  2HB6 A;  2Q4Y A;  5J1Q A;  4Q36 A;  2DE7 A;  4KOU A;  4Y7N I;  1YIT 1;  2FVG A;  3QAH A;  4KUA A;  4HPS A;  3FNC A;  2XEG A;  4UFW A;  1TXR A;  4P4D A;  5JPH A;  2ZOF A;  3S16 I;  3S6K A;  4E2Z A;  4IUS A;  4PPZ A;  2BSW A;  2Z3K A;  2ZW6 A;  4E32 A;  2VUG A;  4GM5 A;  1P0H A;  4A3E I;  4A3B I;  3IFU A;  3D9X A;  3FMC A;  1VQL 1;  1F57 A;  4A95 A;  2JS4 A;  1Q16 A;  2F5I A;  5DWN A;  4DK1 A;  3BG0 B;  1M90 2;  1Q86 2;  1WCM I;  2F8H A;  1LQL A;  4Y52 I;  4BY7 I;  5A27 A;  1F2P A;  3LUS A;  1I3Q I;  2C6C A;  5FLX b;  3PBE A;  4XX2 A;  2QKD A;  4QUS A;  2VEZ A;  1YIT Z;  3CPA A;  4ZX9 A;  3BHX A;  3HUV A;  4OLL A;  3TE5 B;  2O4H A;  3BG1 B;  2NVT I;  3KHX A;  2OTJ 1;  1Z4R A;  3T4N B;  4I49 A;  3VAR A;  3VMG A;  4U9Z A;  2ZW5 A;  3NH5 A;  4RUH A;  1Y9K A;  1K9M 2;  3TCV A;  3IEH A;  1YK3 A;  4ZY0 A;  1VQL Z;  4CGN A;  4A93 I;  1V0C A;  4OC1 A;  4BBH A;  2GU2 A;  4NBB A;  2AYD A;  1TKF A;  4LQ6 A;  3GTP I;  1VQO Z;  3IU1 A;  4PSW A;  3H5Z A;  5IB9 A;  1YVK A;  1I21 A;  4UFX A;  4E0A A;  4BXX I;  1Q2D A;  3R9G A;  4BY1 I;  1YX0 A;  2BEI A;  1W2B Z;  3MZK B;  3CCJ 1;  1QVF Z;  2JDC A;  1YW6 A;  2QVP A;  3N5F A;  3TT2 A;  4Z65 A;  3I4N I;  3JAM f;  3SI0 A;  1XIX A;  4K30 A;  4ZX8 A;  2OTJ Z;  2YNC C;  5F48 A;  3CCV 1;  3TO7 A;  2AFU A;  3JRU A;  1VHE A;  2CIJ A;  4KVX A;  3FQQ A;  3D3S A;  1KD1 1;  4CAE A;  4CRZ B;  2JMO A;  3I3G A;  4PXC A;  1LOK A;  1S3Z A;  3RZO I;  2CTC A;  2D4O A;  4F9U A;  1S7N A;  2FT0 A;  4QBJ A;  3R9E A;  2RHB A;  3KIH A;  2B63 I;  4E30 A;  2QRE B;  2Q4V A;  2OZU A;  4BMH A;  4EWT A;  1QQ9 A;  2AFZ A;  3VMH A;  3PFE A;  3LD2 A;  4ONW A;  4RV9 A;  1XRY A;  2PR1 A;  4WJB A;  5F46 A;  3CPW Z;  2DE6 A;  2V8D A;  3IX0 A;  3GLJ A;  2KPI A;  4K3N A;  3CCJ Z;  1ARL A;  2OZG A;  1LAP A;  3B35 A;  3W6X A;  2V8G A;  4KVO E;  3CCV Z;  2Q04 A;  5KTC A;  3RAM A;  4MFL A;  5HVH A;  3TTH A;  3PO3 S;  1XEB A;  3CCU 1;  4CYQ A;  4S1T A;  1GHE A;  1M4I A;  2J8N A;  1QVG Y;  2Z3N A;  5LRK A;  2QYV A;  5D1P A;  3LAC A;  4C2X A;  2R6M A;  4Q38 A;  3B8G A;  2DE5 A;  1JJ2 Y;  2F4O A;  1RXT A;  3GCF A;  3I55 1;  4A32 A;  4M85 A;  3GTQ I;  3M4O I;  2M48 A;  4F6A A;  2E2H I;  3CC4 1;  1VLA A;  2K5R A;  1R57 A;  2PIZ A;  2V8V A;  2G9D A;  1FDO A;  3KZW A;  1M90 1;  4MCR A;  5G22 A;  1IOI A;  1F2O A;  2HUZ A;  3KI9 A;  2J9A A;  3B2Y A;  1AMP A;  1KZF A;  3FVL A;  4L89 A;  2I3C A;  2BJO A;  4YGO A;  1Y0R A;  4PV6 A;  4CAX A;  3ESW A;  1IB1 E;  4WWV A;  5DS0 A;  2OOT A;  2K5T A;  4LUA A;  1Z8T A;  1LCP A;  2JBJ A;  3SJF A;  3KGQ A;  3CCU Z;  4A3L I;  4EME A;  3N7Z A;  4P4J A;  2X7B A;  5LYF A;  2HQY A;  4A33 A;  2JA7 I;  3MN8 A;  2FIA A;  4NGR A;  1N2F A;  3J81 f;  5LRG A;  4B11 A;  4EFD A;  1VIX A;  1L0C A;  1YLO A;  2G0B A;  4ZGY B;  5CPA A;  4KOW A;  1M4L A;  5FLM I;  1K9M 1;  2AJ6 A;  3I55 Z;  3F3P C;  1ZB9 A;  3NE7 A;  4JYW A;  3D2L A;  2ZEN A;  3D7F A;  3CC4 Z;  3WC7 A;  2XEI A;  1Q2Y A;  3F5B A;  3IWE A;  4UCN A;  5CNP A;  2ZEM A;  4FUU A;  1TKJ A;  5G21 A;  1Z03 A;  2JIR A;  2PJ6 A;  2PRB A;  3S6H A;  2NVX I;  4MHP A;  4NGP A;  2H5M A;  3CXQ A;  2I79 A;  3RYO A;  1B87 A;  2V8K A;  2QJ8 A;  3IR7 A;  3K2K A;  5A2Q b;  4MI4 A;  2H85 A;  1YVO A;  4II9 A;  2Z0Z A;  1NSL A;  1RLY A;  1HDQ A;  1N71 A;  3CCQ Z;  3D7G A;  2DPT A;  3S1M I;  4R57 A;  3CCS 1;  1Y9W A;  2B58 A;  2DEA A;  3HKZ A;  2NVQ I;  2Q0Y A;  2PK7 A;  4DUK A;  3KR5 A;  1VHO A;  4GS4 A;  3SXN A;  2JIP A;  4MY0 A;  2VPZ A;  4CS0 B;  5IT9 f;  4E2W A;  3D7H A;  4HNX B;  4B10 A;  2Q51 A;  3GTM S;  3DR8 A;  2Y0S A;  4RVD A;  5T67 A;  2PDO A;  4NB8 A;  2LFU A;  4NCZ A;  3L2N A;  4UEE A;  3J7A 4;  1S7M A;  5JM6 A;  3V7Z A;  4BIN A;  1NSA A;  5K8N A;  3D6W A;  3CCL 1;  3PEI A;  1J4J A;  4A3I I;  3CCS Z;  2GE3 A;  1X3W A;  2ATR A;  4C2Y A;  2WYR A;  3KHZ A;  2JNY A;  2Z3O A;  3GTL I;  4A37 A;  5K8M A;  2ABZ A;  2G3A A;  1ON0 A;  2R92 I;  1YQE A;  3KQZ A;  3CC2 1;  1ZH1 A;  1XMT A;  2LIY A;  1WK4 A;  1P9N A;  1EE3 P;  1Q81 2;  4A3G I;  1AA6 A;  4JXQ A;  5HMN A;  4W9Y A;  3PB8 X;  1S5K A;  5AN9 F;  2P6E A;  1IYL A;  2QLV B;  1U6M A;  3S9M A;  1TF9 A;  1X0T A;  1DE4 C;  2ODF A;  4P4I A;  3J81 b;  2PJ5 A;  4AYB A;  1R3N A;  2IMO A;  2Q44 A;  1WZN A;  2ZEP A;  2OB0 A;  2GLF A;  4JZ0 A;  4NBH A;  1VQ9 1;  2IV2 X;  2DPS A;  4JXR A;  2AFO A;  3CCL Z;  2JLM A;  2YNC A;  4IF5 A;  2BUE A;  5AG4 A;  4P45 A;  5J8F A;  1RTQ A;  4ZYQ A;  1WJ2 A;  4EVY A;  4ONU A;  2G3T A;  4C7I A;  4M6I A;  3S9N A;  2WPW A;  3GIU A;  1NP6 A;  2B5G B;  3QB8 A;  3DNS A;  2D4P A;  1ML8 A;  3GTK I;  2JUB A;  4NBF A;  3G71 1;  2PJA A;  3FEC A;  3G6E 1;  4PQA A;  1JQG A;  4UBR A;  1IOF A;  4NXY A;  4UWJ A;  1SFO I;  1X10 A;  3R95 A;  4MD8 A;  3D7D A;  3V8I A;  5LYI A;  5HXD A;  1ZO0 A;  4OC2 A;  3R96 A;  2JR6 A;  3G4S 1;  4ZY1 A;  4NSQ A;  4MCQ A;  4MHD A;  5J8C A;  5IT9 b;  1W2B Y;  1CPX A;  4X2T A;  2Z11 A;  1IU8 A;  2ZW7 A;  1QVF Y;  3EXN A;  1X3Z A;  3SXO A;  3GTO I;  2GIV A;  5HH1 A;  3QWU A;  3FEE A;  1RQF A;  3NFZ A;  4UWI A;  4HKF A;  4FD4 A;  2GRE A;  3D2M A;  3NE8 A;  2NSM A;  3IJ3 A;  1MJA A;  2PJ7 A;  3EFA A;  4A39 A;  1YSJ A;  2NMT A;  3LWU A;  3G71 Z;  2AE6 A;  1HDU A;  4MMO A;  3IWG A;  4AVA A;  3G6E Z;  4F8Z A;  4M3S A;  4KSI A;  2YGW A;  4RN7 A;  4MON A;  4X8I A;  4C7H A;  3KR4 A;  2JA6 I;  2ZPA A;  2PSW A;  3CPW Y;  2GFQ A;  4OIW A;  4NGQ A;  4AXV A;  2YAD A;  3FH4 A;  4UIA A;  4LQG A;  4L8A A;  3ZZI A;  2WUU A;  3PRT A;  5EMI A;  1Y1W I;  1NMT A;  2WAQ A;  4KOS A;  3EC4 A;  4XPL A;  3I1U A;  4NBE A;  4KUB A;  2CTB A;  2HC9 A;  4AB7 A;  3IO1 A;  4Q7A A;  2Z10 A;  5JGF A;  2BL1 A;  3B3C A;  3E0K A;  2ZW4 A;  3FIX A;  4TWE A;  2ANP A;  2GAN A;  3QAY A;  4U5Y A;  4CPA A;  1YJ9 1;  1Q81 1;  1Z5R A;  1TIQ A;  2PC1 A;  2VXK A;  4AVB A;  3NH4 A;  3H8F A;  2QEC A;  5C44 I;  2CNM A;  1S7L A;  4MRI A;  3FYN A;  4YU9 A;  2FE7 A;  2J8M A;  3EER A;  3VWE A;  3CCM 1;  4MHZ A;  3S2D I;  2DF5 A;  2B4D B;  3KKW A;  2PVW A;  4H6Z A;  2FIW A;  2E2J I;  5LRJ A;  3U50 C;  1VQM 1;  4NJR A;  3W91 A;  3S1Q I;  1PCA A;  3WC6 A;  4IAV A;  5EBV A;  4OKO A;  3FJU A;  3KIF A;  5A2Q f;  1AUG A;  4MH4 A;  2BO9 A;  2PR8 A;  2OOX B;  3GYA A;  1YJ9 Z;  1Y1V S;  4AG9 A;  3CXC Z;  1YI2 1;  3FB3 A;  3FX6 A;  2ZXV A;  1VKC A;  5D1O B;  3B3V A;  3RZD I;  1USP B;  2FSR A;  4FBE A;  4X5K A;  3CCM Z;  1QSM A;  2VUM I;  3VWD A;  2PJB A;  4UCM A; 
#chains in the Genus database with same CATH homology
 3CXC Y;  1RLY A;  3NDJ A;  1HDQ A;  1RO2 A;  2HF1 A;  3CCQ Z;  2ZED A;  3D7G A;  3S1M I;  4UEZ A;  4A3C I;  4OME A;  3CCS 1;  1VQK 1;  4A3M I;  3CDX A;  4NB9 A;  1VQM Z;  1VQ4 1;  2HU9 A;  4UF4 A;  2DEA A;  4IK2 A;  3HKZ A;  1AYE A;  2EGT A;  5K8P A;  1K73 1;  1VGY A;  2AFM A;  2NVQ I;  3RBU A;  1TWH I;  3DLJ A;  2PK7 A;  4DUK A;  2ZEH A;  1KC8 2;  4A3K I;  3KR5 A;  1JWH C;  2CF4 A;  2W04 A;  3TX8 A;  1VHO A;  4F9V A;  3SI1 A;  2PJ9 A;  4ZY2 A;  4OID A;  4R7M A;  1ARM A;  2JBK A;  2WZN A;  1RO0 A;  1N8R 2;  2C6P A;  3NH8 A;  4NOZ A;  2W03 A;  3IIB A;  5IT9 f;  1I6H I;  4MXU A;  4NBA A;  1M1K 2;  4E2W A;  2AFS A;  3PB4 X;  4YWY A;  1CX8 A;  2E9H A;  3M3Y I;  1BLL E;  3D7H A;  3CCE Z;  2HB6 A;  3CME 1;  4P4F A;  5J1Q A;  3VTN A;  7CPA A;  1YI2 Z;  3GKQ A;  2RFH A;  2Q51 A;  3CCR Z;  3F3F C;  3GTM S;  2DE7 A;  2Y0S A;  3HOV I;  3MRU A;  4NFR A;  3SJG A;  4Y7N I;  2XEJ A;  3S9L A;  4RVD A;  1YIT 1;  2FVG A;  5T67 A;  1IY7 A;  4NB8 A;  2LFU A;  3L2N A;  4UEE A;  2XEF A;  2XEG A;  1LFW A;  1TXR A;  3J7A 4;  1S7M A;  3K9T A;  4P4D A;  5JM6 A;  2GTI A;  3V7Z A;  2ZOF A;  5IP9 I;  3S16 I;  1NSA A;  5K8N A;  2ZAE B;  4E2Z A;  4PPZ A;  3D6W A;  3CCL 1;  2OR4 A;  3PEI A;  4OC3 A;  3WAB A;  1ZG9 A;  4E32 A;  2VUG A;  4A3I I;  3CCS Z;  4GM5 A;  1X3W A;  4OP4 A;  1VQK Z;  3HOZ I;  2WYR A;  3S2H I;  4MD7 A;  2RBL A;  2PVV A;  3KHZ A;  4E33 A;  2JNY A;  4NBG A;  3GTL I;  4A3E I;  1VQ4 Z;  4A3B I;  3IFU A;  4A37 A;  3D9X A;  1Y7E A;  3FMC A;  1FNO A;  5K8M A;  3MON A;  1Q82 1;  1VQL 1;  2ABZ A;  5HVG A;  2JA8 I;  2R92 I;  3CMA 1;  1YIJ 1;  3KQZ A;  2ZOG A;  5F09 A;  1F57 A;  3CC2 1;  1ZH1 A;  2LIY A;  1FT7 A;  2AKL A;  1TWG I;  3HOX I;  1P9N A;  5CBM A;  2JS4 A;  2PMZ A;  1EE3 P;  2AFX A;  1Q81 2;  2G2K A;  2O53 A;  3IC1 A;  4DK1 A;  4A3G I;  3BG0 B;  1M90 2;  4W9Y A;  3PB8 X;  3D68 A;  5AN9 F;  1Q86 2;  3HOW I;  1WCM I;  1BAV A;  4OC4 A;  4HGY A;  2F8H A;  3B7I A;  1LQL A;  4Y52 I;  4BY7 I;  3FF3 A;  2RPR A;  2QLV B;  3LUS A;  1F2P A;  1BPM A;  1I3Q I;  3S9M A;  4R6T A;  3WC5 A;  2PCU A;  1NUI A;  1K83 I;  3TC8 A;  3B3T A;  1TF9 A;  1X0T A;  1DE4 C;  4NBD A;  2C6C A;  5FLX b;  4R76 A;  4P4I A;  3PBE A;  2PJ1 A;  3FKI I;  2PM9 A;  3J81 b;  4UIB A;  4X6A I;  3NDI A;  4XX2 A;  2QKD A;  2PJ5 A;  1S72 1;  1YIT Z;  4AYB A;  3P5J B;  3CPA A;  3HLP A;  4ZX9 A;  3WT4 A;  2KI7 B;  1R3N A;  2IMO A;  1Z8L A;  3BHX A;  1NJI 1;  3HUV A;  4NGN A;  4PXD A;  2ZEP A;  3TE5 B;  2IZ4 A;  2O4H A;  1PFT A;  3BG1 B;  2VL1 A;  2GLF A;  5LYD A;  1L1O C;  1HEE A;  4JZ0 A;  2JA5 I;  4NBH A;  1VQ9 1;  2NVT I;  3KHX A;  4CL1 A;  5T6B A;  5C3E I;  2OTJ 1;  2AFO A;  3T4N B;  3CCL Z;  1QF8 A;  3VAR A;  3VMG A;  3I07 A;  3NH5 A;  4IHM A;  4RUH A;  4G1P A;  2PJ3 A;  1K9M 2;  3VAT A;  1CPS A;  4P45 A;  3IEH A;  3IF8 A;  3PO3 I;  1YUA A;  2WB1 A;  4ZY0 A;  1VQL Z;  5THW A;  1KQS Z;  3CMA Z;  3IFE A;  1YIJ Z;  1RTQ A;  4ZYQ A;  4A93 I;  1YUK A;  4OC1 A;  5K8O A;  4RVG A;  3CD6 1;  2GU2 A;  1QMU A;  4NBB A;  4A94 A;  3S9N A;  1Q7Y 1;  3CC7 1;  1TKF A;  1NP6 A;  3GTP I;  3I56 1;  1ML8 A;  1VQO Z;  3S1N I;  3GTK I;  1TWF I;  2JUB A;  4NBF A;  3D4U A;  4P4E A;  3G71 1;  2C6G A;  5IB9 A;  2PJA A;  3LMS A;  1KQS Y;  3EED A;  4MCS A;  3GTG I;  3FEC A;  4BXX I;  3PBB A;  1VQ5 1;  4X3R A;  4NGT A;  1BPN A;  1VQ7 1;  3G6E 1;  4BY1 I;  1H8L A;  4PQA A;  1W2B Z;  3QNV A;  1S72 Z;  1JQG A;  1KWM A;  2EK9 A;  2R7Z I;  3IWW A;  3MZK B;  2E2I I;  1Q7L A;  3CCJ 1;  1YHQ 1;  4DYO A;  1SFO I;  1QVF Z;  1Q86 1;  3H0G I;  4MD8 A;  2IZ3 A;  3D7D A;  1YW6 A;  4BBS I;  2QVP A;  3N5F A;  5LYI A;  1K8A 1;  5HXD A;  4Z65 A;  2GTH A;  4OC2 A;  2JR6 A;  2C1C A;  3I4N I;  3JAM f;  3SI0 A;  2V8J A;  3G4S 1;  1UWY A;  4ZX8 A;  4A38 A;  2OTJ Z;  4ZY1 A;  6CPA A;  3FED A;  4MCQ A;  3CCV 1;  1K73 2;  3BI1 A;  3J80 f;  2AFU A;  3JRU A;  3B3S A;  5IT9 b;  1W2B Y;  1VHE A;  1CPX A;  2CIJ A;  4X2T A;  2VF1 A;  3FQQ A;  1KD1 1;  1R43 A;  2QRD B;  2JMO A;  1QVF Y;  2ZEE A;  1X3Z A;  1VQ6 1;  3GTO I;  1WII A;  3HOY I;  1I50 I;  1LOK A;  3KAS A;  4P44 A;  4PXC A;  3RZO I;  3V38 A;  2AFW A;  3CCQ 1;  3GUX A;  2CTC A;  3PB6 X;  3QWU A;  4F9U A;  3CD6 Z;  1RQF A;  3FEE A;  4E2X A;  3K7A I;  3NFZ A;  4OC0 A;  1YJW 1;  2R93 I;  2GRE A;  1XBU A;  3CC7 Z;  2RHB A;  3KIH A;  4NGM A;  3Q87 A;  2B63 I;  2NSM A;  4E30 A;  2QRE B;  3IJ3 A;  2V8I A;  3I56 Z;  2PJ7 A;  2RT9 A;  1QQ9 A;  2V8H A;  4EWT A;  1ELL P;  2AFZ A;  4A39 A;  2YU9 I;  3VMH A;  3JAM b;  3TDH B;  5LYL A;  1YSJ A;  3PFE A;  1Y0Y A;  3LWU A;  4ONW A;  3G71 Z;  3CME Z;  4RV9 A;  1XRY A;  4HH4 A;  3S17 I;  1TF8 A;  3VB9 A;  4WJB A;  2K3R A;  5HVF A;  3CPW Z;  4P10 A;  1KC8 1;  1HDU A;  1VQ5 Z;  2DE6 A;  4MMO A;  2V8D A;  3VMI A;  3IX0 A;  1VQ7 Z;  4F8Z A;  3G6E Z;  3GLJ A;  2KPI A;  4K3N A;  3VH9 A;  4DGL A;  5D1O A;  3BI0 A;  2M6N A;  4KSI A;  1Y1V I;  4RVH A;  3CCJ Z;  1ARL A;  1TKH A;  1YHQ Z;  1CG2 A;  1USP A;  4MON A;  2BOA A;  1LAP A;  4X8I A;  5D29 A;  5D8N A;  1N8R 1;  3T8W A;  3B35 A;  1ZB8 A;  1Z2L A;  2V8G A;  1ZG8 A;  3KR4 A;  2NYQ A;  2JA6 I;  1QVG Z;  1ELM P;  1M1K 1;  4NJQ A;  3CPW Y;  4OIW A;  5LL6 f;  5C4X I;  4HGZ A;  1XFO A;  4NGQ A;  4AXV A;  1ZG7 A;  3CCV Z;  2YAD A;  3SJX A;  2QA4 1;  3S1R I;  3RAM A;  3CQZ I;  4MCP A;  3FH4 A;  5HVH A;  1JJ2 Z;  3GB0 A;  2Q43 A;  4UIA A;  4MD9 A;  3PO3 S;  1VQ8 1;  2PJC A;  4FWU A;  4LQG A;  4OC5 A;  3CCU 1;  4S1T A;  4TNU A;  4E31 A;  1VQ6 Z;  2ZEL A;  3CC2 Z;  2F4M A;  3PRT A;  4EWC A;  1DL6 A;  3OW2 Z;  1QVG Y;  4BD9 A;  3PFO A;  1Y1W I;  5LRK A;  5C4J I;  3KQX A;  3B3W A;  4QTT A;  2QYV A;  4P4B A;  1YJW Z;  2WAQ A;  3GTJ I;  2GLJ A;  5D1P A;  3D67 A;  2QRC B;  3SI2 A;  4DJL A;  2R6M A;  1YJN 1;  2DE5 A;  3FQM A;  1PYT B;  1VQP 1;  1JJ2 Y;  2F4O A;  3GCF A;  4BBR I;  4NBE A;  4DQY B;  2RB7 A;  3I1U A;  2EK8 A;  4E2Y A;  3I55 1;  1GYT A;  1YW4 A;  2CTB A;  2HC9 A;  3GTQ I;  3IO1 A;  3M4O I;  3CT9 A;  4Q7A A;  5JGF A;  2M48 A;  3NA6 A;  2E2H I;  3B3C A;  3CC4 1;  4O23 A;  5T64 A;  2OTL 1;  3D66 A;  1VLA A;  1R9T I;  5JH9 A;  2OOY B;  3OW2 Y;  2OZK A;  2K5R A;  1NJI 2;  4TWE A;  2ANP A;  4A3J I;  2PIZ A;  2V77 A;  2G9D A;  2V8V A;  1Z02 A;  4CPA A;  1YJ9 1;  2P28 A;  1Q81 1;  3KZW A;  1Z5R A;  4PXE A;  1M90 1;  4MCR A;  3H3V J;  1Z01 A;  1LAM A;  2Q4Z A;  2QR1 B;  1DTD A;  1F2O A;  3NH4 A;  3H8F A;  5I4M A;  3KI9 A;  3MZL B;  5IP7 I;  2NVY I;  1LAN A;  1VQ9 Z;  2J9A A;  4QTU A;  5C44 I;  4RVF A;  3B2Y A;  1AMP A;  3FVL A;  3GTM I;  2I3C A;  4MRI A;  2QEX 1;  1ZLH A;  2BJO A;  2IQ6 A;  1Y0R A;  2IJZ A;  4UEF A;  4YU9 A;  3ISX A;  4NGS A;  3ESW A;  1VQN 1;  2PJ4 A;  4WWV A;  3EER A;  2ZEG A;  2QA4 Z;  5CM2 M;  4NH1 C;  3CCM 1;  5DS0 A;  2OOT A;  4B6Z A;  1LCP A;  4MHZ A;  1VQ8 Z;  4R8F A;  2JBJ A;  3SJF A;  3KGQ A;  3S2D I;  3CCU Z;  4A3L I;  4EME A;  2POK A;  1CP6 A;  1Q7Y 2;  4P4J A;  8CPA A;  5LYF A;  2PVW A;  2F7V A;  3I4M I;  2E2J I;  2JA7 I;  3H8E A;  5LRJ A;  3KL9 A;  5FLX f;  3MN8 A;  1WW9 A;  4NGR A;  3U50 C;  3PB9 X;  3H8G A;  1VQM 1;  3DGV A;  4NJR A;  1N2F A;  3J81 f;  3S1Q I;  1PCA A;  5LRG A;  4IAV A;  2JEW A;  3WC6 A;  4ZI6 A;  1IGB A;  4EFD A;  1VIX A;  4NBC A;  1TFI A;  3PO2 I;  2P3Y A;  1YJN Z;  1YLO A;  2PRQ A;  4OKO A;  3S14 I;  5CPA A;  2RIQ A;  3FJU A;  1VQP Z;  4A3F I;  1M4L A;  3KIF A;  5FLM I;  1K9M 1;  5A2Q f;  3PB7 X;  3I55 Z;  5ELY A;  3F3P C;  1ZB9 A;  3ISZ A;  4JYW A;  4MH4 A;  4MHY A;  3J80 b;  3D7F A;  2ZEN A;  3CC4 Z;  2OTL Z;  2BO9 A;  3WC7 A;  2XEI A;  4FAI A;  4MHN A;  2OOX B;  2ZEM A;  3CPX A;  1QYP A;  4FUU A;  1TKJ A;  3BXM A;  3HOU I;  1YJ9 Z;  1VQO 1;  2PJ0 A;  1Y1V S;  1K8A 2;  1Z03 A;  1CBX A;  1XMB A;  1RNI A;  2PJ6 A;  1RO4 A;  3CCE 1;  3RZA A;  2NVX I;  3CXC Z;  1YI2 1;  3FX6 A;  4MHP A;  4NGP A;  3CCR 1;  4RS4 A;  4PXB A;  2PJ8 A;  1TWA I;  3G4S Z;  2BCO A;  1TWC I;  5D1O B;  1ZLI A;  1OBR A;  3S15 I;  3B3V A;  2QEX Z;  3RZD I;  1KD1 2;  3SJE A;  4A3D I;  1CP7 A;  1Q82 2;  2J6A A;  1USP B;  1VQN Z;  2V8K A;  4H2K A;  2ZEO A;  4P6Y A;  2QJ8 A;  2EWB A;  3K2K A;  4FBE A;  2PE3 A;  3CCM Z;  2PIY A;  5A2Q b;  1YME A;  2H85 A;  2VUM I;  2ZEF A;  1XJO A;  2PJ2 A;  1KRL A;  2PJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...