2Q4ZA

Ensemble refinement of the protein crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 89
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q4zA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q4zA01
4NJQA 4BD9A 3B3SA 3IC1A 1OBRA 5JGFA 2ZEOA 5LYDA 1ELMP 2C6CA 2PRQA 3ISXA 3PFEA 4OC2A 1ARMA 4W9YA 1Z5RA 4OC5A 4B6ZA 1PYTB 3ISZA 3KZWA 2FVGA 4UEFA 2ZEMA 3IFEA 4FWUA 3KQXA 2PJ3A 2ZEDA 1YW6A 4MHPA 4NFRA 4MHYA 5CPAA 1F2PA 4DUKA 2C1CA 4PXBA 4H2KA 2XEFA 4A94A 3CT9A 1XJOA 2DEAA 4ZX9A 4NGMA 5THWA 3HLPA 1ZG8A 1HEEA 4IAVA 2XEIA 2PIZA 3RAMA 4JZ0A 1BPMA 1ZLHA 5HVGA 1BLLE 2JBJA 5HVFA 5D29A 1CPXA 1FNOA 2AFSA 2BCOA 1LCPA 2AFMA 4OIDA 4EMEA 2VL1A 4OKOA 3B3VA 4NGPA 2PVVA 4OC0A 5J1QA 5K8MA 4UF4A 1PCAA 1EE3P 1YW4A 4FBEA 2C6PA 2Q4ZA 4UEZA 2CIJA 2J9AA 3GUXA 4NJRA 1LAMA 3PB6X 5HXDA 4NGRA 4IHMA 1XFOA 2PJ9A 3MRUA 5K8PA 2V8GA 2PJCA 2QVPA 4O23A 2GU2A 2PJBA 2WZNA 2V77A 2POKA 3KI9A 3SJEA 4ZY0A 3B3TA 2V8VA 2JEWA 3PB4X 5I4MA 5JM6A 3D7DA 1TXRA 5DS0A 3BI0A 1R3NA 3SI0A 3KQZA 5CBMA 2PJ5A 3V38A 4P4FA 1RTQA 2ZEEA 3D7GA 3JRUA 2ZENA 3LWUA 1F2OA 3B7IA 3GB0A 3NH8A 3WABA 3FX6A 4UEEA 4ZI6A 3D7FA 4ZYQA 2ZOGA 2XEGA 2AFOA 1VHEA 3KHZA 2IQ6A 3B2YA 4YU9A 4P44A 4X2TA 1ZLIA 5F09A 3KASA 2CTCA 2PJAA 3S9NA 3B35A 3PBBA 3BHXA 4UIAA 4EFDA 4OIWA 2NYQA 3D67A 2WYRA 6CPAA 4ZY1A 3NH5A 1LOKA 4G1PA 2QYVA 3KHXA 4MCQA 1F57A 1VGYA 3KL9A 4ZX8A 1IY7A 3TC8A 1IGBA 4P6YA 2V8DA 2OR4A 5LRGA 2GLJA 3CPXA 4K3NA 4P10A 4NGSA 1Y7EA 4PPZA 2G9DA 1XMBA 3BXMA 3CDXA 3B3WA 1HDUA 1ARLA 4DJLA 3NA6A 4NGTA 2BOAA 2PJ4A 4ONWA 4F9UA 4A37A 1H8LA 4A38A 3WT4A 1YMEA 2Q51A 1QMUA 3H8EA 3PB8X 5LYIA 4PXDA 3SJGA 2PJ8A 1DE4C 4R7MA 3SJXA 3PEIA 1FT7A 2IMOA 2ZOFA 8CPAA 4R8FA 1CPSA 1XRYA 1HDQA 2EWBA 3PB7X 1TKJA 3KR4A 3IO1A 3IEHA 3KGQA 4P45A 2PJ0A 2ZELA 4P4JA 2ZEFA 1AYEA 4F9VA 4OP4A 2BO9A 3RZAA 4WWVA 1CG2A 1LAPA 5LRKA 3D68A 3MN8A 4TWEA 3SI2A 3K2KA 3N5FA 3SI1A 4TNUA 4MXUA 4X3RA 3RBUA 4MHZA 2F7VA 5LYLA 2CF4A 3WC5A 5D8NA 4GM5A 4PXEA 2PCUA 5ELYA 2AFXA 2CTBA 4OMEA 1CBXA 3LMSA 4R76A 2OOTA 1TF8A 2ZEPA 3PFOA 4AXVA 4P4EA 3WC7A 1JQGA 2V8HA 1ELLP 3DGVA 2PVWA 4JYWA 1LANA 1KWMA 1VHOA 3PB9X 3FECA 2PJ7A 3K9TA 3D7HA 2RFHA 4Z65A 2QJ8A 4YWYA 3KR5A 3QNVA 1CX8A 2Q43A 1BPNA 1YLOA 2EK8A 3VATA 3I1UA 1CP7A 2PJ2A 4OC4A 2HC9A 4OC3A 3PRTA 4FUUA 2ABZA 5HVHA 3HUVA 4MHNA 3NFZA 1QQ9A 2ZEGA 3IJ3A 2EK9A 5LYFA 1CP6A 4NGQA 3FF3A 3D4UA 3B3CA 2RB7A 3FMCA 1NSAA 3IIBA 3L2NA 3T8WA 3TX8A 1VIXA 3IWWA 4ZY2A 4P4IA 4X8IA 3BI1A 1XBUA 2GLFA 7CPAA 2GREA 1TF9A 2I3CA 4WJBA 1Z8LA 1BAVA 4NGNA 3VARA 4R6TA 2O53A 4UIBA 4MCPA 3H8GA 4PQAA 3FVLA 4KSIA 1Z2LA 2JBKA 5LRJA 3S9MA 4LQGA 4EWTA 4P4DA 2PJ6A 3PBEA 4Q7AA 3WC6A 2AFZA 4MCSA 2F8HA 5K8NA 3FEEA 1DTDA 2HB6A 4CPAA 3CPAA 1TKFA 2AFWA 2AFUA 3FH4A 2ZEHA 2IJZA 2PE3A 5JH9A 2NSMA 4OC1A 1LFWA 1ZG7A 3S9LA 1Y0YA 3NH4A 1Q7LA 3FJUA 2O4HA 2ANPA 3FEDA 4F8ZA 4A39A 2PIYA 2XEJA 4MCRA 1GYTA 3H8FA 4P4BA 4MRIA 3DLJA 1R43A 3V7ZA 4RUHA 3D66A 3GLJA 1UWYA 5K8OA 2PJ1A 1Y0RA 1AMPA 5IB9A 3SJFA 1M4LA 4DYOA 1TKHA 4PXCA 1ZG9A 3VH9A 4IK2A 4FAIA 2C6GA 4MMOA 1YSJA
chains in the Genus database with same CATH superfamily
4MFZA 2QKDA 1YR0A 1OBRA 4A31A 4RN7A 3CZXA 1S60A 3F8KA 2C6CA 2PRQA 1Q861 3PFEA 1ARMA 5ISVA 1PYTB 3M3YI 1RXTA 1Y1VI 2FVGA 3BLNA 4E2YA 2HF1A 3IFEA 2Q44A 3KQXA 2ZEDA 2OTJ1 2JIOA 1L1OC 5T67A 5CPAA 1F2PA 1M902 1AUGA 4NBDA 4DUKA 1IICA 4OAEA 2V8JA 2Y0MA 1Y8CA 2W03A 2XEFA 1XJOA 2WUUA 4KLVA 4GXHA 2WB1A 2PIZA 3RAMA 2J8NA 2ZW4A 4NBCA 1ZLHA 4NB9A 4A3DI 2VUGA 2B3UA 4MHDA 1Z03A 2RC4A 2ZPAA 2LEXA 5A27A 4MY3A 1QSRA 2OZGA 4BINA 1Q862 2VL1A 4CGPA 2Z3LA 1K9M1 1YVKA 3IU1A 1PCAA 1YW4A 2JA6I 1IB1E 1IIDA 4XNHC 2Q7BA 3G711 4NJRA 3PB6X 2KCWA 4IHMA 1NP6A 2V8GA 2GTIA 2PJCA 2GU2A 3IWEA 4HKFA 2FIWA 3TO6A 4ZY0A 1U6MA 4CGNA 3CCL1 2V8VA 5FVJA 3PB4X 3G71Z 5I4MA 2WSAA 1TXRA 2EBJA 1CM0A 3RZOI 3SI0A 3KQZA 3V38A 2QR1B 1Z8XA 2P0WA 2WPWA 3D2PA 3I561 4OLLA 2I79A 4A3MI 1KUXA 4ZI6A 3TDHB 2NVTI 2RBLA 4R3KA 2ZOGA 5KTAA 3KHZA 1VHEA 2IQ6A 4YU9A 3MZLB 4P44A 2Z0ZA 4KOYA 1ZLIA 3HOUI 5EMIA 4XX2A 4QBJA 1YJ9Z 3GTMI 4K30A 4NBAA 3W6XA 4KUBA 4OIWA 2NYQA 4ZY1A 2J6AA 3KHXA 3CC71 3FQQA 1NJI1 3GTOI 1NJI2 1VGYA 3KL9A 4MD8A 4ZX8A 3TC8A 2JUBA 2V8DA 3TFYA 4NBGA 1WIIA 4H6UA 5LRGA 2X7BA 2GLJA 4K3NA 3LD2A 5F46A 4PPZA 1XMBA 3K7AI 3BXMA 4E33A 3G6EZ 1Y7RA 1HDUA 3D9XA 1ARLA 3CMEZ 5FLMI 2VEZA 3NA6A 4F9UA 5D1OB 4LQ6A 4JJXA 4A37A 3EXNA 1YMEA 4A3JI 4KVXA 1R9TI 2Q51A 3PB8X 2PJ8A 1NSLA 1M4IA 3PEIA 1K4JA 1N71A 2IMOA 2JIRA 4NB8A 2EWBA 4C7IA 3LUSA 2I00A 2R7HA 4R3LA 4P4JA 1Z8WA 1P9NA 1CG2A 4CYNA 2K3RA 1BOBA 4HNWB 3SI2A 3DR8A 3K2KA 3D3SA 4GS4A 1N2FA 5D1PA 4S1TA 3CCUZ 4GM5A 2JIQA 4PXEA 2PCUA 3B8GA 2CTBA 3LMSA 2OOTA 1TF8A 1S7LA 2V8HA 1TFIA 2E2HI 2V8KA 2BL1A 4XPLA 1X12A 1YI21 2PVWA 3CMAZ 3TTHA 3HKZA 4DQYB 2PSWA 5AG7A 1LANA 4PSXA 4UBRA 5AGEA 3K9TA 5IT9b 3S1NI 4CL1A 2RFHA 4ZGYB 4MD7A 1L0CA 4U9ZA 1KUVA 2DE6A 4YWYA 4B14A 3KR5A 3QNVA 2FS5A 1UFHA 1Z9UA 3CC2Z 4A3CI 4OC4A 4OC3A 2ABZA 4E2AA 1K8A2 3IJ3A 4UWJA 1NSAA 4B13A 1LQLA 3TX8A 3IWWA 4P4IA 3BI1A 1XBUA 2OTJZ 1TF9A 2I3CA 4PK2A 2YADA 3DSBA 4MI4A 2VQYA 4NEXA 3H8GA 3R9FA 4P4DA 3WC6A 2AFZA 4CAWA 5CNPA 2EUIA 1I6HI 2ZEHA 3CXPA 4MH4A 4RVHA 4U9YA 4DNCA 1ZG7A 2DXQA 2F4MA 3GTGI 2DE5A 3PO3I 4NXYA 3NH4A 3FJUA 2PR1A 3FEDA 3GTMS 2RPRA 2ATRA 1KQSZ 2PIYA 3CCQZ 3CPWZ 5H84A 3KIHA 2DPTA 1K9M2 3H8FA 4P4BA 1YVOA 4MRIA 3DLJA 3MGDA 2VBQA 2HUZA 2R6MA 5K8OA 4F0YA 4KOVA 1VQK1 2GIVA 2BJOA 1TKHA 1W2BY 1X0TA 2Z3PA 3TOBA 1KD12 1VHSA 1IYLA 3RYOA 2P28A 4MMOA 3PGPA 5J8CA 1M1DA 3U50C 4FD6A 1M1K1 4BD9A 3B3SA 1W2BZ 4AVBA 2QRCB 2EVNA 4A3BI 3HOYI 2R98A 4OC2A 4X5KA 2B63I 1Z5RA 2IV2X 3KZWA 1QSNA 4FWUA 4RI1A 3CXSA 1VQ61 1Z4RA 4H6ZA 4NFRA 2QRDB 5T6BA 2RT9A 1Q811 2M6NA 4R57A 3FXTA 4KOUA 4MFLA 4PXBA 4A94A 4CAVA 2A4NA 3WR7A 1ZG8A 1HEEA 2XEIA 5C88A 2OZUA 5D1OA 1QSMA 2CXAA 3K9UA 2NVYI 4HGZA 3GTLI 3IWGA 5HVGA 2P6GA 5DWNA 2AFSA 1XF8A 4NOZA 3CCV1 4KS9A 4OIDA 1I3QI 2G3TA 1YUKA 3J7A4 4CYOA 1Q2YA 4OC0A 5K8MA 4E32A 4MFJA 4FBEA 2C6PA 3R1KA 2Q4ZA 3LODA 4UEZA 4NBEA 1BO4A 2J9AA 1LAMA 1PU9A 4CAXA 1QVGY 2PJ9A 5K8PA 3D2LA 3CC7Z 5E96A 2PJBA 4C2XA 2WZNA 1Q7Y1 2V77A 1FDIA 3TE4A 2JEWA 1WCMI 5HMNA 2V3VA 3CD61 2QIRA 2G2KA 5CBMA 5EC4A 4JLYA 4P4FA 2ZAEB 4MFKA 3VTNA 3D7GA 4AYBA 3JRUA 4KOTA 1I12A 3B7IA 5J8FA 1RQFA 3I4NI 1S7FA 2LIYA 3HOWI 3S6GA 1S5KA 2DF5A 3EEDA 2AFOA 3B2YA 4A3LI 5T64A 3SHPA 3CXCZ 3CC4Z 2GE3A 1S3ZA 1KRLA 2PJAA 5F49A 3OWCA 4A93I 4RS4A 1USPA 4LUAA 3PBBA 3S6FA 4KVME 1MJ9A 3CCU1 2WYRA 1LOKA 4G1PA 4E0AA 4EVYA 3VB9A 3EERA 3GTJI 1IGBA 2E2II 2ARHA 1YJ91 2VPYA 5IP9I 4P10A 1Y7EA 1X10A 3CDXA 2OZKA 4CRYB 5C4XI 3QAYA 3JVNA 1H8LA 4NSQA 4A38A 4RVDA 4ZBGA 1VQLZ 3FNCA 2YNCC 1QMUA 4NCZA 3H8EA 4A3KI 3F3PC 4PXDA 3SJGA 1MJBA 2QECA 3CC21 3OW2Y 4FD5A 1VQPZ 8CPAA 1YITZ 1CPSA 1HDQA 2GTHA 5C3EI 1K732 3PB7X 1TKJA 3IEHA 3KGQA 2ZELA 4F9VA 4OP4A 2BO9A 1YGHA 1XOVA 4WWVA 2JDDA 4B12A 3GTQI 3MN8A 3CXQA 2HU9A 3CCE1 1VQ81 3SI1A 4B11A 4TNUA 3RBUA 2F7VA 1XMTA 5LYLA 2FSRA 4KSAA 1Z01A 3SXNA 4AXVA 2ZEPA 3PFOA 3WC7A 1JJ2Z 3S2DI 2CNTA 1IYKA 2ZW5A 5AN9F 2VPWA 4QTTA 1LRZA 2OH1A 3D7HA 3HOXI 4MFPA 4Z65A 3DNSA 1TIQA 2QJ8A 2REFA 1M1K2 2OZHA 1XIXA 3NE8A 1BPNA 3FRMA 2FXFA 5AG5A 2PR8A 3CQZI 4AVCA 3W91A 4KORA 3NFZA 3RZDI 1Y1WI 2ZEGA 1M4DA 1VQ91 4CS0B 2ZXVA 3GYAA 3CD6Z 2E2JI 2RB7A 3IIBA 4XPDB 3CCRZ 1IOIA 3L2NA 1VIXA 4X8IA 2GLFA 7CPAA 1S721 2ZW6A 5A28A 2P6EA 4R6TA 2HV2A 3IX0A 2VUMI 4PQAA 1YLEA 1Q2CA 5G20A 1YI2Z 2FE7A 1NE9A 4Q7AA 2REEA 4MCSA 1DL6A 3FEEA 1RNIA 2JIMA 3CPAA 1TKFA 5DWMA 2B4BA 1TWGI 2PE3A 2NSMA 4OC1A 2EO8A 1LFWA 1YJW1 4NF1A 4PV6A 2LFUA 2O4HA 4CGOA 4NBHA 3S1QI 3PO3S 2B4DB 3R96A 2Q4YA 1GYTA 2P3YA 1QVFY 4KOXA 1YIT1 3V7ZA 1KUYA 3D66A 4IUSA 3T4NB 3G8WA 4KZTA 1OZPA 3BG1B 4PXCA 2QMLA 2OTL1 1RO2A 4QTUA 5G21A 4FAIA 5FLXf 1YSJA 3QAHA 1QXFA 4BBRI 3IC1A 3V8IA 2VZYA 3ISXA 4NBBA 1KC82 3I3GA 4W9YA 1VQ71 4OC5A 3ISZA 4AVAA 3GCFA 4UEFA 2B3VA 5I0CA 3NE7A 2C27A 3CC41 1VQN1 2AJ6A 4MHYA 1KD11 5JQ4A 2HQYA 3TOAA 2QEX1 3VMGA 1SFOI 1ZO0A 4BY1I 4UA3A 4C2YA 3BJ7A 4UWIA 4ZX9A 1ZH1A 5THWA 2PM9A 3J80f 1RO4A 3HLPA 1SQHA 4RVGA 2H85A 3NDIA 4B5PA 1YX0A 2VI7A 2B5GA 3GTKI 4BMHA 3MONA 1JWQA 2CNSA 1CPXA 4EMEA 4A3GI 2B58A 2PQ8A 3JTKA 3GY9A 4JXQA 5HH1A 4NGPA 2PVVA 3RNZA 3CCJZ 3OW2Z 4C68A 1MK4A 3J81f 5HXDA 1XFOA 4A95A 3CCM1 3R95A 3MRUA 1K83I 2Z3KA 3T9YA 2POKA 4X6AI 3SJEA 3S2HI 2JEVA 3FQMA 3B3TA 2OB0A 5C44I 1V0CA 2GFQA 3D7DA 5DS0A 5C4JI 1XE4A 1R3NA 4RS2A 2KPIA 2PJ5A 3D2MA 3R9GA 2B5GB 2ZENA 1S72Z 4QUSA 2Z3MA 3NH8A 4UEEA 3FX6A 4R87A 2NAPA 2JA8I 2XEGA 3HOZI 2PMZA 4X2TA 2R93I 3VWEA 2CTCA 1VQMZ 3RO0A 3BHXA 4Q36A 4AB7A 4UIAA 3IF8A 3GKQA 3H4QA 2EGTA 4EFDA 2PK7A 2VXKA 4YFJA 3QB8A 3D67A 6CPAA 4ORFA 4A2ZA 4MD9A 2QYVA 3IR7A 4MCQA 3GIUA 2RIQA 2B4DA 1A2ZA 2Q04A 4P6YA 2FIAA 3CCR1 3I9SA 3CPXA 4Y7NI 4C2ZA 4HGYA 2QREB 1RO5A 3B3WA 2CNMA 4DJLA 1TWAI 3I4MI 1VQ6Z 1M4GA 2BSWA 3EO4A 2Q7SA 4B5PB 2NVQI 3P5JB 1KZFA 4A32A 3G3SA 1B6BA 1VQNZ 4R7MA 1FT7A 2ZOFA 3F5BA 4R8FA 1XRYA 1VQ8Z 1WW9A 3GTPI 1WWZA 2K5TA 4CAFA 1IOFA 3KR4A 3IO1A 4Y52I 3R9EA 1S7MA 2PJ0A 3FBUA 1RO0A 2ZEFA 1AYEA 2CY2A 3E0KA 4Q38A 4II9A 3FKII 4E2ZA 2M48A 4TWEA 3M4OI 3N5FA 1Q812 4MXUA 4MHZA 1M901 1ZB9A 4A30A 1VQ51 3WC5A 2IZ4A 3CXCY 5D8NA 1YHQ1 4A3FI 4R76A 2QEXZ 4UCPA 1JQGA 3DGVA 3VWDA 5KTDA 1VHOA 1X3WA 3PB9X 2GANA 4XPDC 2IZ3A 3DDDA 4JXRA 2R8VA 1QSOA 4KOWA 3LACA 2EK8A 3VATA 4KOSA 3VMIA 5G22A 1TWFI 2PJ2A 3S1RI 2BUEA 2HC9A 1QVFZ 5GCNA 4UCNA 2JLMA 1NUIA 1P0HA 4MHNA 3H0GI 3KIFA 3Q87A 4NGQA 1QYPA 4M85A 2PC1A 3T8WA 3TCVA 4B10A 3VMHA 2GREA 4QB9A 4WJBA 1Z8LA 2OTLZ 2VPXA 2F5IA 3DR6A 3IGRA 3GKRA 1VQM1 3HOVI 2PRBA 2O53A 4E30A 3P2HA 1B87A 5IP7I 3CPWY 4IF5A 1TWHI 2JBKA 2JR6A 4KUAA 3CMA1 2F8HA 2HB6A 1Z02A 4CPAA 3H5ZA 3KKWA 2AFWA 3FH4A 3QWUA 5JH9A 2Z10A 3S15I 3S6HA 1P4NA 3S9LA 4PK3A 3A9LA 1Y0YA 4YGOA 3D6WA 4Y49B 1Z4EA 2Q0YA 2XEJA 1Z8TA 2BEIA 2VPZA 2FCKA 4RUHA 1Y1VS 1UWYA 3MZKB 2PJ1A 3I55Z 5IB9A 3SJFA 1FDOA 1K731 4ONUA 2E9HA 1ZG9A 2Y0SA 3CCEZ 2C6GA 1Y9WA 2FT0A 3CCVZ 5F47A 4NJQA 3BG0B 2Z3OA 4UFXA 3TT2A 5JGFA 1R57A 1ZB8A 2ZEOA 5LYDA 1ELMP 3CCJ1 3I56Z 1VQO1 1YQEA 3BJ8A 4B6ZA 4LX9A 5BWAB 2ZEMA 2R1IA 2PJ3A 4E2XA 1YW6A 5FLXb 4MHPA 3G4SZ 2JS4A 4CGMA 4HPSA 4JWPA 2AYDA 4E2WA 3F0AA 4M3SA 1KC81 2C1CA 2JMOA 4H2KA 2AKLA 3JUWA 1USPB 3CT9A 2DEAA 4NGMA 1GHEA 3NDJA 4KLWA 4IAVA 4A3II 4C7HA 1I21A 4JZ0A 1BPMA 5LL6f 1WJ2A 3CME1 4QC6A 3ZZIA 3G6E1 1BLLE 2JBJA 5HVFA 4MJ8A 4CYQA 2O28A 2OU2A 2K5RA 4PSWA 5D29A 1FNOA 5IT9f 1LCPA 2BCOA 1YIJZ 2AFMA 1Q2DA 4F0XA 4AG7A 4OKOA 1RLYA 3B3VA 1Q16A 5F48A 4L89A 1VQL1 5J1QA 1VQ7Z 4EWCA 4KVOE 4UF4A 1EE3P 4BBSI 2G3AA 2CIJA 2WAQA 4RVFA 4FD4A 1JWHC 2OOYB 3GUXA 4NGRA 3S6KA 3CCSZ 3N7ZA 2YNCA 3G4S1 2QVPA 4M6HA 4O23A 1QSTA 3S14I 3KI9A 1Q7Y2 2QA4Z 3PO2I 2H5MA 5JM6A 2VF1A 3H3VJ 3J81b 1NMTA 1VKCA 3EY5A 3BI0A 4OADA 4XNHB 1RTQA 2ZEEA 4M6IA 3SXOA 2R7ZI 2ZW7A 3LWUA 1F2OA 2JA5I 3GB0A 3ESWA 3WABA 5EBVA 2Z11A 3D7FA 4L8AA 3CCLZ 2F4OA 4J3GA 4MONA 2FL4A 4ZYQA 1SIWA 3IU2A 2R92I 5F09A 3KASA 3UY5A 3S9NA 3B35A 2KI7B 1JJ2Y 4E31A 3W6SA 3F3FC 1VQ5Z 3NH5A 4Y49C 4MY0A 3PZJA 1F57A 2RHBA 4YRHA 1KQSY 2JDCA 1IY7A 4AG9A 1VQ9Z 2OR4A 4M6GA 4H89A 1PUAA 1Q822 2VZZA 4NGSA 3EFAA 4DK1A 1Y9KA 2G9DA 2Z3NA 3IFUA 5IV0A 4UFWA 4NGTA 3ZJ0A 2BOAA 2PJ4A 4ONWA 3JAMb 2D4OA 3FYNA 2PDOA 3WT4A 1K8A1 3I551 2Q4VA 1YUAA 5LYIA 2QLVB 1DE4C 1YREA 4MFQA 5A2Qb 1N8R1 3SJXA 5C82A 2E7ZA 2YU9I 1X3ZA 1IU8A 3I07A 1N8R2 2YGWA 4P45A 4UFVA 2J8RA 4HNXB 4CAEA 3RZAA 1XEBA 4BY7I 2JIPA 1LAPA 3CCMZ 3S1MI 5LRKA 5G1ZA 1TWCI 3D68A 1YJNZ 4I49A 3JAMf 1ON0A 1FY7A 2NMTA 4X3RA 4UCMA 2CF4A 5IB0A 5IX3A 2V45A 5ELYA 2AFXA 5H86A 4OMEA 1CBXA 4P4EA 2JA7I 4CYPA 1Q821 1ELLP 3T90A 4JYWA 1KWMA 1ML8A 1CJWA 3FECA 2PJ7A 1VLAA 4BBHA 1CX8A 2Q43A 1YLOA 3I1UA 1CP7A 1M44A 4HH4A 4B5OA 2QA41 4U5YA 2OOXB 2ODFA 5AG6A 3PRTA 4FUUA 2V8IA 5HVHA 3HUVA 2YNEA 4CGLA 3J80b 1PFTA 3S17I 1QQ9A 5JPHA 2EK9A 5LYFA 4MBUA 5CM2M 1CP6A 3TE5B 3FF3A 3D4UA 1VQ41 3B3CA 2IL4A 1MJAA 1S7KA 4XPKA 4KSFA 3FMCA 3TO7A 1YK3A 4QVTA 1QF8A 5AG4A 4F6AA 4ZY2A 2WPXA 4A3EI 2P6FA 3EC4A 1QVGZ 4DGLA 1YJN1 1S7NA 1YHQZ 1BAVA 3VARA 4NGNA 2DPSA 3CCS1 1VQ4Z 4UIBA 4FD7A 4MCPA 3FVLA 4KSIA 1Z2LA 1VQP1 1WK4A 5LRJA 3S9MA 4LQGA 4EWTA 2AE6A 1AA6A 2PJ6A 3C26A 3FB3A 3PBEA 4RV9A 5K8NA 1YJWZ 1DTDA 4CRZB 1YIJ1 3CCQ1 1VQOZ 3PP9A 2AFUA 2J8MA 2IJZA 2W04A 4NBFA 3FIXA 1VQKZ 2NVXI 4HNYB 1I1DA 1Q7LA 2ANPA 2D4PA 4F8ZA 3TO9A 4A39A 2G0BA 4BXXI 4MCRA 3S16I 4JD6A 5KTCA 3D8PA 1I50I 4NH1C 4R9MA 1R43A 2DE7A 3GLJA 2JNYA 1J4JA 4A33A 1Y0RA 1AMPA 3P2FA 4E8OA 4DYOA 1M4LA 1WZNA 3VH9A 5A2Qf 4IK2A 2YNDA
chains in the Genus database with same CATH topology
3CCVZ 2QKDA 4NJQA 3BG0B 3U50C 4BBRI 1M1K1 4BD9A 3B3SA 3IC1A 1OBRA 1W2BZ 2QRCB 4A3BI 5JGFA 1ZB8A 2ZEOA 5LYDA 1ELMP 2C6CA 3HOYI 2PRQA 3CCJ1 1Q861 3I56Z 1VQO1 3ISXA 3PFEA 4NBBA 1KC82 2B63I 4OC2A 1ARMA 1VQ71 4W9YA 1Z5RA 4OC5A 4B6ZA 1PYTB 3ISZA 3KZWA 3M3YI 3GCFA 1Y1VI 2FVGA 4E2YA 2HF1A 4UEFA 2ZEMA 3IFEA 4FWUA 3KQXA 2PJ3A 2ZEDA 4E2XA 3CC41 1YW6A 5FLXb 4MHPA 1VQ61 1VQN1 2OTJ1 3G4SZ 2JS4A 4NFRA 2QRDB 4MHYA 1L1OC 1KD11 2QEX1 3VMGA 4E2WA 5T67A 5CPAA 1F2PA 1SFOI 1M902 5T6BA 4NBDA 4BY1I 4DUKA 2RT9A 1Q811 2M6NA 1KC81 2C1CA 2JMOA 2V8JA 4PXBA 4H2KA 2AKLA 2W03A 1USPB 2XEFA 4A94A 3CT9A 1XJOA 2DEAA 4ZX9A 4NGMA 1ZH1A 5THWA 2PM9A 3NDJA 3J80f 1RO4A 3HLPA 1ZG8A 1HEEA 4IAVA 2XEIA 2WB1A 2PIZA 3RAMA 5D1OA 4A3II 4RVGA 4JZ0A 1BPMA 4NBCA 2H85A 5LL6f 3CME1 1ZLHA 3NDIA 4NB9A 4A3DI 2VUGA 2NVYI 4HGZA 3GTLI 5HVGA 3G6E1 1BLLE 2JBJA 3GTKI 5HVFA 3MONA 1Z03A 2K5RA 5D29A 1CPXA 1FNOA 2AFSA 4NOZA 3CCV1 5IT9f 1LCPA 1YIJZ 2AFMA 2BCOA 4OIDA 4EMEA 4A3GI 1I3QI 1Q862 2VL1A 4OKOA 1RLYA 3B3VA 1YUKA 1K9M1 3J7A4 1VQL1 4NGPA 2PVVA 4OC0A 5J1QA 1VQ7Z 4EWCA 4E32A 5K8MA 3CCJZ 1PCAA 1EE3P 4BBSI 1YW4A 3OW2Z 2JA6I 4UF4A 4FBEA 2C6PA 2Q4ZA 4UEZA 4NBEA 2CIJA 2J9AA 2WAQA 4RVFA 1JWHC 2OOYB 3J81f 3G711 1LAMA 3GUXA 3PB6X 4NJRA 5HXDA 4NGRA 4IHMA 1XFOA 1QVGY 1NP6A 3CCM1 2PJ9A 3MRUA 3CCSZ 5K8PA 2V8GA 2GTIA 2PJCA 3CC7Z 3G4S1 2QVPA 2GU2A 4O23A 1K83I 2PJBA 2WZNA 1Q7Y1 3S14I 2V77A 2POKA 3KI9A 1Q7Y2 4X6AI 3SJEA 2QA4Z 3PO2I 4ZY0A 3S2HI 3CCL1 3FQMA 2V8VA 3B3TA 5C44I 2JEWA 3PB4X 1WCMI 3G71Z 5I4MA 5JM6A 2VF1A 3H3VJ 3J81b 3D7DA 1TXRA 3CD61 5DS0A 5C4JI 3BI0A 1R3NA 2G2KA 3RZOI 3SI0A 3KQZA 2KPIA 5CBMA 2PJ5A 3V38A 4P4FA 2QR1B 2ZAEB 3VTNA 1RTQA 2ZEEA 3I561 3D7GA 4AYBA 2R7ZI 3JRUA 2ZENA 3LWUA 1F2OA 1S72Z 2JA5I 3B7IA 1RQFA 3I4NI 3GB0A 3ESWA 3NH8A 3WABA 4A3MI 3FX6A 4UEEA 4ZI6A 2LIYA 3TDHB 3D7FA 3CCLZ 2F4OA 3HOWI 4MONA 2NVTI 2RBLA 3EEDA 4ZYQA 2JA8I 2ZOGA 2XEGA 2AFOA 1VHEA 3HOZI 3KHZA 2PMZA 2IQ6A 3B2YA 3MZLB 4YU9A 4P44A 4A3LI 5T64A 3CXCZ 3CC4Z 4X2TA 1ZLIA 2R92I 3HOUI 1KRLA 2R93I 3KASA 5F09A 2CTCA 4XX2A 2PJAA 1VQMZ 3S9NA 1YJ9Z 3B35A 3GTMI 4A93I 4RS4A 1USPA 4NBAA 3PBBA 2KI7B 1JJ2Y 3BHXA 4UIAA 3IF8A 3GKQA 4E31A 2EGTA 4EFDA 2PK7A 3CCU1 3F3FC 4OIWA 2NYQA 3D67A 2WYRA 6CPAA 1VQ5Z 4ZY1A 4MD9A 2J6AA 3NH5A 1LOKA 4G1PA 2QYVA 3KHXA 3CC71 3FQQA 1NJI1 3GTOI 4MCQA 3VB9A 2RIQA 2RHBA 3EERA 1NJI2 1KQSY 1F57A 1VGYA 3KL9A 4MD8A 3GTJI 4ZX8A 1IY7A 3TC8A 1IGBA 2JUBA 2E2II 2V8DA 4P6YA 1YJ91 1VQ9Z 3CCR1 2OR4A 4NBGA 1WIIA 1Q822 5LRGA 5IP9I 2GLJA 3CPXA 4K3NA 4P10A 4Y7NI 4NGSA 1Y7EA 4HGYA 2QREB 4DK1A 4PPZA 2G9DA 1XMBA 3K7AI 3CDXA 3IFUA 4E33A 3BXMA 3G6EZ 3B3WA 1HDUA 2OZKA 3D9XA 1ARLA 3CMEZ 5FLMI 4DJLA 3NA6A 1TWAI 3I4MI 4NGTA 2BOAA 2PJ4A 4ONWA 3JAMb 1VQ6Z 4F9UA 5D1OB 4A37A 5C4XI 1H8LA 4A38A 3WT4A 4RVDA 4A3JI 1K8A1 1VQLZ 1YMEA 3I551 1R9TI 2NVQI 2Q51A 3P5JB 1QMUA 1YUAA 3H8EA 4A3KI 3PB8X 5LYIA 3F3PC 1VQNZ 4PXDA 2QLVB 3SJGA 2PJ8A 3CC21 1DE4C 3OW2Y 5A2Qb 1N8R1 4R7MA 3SJXA 3PEIA 1VQPZ 1FT7A 2IMOA 2ZOFA 8CPAA 1YITZ 4R8FA 1VQ8Z 1WW9A 1CPSA 1XRYA 4NB8A 1HDQA 2GTHA 5C3EI 3GTPI 2EWBA 1K732 3PB7X 2YU9I 1TKJA 3KR4A 1X3ZA 3I07A 3LUSA 1S7MA 1N8R2 4Y52I 3IEHA 2PJ0A 2ZELA 3IO1A 3KGQA 4P45A 1RO0A 4P4JA 2ZEFA 1AYEA 4F9VA 4OP4A 2BO9A 3RZAA 1P9NA 1CG2A 4WWVA 4BY7I 2K3RA 1LAPA 3CCMZ 3FKII 4E2ZA 3S1MI 5LRKA 2M48A 3GTQI 1TWCI 3D68A 3MN8A 4TWEA 3SI2A 1YJNZ 3K2KA 3M4OI 2HU9A 3JAMf 3CCE1 1VQ81 3N5FA 3SI1A 4TNUA 1Q812 1N2FA 4MXUA 4X3RA 3RBUA 4MHZA 1M901 2F7VA 5D1PA 1ZB9A 2CF4A 5LYLA 1VQ51 3WC5A 2IZ4A 4S1TA 1Z01A 3CXCY 3CCUZ 4GM5A 5D8NA 4PXEA 1YHQ1 2PCUA 5ELYA 4A3FI 2AFXA 2CTBA 4OMEA 1CBXA 3LMSA 4R76A 2OOTA 1TF8A 2ZEPA 2QEXZ 3PFOA 4AXVA 4P4EA 3WC7A 1JQGA 1JJ2Z 2V8HA 1TFIA 3S2DI 2JA7I 2E2HI 2V8KA 1Q821 1ELLP 1YI21 3DGVA 2PVWA 3CMAZ 5AN9F 3HKZA 4DQYB 4JYWA 4QTTA 1LANA 1KWMA 1VHOA 1ML8A 1X3WA 3PB9X 3FECA 2PJ7A 1VLAA 3D7HA 3K9TA 5IT9b 3S1NI 2IZ3A 4CL1A 2RFHA 3HOXI 4MD7A 4Z65A 2QJ8A 2DE6A 4YWYA 3KR5A 3QNVA 1M1K2 1CX8A 2Q43A 1BPNA 1YLOA 2EK8A 3VATA 3I1UA 1CP7A 3CC2Z 4A3CI 4HH4A 3VMIA 1TWFI 2PJ2A 2QA41 3S1RI 4OC4A 2HC9A 1QVFZ 2OOXB 4OC3A 1NUIA 3CQZI 3PRTA 4FUUA 2V8IA 2ABZA 5HVHA 3HUVA 3J80b 1PFTA 4MHNA 3H0GI 3KIFA 3NFZA 1K8A2 3RZDI 1Y1WI 3S17I 1QQ9A 2ZEGA 3IJ3A 3Q87A 2EK9A 5LYFA 5CM2M 1CP6A 1VQ91 4NGQA 1QYPA 3TE5B 3FF3A 3CD6Z 3D4UA 2E2JI 1VQ41 3B3CA 2RB7A 3FMCA 1NSAA 3IIBA 3CCRZ 3L2NA 1LQLA 1QF8A 3T8WA 3TX8A 1VIXA 3IWWA 4ZY2A 4P4IA 4X8IA 4MMOA 3BI1A 1XBUA 4A3EI 2GLFA 3VMHA 4DGLA 1YJN1 1QVGZ 7CPAA 2OTJZ 2GREA 1TF9A 1S721 2I3CA 4WJBA 1Z8LA 1YHQZ 2YADA 2OTLZ 1BAVA 4NGNA 3VARA 1VQM1 3CCS1 3HOVI 4R6TA 2O53A 3IX0A 4E30A 1VQ4Z 4UIBA 5IP7I 3CPWY 2VUMI 4MCPA 1TWHI 3H8GA 3FVLA 4PQAA 4KSIA 1Z2LA 1VQP1 2JBKA 5LRJA 3S9MA 4LQGA 4EWTA 2JR6A 4P4DA 2PJ6A 3PBEA 1YI2Z 4Q7AA 3WC6A 3CMA1 2AFZA 4MCSA 4RV9A 1DL6A 2F8HA 5K8NA 1YJWZ 1DTDA 3FEEA 1YIJ1 3CCQ1 1Z02A 1I6HI 2HB6A 4CPAA 1RNIA 1VQOZ 3CPAA 1TKFA 2AFWA 2AFUA 3FH4A 2ZEHA 3QWUA 1TWGI 2IJZA 4MH4A 2PE3A 5JH9A 2W04A 2NSMA 4NBFA 4RVHA 4OC1A 1LFWA 1VQKZ 2NVXI 3S15I 1ZG7A 2F4MA 1YJW1 3GTGI 3S9LA 1Y0YA 2DE5A 3PO3I 3D6WA 3NH4A 2LFUA 1Q7LA 3FJUA 2O4HA 2ANPA 3FEDA 3GTMS 4NBHA 3S1QI 4F8ZA 2RPRA 4A39A 3PO3S 4BXXI 1KQSZ 2PIYA 3CCQZ 3CPWZ 2XEJA 4MCRA 3S16I 1GYTA 2P3YA 3KIHA 1QVFY 1K9M2 1I50I 3H8FA 4P4BA 4NH1C 4MRIA 3DLJA 1YIT1 1R43A 3V7ZA 4RUHA 2DE7A 1Y1VS 3D66A 3GLJA 2JNYA 2R6MA 1UWYA 5K8OA 3MZKB 2PJ1A 3I55Z 1Y0RA 1VQK1 1AMPA 3T4NB 5IB9A 3SJFA 1M4LA 4DYOA 2BJOA 1TKHA 3BG1B 4PXCA 1K731 1W2BY 1X0TA 2OTL1 1RO2A 2E9HA 4QTUA 1KD12 1ZG9A 3VH9A 2Y0SA 5A2Qf 4IK2A 4FAIA 3CCEZ 2P28A 5FLXf 2C6GA 1YSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJQ A;  4BD9 A;  3B3S A;  3IC1 A;  1OBR A;  5JGF A;  2ZEO A;  5LYD A;  1ELM P;  2C6C A;  2PRQ A;  3ISX A;  3PFE A;  4OC2 A;  1ARM A;  4W9Y A;  1Z5R A;  4OC5 A;  4B6Z A;  1PYT B;  3ISZ A;  3KZW A;  2FVG A;  4UEF A;  2ZEM A;  3IFE A;  4FWU A;  3KQX A;  2PJ3 A;  2ZED A;  1YW6 A;  4MHP A;  4NFR A;  4MHY A;  5CPA A;  1F2P A;  4DUK A;  2C1C A;  4PXB A;  4H2K A;  2XEF A;  4A94 A;  3CT9 A;  1XJO A;  2DEA A;  4ZX9 A;  4NGM A;  5THW A;  3HLP A;  1ZG8 A;  1HEE A;  4IAV A;  2XEI A;  2PIZ A;  3RAM A;  4JZ0 A;  1BPM A;  1ZLH A;  5HVG A;  1BLL E;  2JBJ A;  5HVF A;  5D29 A;  1CPX A;  1FNO A;  2AFS A;  2BCO A;  1LCP A;  2AFM A;  4OID A;  4EME A;  2VL1 A;  4OKO A;  3B3V A;  4NGP A;  2PVV A;  4OC0 A;  5J1Q A;  5K8M A;  4UF4 A;  1PCA A;  1EE3 P;  1YW4 A;  4FBE A;  2C6P A;  2Q4Z A;  4UEZ A;  2CIJ A;  2J9A A;  3GUX A;  4NJR A;  1LAM A;  3PB6 X;  5HXD A;  4NGR A;  4IHM A;  1XFO A;  2PJ9 A;  3MRU A;  5K8P A;  2V8G A;  2PJC A;  2QVP A;  4O23 A;  2GU2 A;  2PJB A;  2WZN A;  2V77 A;  2POK A;  3KI9 A;  3SJE A;  4ZY0 A;  3B3T A;  2V8V A;  2JEW A;  3PB4 X;  5I4M A;  5JM6 A;  3D7D A;  1TXR A;  5DS0 A;  3BI0 A;  1R3N A;  3SI0 A;  3KQZ A;  5CBM A;  2PJ5 A;  3V38 A;  4P4F A;  1RTQ A;  2ZEE A;  3D7G A;  3JRU A;  2ZEN A;  3LWU A;  1F2O A;  3B7I A;  3GB0 A;  3NH8 A;  3WAB A;  3FX6 A;  4UEE A;  4ZI6 A;  3D7F A;  4ZYQ A;  2ZOG A;  2XEG A;  2AFO A;  1VHE A;  3KHZ A;  2IQ6 A;  3B2Y A;  4YU9 A;  4P44 A;  4X2T A;  1ZLI A;  5F09 A;  3KAS A;  2CTC A;  2PJA A;  3S9N A;  3B35 A;  3PBB A;  3BHX A;  4UIA A;  4EFD A;  4OIW A;  2NYQ A;  3D67 A;  2WYR A;  6CPA A;  4ZY1 A;  3NH5 A;  1LOK A;  4G1P A;  2QYV A;  3KHX A;  4MCQ A;  1F57 A;  1VGY A;  3KL9 A;  4ZX8 A;  1IY7 A;  3TC8 A;  1IGB A;  4P6Y A;  2V8D A;  2OR4 A;  5LRG A;  2GLJ A;  3CPX A;  4K3N A;  4P10 A;  4NGS A;  1Y7E A;  4PPZ A;  2G9D A;  1XMB A;  3BXM A;  3CDX A;  3B3W A;  1HDU A;  1ARL A;  4DJL A;  3NA6 A;  4NGT A;  2BOA A;  2PJ4 A;  4ONW A;  4F9U A;  4A37 A;  1H8L A;  4A38 A;  3WT4 A;  1YME A;  2Q51 A;  1QMU A;  3H8E A;  3PB8 X;  5LYI A;  4PXD A;  3SJG A;  2PJ8 A;  1DE4 C;  4R7M A;  3SJX A;  3PEI A;  1FT7 A;  2IMO A;  2ZOF A;  8CPA A;  4R8F A;  1CPS A;  1XRY A;  1HDQ A;  2EWB A;  3PB7 X;  1TKJ A;  3KR4 A;  3IO1 A;  3IEH A;  3KGQ A;  4P45 A;  2PJ0 A;  2ZEL A;  4P4J A;  2ZEF A;  1AYE A;  4F9V A;  4OP4 A;  2BO9 A;  3RZA A;  4WWV A;  1CG2 A;  1LAP A;  5LRK A;  3D68 A;  3MN8 A;  4TWE A;  3SI2 A;  3K2K A;  3N5F A;  3SI1 A;  4TNU A;  4MXU A;  4X3R A;  3RBU A;  4MHZ A;  2F7V A;  5LYL A;  2CF4 A;  3WC5 A;  5D8N A;  4GM5 A;  4PXE A;  2PCU A;  5ELY A;  2AFX A;  2CTB A;  4OME A;  1CBX A;  3LMS A;  4R76 A;  2OOT A;  1TF8 A;  2ZEP A;  3PFO A;  4AXV A;  4P4E A;  3WC7 A;  1JQG A;  2V8H A;  1ELL P;  3DGV A;  2PVW A;  4JYW A;  1LAN A;  1KWM A;  1VHO A;  3PB9 X;  3FEC A;  2PJ7 A;  3K9T A;  3D7H A;  2RFH A;  4Z65 A;  2QJ8 A;  4YWY A;  3KR5 A;  3QNV A;  1CX8 A;  2Q43 A;  1BPN A;  1YLO A;  2EK8 A;  3VAT A;  3I1U A;  1CP7 A;  2PJ2 A;  4OC4 A;  2HC9 A;  4OC3 A;  3PRT A;  4FUU A;  2ABZ A;  5HVH A;  3HUV A;  4MHN A;  3NFZ A;  1QQ9 A;  2ZEG A;  3IJ3 A;  2EK9 A;  5LYF A;  1CP6 A;  4NGQ A;  3FF3 A;  3D4U A;  3B3C A;  2RB7 A;  3FMC A;  1NSA A;  3IIB A;  3L2N A;  3T8W A;  3TX8 A;  1VIX A;  3IWW A;  4ZY2 A;  4P4I A;  4X8I A;  3BI1 A;  1XBU A;  2GLF A;  7CPA A;  2GRE A;  1TF9 A;  2I3C A;  4WJB A;  1Z8L A;  1BAV A;  4NGN A;  3VAR A;  4R6T A;  2O53 A;  4UIB A;  4MCP A;  3H8G A;  4PQA A;  3FVL A;  4KSI A;  1Z2L A;  2JBK A;  5LRJ A;  3S9M A;  4LQG A;  4EWT A;  4P4D A;  2PJ6 A;  3PBE A;  4Q7A A;  3WC6 A;  2AFZ A;  4MCS A;  2F8H A;  5K8N A;  3FEE A;  1DTD A;  2HB6 A;  4CPA A;  3CPA A;  1TKF A;  2AFW A;  2AFU A;  3FH4 A;  2ZEH A;  2IJZ A;  2PE3 A;  5JH9 A;  2NSM A;  4OC1 A;  1LFW A;  1ZG7 A;  3S9L A;  1Y0Y A;  3NH4 A;  1Q7L A;  3FJU A;  2O4H A;  2ANP A;  3FED A;  4F8Z A;  4A39 A;  2PIY A;  2XEJ A;  4MCR A;  1GYT A;  3H8F A;  4P4B A;  4MRI A;  3DLJ A;  1R43 A;  3V7Z A;  4RUH A;  3D66 A;  3GLJ A;  1UWY A;  5K8O A;  2PJ1 A;  1Y0R A;  1AMP A;  5IB9 A;  3SJF A;  1M4L A;  4DYO A;  1TKH A;  4PXC A;  1ZG9 A;  3VH9 A;  4IK2 A;  4FAI A;  2C6G A;  4MMO A;  1YSJ A; 
#chains in the Genus database with same CATH topology
 4MFZ A;  2QKD A;  1YR0 A;  1OBR A;  4A31 A;  4RN7 A;  3CZX A;  1S60 A;  3F8K A;  2C6C A;  2PRQ A;  1Q86 1;  3PFE A;  1ARM A;  5ISV A;  1PYT B;  3M3Y I;  1RXT A;  1Y1V I;  2FVG A;  3BLN A;  4E2Y A;  2HF1 A;  3IFE A;  2Q44 A;  3KQX A;  2ZED A;  2OTJ 1;  2JIO A;  1L1O C;  5T67 A;  5CPA A;  1F2P A;  1M90 2;  1AUG A;  4NBD A;  4DUK A;  1IIC A;  4OAE A;  2V8J A;  2Y0M A;  1Y8C A;  2W03 A;  2XEF A;  1XJO A;  2WUU A;  4KLV A;  4GXH A;  2WB1 A;  2PIZ A;  3RAM A;  2J8N A;  2ZW4 A;  4NBC A;  1ZLH A;  4NB9 A;  4A3D I;  2VUG A;  2B3U A;  4MHD A;  1Z03 A;  2RC4 A;  2ZPA A;  2LEX A;  5A27 A;  4MY3 A;  1QSR A;  2OZG A;  4BIN A;  1Q86 2;  2VL1 A;  4CGP A;  2Z3L A;  1K9M 1;  1YVK A;  3IU1 A;  1PCA A;  1YW4 A;  2JA6 I;  1IB1 E;  1IID A;  4XNH C;  2Q7B A;  3G71 1;  4NJR A;  3PB6 X;  2KCW A;  4IHM A;  1NP6 A;  2V8G A;  2GTI A;  2PJC A;  2GU2 A;  3IWE A;  4HKF A;  2FIW A;  3TO6 A;  4ZY0 A;  1U6M A;  4CGN A;  3CCL 1;  2V8V A;  5FVJ A;  3PB4 X;  3G71 Z;  5I4M A;  2WSA A;  1TXR A;  2EBJ A;  1CM0 A;  3RZO I;  3SI0 A;  3KQZ A;  3V38 A;  2QR1 B;  1Z8X A;  2P0W A;  2WPW A;  3D2P A;  3I56 1;  4OLL A;  2I79 A;  4A3M I;  1KUX A;  4ZI6 A;  3TDH B;  2NVT I;  2RBL A;  4R3K A;  2ZOG A;  5KTA A;  3KHZ A;  1VHE A;  2IQ6 A;  4YU9 A;  3MZL B;  4P44 A;  2Z0Z A;  4KOY A;  1ZLI A;  3HOU I;  5EMI A;  4XX2 A;  4QBJ A;  1YJ9 Z;  3GTM I;  4K30 A;  4NBA A;  3W6X A;  4KUB A;  4OIW A;  2NYQ A;  4ZY1 A;  2J6A A;  3KHX A;  3CC7 1;  3FQQ A;  1NJI 1;  3GTO I;  1NJI 2;  1VGY A;  3KL9 A;  4MD8 A;  4ZX8 A;  3TC8 A;  2JUB A;  2V8D A;  3TFY A;  4NBG A;  1WII A;  4H6U A;  5LRG A;  2X7B A;  2GLJ A;  4K3N A;  3LD2 A;  5F46 A;  4PPZ A;  1XMB A;  3K7A I;  3BXM A;  4E33 A;  3G6E Z;  1Y7R A;  1HDU A;  3D9X A;  1ARL A;  3CME Z;  5FLM I;  2VEZ A;  3NA6 A;  4F9U A;  5D1O B;  4LQ6 A;  4JJX A;  4A37 A;  3EXN A;  1YME A;  4A3J I;  4KVX A;  1R9T I;  2Q51 A;  3PB8 X;  2PJ8 A;  1NSL A;  1M4I A;  3PEI A;  1K4J A;  1N71 A;  2IMO A;  2JIR A;  4NB8 A;  2EWB A;  4C7I A;  3LUS A;  2I00 A;  2R7H A;  4R3L A;  4P4J A;  1Z8W A;  1P9N A;  1CG2 A;  4CYN A;  2K3R A;  1BOB A;  4HNW B;  3SI2 A;  3DR8 A;  3K2K A;  3D3S A;  4GS4 A;  1N2F A;  5D1P A;  4S1T A;  3CCU Z;  4GM5 A;  2JIQ A;  4PXE A;  2PCU A;  3B8G A;  2CTB A;  3LMS A;  2OOT A;  1TF8 A;  1S7L A;  2V8H A;  1TFI A;  2E2H I;  2V8K A;  2BL1 A;  4XPL A;  1X12 A;  1YI2 1;  2PVW A;  3CMA Z;  3TTH A;  3HKZ A;  4DQY B;  2PSW A;  5AG7 A;  1LAN A;  4PSX A;  4UBR A;  5AGE A;  3K9T A;  5IT9 b;  3S1N I;  4CL1 A;  2RFH A;  4ZGY B;  4MD7 A;  1L0C A;  4U9Z A;  1KUV A;  2DE6 A;  4YWY A;  4B14 A;  3KR5 A;  3QNV A;  2FS5 A;  1UFH A;  1Z9U A;  3CC2 Z;  4A3C I;  4OC4 A;  4OC3 A;  2ABZ A;  4E2A A;  1K8A 2;  3IJ3 A;  4UWJ A;  1NSA A;  4B13 A;  1LQL A;  3TX8 A;  3IWW A;  4P4I A;  3BI1 A;  1XBU A;  2OTJ Z;  1TF9 A;  2I3C A;  4PK2 A;  2YAD A;  3DSB A;  4MI4 A;  2VQY A;  4NEX A;  3H8G A;  3R9F A;  4P4D A;  3WC6 A;  2AFZ A;  4CAW A;  5CNP A;  2EUI A;  1I6H I;  2ZEH A;  3CXP A;  4MH4 A;  4RVH A;  4U9Y A;  4DNC A;  1ZG7 A;  2DXQ A;  2F4M A;  3GTG I;  2DE5 A;  3PO3 I;  4NXY A;  3NH4 A;  3FJU A;  2PR1 A;  3FED A;  3GTM S;  2RPR A;  2ATR A;  1KQS Z;  2PIY A;  3CCQ Z;  3CPW Z;  5H84 A;  3KIH A;  2DPT A;  1K9M 2;  3H8F A;  4P4B A;  1YVO A;  4MRI A;  3DLJ A;  3MGD A;  2VBQ A;  2HUZ A;  2R6M A;  5K8O A;  4F0Y A;  4KOV A;  1VQK 1;  2GIV A;  2BJO A;  1TKH A;  1W2B Y;  1X0T A;  2Z3P A;  3TOB A;  1KD1 2;  1VHS A;  1IYL A;  3RYO A;  2P28 A;  4MMO A;  3PGP A;  5J8C A;  1M1D A;  3U50 C;  4FD6 A;  1M1K 1;  4BD9 A;  3B3S A;  1W2B Z;  4AVB A;  2QRC B;  2EVN A;  4A3B I;  3HOY I;  2R98 A;  4OC2 A;  4X5K A;  2B63 I;  1Z5R A;  2IV2 X;  3KZW A;  1QSN A;  4FWU A;  4RI1 A;  3CXS A;  1VQ6 1;  1Z4R A;  4H6Z A;  4NFR A;  2QRD B;  5T6B A;  2RT9 A;  1Q81 1;  2M6N A;  4R57 A;  3FXT A;  4KOU A;  4MFL A;  4PXB A;  4A94 A;  4CAV A;  2A4N A;  3WR7 A;  1ZG8 A;  1HEE A;  2XEI A;  5C88 A;  2OZU A;  5D1O A;  1QSM A;  2CXA A;  3K9U A;  2NVY I;  4HGZ A;  3GTL I;  3IWG A;  5HVG A;  2P6G A;  5DWN A;  2AFS A;  1XF8 A;  4NOZ A;  3CCV 1;  4KS9 A;  4OID A;  1I3Q I;  2G3T A;  1YUK A;  3J7A 4;  4CYO A;  1Q2Y A;  4OC0 A;  5K8M A;  4E32 A;  4MFJ A;  4FBE A;  2C6P A;  3R1K A;  2Q4Z A;  3LOD A;  4UEZ A;  4NBE A;  1BO4 A;  2J9A A;  1LAM A;  1PU9 A;  4CAX A;  1QVG Y;  2PJ9 A;  5K8P A;  3D2L A;  3CC7 Z;  5E96 A;  2PJB A;  4C2X A;  2WZN A;  1Q7Y 1;  2V77 A;  1FDI A;  3TE4 A;  2JEW A;  1WCM I;  5HMN A;  2V3V A;  3CD6 1;  2QIR A;  2G2K A;  5CBM A;  5EC4 A;  4JLY A;  4P4F A;  2ZAE B;  4MFK A;  3VTN A;  3D7G A;  4AYB A;  3JRU A;  4KOT A;  1I12 A;  3B7I A;  5J8F A;  1RQF A;  3I4N I;  1S7F A;  2LIY A;  3HOW I;  3S6G A;  1S5K A;  2DF5 A;  3EED A;  2AFO A;  3B2Y A;  4A3L I;  5T64 A;  3SHP A;  3CXC Z;  3CC4 Z;  2GE3 A;  1S3Z A;  1KRL A;  2PJA A;  5F49 A;  3OWC A;  4A93 I;  4RS4 A;  1USP A;  4LUA A;  3PBB A;  3S6F A;  4KVM E;  1MJ9 A;  3CCU 1;  2WYR A;  1LOK A;  4G1P A;  4E0A A;  4EVY A;  3VB9 A;  3EER A;  3GTJ I;  1IGB A;  2E2I I;  2ARH A;  1YJ9 1;  2VPY A;  5IP9 I;  4P10 A;  1Y7E A;  1X10 A;  3CDX A;  2OZK A;  4CRY B;  5C4X I;  3QAY A;  3JVN A;  1H8L A;  4NSQ A;  4A38 A;  4RVD A;  4ZBG A;  1VQL Z;  3FNC A;  2YNC C;  1QMU A;  4NCZ A;  3H8E A;  4A3K I;  3F3P C;  4PXD A;  3SJG A;  1MJB A;  2QEC A;  3CC2 1;  3OW2 Y;  4FD5 A;  1VQP Z;  8CPA A;  1YIT Z;  1CPS A;  1HDQ A;  2GTH A;  5C3E I;  1K73 2;  3PB7 X;  1TKJ A;  3IEH A;  3KGQ A;  2ZEL A;  4F9V A;  4OP4 A;  2BO9 A;  1YGH A;  1XOV A;  4WWV A;  2JDD A;  4B12 A;  3GTQ I;  3MN8 A;  3CXQ A;  2HU9 A;  3CCE 1;  1VQ8 1;  3SI1 A;  4B11 A;  4TNU A;  3RBU A;  2F7V A;  1XMT A;  5LYL A;  2FSR A;  4KSA A;  1Z01 A;  3SXN A;  4AXV A;  2ZEP A;  3PFO A;  3WC7 A;  1JJ2 Z;  3S2D I;  2CNT A;  1IYK A;  2ZW5 A;  5AN9 F;  2VPW A;  4QTT A;  1LRZ A;  2OH1 A;  3D7H A;  3HOX I;  4MFP A;  4Z65 A;  3DNS A;  1TIQ A;  2QJ8 A;  2REF A;  1M1K 2;  2OZH A;  1XIX A;  3NE8 A;  1BPN A;  3FRM A;  2FXF A;  5AG5 A;  2PR8 A;  3CQZ I;  4AVC A;  3W91 A;  4KOR A;  3NFZ A;  3RZD I;  1Y1W I;  2ZEG A;  1M4D A;  1VQ9 1;  4CS0 B;  2ZXV A;  3GYA A;  3CD6 Z;  2E2J I;  2RB7 A;  3IIB A;  4XPD B;  3CCR Z;  1IOI A;  3L2N A;  1VIX A;  4X8I A;  2GLF A;  7CPA A;  1S72 1;  2ZW6 A;  5A28 A;  2P6E A;  4R6T A;  2HV2 A;  3IX0 A;  2VUM I;  4PQA A;  1YLE A;  1Q2C A;  5G20 A;  1YI2 Z;  2FE7 A;  1NE9 A;  4Q7A A;  2REE A;  4MCS A;  1DL6 A;  3FEE A;  1RNI A;  2JIM A;  3CPA A;  1TKF A;  5DWM A;  2B4B A;  1TWG I;  2PE3 A;  2NSM A;  4OC1 A;  2EO8 A;  1LFW A;  1YJW 1;  4NF1 A;  4PV6 A;  2LFU A;  2O4H A;  4CGO A;  4NBH A;  3S1Q I;  3PO3 S;  2B4D B;  3R96 A;  2Q4Y A;  1GYT A;  2P3Y A;  1QVF Y;  4KOX A;  1YIT 1;  3V7Z A;  1KUY A;  3D66 A;  4IUS A;  3T4N B;  3G8W A;  4KZT A;  1OZP A;  3BG1 B;  4PXC A;  2QML A;  2OTL 1;  1RO2 A;  4QTU A;  5G21 A;  4FAI A;  5FLX f;  1YSJ A;  3QAH A;  1QXF A;  4BBR I;  3IC1 A;  3V8I A;  2VZY A;  3ISX A;  4NBB A;  1KC8 2;  3I3G A;  4W9Y A;  1VQ7 1;  4OC5 A;  3ISZ A;  4AVA A;  3GCF A;  4UEF A;  2B3V A;  5I0C A;  3NE7 A;  2C27 A;  3CC4 1;  1VQN 1;  2AJ6 A;  4MHY A;  1KD1 1;  5JQ4 A;  2HQY A;  3TOA A;  2QEX 1;  3VMG A;  1SFO I;  1ZO0 A;  4BY1 I;  4UA3 A;  4C2Y A;  3BJ7 A;  4UWI A;  4ZX9 A;  1ZH1 A;  5THW A;  2PM9 A;  3J80 f;  1RO4 A;  3HLP A;  1SQH A;  4RVG A;  2H85 A;  3NDI A;  4B5P A;  1YX0 A;  2VI7 A;  2B5G A;  3GTK I;  4BMH A;  3MON A;  1JWQ A;  2CNS A;  1CPX A;  4EME A;  4A3G I;  2B58 A;  2PQ8 A;  3JTK A;  3GY9 A;  4JXQ A;  5HH1 A;  4NGP A;  2PVV A;  3RNZ A;  3CCJ Z;  3OW2 Z;  4C68 A;  1MK4 A;  3J81 f;  5HXD A;  1XFO A;  4A95 A;  3CCM 1;  3R95 A;  3MRU A;  1K83 I;  2Z3K A;  3T9Y A;  2POK A;  4X6A I;  3SJE A;  3S2H I;  2JEV A;  3FQM A;  3B3T A;  2OB0 A;  5C44 I;  1V0C A;  2GFQ A;  3D7D A;  5DS0 A;  5C4J I;  1XE4 A;  1R3N A;  4RS2 A;  2KPI A;  2PJ5 A;  3D2M A;  3R9G A;  2B5G B;  2ZEN A;  1S72 Z;  4QUS A;  2Z3M A;  3NH8 A;  4UEE A;  3FX6 A;  4R87 A;  2NAP A;  2JA8 I;  2XEG A;  3HOZ I;  2PMZ A;  4X2T A;  2R93 I;  3VWE A;  2CTC A;  1VQM Z;  3RO0 A;  3BHX A;  4Q36 A;  4AB7 A;  4UIA A;  3IF8 A;  3GKQ A;  3H4Q A;  2EGT A;  4EFD A;  2PK7 A;  2VXK A;  4YFJ A;  3QB8 A;  3D67 A;  6CPA A;  4ORF A;  4A2Z A;  4MD9 A;  2QYV A;  3IR7 A;  4MCQ A;  3GIU A;  2RIQ A;  2B4D A;  1A2Z A;  2Q04 A;  4P6Y A;  2FIA A;  3CCR 1;  3I9S A;  3CPX A;  4Y7N I;  4C2Z A;  4HGY A;  2QRE B;  1RO5 A;  3B3W A;  2CNM A;  4DJL A;  1TWA I;  3I4M I;  1VQ6 Z;  1M4G A;  2BSW A;  3EO4 A;  2Q7S A;  4B5P B;  2NVQ I;  3P5J B;  1KZF A;  4A32 A;  3G3S A;  1B6B A;  1VQN Z;  4R7M A;  1FT7 A;  2ZOF A;  3F5B A;  4R8F A;  1XRY A;  1VQ8 Z;  1WW9 A;  3GTP I;  1WWZ A;  2K5T A;  4CAF A;  1IOF A;  3KR4 A;  3IO1 A;  4Y52 I;  3R9E A;  1S7M A;  2PJ0 A;  3FBU A;  1RO0 A;  2ZEF A;  1AYE A;  2CY2 A;  3E0K A;  4Q38 A;  4II9 A;  3FKI I;  4E2Z A;  2M48 A;  4TWE A;  3M4O I;  3N5F A;  1Q81 2;  4MXU A;  4MHZ A;  1M90 1;  1ZB9 A;  4A30 A;  1VQ5 1;  3WC5 A;  2IZ4 A;  3CXC Y;  5D8N A;  1YHQ 1;  4A3F I;  4R76 A;  2QEX Z;  4UCP A;  1JQG A;  3DGV A;  3VWD A;  5KTD A;  1VHO A;  1X3W A;  3PB9 X;  2GAN A;  4XPD C;  2IZ3 A;  3DDD A;  4JXR A;  2R8V A;  1QSO A;  4KOW A;  3LAC A;  2EK8 A;  3VAT A;  4KOS A;  3VMI A;  5G22 A;  1TWF I;  2PJ2 A;  3S1R I;  2BUE A;  2HC9 A;  1QVF Z;  5GCN A;  4UCN A;  2JLM A;  1NUI A;  1P0H A;  4MHN A;  3H0G I;  3KIF A;  3Q87 A;  4NGQ A;  1QYP A;  4M85 A;  2PC1 A;  3T8W A;  3TCV A;  4B10 A;  3VMH A;  2GRE A;  4QB9 A;  4WJB A;  1Z8L A;  2OTL Z;  2VPX A;  2F5I A;  3DR6 A;  3IGR A;  3GKR A;  1VQM 1;  3HOV I;  2PRB A;  2O53 A;  4E30 A;  3P2H A;  1B87 A;  5IP7 I;  3CPW Y;  4IF5 A;  1TWH I;  2JBK A;  2JR6 A;  4KUA A;  3CMA 1;  2F8H A;  2HB6 A;  1Z02 A;  4CPA A;  3H5Z A;  3KKW A;  2AFW A;  3FH4 A;  3QWU A;  5JH9 A;  2Z10 A;  3S15 I;  3S6H A;  1P4N A;  3S9L A;  4PK3 A;  3A9L A;  1Y0Y A;  4YGO A;  3D6W A;  4Y49 B;  1Z4E A;  2Q0Y A;  2XEJ A;  1Z8T A;  2BEI A;  2VPZ A;  2FCK A;  4RUH A;  1Y1V S;  1UWY A;  3MZK B;  2PJ1 A;  3I55 Z;  5IB9 A;  3SJF A;  1FDO A;  1K73 1;  4ONU A;  2E9H A;  1ZG9 A;  2Y0S A;  3CCE Z;  2C6G A;  1Y9W A;  2FT0 A;  3CCV Z;  5F47 A;  4NJQ A;  3BG0 B;  2Z3O A;  4UFX A;  3TT2 A;  5JGF A;  1R57 A;  1ZB8 A;  2ZEO A;  5LYD A;  1ELM P;  3CCJ 1;  3I56 Z;  1VQO 1;  1YQE A;  3BJ8 A;  4B6Z A;  4LX9 A;  5BWA B;  2ZEM A;  2R1I A;  2PJ3 A;  4E2X A;  1YW6 A;  5FLX b;  4MHP A;  3G4S Z;  2JS4 A;  4CGM A;  4HPS A;  4JWP A;  2AYD A;  4E2W A;  3F0A A;  4M3S A;  1KC8 1;  2C1C A;  2JMO A;  4H2K A;  2AKL A;  3JUW A;  1USP B;  3CT9 A;  2DEA A;  4NGM A;  1GHE A;  3NDJ A;  4KLW A;  4IAV A;  4A3I I;  4C7H A;  1I21 A;  4JZ0 A;  1BPM A;  5LL6 f;  1WJ2 A;  3CME 1;  4QC6 A;  3ZZI A;  3G6E 1;  1BLL E;  2JBJ A;  5HVF A;  4MJ8 A;  4CYQ A;  2O28 A;  2OU2 A;  2K5R A;  4PSW A;  5D29 A;  1FNO A;  5IT9 f;  1LCP A;  2BCO A;  1YIJ Z;  2AFM A;  1Q2D A;  4F0X A;  4AG7 A;  4OKO A;  1RLY A;  3B3V A;  1Q16 A;  5F48 A;  4L89 A;  1VQL 1;  5J1Q A;  1VQ7 Z;  4EWC A;  4KVO E;  4UF4 A;  1EE3 P;  4BBS I;  2G3A A;  2CIJ A;  2WAQ A;  4RVF A;  4FD4 A;  1JWH C;  2OOY B;  3GUX A;  4NGR A;  3S6K A;  3CCS Z;  3N7Z A;  2YNC A;  3G4S 1;  2QVP A;  4M6H A;  4O23 A;  1QST A;  3S14 I;  3KI9 A;  1Q7Y 2;  2QA4 Z;  3PO2 I;  2H5M A;  5JM6 A;  2VF1 A;  3H3V J;  3J81 b;  1NMT A;  1VKC A;  3EY5 A;  3BI0 A;  4OAD A;  4XNH B;  1RTQ A;  2ZEE A;  4M6I A;  3SXO A;  2R7Z I;  2ZW7 A;  3LWU A;  1F2O A;  2JA5 I;  3GB0 A;  3ESW A;  3WAB A;  5EBV A;  2Z11 A;  3D7F A;  4L8A A;  3CCL Z;  2F4O A;  4J3G A;  4MON A;  2FL4 A;  4ZYQ A;  1SIW A;  3IU2 A;  2R92 I;  5F09 A;  3KAS A;  3UY5 A;  3S9N A;  3B35 A;  2KI7 B;  1JJ2 Y;  4E31 A;  3W6S A;  3F3F C;  1VQ5 Z;  3NH5 A;  4Y49 C;  4MY0 A;  3PZJ A;  1F57 A;  2RHB A;  4YRH A;  1KQS Y;  2JDC A;  1IY7 A;  4AG9 A;  1VQ9 Z;  2OR4 A;  4M6G A;  4H89 A;  1PUA A;  1Q82 2;  2VZZ A;  4NGS A;  3EFA A;  4DK1 A;  1Y9K A;  2G9D A;  2Z3N A;  3IFU A;  5IV0 A;  4UFW A;  4NGT A;  3ZJ0 A;  2BOA A;  2PJ4 A;  4ONW A;  3JAM b;  2D4O A;  3FYN A;  2PDO A;  3WT4 A;  1K8A 1;  3I55 1;  2Q4V A;  1YUA A;  5LYI A;  2QLV B;  1DE4 C;  1YRE A;  4MFQ A;  5A2Q b;  1N8R 1;  3SJX A;  5C82 A;  2E7Z A;  2YU9 I;  1X3Z A;  1IU8 A;  3I07 A;  1N8R 2;  2YGW A;  4P45 A;  4UFV A;  2J8R A;  4HNX B;  4CAE A;  3RZA A;  1XEB A;  4BY7 I;  2JIP A;  1LAP A;  3CCM Z;  3S1M I;  5LRK A;  5G1Z A;  1TWC I;  3D68 A;  1YJN Z;  4I49 A;  3JAM f;  1ON0 A;  1FY7 A;  2NMT A;  4X3R A;  4UCM A;  2CF4 A;  5IB0 A;  5IX3 A;  2V45 A;  5ELY A;  2AFX A;  5H86 A;  4OME A;  1CBX A;  4P4E A;  2JA7 I;  4CYP A;  1Q82 1;  1ELL P;  3T90 A;  4JYW A;  1KWM A;  1ML8 A;  1CJW A;  3FEC A;  2PJ7 A;  1VLA A;  4BBH A;  1CX8 A;  2Q43 A;  1YLO A;  3I1U A;  1CP7 A;  1M44 A;  4HH4 A;  4B5O A;  2QA4 1;  4U5Y A;  2OOX B;  2ODF A;  5AG6 A;  3PRT A;  4FUU A;  2V8I A;  5HVH A;  3HUV A;  2YNE A;  4CGL A;  3J80 b;  1PFT A;  3S17 I;  1QQ9 A;  5JPH A;  2EK9 A;  5LYF A;  4MBU A;  5CM2 M;  1CP6 A;  3TE5 B;  3FF3 A;  3D4U A;  1VQ4 1;  3B3C A;  2IL4 A;  1MJA A;  1S7K A;  4XPK A;  4KSF A;  3FMC A;  3TO7 A;  1YK3 A;  4QVT A;  1QF8 A;  5AG4 A;  4F6A A;  4ZY2 A;  2WPX A;  4A3E I;  2P6F A;  3EC4 A;  1QVG Z;  4DGL A;  1YJN 1;  1S7N A;  1YHQ Z;  1BAV A;  3VAR A;  4NGN A;  2DPS A;  3CCS 1;  1VQ4 Z;  4UIB A;  4FD7 A;  4MCP A;  3FVL A;  4KSI A;  1Z2L A;  1VQP 1;  1WK4 A;  5LRJ A;  3S9M A;  4LQG A;  4EWT A;  2AE6 A;  1AA6 A;  2PJ6 A;  3C26 A;  3FB3 A;  3PBE A;  4RV9 A;  5K8N A;  1YJW Z;  1DTD A;  4CRZ B;  1YIJ 1;  3CCQ 1;  1VQO Z;  3PP9 A;  2AFU A;  2J8M A;  2IJZ A;  2W04 A;  4NBF A;  3FIX A;  1VQK Z;  2NVX I;  4HNY B;  1I1D A;  1Q7L A;  2ANP A;  2D4P A;  4F8Z A;  3TO9 A;  4A39 A;  2G0B A;  4BXX I;  4MCR A;  3S16 I;  4JD6 A;  5KTC A;  3D8P A;  1I50 I;  4NH1 C;  4R9M A;  1R43 A;  2DE7 A;  3GLJ A;  2JNY A;  1J4J A;  4A33 A;  1Y0R A;  1AMP A;  3P2F A;  4E8O A;  4DYO A;  1M4L A;  1WZN A;  3VH9 A;  5A2Q f;  4IK2 A;  2YND A; 
#chains in the Genus database with same CATH homology
 3CCV Z;  2QKD A;  4NJQ A;  3BG0 B;  3U50 C;  4BBR I;  1M1K 1;  4BD9 A;  3B3S A;  3IC1 A;  1OBR A;  1W2B Z;  2QRC B;  4A3B I;  5JGF A;  1ZB8 A;  2ZEO A;  5LYD A;  1ELM P;  2C6C A;  3HOY I;  2PRQ A;  3CCJ 1;  1Q86 1;  3I56 Z;  1VQO 1;  3ISX A;  3PFE A;  4NBB A;  1KC8 2;  2B63 I;  4OC2 A;  1ARM A;  1VQ7 1;  4W9Y A;  1Z5R A;  4OC5 A;  4B6Z A;  1PYT B;  3ISZ A;  3KZW A;  3M3Y I;  3GCF A;  1Y1V I;  2FVG A;  4E2Y A;  2HF1 A;  4UEF A;  2ZEM A;  3IFE A;  4FWU A;  3KQX A;  2PJ3 A;  2ZED A;  4E2X A;  3CC4 1;  1YW6 A;  5FLX b;  4MHP A;  1VQ6 1;  1VQN 1;  2OTJ 1;  3G4S Z;  2JS4 A;  4NFR A;  2QRD B;  4MHY A;  1L1O C;  1KD1 1;  2QEX 1;  3VMG A;  4E2W A;  5T67 A;  5CPA A;  1F2P A;  1SFO I;  1M90 2;  5T6B A;  4NBD A;  4BY1 I;  4DUK A;  2RT9 A;  1Q81 1;  2M6N A;  1KC8 1;  2C1C A;  2JMO A;  2V8J A;  4PXB A;  4H2K A;  2AKL A;  2W03 A;  1USP B;  2XEF A;  4A94 A;  3CT9 A;  1XJO A;  2DEA A;  4ZX9 A;  4NGM A;  1ZH1 A;  5THW A;  2PM9 A;  3NDJ A;  3J80 f;  1RO4 A;  3HLP A;  1ZG8 A;  1HEE A;  4IAV A;  2XEI A;  2WB1 A;  2PIZ A;  3RAM A;  5D1O A;  4A3I I;  4RVG A;  4JZ0 A;  1BPM A;  4NBC A;  2H85 A;  5LL6 f;  3CME 1;  1ZLH A;  3NDI A;  4NB9 A;  4A3D I;  2VUG A;  2NVY I;  4HGZ A;  3GTL I;  5HVG A;  3G6E 1;  1BLL E;  2JBJ A;  3GTK I;  5HVF A;  3MON A;  1Z03 A;  2K5R A;  5D29 A;  1CPX A;  1FNO A;  2AFS A;  4NOZ A;  3CCV 1;  5IT9 f;  1LCP A;  1YIJ Z;  2AFM A;  2BCO A;  4OID A;  4EME A;  4A3G I;  1I3Q I;  1Q86 2;  2VL1 A;  4OKO A;  1RLY A;  3B3V A;  1YUK A;  1K9M 1;  3J7A 4;  1VQL 1;  4NGP A;  2PVV A;  4OC0 A;  5J1Q A;  1VQ7 Z;  4EWC A;  4E32 A;  5K8M A;  3CCJ Z;  1PCA A;  1EE3 P;  4BBS I;  1YW4 A;  3OW2 Z;  2JA6 I;  4UF4 A;  4FBE A;  2C6P A;  2Q4Z A;  4UEZ A;  4NBE A;  2CIJ A;  2J9A A;  2WAQ A;  4RVF A;  1JWH C;  2OOY B;  3J81 f;  3G71 1;  1LAM A;  3GUX A;  3PB6 X;  4NJR A;  5HXD A;  4NGR A;  4IHM A;  1XFO A;  1QVG Y;  1NP6 A;  3CCM 1;  2PJ9 A;  3MRU A;  3CCS Z;  5K8P A;  2V8G A;  2GTI A;  2PJC A;  3CC7 Z;  3G4S 1;  2QVP A;  2GU2 A;  4O23 A;  1K83 I;  2PJB A;  2WZN A;  1Q7Y 1;  3S14 I;  2V77 A;  2POK A;  3KI9 A;  1Q7Y 2;  4X6A I;  3SJE A;  2QA4 Z;  3PO2 I;  4ZY0 A;  3S2H I;  3CCL 1;  3FQM A;  2V8V A;  3B3T A;  5C44 I;  2JEW A;  3PB4 X;  1WCM I;  3G71 Z;  5I4M A;  5JM6 A;  2VF1 A;  3H3V J;  3J81 b;  3D7D A;  1TXR A;  3CD6 1;  5DS0 A;  5C4J I;  3BI0 A;  1R3N A;  2G2K A;  3RZO I;  3SI0 A;  3KQZ A;  2KPI A;  5CBM A;  2PJ5 A;  3V38 A;  4P4F A;  2QR1 B;  2ZAE B;  3VTN A;  1RTQ A;  2ZEE A;  3I56 1;  3D7G A;  4AYB A;  2R7Z I;  3JRU A;  2ZEN A;  3LWU A;  1F2O A;  1S72 Z;  2JA5 I;  3B7I A;  1RQF A;  3I4N I;  3GB0 A;  3ESW A;  3NH8 A;  3WAB A;  4A3M I;  3FX6 A;  4UEE A;  4ZI6 A;  2LIY A;  3TDH B;  3D7F A;  3CCL Z;  2F4O A;  3HOW I;  4MON A;  2NVT I;  2RBL A;  3EED A;  4ZYQ A;  2JA8 I;  2ZOG A;  2XEG A;  2AFO A;  1VHE A;  3HOZ I;  3KHZ A;  2PMZ A;  2IQ6 A;  3B2Y A;  3MZL B;  4YU9 A;  4P44 A;  4A3L I;  5T64 A;  3CXC Z;  3CC4 Z;  4X2T A;  1ZLI A;  2R92 I;  3HOU I;  1KRL A;  2R93 I;  3KAS A;  5F09 A;  2CTC A;  4XX2 A;  2PJA A;  1VQM Z;  3S9N A;  1YJ9 Z;  3B35 A;  3GTM I;  4A93 I;  4RS4 A;  1USP A;  4NBA A;  3PBB A;  2KI7 B;  1JJ2 Y;  3BHX A;  4UIA A;  3IF8 A;  3GKQ A;  4E31 A;  2EGT A;  4EFD A;  2PK7 A;  3CCU 1;  3F3F C;  4OIW A;  2NYQ A;  3D67 A;  2WYR A;  6CPA A;  1VQ5 Z;  4ZY1 A;  4MD9 A;  2J6A A;  3NH5 A;  1LOK A;  4G1P A;  2QYV A;  3KHX A;  3CC7 1;  3FQQ A;  1NJI 1;  3GTO I;  4MCQ A;  3VB9 A;  2RIQ A;  2RHB A;  3EER A;  1NJI 2;  1KQS Y;  1F57 A;  1VGY A;  3KL9 A;  4MD8 A;  3GTJ I;  4ZX8 A;  1IY7 A;  3TC8 A;  1IGB A;  2JUB A;  2E2I I;  2V8D A;  4P6Y A;  1YJ9 1;  1VQ9 Z;  3CCR 1;  2OR4 A;  4NBG A;  1WII A;  1Q82 2;  5LRG A;  5IP9 I;  2GLJ A;  3CPX A;  4K3N A;  4P10 A;  4Y7N I;  4NGS A;  1Y7E A;  4HGY A;  2QRE B;  4DK1 A;  4PPZ A;  2G9D A;  1XMB A;  3K7A I;  3CDX A;  3IFU A;  4E33 A;  3BXM A;  3G6E Z;  3B3W A;  1HDU A;  2OZK A;  3D9X A;  1ARL A;  3CME Z;  5FLM I;  4DJL A;  3NA6 A;  1TWA I;  3I4M I;  4NGT A;  2BOA A;  2PJ4 A;  4ONW A;  3JAM b;  1VQ6 Z;  4F9U A;  5D1O B;  4A37 A;  5C4X I;  1H8L A;  4A38 A;  3WT4 A;  4RVD A;  4A3J I;  1K8A 1;  1VQL Z;  1YME A;  3I55 1;  1R9T I;  2NVQ I;  2Q51 A;  3P5J B;  1QMU A;  1YUA A;  3H8E A;  4A3K I;  3PB8 X;  5LYI A;  3F3P C;  1VQN Z;  4PXD A;  2QLV B;  3SJG A;  2PJ8 A;  3CC2 1;  1DE4 C;  3OW2 Y;  5A2Q b;  1N8R 1;  4R7M A;  3SJX A;  3PEI A;  1VQP Z;  1FT7 A;  2IMO A;  2ZOF A;  8CPA A;  1YIT Z;  4R8F A;  1VQ8 Z;  1WW9 A;  1CPS A;  1XRY A;  4NB8 A;  1HDQ A;  2GTH A;  5C3E I;  3GTP I;  2EWB A;  1K73 2;  3PB7 X;  2YU9 I;  1TKJ A;  3KR4 A;  1X3Z A;  3I07 A;  3LUS A;  1S7M A;  1N8R 2;  4Y52 I;  3IEH A;  2PJ0 A;  2ZEL A;  3IO1 A;  3KGQ A;  4P45 A;  1RO0 A;  4P4J A;  2ZEF A;  1AYE A;  4F9V A;  4OP4 A;  2BO9 A;  3RZA A;  1P9N A;  1CG2 A;  4WWV A;  4BY7 I;  2K3R A;  1LAP A;  3CCM Z;  3FKI I;  4E2Z A;  3S1M I;  5LRK A;  2M48 A;  3GTQ I;  1TWC I;  3D68 A;  3MN8 A;  4TWE A;  3SI2 A;  1YJN Z;  3K2K A;  3M4O I;  2HU9 A;  3JAM f;  3CCE 1;  1VQ8 1;  3N5F A;  3SI1 A;  4TNU A;  1Q81 2;  1N2F A;  4MXU A;  4X3R A;  3RBU A;  4MHZ A;  1M90 1;  2F7V A;  5D1P A;  1ZB9 A;  2CF4 A;  5LYL A;  1VQ5 1;  3WC5 A;  2IZ4 A;  4S1T A;  1Z01 A;  3CXC Y;  3CCU Z;  4GM5 A;  5D8N A;  4PXE A;  1YHQ 1;  2PCU A;  5ELY A;  4A3F I;  2AFX A;  2CTB A;  4OME A;  1CBX A;  3LMS A;  4R76 A;  2OOT A;  1TF8 A;  2ZEP A;  2QEX Z;  3PFO A;  4AXV A;  4P4E A;  3WC7 A;  1JQG A;  1JJ2 Z;  2V8H A;  1TFI A;  3S2D I;  2JA7 I;  2E2H I;  2V8K A;  1Q82 1;  1ELL P;  1YI2 1;  3DGV A;  2PVW A;  3CMA Z;  5AN9 F;  3HKZ A;  4DQY B;  4JYW A;  4QTT A;  1LAN A;  1KWM A;  1VHO A;  1ML8 A;  1X3W A;  3PB9 X;  3FEC A;  2PJ7 A;  1VLA A;  3D7H A;  3K9T A;  5IT9 b;  3S1N I;  2IZ3 A;  4CL1 A;  2RFH A;  3HOX I;  4MD7 A;  4Z65 A;  2QJ8 A;  2DE6 A;  4YWY A;  3KR5 A;  3QNV A;  1M1K 2;  1CX8 A;  2Q43 A;  1BPN A;  1YLO A;  2EK8 A;  3VAT A;  3I1U A;  1CP7 A;  3CC2 Z;  4A3C I;  4HH4 A;  3VMI A;  1TWF I;  2PJ2 A;  2QA4 1;  3S1R I;  4OC4 A;  2HC9 A;  1QVF Z;  2OOX B;  4OC3 A;  1NUI A;  3CQZ I;  3PRT A;  4FUU A;  2V8I A;  2ABZ A;  5HVH A;  3HUV A;  3J80 b;  1PFT A;  4MHN A;  3H0G I;  3KIF A;  3NFZ A;  1K8A 2;  3RZD I;  1Y1W I;  3S17 I;  1QQ9 A;  2ZEG A;  3IJ3 A;  3Q87 A;  2EK9 A;  5LYF A;  5CM2 M;  1CP6 A;  1VQ9 1;  4NGQ A;  1QYP A;  3TE5 B;  3FF3 A;  3CD6 Z;  3D4U A;  2E2J I;  1VQ4 1;  3B3C A;  2RB7 A;  3FMC A;  1NSA A;  3IIB A;  3CCR Z;  3L2N A;  1LQL A;  1QF8 A;  3T8W A;  3TX8 A;  1VIX A;  3IWW A;  4ZY2 A;  4P4I A;  4X8I A;  4MMO A;  3BI1 A;  1XBU A;  4A3E I;  2GLF A;  3VMH A;  4DGL A;  1YJN 1;  1QVG Z;  7CPA A;  2OTJ Z;  2GRE A;  1TF9 A;  1S72 1;  2I3C A;  4WJB A;  1Z8L A;  1YHQ Z;  2YAD A;  2OTL Z;  1BAV A;  4NGN A;  3VAR A;  1VQM 1;  3CCS 1;  3HOV I;  4R6T A;  2O53 A;  3IX0 A;  4E30 A;  1VQ4 Z;  4UIB A;  5IP7 I;  3CPW Y;  2VUM I;  4MCP A;  1TWH I;  3H8G A;  3FVL A;  4PQA A;  4KSI A;  1Z2L A;  1VQP 1;  2JBK A;  5LRJ A;  3S9M A;  4LQG A;  4EWT A;  2JR6 A;  4P4D A;  2PJ6 A;  3PBE A;  1YI2 Z;  4Q7A A;  3WC6 A;  3CMA 1;  2AFZ A;  4MCS A;  4RV9 A;  1DL6 A;  2F8H A;  5K8N A;  1YJW Z;  1DTD A;  3FEE A;  1YIJ 1;  3CCQ 1;  1Z02 A;  1I6H I;  2HB6 A;  4CPA A;  1RNI A;  1VQO Z;  3CPA A;  1TKF A;  2AFW A;  2AFU A;  3FH4 A;  2ZEH A;  3QWU A;  1TWG I;  2IJZ A;  4MH4 A;  2PE3 A;  5JH9 A;  2W04 A;  2NSM A;  4NBF A;  4RVH A;  4OC1 A;  1LFW A;  1VQK Z;  2NVX I;  3S15 I;  1ZG7 A;  2F4M A;  1YJW 1;  3GTG I;  3S9L A;  1Y0Y A;  2DE5 A;  3PO3 I;  3D6W A;  3NH4 A;  2LFU A;  1Q7L A;  3FJU A;  2O4H A;  2ANP A;  3FED A;  3GTM S;  4NBH A;  3S1Q I;  4F8Z A;  2RPR A;  4A39 A;  3PO3 S;  4BXX I;  1KQS Z;  2PIY A;  3CCQ Z;  3CPW Z;  2XEJ A;  4MCR A;  3S16 I;  1GYT A;  2P3Y A;  3KIH A;  1QVF Y;  1K9M 2;  1I50 I;  3H8F A;  4P4B A;  4NH1 C;  4MRI A;  3DLJ A;  1YIT 1;  1R43 A;  3V7Z A;  4RUH A;  2DE7 A;  1Y1V S;  3D66 A;  3GLJ A;  2JNY A;  2R6M A;  1UWY A;  5K8O A;  3MZK B;  2PJ1 A;  3I55 Z;  1Y0R A;  1VQK 1;  1AMP A;  3T4N B;  5IB9 A;  3SJF A;  1M4L A;  4DYO A;  2BJO A;  1TKH A;  3BG1 B;  4PXC A;  1K73 1;  1W2B Y;  1X0T A;  2OTL 1;  1RO2 A;  2E9H A;  4QTU A;  1KD1 2;  1ZG9 A;  3VH9 A;  2Y0S A;  5A2Q f;  4IK2 A;  4FAI A;  3CCE Z;  2P28 A;  5FLX f;  2C6G A;  1YSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...