2Q4ZA

Ensemble refinement of the protein crystal structure of an aspartoacylase from rattus norvegicus
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
307
structure length
307
Chain Sequence
CVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILGDSGNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 89
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2q4zA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2q4zA01
2Q51A 2ZENA 2ZEPA 1BPMA 4O23A 2RB7A 3CT9A 1ELLP 4WWVA 3PBEA 2NSMA 1LAPA 3FEDA 4IAVA 1TKHA 1UWYA 1DE4C 3KASA 1CP6A 2ZEDA 4EMEA 3B3VA 1XBUA 3MRUA 1YSJA 4R6TA 4PXCA 5LYIA 2EWBA 5K8OA 4KSIA 3NH5A 3IC1A 5IB9A 3H8GA 4FBEA 1AYEA 4NGTA 2J9AA 3SJFA 1DTDA 4B6ZA 1ZG9A 2JBJA 5HVFA 2HC9A 4DJLA 4AXVA 3CDXA 2O53A 2JBKA 3D7FA 1ZG8A 1OBRA 1ZG7A 3B3TA 4X3RA 4MRIA 1HDQA 4A39A 3B35A 2AFXA 4RUHA 2AFWA 2PJ6A 4UEZA 3KQXA 4Q7AA 2PCUA 3I1UA 3FJUA 2AFZA 2POKA 1CP7A 1GYTA 4R8FA 7CPAA 3PB8X 4MMOA 3H8FA 1QQ9A 5I4MA 4PXDA 4NFRA 4UEFA 2GU2A 2C1CA 1KWMA 3B3CA 1NSAA 4YWYA 3NH4A 3PB4X 3FEEA 5JM6A 4MHPA 5HVHA 4EFDA 3NFZA 2AFUA 3KI9A 1YMEA 5D8NA 3VATA 2IJZA 1LFWA 4NGRA 2DEAA 2PJ3A 1BLLE 2PRQA 5LRKA 3PB6X 3FMCA 4MCQA 4W9YA 2ZEFA 4MXUA 4NGPA 4F8ZA 3LWUA 1R43A 1JQGA 3MN8A 4BD9A 4X2TA 3IWWA 1ZLIA 3BI1A 4OP4A 4F9VA 4OIDA 3K2KA 1TKFA 4FAIA 3SI1A 3PEIA 1F57A 3RAMA 5JH9A 3NA6A 1VHEA 3WC6A 3KR4A 3IEHA 3PB9X 5K8NA 4GM5A 1LAMA 3QNVA 2XEFA 2CF4A 1TF9A 4NJQA 4OC1A 3WABA 2PJ4A 3KL9A 4PQAA 2ZEOA 3ISZA 2BCOA 1AMPA 1F2PA 2HB6A 2ZEHA 4LQGA 2IQ6A 4F9UA 4ZYQA 4P4FA 2GLJA 4R76A 2PJCA 2PJ9A 2V8HA 3TC8A 2QYVA 1QMUA 2V77A 4P4DA 4MCPA 2XEIA 5HXDA 1FT7A 4P4EA 4OC0A 3ISXA 1VGYA 4P45A 4NGSA 1CBXA 1Q7LA 2PVWA 2BOAA 1VHOA 2G9DA 3GUXA 1CG2A 4JZ0A 3V38A 2C6CA 4EWTA 6CPAA 1Z2LA 4Z65A 4P4JA 1YW4A 2PJ5A 5ELYA 1LANA 3K9TA 3KGQA 4OKOA 2PJ0A 4PXBA 1XRYA 4MHZA 4UF4A 1Z5RA 4MHYA 4JYWA 1Y7EA 5CPAA 2PJAA 1ARMA 1XJOA 2AFSA 2ZEMA 1Y0RA 3WT4A 3KQZA 3IO1A 4P6YA 4TNUA 4CPAA 3PB7X 5D29A 2ZEEA 3GLJA 8CPAA 3KZWA 1TXRA 5F09A 1IGBA 1CX8A 2EK9A 4MCSA 3V7ZA 3WC7A 2PJ7A 4FUUA 3RZAA 4NGNA 2V8DA 5K8MA 1BAVA 5THWA 2QJ8A 3GB0A 1LCPA 3IJ3A 3L2NA 4MHNA 5J1QA 2PJBA 5LYLA 4P44A 3FX6A 3JRUA 4UIBA 2CTCA 5CBMA 4A94A 2CTBA 3PFOA 2ZOFA 1XMBA 2ZEGA 5LYFA 1EE3P 4ZI6A 3VARA 3DLJA 4NGQA 2ABZA 4ZX9A 4R7MA 3B3SA 3D66A 1HDUA 1F2OA 4ZX8A 2V8GA 4PXEA 2PE3A 2GLFA 1IY7A 4ZY1A 3PRTA 2I3CA 1YW6A 3D4UA 3KHXA 1TF8A 3NH8A 1H8LA 2IMOA 4G1PA 2F8HA 3CPXA 4OC5A 3T8WA 3TX8A 1ZLHA 4FWUA 3HUVA 2ZELA 4ONWA 4OC4A 2ANPA 4DYOA 2BO9A 2V8VA 3BI0A 3N5FA 3PBBA 3FF3A 1ELMP 2CIJA 3S9MA 5JGFA 4K3NA 2AFMA 1TKJA 4P4BA 4A37A 2VL1A 3D67A 2PJ1A 2PJ8A 1BPNA 4YU9A 2EK8A 3D7HA 1Z8LA 1XFOA 2GREA 1PCAA 2XEJA 3RBUA 4NGMA 1PYTB 2O4HA 2PJ2A 1HEEA 4NJRA 3VH9A 2PIYA 5K8PA 2FVGA 4P4IA 2OOTA 3FVLA 3S9LA 4WJBA 4DUKA 3S9NA 4OIWA 3SJXA 3SJGA 4MCRA 2C6PA 2OR4A 5LYDA 4OC3A 4UIAA 1R3NA 5HVGA 3BHXA 1VIXA 3CPAA 4UEEA 3HLPA 4P10A 3D68A 2WYRA 3SJEA 3SI2A 2AFOA 5LRGA 1M4LA 3IIBA 1YLOA 4TWEA 3B7IA 2Q43A 3IFEA 4IHMA 3PFEA 5DS0A 2JEWA 1ARLA 4X8IA 3LMSA 2C6GA 3B3WA 3KR5A 3D7DA 3DGVA 1CPXA 3D7GA 3H8EA 2RFHA 4PPZA 1CPSA 2ZOGA 2WZNA 3BXMA 2PVVA 5LRJA 4OMEA 4H2KA 3WC5A 4ZY2A 1LOKA 4ZY0A 2PIZA 3FH4A 3SI0A 4IK2A 2F7VA 3KHZA 2NYQA 3FECA 2QVPA 1Y0YA 1FNOA 2Q4ZA 1RTQA 3B2YA 2XEGA 4OC2A 4A38A
chains in the Genus database with same CATH superfamily
4KOUA 3JUWA 5A2Qf 2ZW6A 4WWVA 3PBEA 4FD5A 2NSMA 1GHEA 1LAPA 3J81b 1DE4C 1WWZA 3I561 4CAXA 4A3II 1Q7Y1 5AG5A 4R6TA 1YUAA 4M85A 4II9A 2J9AA 3OW2Z 4E32A 1DTDA 2JIMA 1ZG9A 2RHBA 1KUYA 1IB1E 4QVTA 2AE6A 1ZG7A 2DE6A 4F6AA 4X3RA 4MRIA 1MJBA 4Q7AA 2HV2A 2VPXA 5EC4A 3VMGA 2Z0ZA 4R3LA 3CMAZ 3N7ZA 3QWUA 1M1K1 4NB8A 3OWCA 2OU2A 3CCJZ 1YIJZ 3PO3S 1KRLA 1Y1VS 3NFZA 3KI9A 1YMEA 4BBRI 1M4DA 5ISVA 4NGRA 2DEAA 3JTKA 1BLLE 3IU1A 1S721 4MCQA 3ZZIA 4BINA 4MXUA 1WW9A 4Q38A 4E2AA 2HUZA 4LQ6A 4A3JI 5HMNA 1ZLIA 3GKRA 2PDOA 3E0KA 4FAIA 3PEIA 2VUMI 4X5KA 4HNWB 4ORFA 2RIQA 2B4BA 3GCFA 1TWFI 3RO0A 1S7NA 3TE4A 2H5MA 4GM5A 2VF1A 3QNVA 3LODA 4QUSA 5EMIA 4NJQA 1JWQA 1RXTA 1RO4A 4NH1C 2G2KA 1TWGI 3ISZA 2BCOA 1AMPA 2HB6A 3UY5A 2IQ6A 3H4QA 1X3WA 3CD61 2FT0A 3F8KA 2OZGA 2GLJA 2V8HA 4RN7A 2JIQA 1VQMZ 3D2LA 1WIIA 1QSNA 4CGMA 1KC82 4P4DA 3P5JB 3IGRA 5J8CA 2R7HA 3ISXA 3G6E1 4P45A 3CQZI 4NGSA 3CCJ1 3GTOI 1PU9A 1Q16A 1Q7LA 2CNMA 3CC7Z 5CNPA 1Y1WI 3V38A 4EWTA 2HF1A 1YI21 1R57A 3K9TA 3KGQA 1V0CA 4OKOA 4HH4A 2J8RA 2E2HI 4X6AI 2DPSA 4Y49C 4A3GI 4JYWA 1M44A 1Y7EA 5E96A 2PJAA 1ARMA 1XJOA 1S60A 2KCWA 3DDDA 4OLLA 4CRYB 4TNUA 4CPAA 2E2JI 1NMTA 2IZ3A 8CPAA 4Y7NI 2BJOA 2EK9A 3D9XA 2VUGA 4S1TA 1QVGZ 2QRDB 3WC7A 3FB3A 2R93I 4NBAA 4NGNA 3G3SA 2V8DA 2JA6I 5K8MA 1BAVA 2QJ8A 1LCPA 3IJ3A 4MHNA 5DWNA 2YADA 4XNHC 2QLVB 3CCMZ 3R1KA 4NF1A 4B13A 1R9TI 2CTCA 1Q862 1I6HI 5CBMA 3G4SZ 2DE7A 4CRZB 4MFLA 3GTPI 1M4IA 2Q04A 4KSAA 2ZEGA 4H6UA 5G21A 5LYFA 1L1OC 3PO2I 4ZI6A 2VXKA 4NGQA 3CC41 4A93I 4ZX9A 4R7MA 2Z3NA 3TTHA 5D1OA 4MH4A 1F2OA 4PXEA 2G3AA 4UCMA 1CM0A 4RS2A 4B5OA 1YGHA 5T67A 1Z8XA 4AVAA 2VZZA 4HNXB 5BWAB 2IMOA 4G1PA 2VPWA 4OC5A 3TE5B 3T8WA 4NBHA 3TX8A 1ZLHA 1M901 3NE8A 2ANPA 3G71Z 2BO9A 1XEBA 3PBBA 1M4GA 2CIJA 2I00A 2CY2A 4P4BA 4PK3A 4R9MA 3R9EA 3EY5A 1BPNA 4M3SA 1Z8LA 3GTGI 1Y9KA 1K9M2 5AG4A 3TO9A 1S3ZA 2AYDA 5K8PA 2VBQA 3TDHB 3DR6A 1TIQA 4PSXA 3T9YA 1S7KA 2HQYA 4KUAA 4UEEA 1L0CA 3C26A 4JWPA 4NBFA 4P10A 4E8OA 4E31A 3CXSA 1TFIA 3RNZA 3S1MI 1YREA 1YLOA 3G4S1 4MFPA 3CCVZ 4MD7A 3PFEA 2LFUA 1X12A 1WJ2A 2QEXZ 3RYOA 5IT9f 1I3QI 4PK2A 5CM2M 2C6GA 1K8A2 4MONA 2IV2X 3KIHA 1K83I 3R95A 1YJ91 3I4MI 2WZNA 5LRJA 3MZLB 4H2KA 3WC5A 2R98A 4C2ZA 3FH4A 3CMEZ 1ZH1A 4KOVA 2F7VA 2ODFA 2REFA 1IYLA 1KC81 4A3MI 2B4DA 3IX0A 4CGNA 2P28A 4JD6A 2GTHA 3B2YA 1VQ51 5FLMI 4DK1A 1VQ71 2RB7A 3CT9A 1YHQ1 2RBLA 3M4OI 2ZXVA 4B10A 4IAVA 1TKHA 4H89A 4E33A 3SHPA 1VQPZ 2JS4A 2EWBA 1YJW1 3EXNA 4A2ZA 4MFZA 3CPWY 1FY7A 4NSQA 3SJFA 4B6ZA 2B5GA 2JBJA 5HVFA 3QAHA 2OTLZ 1JJ2Y 3CDXA 2O53A 2E7ZA 1HDQA 1IYKA 2IL4A 1B87A 3B35A 2AFXA 4RUHA 2AFWA 2PJ6A 4UEZA 3KQXA 4CS0B 3I1UA 1K732 1ON0A 5KTAA 2WPXA 4R8FA 3PB8X 5C4XI 1S7FA 3H8FA 4KUBA 4NFRA 2QEX1 4R87A 4E0AA 2BEIA 1Q861 3JAMf 1LQLA 2R8VA 1YJNZ 2OOYB 4ZBGA 3F5BA 1LFWA 3K9UA 2PJ3A 1VQ9Z 2PRQA 3EERA 4W9YA 4NGPA 3GTMS 3CXQA 4RVDA 3EO4A 3LWUA 3KKWA 4B12A 2ZW7A 1R43A 4X2TA 3IWWA 3BI1A 4F9VA 3J81f 2R1IA 4UWJA 1F57A 3CCRZ 3BJ7A 3RAMA 4C7IA 1S5KA 2JUBA 5JH9A 4MJ8A 3NA6A 3A9LA 4RI1A 4RVHA 2Q7BA 3T90A 3PB9X 4XPDB 1W2BZ 3W6XA 2PRBA 1X10A 2CNTA 1IOFA 2CF4A 3CCQZ 4OC1A 1Y7RA 2AKLA 3P2HA 4CAVA 2OTL1 2V45A 3D8PA 4CAWA 1U6MA 1VQNZ 2Q4VA 1Z8TA 1K9M1 4P4FA 4R76A 2PJ9A 1MJAA 4ONUA 2QYVA 1S7LA 4NBEA 4UBRA 4DGLA 4QC6A 4OC0A 4QB9A 1VQL1 1VGYA 2EUIA 4JXRA 4QBJA 4E2WA 1CBXA 1USPA 3CXCY 3FQMA 2HU9A 1NJI2 2BOAA 2G9DA 3GUXA 4JZ0A 1QVFY 1M902 6CPAA 4HGZA 2QMLA 4Z65A 4P4JA 5G20A 2PJ5A 3CCU1 5A2Qb 2W04A 1VQKZ 2QREB 2VPYA 1K8A1 3EFAA 4UF4A 3I07A 4KVXA 5CPAA 3J80b 3GTJI 2AFSA 3DNSA 1Y0RA 2X7BA 4P6YA 5H84A 2FL4A 4A3CI 4FD6A 2JMOA 3PB7X 4C68A 3H3VJ 3TOAA 1IGBA 4L89A 4E2XA 1PFTA 4QTTA 3V7ZA 1KQSY 1YUKA 2NVQI 2JA8I 5FVJA 2VQYA 4FUUA 4U5YA 4UFVA 3RZAA 3CCQ1 3SXNA 1ZB9A 3F3PC 1NE9A 2VI7A 5LYLA 3K7AI 4KLVA 2BSWA 4NBCA 4YFJA 1ZO0A 2CTBA 3PFOA 1VQN1 2ZOFA 5LL6f 2AJ6A 3D2PA 3I55Z 1RLYA 4KOTA 1N71A 3VARA 2JR6A 3DLJA 3IF8A 1XOVA 4BBSI 3TFYA 1QYPA 3B3SA 1QSTA 3IFUA 1BOBA 1IY7A 4ZY1A 5JPHA 3FKII 3D4UA 3I3GA 3KHXA 1X3ZA 1K731 2F8HA 4IF5A 3DR8A 3CMA1 2ZELA 4ONWA 3S6GA 2V8VA 2F4OA 3N5FA 2Q4YA 2B63I 5JGFA 1VQK1 1VLAA 2E2II 1YIJ1 4NXYA 3CCSZ 4MBUA 1Y9WA 2QR1B 3FYNA 3Q87A 2PJ1A 4YU9A 3U50C 2EK8A 3S17I 4J3GA 3CCEZ 1PCAA 5GCNA 1SQHA 3GYAA 1RNIA 4HKFA 4NGMA 3FIXA 2O4HA 2PJ2A 1HEEA 4UA3A 3BG0B 2Y0SA 3SXOA 3S9LA 3SJXA 1CJWA 3SJGA 3S16I 4OC3A 1R3NA 5IV0A 2Y0MA 3NDJA 1IIDA 3SJEA 2ARHA 2AFOA 3CCLZ 3H5ZA 4KOWA 1QSOA 1Q2YA 2WSAA 5C88A 3LMSA 3S6KA 2QRCB 4BXXI 3B3WA 3KR5A 4AB7A 2YNDA 2JA7I 3D7DA 3DGVA 2RC4A 3D7GA 3H8EA 3TOBA 3PGPA 4PPZA 2ZOGA 1YLEA 1Q822 1WK4A 4MFJA 3OW2Y 4DQYB 1VQM1 1LOKA 4ZY0A 3S14I 3SI0A 4IK2A 3HOXI 3KHZA 1RQFA 2I79A 4HNYB 2QVPA 2JDCA 4MHDA 4XPLA 2PSWA 2QECA 1YX0A 5C3EI 3HOYI 1RTQA 3D6WA 2NAPA 4A38A 2REEA 2ZEPA 4O23A 3B8GA 4PSWA 5FLXb 1NJI1 5KTDA 2VPZA 3CC71 3VB9A 4CGLA 1CP6A 2ZEDA 4EMEA 3BG1B 3MRUA 1YSJA 5K8OA 3IC1A 1RO2A 4FBEA 4NEXA 4KS9A 2M48A 2HC9A 4DJLA 2DF5A 3NDIA 4BY1I 1ZG8A 4F0XA 5J8FA 1OBRA 5EBVA 2P3YA 1I50I 2B58A 2QKDA 1Q2CA 4A39A 3CC2Z 2W03A 2NVTI 1Q2DA 3IWGA 2Q0YA 4B5PB 5F47A 2POKA 4UFXA 1P4NA 1CP7A 2F5IA 3M3YI 4GS4A 1GYTA 2JDDA 3HOVI 4MMOA 3S6FA 1SFOI 2C1CA 5T64A 2FIAA 3B3CA 4A3DI 4YWYA 2O28A 3V8IA 4A95A 3CCM1 1Z4RA 5AGEA 1VQ8Z 3FEEA 4MD8A 5HVHA 3ZJ0A 4U9YA 1LRZA 4I49A 5D8NA 4NOZA 2M6NA 1MK4A 2RT9A 3FMCA 5C44I 2VZYA 1JQGA 3MN8A 1MJ9A 4R57A 4BD9A 5F49A 1B6BA 3HOWI 1AA6A 3K2KA 1TKFA 2QIRA 4JXQA 2C27A 4CYQA 3G8WA 3S6HA 4F0YA 1VQ6Z 4RVFA 3FNCA 1AUGA 1VHEA 3WC6A 2J8MA 1QF8A 5K8NA 1LAMA 1Z02A 2NVYI 3G711 1M1DA 4OAEA 1TF9A 4A30A 3WABA 3JVNA 4A32A 3T4NB 3KL9A 2Z11A 3GKQA 3I9SA 2BUEA 4LQGA 2ZW4A 5IT9b 3RZDI 1PUAA 5F46A 2GANA 4F9UA 3MGDA 2PJCA 4AVCA 1KUXA 4B11A 1QMUA 2WB1A 3F3FC 1NSLA 2V77A 4MCPA 4JJXA 2YNCA 3LACA 2XEIA 5HXDA 2OTJZ 3TO6A 2E9HA 4KOSA 1QVGY 1VHOA 2BL1A 4OADA 5H86A 3CCV1 2V8JA 3I56Z 2GIVA 2GTIA 1YW4A 4IUSA 5ELYA 1LANA 2K3RA 2R92I 2PJ0A 4CAFA 1XIXA 2WPWA 3H0GI 4MHYA 2JIOA 2ZEMA 3WT4A 1Q821 4Y49B 5D29A 2ZEEA 3GLJA 4H6ZA 4MY3A 3GTKI 4C2YA 3CME1 5T6BA 2FSRA 1P0HA 2Z10A 2PJ7A 1KD12 1I1DA 2YGWA 3IWEA 3QAYA 1NP6A 2PK7A 5THWA 4E2YA 3PO3I 3GB0A 4A3KI 1QSRA 5G1ZA 1Y1VI 4A3LI 2PJBA 4P44A 4UIBA 2D4OA 3JRUA 3HOUI 1Z8WA 4A94A 1VQP1 2CNSA 1XMBA 4XNHB 4CYPA 2Q7SA 1USPB 1EE3P 2F4MA 4RV9A 2FIWA 2KI7B 2VEZA 2ABZA 3TO7A 1HDUA 3DSBA 2R7ZI 4ZX8A 2V8GA 3NE7A 1Z03A 2GLFA 3PZJA 2OTJ1 1YW6A 2DE5A 1H8LA 3S2DI 3LUSA 4M6IA 2EBJA 3HUVA 3J80f 2PR8A 4DYOA 1FDOA 1VQOZ 3S1NI 3FF3A 4YGOA 1ELMP 4HPSA 4KSFA 1YVKA 1TKJA 1YR0A 2JIPA 1J4JA 5JQ4A 2VL1A 1YJN1 4KORA 2A4NA 3D7HA 1XFOA 1P9NA 2GREA 2XEJA 3CD6Z 1VQ91 1UFHA 1Z4EA 2FXFA 3FXTA 1PYTB 4A3BI 5IP7I 3VH9A 3HOZI 5C4JI 2FVGA 4E2ZA 4P4IA 4L8AA 4WJBA 4DUKA 4OIWA 5AG7A 2C6PA 3VWDA 5LYDA 5HVGA 3G6EZ 3CCR1 1XMTA 3BHXA 3CPAA 3SI2A 5I0CA 4KOXA 1M4LA 2R6MA 1IOIA 3BJ8A 3B7IA 4AVBA 3IFEA 2Q44A 2OH1A 2YNCC 3LD2A 1YI2Z 2JEWA 3S1QI 4X8IA 5G22A 1Y8CA 5IX3A 3I4NI 3GIUA 3P2FA 1S7MA 4XX2A 2EO8A 2PVVA 4UWIA 4OMEA 4LX9A 4ZY2A 1N2FA 5IB0A 1VHSA 4R3KA 1Y0YA 2PMZA 1FNOA 2OZHA 3KIFA 1VQO1 2V3VA 2XEGA 4OC2A 2Q51A 2ZENA 1BPMA 1ELLP 3VWEA 3FEDA 1TWCI 1UWYA 3KASA 3B3VA 1XBUA 4PXCA 5LYIA 4AG9A 3FBUA 3NH5A 4KSIA 5AG6A 5IB9A 3H8GA 4CGOA 1JWHC 1AYEA 4NGTA 3R96A 3CC4Z 4KZTA 4AXVA 2JBKA 3D7FA 4M6GA 3B3TA 4MY0A 4BY7I 2NMTA 2PCUA 2FS5A 3FJUA 2AFZA 4AYBA 1KD11 1Q811 3HKZA 7CPAA 1I21A 1N8R2 1QQ9A 5I4MA 1TWHI 4KVME 4PXDA 4UEFA 4BMHA 2GU2A 1KWMA 3CPWZ 1NSAA 2Z3PA 5D1OB 2P0WA 3NH4A 4YRHA 3R9FA 1ZB8A 3PB4X 2ZPAA 5JM6A 4A3EI 4KLWA 1JJ2Z 4MHPA 4CGPA 4EFDA 2PQ8A 5KTCA 1W2BY 3EEDA 2AFUA 4UCPA 3VATA 2IJZA 4CYNA 3I551 5A27A 5D1PA 4NBDA 5LRKA 4CYOA 3PB6X 2K5RA 2LEXA 2ZEFA 4F8ZA 3PP9A 2J6AA 5FLXf 3R9GA 3CZXA 1XE4A 2JNYA 4OP4A 4OIDA 3S2HI 3SI1A 4XPDC 3WR7A 1Z01A 4NBGA 3S15I 2GFQA 3D2MA 3KR4A 3IEHA 2DXQA 2P6FA 5HH1A 2B3UA 2XEFA 5AN9F 4A31A 2Z3MA 3CCS1 2PJ4A 4PQAA 3GTLI 2ZEOA 4RS4A 1F2PA 3IU2A 3MONA 2ZEHA 1YJ9Z 3CCE1 3J7A4 4KVOE 3TCVA 4ZYQA 2PR1A 2NVXI 4K30A 4U9ZA 2OZKA 4FD7A 1WCMI 3TC8A 1RO0A 2GE3A 1FT7A 4P4EA 1QSMA 1IU8A 1YITZ 1VQ5Z 3TT2A 3CCL1 2V8IA 1SIWA 1VQ7Z 4C2XA 2JLMA 1YHQZ 2PVWA 1CG2A 1A2ZA 2C6CA 2DPTA 2IZ4A 1Z2LA 4E30A 2OZUA 3F0AA 1KZFA 1Q7Y2 1NUIA 4PV6A 1I12A 4MFKA 1YJWZ 2YNEA 4PXBA 3VTNA 1XRYA 4MHZA 1Z5RA 2B4DB 4AG7A 3D3SA 3ESWA 4NBBA 2JA5I 2D4PA 2P6GA 1YQEA 2RPRA 4M6HA 3KQZA 3IO1A 4LUAA 3KZWA 4Q36A 1TXRA 4CL1A 4EWCA 5F09A 3FQQA 3CXCZ 1VQ4Z 1CX8A 4UCNA 4MCSA 1QVFZ 2H85A 4NB9A 1X0TA 3IR7A 2B5GB 4ZGYB 2B3VA 1QXFA 1M1K2 3L2NA 5J1QA 3FX6A 4HGYA 4B5PA 2Z3KA 2J8NA 1BO4A 2K5TA 3W91A 3GTMI 1OZPA 4NCZA 2FCKA 1KUVA 4A3FI 2OOXB 5F48A 1KQSZ 3D66A 2Z3OA 2LIYA 3VMIA 2PE3A 3CXPA 3PRTA 1YIT1 3CC21 2I3CA 2EVNA 1ML8A 3NH8A 1TF8A 2Z3LA 2ZAEB 3CPXA 2FE7A 3EC4A 5DWMA 4FWUA 3BLNA 1N8R1 4OC4A 4MI4A 2QA4Z 1WZNA 4CAEA 3BI0A 5A28A 4MFQA 3S9MA 4K3NA 4DNCA 2AFMA 1VQ81 3S1RI 4A37A 3FRMA 3GTQI 4GXHA 4JLYA 3MZKB 2JIRA 3D67A 2PJ8A 1YVOA 2CXAA 1YK3A 2G0BA 3VMHA 3RBUA 3GY9A 5IP9I 1VKCA 2V8KA 4NJRA 1VQ41 4QTUA 2PIYA 3RZOI 2G3TA 2OOTA 3FVLA 1K4JA 4B14A 3S9NA 4MCRA 2ZW5A 1DL6A 1RO5A 1Z9UA 2OR4A 4UIAA 1VQLZ 1VIXA 3HLPA 4XPKA 3D68A 2WYRA 1VQ61 5LRGA 1XF8A 2ATRA 3IIBA 4TWEA 2WUUA 2Q43A 4FD4A 4IHMA 1Q812 4EVYA 4Y52I 5DS0A 1ARLA 4MD9A 3CCUZ 4BBHA 2P6EA 1CPXA 2PC1A 4A33A 2RFHA 3W6SA 4RVGA 1CPSA 3BXMA 2PM9A 2OB0A 4KOYA 3QB8A 2YU9I 1IICA 5C82A 1S72Z 2WAQA 4C7HA 2EGTA 4UFWA 2PIZA 3JAMb 1TWAI 2NYQA 3FECA 2KPIA 2JEVA 1FDIA 2QA41 2Q4ZA
chains in the Genus database with same CATH topology
2Q51A 4DK1A 2ZENA 5A2Qf 2ZEPA 1BPMA 1VQ71 2RB7A 4O23A 3CT9A 5FLXb 1YHQ1 1ELLP 4WWVA 1NJI1 3CC71 3PBEA 2NSMA 2RBLA 3VB9A 3M4OI 1LAPA 3FEDA 4IAVA 1TWCI 3J81b 1TKHA 1DE4C 1UWYA 3KASA 1CP6A 2ZEDA 3I561 4EMEA 3B3VA 3BG1B 4A3II 4E33A 1XBUA 3MRUA 1VQPZ 1Q7Y1 1YSJA 2JS4A 4R6TA 4PXCA 5LYIA 1YUAA 2EWBA 5K8OA 1YJW1 4KSIA 3NH5A 3IC1A 1RO2A 5IB9A 3CPWY 3H8GA 4FBEA 1JWHC 1AYEA 4NGTA 2J9AA 3SJFA 3OW2Z 4E32A 1DTDA 4B6ZA 3CC4Z 2M48A 1ZG9A 2JBJA 5HVFA 2RHBA 2OTLZ 2HC9A 1JJ2Y 4AXVA 3CDXA 4DJLA 2O53A 2JBKA 3NDIA 4BY1I 3D7FA 1ZG8A 1OBRA 1ZG7A 3B3TA 2DE6A 2P3YA 1I50I 4X3RA 4MRIA 1HDQA 2QKDA 4A39A 3CC2Z 3B35A 2W03A 2NVTI 2AFXA 4RUHA 4BY7I 2AFWA 2PJ6A 4UEZA 3KQXA 4Q7AA 2PCUA 3I1UA 1K732 3FJUA 3VMGA 2AFZA 4AYBA 2POKA 1CP7A 3M3YI 1GYTA 1KD11 1Q811 3HKZA 4R8FA 7CPAA 3CMAZ 3HOVI 3PB8X 1N8R2 4MMOA 5C4XI 3H8FA 1QQ9A 1SFOI 1TWHI 5I4MA 4PXDA 4NFRA 2QEX1 4UEFA 2GU2A 2C1CA 3QWUA 5T64A 1KWMA 3CPWZ 3B3CA 1M1K1 4NB8A 4A3DI 1NSAA 4YWYA 3CCJZ 5D1OB 3NH4A 3CCM1 1ZB8A 1YIJZ 3PB4X 1VQ8Z 1Q861 3FEEA 4A3EI 4MHPA 1JJ2Z 5JM6A 3PO3S 4MD8A 3JAMf 1LQLA 5HVHA 4EFDA 1YJNZ 1KRLA 1Y1VS 2OOYB 1W2BY 3EEDA 3NFZA 2AFUA 1YMEA 3KI9A 4NOZA 4BBRI 2IJZA 5D8NA 3VATA 2M6NA 1LFWA 3I551 4NGRA 5D1PA 2DEAA 2PJ3A 1BLLE 4NBDA 1VQ9Z 3EERA 2PRQA 2RT9A 5LRKA 3PB6X 3FMCA 5C44I 1S721 2K5RA 4MCQA 4W9YA 2ZEFA 4MXUA 4NGPA 3GTMS 1WW9A 4F8ZA 4RVDA 2J6AA 3LWUA 5FLXf 4A3JI 1R43A 1JQGA 3MN8A 4BD9A 4X2TA 3IWWA 1ZLIA 3BI1A 2JNYA 4OP4A 3HOWI 3J81f 4F9VA 4OIDA 3K2KA 1TKFA 4FAIA 3S2HI 3SI1A 3PEIA 1F57A 3CCRZ 2VUMI 3RAMA 1VQ6Z 2JUBA 4RVFA 1Z01A 5JH9A 2RIQA 4NBGA 3NA6A 3S15I 1VHEA 3WC6A 3GCFA 3KR4A 1TWFI 1QF8A 4RVHA 3IEHA 3PB9X 5K8NA 4GM5A 2VF1A 1LAMA 3QNVA 1Z02A 2NVYI 3G711 1W2BZ 2XEFA 2CF4A 3CCQZ 5AN9F 1TF9A 4NJQA 4OC1A 3WABA 2AKLA 1RO4A 4NH1C 3T4NB 2G2KA 3CCS1 2OTL1 2PJ4A 3KL9A 4PQAA 1TWGI 3GTLI 2ZEOA 4RS4A 3ISZA 3GKQA 2BCOA 1AMPA 1F2PA 3MONA 2HB6A 2ZEHA 1YJ9Z 1VQNZ 4LQGA 2IQ6A 5IT9b 3CCE1 1X3WA 3RZDI 3CD61 1K9M1 3J7A4 4F9UA 3V7ZA 4ZYQA 4P4FA 2GLJA 2NVXI 4R76A 2PJCA 2PJ9A 2V8HA 1VQMZ 2OZKA 1WIIA 1WCMI 3TC8A 2QYVA 1QMUA 2WB1A 3F3FC 1KC82 2V77A 4P4DA 3P5JB 4MCPA 4NBEA 4DGLA 1RO0A 2XEIA 5HXDA 1FT7A 4P4EA 4OC0A 3ISXA 1VQL1 1YITZ 1VGYA 3G6E1 2OTJZ 4P45A 3CQZI 1VQ5Z 4NGSA 2E9HA 3CCJ1 3GTOI 3CCL1 2V8IA 4E2WA 1CBXA 1USPA 3CXCY 1VQ7Z 3FQMA 1Q7LA 1YHQZ 2PVWA 1QVGY 2HU9A 3CC7Z 1NJI2 1VHOA 2BOAA 1CG2A 2G9DA 1QVFY 3GUXA 1Y1WI 4JZ0A 3V38A 2C6CA 1M902 4EWTA 6CPAA 2IZ4A 3CCV1 1Z2LA 2V8JA 4E30A 2HF1A 4HGZA 3I56Z 4Z65A 4P4JA 2GTIA 1YW4A 1Q7Y2 1NUIA 1YI21 2PJ5A 5ELYA 1LANA 1YJWZ 2K3RA 3K9TA 3CCU1 3KGQA 4OKOA 5A2Qb 2R92I 4HH4A 2PJ0A 2W04A 4PXBA 3VTNA 1VQKZ 2QREB 1K8A1 2E2HI 1XRYA 4X6AI 4MHZA 4UF4A 1Z5RA 3H0GI 4A3GI 3I07A 4MHYA 4JYWA 3ESWA 4NBBA 2JA5I 1Y7EA 5CPAA 3J80b 2PJAA 3GTJI 1ARMA 1XJOA 2AFSA 2ZEMA 2RPRA 1Y0RA 3WT4A 3KQZA 3IO1A 4P6YA 1Q821 4A3CI 4TNUA 2JMOA 4CPAA 3PB7X 5D29A 2E2JI 2ZEEA 2IZ3A 3GLJA 8CPAA 3KZWA 4Y7NI 3GTKI 1TXRA 2BJOA 4CL1A 4EWCA 3H3VJ 5F09A 3FQQA 3CME1 3CXCZ 1IGBA 1VQ4Z 1CX8A 4E2XA 2EK9A 1PFTA 2VUGA 3D9XA 4S1TA 4QTTA 2QRDB 1YUKA 1QVGZ 1KQSY 5T6BA 2JA8I 2NVQI 3WC7A 1QVFZ 2H85A 2PJ7A 4FUUA 4NB9A 1X0TA 1KD12 2R93I 3RZAA 4NBAA 4NGNA 2V8DA 2JA6I 5K8MA 3CCQ1 1BAVA 1NP6A 2PK7A 2QJ8A 5THWA 4E2YA 3PO3I 3GB0A 1ZB9A 4A3KI 1LCPA 3IJ3A 3F3PC 1M1K2 3L2NA 4MHNA 2YADA 5J1QA 1Y1VI 4A3LI 2PJBA 2QLVB 3CCMZ 4P44A 5LYLA 3FX6A 4HGYA 3JRUA 4UIBA 1R9TI 2CTCA 3K7AI 1Q862 1I6HI 5CBMA 3HOUI 3G4SZ 4NBCA 2DE7A 4A94A 2CTBA 3PFOA 1VQN1 1VQP1 3GTPI 2ZOFA 5LL6f 1XMBA 3GTMI 2ZEGA 5LYFA 1L1OC 3I55Z 1RLYA 3PO2I 1USPB 1EE3P 2F4MA 4ZI6A 4RV9A 3VARA 2JR6A 2KI7B 3DLJA 3IF8A 4NGQA 3CC41 4BBSI 4A3FI 2OOXB 4A93I 2ABZA 4ZX9A 4R7MA 1QYPA 3B3SA 1KQSZ 3D66A 5D1OA 1HDUA 3IFUA 4MH4A 2R7ZI 1F2OA 4ZX8A 2LIYA 3VMIA 2V8GA 4PXEA 2PE3A 1Z03A 2GLFA 1IY7A 4ZY1A 3PRTA 1YIT1 5T67A 3CC21 2OTJ1 2I3CA 1YW6A 3FKII 3D4UA 3KHXA 1ML8A 2DE5A 3NH8A 1TF8A 1X3ZA 1K731 1H8LA 3S2DI 2IMOA 4G1PA 2ZAEB 2F8HA 3CPXA 4OC5A 3LUSA 3TE5B 3T8WA 4NBHA 3TX8A 1ZLHA 1M901 4FWUA 3HUVA 3CMA1 2ZELA 4ONWA 1N8R1 4OC4A 3J80f 2ANPA 3G71Z 4DYOA 2QA4Z 2BO9A 2V8VA 2F4OA 3BI0A 3N5FA 3S1NI 1VQOZ 3PBBA 3FF3A 1ELMP 2CIJA 2B63I 3S9MA 5JGFA 1VQK1 1VLAA 2E2II 4K3NA 2AFMA 1TKJA 1YIJ1 4P4BA 1VQ81 3S1RI 4A37A 3CCSZ 3GTQI 2QR1B 2VL1A 3Q87A 3MZKB 1YJN1 3D67A 2PJ1A 2PJ8A 1BPNA 4YU9A 3U50C 2EK8A 3S17I 3D7HA 1Z8LA 1XFOA 1P9NA 2GREA 3VMHA 3CCEZ 1PCAA 2XEJA 3RBUA 5IP9I 3CD6Z 3GTGI 1VQ91 1RNIA 1K9M2 4NGMA 1PYTB 2O4HA 4A3BI 5IP7I 2PJ2A 2V8KA 1HEEA 4NJRA 3BG0B 2Y0SA 1VQ41 3VH9A 4QTUA 3HOZI 2PIYA 5C4JI 2FVGA 5K8PA 3RZOI 4E2ZA 4P4IA 2OOTA 3FVLA 3S9LA 4WJBA 4DUKA 3S9NA 4OIWA 3SJXA 3TDHB 3SJGA 4MCRA 1DL6A 2C6PA 3S16I 2OR4A 5LYDA 4OC3A 4UIAA 1R3NA 1VQLZ 5HVGA 3NDJA 3G6EZ 3CCR1 1VIXA 3BHXA 3CPAA 4UEEA 3HLPA 4P10A 3D68A 2WYRA 4NBFA 3SJEA 1VQ61 3SI2A 4E31A 2AFOA 3CCLZ 5LRGA 1TFIA 3S1MI 1M4LA 2R6MA 3IIBA 1YLOA 3G4S1 4TWEA 3B7IA 2Q43A 3IFEA 4IHMA 3CCVZ 1Q812 4MD7A 3PFEA 2LFUA 4Y52I 2QEXZ 5DS0A 1YI2Z 2JEWA 1ARLA 4MD9A 5IT9f 3S1QI 3CCUZ 4X8IA 1I3QI 3LMSA 2QRCB 5CM2M 2C6GA 4BXXI 1K8A2 4MONA 3B3WA 3KR5A 3KIHA 1K83I 3I4NI 2JA7I 3D7DA 3DGVA 1S7MA 1CPXA 4XX2A 3D7GA 1YJ91 3H8EA 2RFHA 4RVGA 4MCSA 4PPZA 1CPSA 2ZOGA 3I4MI 2WZNA 3BXMA 2PVVA 2PM9A 1Q822 5LRJA 3MZLB 2YU9I 4OMEA 1S72Z 4H2KA 3OW2Y 4DQYB 4ZY2A 2WAQA 1VQM1 1LOKA 3WC5A 2EGTA 4ZY0A 2PIZA 3CMEZ 3FH4A 1ZH1A 3JAMb 3S14I 3SI0A 4IK2A 3HOXI 4OC2A 2F7VA 1RQFA 1N2FA 3KHZA 1TWAI 2NYQA 3FECA 1KC81 2KPIA 2QVPA 4A3MI 3IX0A 2QA41 2P28A 2PMZA 1FNOA 1Y0YA 5C3EI 2GTHA 2Q4ZA 3HOYI 1RTQA 3KIFA 1VQO1 3D6WA 3B2YA 1VQ51 2XEGA 5FLMI 4A38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q51 A;  2ZEN A;  2ZEP A;  1BPM A;  4O23 A;  2RB7 A;  3CT9 A;  1ELL P;  4WWV A;  3PBE A;  2NSM A;  1LAP A;  3FED A;  4IAV A;  1TKH A;  1UWY A;  1DE4 C;  3KAS A;  1CP6 A;  2ZED A;  4EME A;  3B3V A;  1XBU A;  3MRU A;  1YSJ A;  4R6T A;  4PXC A;  5LYI A;  2EWB A;  5K8O A;  4KSI A;  3NH5 A;  3IC1 A;  5IB9 A;  3H8G A;  4FBE A;  1AYE A;  4NGT A;  2J9A A;  3SJF A;  1DTD A;  4B6Z A;  1ZG9 A;  2JBJ A;  5HVF A;  2HC9 A;  4DJL A;  4AXV A;  3CDX A;  2O53 A;  2JBK A;  3D7F A;  1ZG8 A;  1OBR A;  1ZG7 A;  3B3T A;  4X3R A;  4MRI A;  1HDQ A;  4A39 A;  3B35 A;  2AFX A;  4RUH A;  2AFW A;  2PJ6 A;  4UEZ A;  3KQX A;  4Q7A A;  2PCU A;  3I1U A;  3FJU A;  2AFZ A;  2POK A;  1CP7 A;  1GYT A;  4R8F A;  7CPA A;  3PB8 X;  4MMO A;  3H8F A;  1QQ9 A;  5I4M A;  4PXD A;  4NFR A;  4UEF A;  2GU2 A;  2C1C A;  1KWM A;  3B3C A;  1NSA A;  4YWY A;  3NH4 A;  3PB4 X;  3FEE A;  5JM6 A;  4MHP A;  5HVH A;  4EFD A;  3NFZ A;  2AFU A;  3KI9 A;  1YME A;  5D8N A;  3VAT A;  2IJZ A;  1LFW A;  4NGR A;  2DEA A;  2PJ3 A;  1BLL E;  2PRQ A;  5LRK A;  3PB6 X;  3FMC A;  4MCQ A;  4W9Y A;  2ZEF A;  4MXU A;  4NGP A;  4F8Z A;  3LWU A;  1R43 A;  1JQG A;  3MN8 A;  4BD9 A;  4X2T A;  3IWW A;  1ZLI A;  3BI1 A;  4OP4 A;  4F9V A;  4OID A;  3K2K A;  1TKF A;  4FAI A;  3SI1 A;  3PEI A;  1F57 A;  3RAM A;  5JH9 A;  3NA6 A;  1VHE A;  3WC6 A;  3KR4 A;  3IEH A;  3PB9 X;  5K8N A;  4GM5 A;  1LAM A;  3QNV A;  2XEF A;  2CF4 A;  1TF9 A;  4NJQ A;  4OC1 A;  3WAB A;  2PJ4 A;  3KL9 A;  4PQA A;  2ZEO A;  3ISZ A;  2BCO A;  1AMP A;  1F2P A;  2HB6 A;  2ZEH A;  4LQG A;  2IQ6 A;  4F9U A;  4ZYQ A;  4P4F A;  2GLJ A;  4R76 A;  2PJC A;  2PJ9 A;  2V8H A;  3TC8 A;  2QYV A;  1QMU A;  2V77 A;  4P4D A;  4MCP A;  2XEI A;  5HXD A;  1FT7 A;  4P4E A;  4OC0 A;  3ISX A;  1VGY A;  4P45 A;  4NGS A;  1CBX A;  1Q7L A;  2PVW A;  2BOA A;  1VHO A;  2G9D A;  3GUX A;  1CG2 A;  4JZ0 A;  3V38 A;  2C6C A;  4EWT A;  6CPA A;  1Z2L A;  4Z65 A;  4P4J A;  1YW4 A;  2PJ5 A;  5ELY A;  1LAN A;  3K9T A;  3KGQ A;  4OKO A;  2PJ0 A;  4PXB A;  1XRY A;  4MHZ A;  4UF4 A;  1Z5R A;  4MHY A;  4JYW A;  1Y7E A;  5CPA A;  2PJA A;  1ARM A;  1XJO A;  2AFS A;  2ZEM A;  1Y0R A;  3WT4 A;  3KQZ A;  3IO1 A;  4P6Y A;  4TNU A;  4CPA A;  3PB7 X;  5D29 A;  2ZEE A;  3GLJ A;  8CPA A;  3KZW A;  1TXR A;  5F09 A;  1IGB A;  1CX8 A;  2EK9 A;  4MCS A;  3V7Z A;  3WC7 A;  2PJ7 A;  4FUU A;  3RZA A;  4NGN A;  2V8D A;  5K8M A;  1BAV A;  5THW A;  2QJ8 A;  3GB0 A;  1LCP A;  3IJ3 A;  3L2N A;  4MHN A;  5J1Q A;  2PJB A;  5LYL A;  4P44 A;  3FX6 A;  3JRU A;  4UIB A;  2CTC A;  5CBM A;  4A94 A;  2CTB A;  3PFO A;  2ZOF A;  1XMB A;  2ZEG A;  5LYF A;  1EE3 P;  4ZI6 A;  3VAR A;  3DLJ A;  4NGQ A;  2ABZ A;  4ZX9 A;  4R7M A;  3B3S A;  3D66 A;  1HDU A;  1F2O A;  4ZX8 A;  2V8G A;  4PXE A;  2PE3 A;  2GLF A;  1IY7 A;  4ZY1 A;  3PRT A;  2I3C A;  1YW6 A;  3D4U A;  3KHX A;  1TF8 A;  3NH8 A;  1H8L A;  2IMO A;  4G1P A;  2F8H A;  3CPX A;  4OC5 A;  3T8W A;  3TX8 A;  1ZLH A;  4FWU A;  3HUV A;  2ZEL A;  4ONW A;  4OC4 A;  2ANP A;  4DYO A;  2BO9 A;  2V8V A;  3BI0 A;  3N5F A;  3PBB A;  3FF3 A;  1ELM P;  2CIJ A;  3S9M A;  5JGF A;  4K3N A;  2AFM A;  1TKJ A;  4P4B A;  4A37 A;  2VL1 A;  3D67 A;  2PJ1 A;  2PJ8 A;  1BPN A;  4YU9 A;  2EK8 A;  3D7H A;  1Z8L A;  1XFO A;  2GRE A;  1PCA A;  2XEJ A;  3RBU A;  4NGM A;  1PYT B;  2O4H A;  2PJ2 A;  1HEE A;  4NJR A;  3VH9 A;  2PIY A;  5K8P A;  2FVG A;  4P4I A;  2OOT A;  3FVL A;  3S9L A;  4WJB A;  4DUK A;  3S9N A;  4OIW A;  3SJX A;  3SJG A;  4MCR A;  2C6P A;  2OR4 A;  5LYD A;  4OC3 A;  4UIA A;  1R3N A;  5HVG A;  3BHX A;  1VIX A;  3CPA A;  4UEE A;  3HLP A;  4P10 A;  3D68 A;  2WYR A;  3SJE A;  3SI2 A;  2AFO A;  5LRG A;  1M4L A;  3IIB A;  1YLO A;  4TWE A;  3B7I A;  2Q43 A;  3IFE A;  4IHM A;  3PFE A;  5DS0 A;  2JEW A;  1ARL A;  4X8I A;  3LMS A;  2C6G A;  3B3W A;  3KR5 A;  3D7D A;  3DGV A;  1CPX A;  3D7G A;  3H8E A;  2RFH A;  4PPZ A;  1CPS A;  2ZOG A;  2WZN A;  3BXM A;  2PVV A;  5LRJ A;  4OME A;  4H2K A;  3WC5 A;  4ZY2 A;  1LOK A;  4ZY0 A;  2PIZ A;  3FH4 A;  3SI0 A;  4IK2 A;  2F7V A;  3KHZ A;  2NYQ A;  3FEC A;  2QVP A;  1Y0Y A;  1FNO A;  2Q4Z A;  1RTQ A;  3B2Y A;  2XEG A;  4OC2 A;  4A38 A; 
#chains in the Genus database with same CATH topology
 4KOU A;  3JUW A;  5A2Q f;  2ZW6 A;  4WWV A;  3PBE A;  4FD5 A;  2NSM A;  1GHE A;  1LAP A;  3J81 b;  1DE4 C;  1WWZ A;  3I56 1;  4CAX A;  4A3I I;  1Q7Y 1;  5AG5 A;  4R6T A;  1YUA A;  4M85 A;  4II9 A;  2J9A A;  3OW2 Z;  4E32 A;  1DTD A;  2JIM A;  1ZG9 A;  2RHB A;  1KUY A;  1IB1 E;  4QVT A;  2AE6 A;  1ZG7 A;  2DE6 A;  4F6A A;  4X3R A;  4MRI A;  1MJB A;  4Q7A A;  2HV2 A;  2VPX A;  5EC4 A;  3VMG A;  2Z0Z A;  4R3L A;  3CMA Z;  3N7Z A;  3QWU A;  1M1K 1;  4NB8 A;  3OWC A;  2OU2 A;  3CCJ Z;  1YIJ Z;  3PO3 S;  1KRL A;  1Y1V S;  3NFZ A;  3KI9 A;  1YME A;  4BBR I;  1M4D A;  5ISV A;  4NGR A;  2DEA A;  3JTK A;  1BLL E;  3IU1 A;  1S72 1;  4MCQ A;  3ZZI A;  4BIN A;  4MXU A;  1WW9 A;  4Q38 A;  4E2A A;  2HUZ A;  4LQ6 A;  4A3J I;  5HMN A;  1ZLI A;  3GKR A;  2PDO A;  3E0K A;  4FAI A;  3PEI A;  2VUM I;  4X5K A;  4HNW B;  4ORF A;  2RIQ A;  2B4B A;  3GCF A;  1TWF I;  3RO0 A;  1S7N A;  3TE4 A;  2H5M A;  4GM5 A;  2VF1 A;  3QNV A;  3LOD A;  4QUS A;  5EMI A;  4NJQ A;  1JWQ A;  1RXT A;  1RO4 A;  4NH1 C;  2G2K A;  1TWG I;  3ISZ A;  2BCO A;  1AMP A;  2HB6 A;  3UY5 A;  2IQ6 A;  3H4Q A;  1X3W A;  3CD6 1;  2FT0 A;  3F8K A;  2OZG A;  2GLJ A;  2V8H A;  4RN7 A;  2JIQ A;  1VQM Z;  3D2L A;  1WII A;  1QSN A;  4CGM A;  1KC8 2;  4P4D A;  3P5J B;  3IGR A;  5J8C A;  2R7H A;  3ISX A;  3G6E 1;  4P45 A;  3CQZ I;  4NGS A;  3CCJ 1;  3GTO I;  1PU9 A;  1Q16 A;  1Q7L A;  2CNM A;  3CC7 Z;  5CNP A;  1Y1W I;  3V38 A;  4EWT A;  2HF1 A;  1YI2 1;  1R57 A;  3K9T A;  3KGQ A;  1V0C A;  4OKO A;  4HH4 A;  2J8R A;  2E2H I;  4X6A I;  2DPS A;  4Y49 C;  4A3G I;  4JYW A;  1M44 A;  1Y7E A;  5E96 A;  2PJA A;  1ARM A;  1XJO A;  1S60 A;  2KCW A;  3DDD A;  4OLL A;  4CRY B;  4TNU A;  4CPA A;  2E2J I;  1NMT A;  2IZ3 A;  8CPA A;  4Y7N I;  2BJO A;  2EK9 A;  3D9X A;  2VUG A;  4S1T A;  1QVG Z;  2QRD B;  3WC7 A;  3FB3 A;  2R93 I;  4NBA A;  4NGN A;  3G3S A;  2V8D A;  2JA6 I;  5K8M A;  1BAV A;  2QJ8 A;  1LCP A;  3IJ3 A;  4MHN A;  5DWN A;  2YAD A;  4XNH C;  2QLV B;  3CCM Z;  3R1K A;  4NF1 A;  4B13 A;  1R9T I;  2CTC A;  1Q86 2;  1I6H I;  5CBM A;  3G4S Z;  2DE7 A;  4CRZ B;  4MFL A;  3GTP I;  1M4I A;  2Q04 A;  4KSA A;  2ZEG A;  4H6U A;  5G21 A;  5LYF A;  1L1O C;  3PO2 I;  4ZI6 A;  2VXK A;  4NGQ A;  3CC4 1;  4A93 I;  4ZX9 A;  4R7M A;  2Z3N A;  3TTH A;  5D1O A;  4MH4 A;  1F2O A;  4PXE A;  2G3A A;  4UCM A;  1CM0 A;  4RS2 A;  4B5O A;  1YGH A;  5T67 A;  1Z8X A;  4AVA A;  2VZZ A;  4HNX B;  5BWA B;  2IMO A;  4G1P A;  2VPW A;  4OC5 A;  3TE5 B;  3T8W A;  4NBH A;  3TX8 A;  1ZLH A;  1M90 1;  3NE8 A;  2ANP A;  3G71 Z;  2BO9 A;  1XEB A;  3PBB A;  1M4G A;  2CIJ A;  2I00 A;  2CY2 A;  4P4B A;  4PK3 A;  4R9M A;  3R9E A;  3EY5 A;  1BPN A;  4M3S A;  1Z8L A;  3GTG I;  1Y9K A;  1K9M 2;  5AG4 A;  3TO9 A;  1S3Z A;  2AYD A;  5K8P A;  2VBQ A;  3TDH B;  3DR6 A;  1TIQ A;  4PSX A;  3T9Y A;  1S7K A;  2HQY A;  4KUA A;  4UEE A;  1L0C A;  3C26 A;  4JWP A;  4NBF A;  4P10 A;  4E8O A;  4E31 A;  3CXS A;  1TFI A;  3RNZ A;  3S1M I;  1YRE A;  1YLO A;  3G4S 1;  4MFP A;  3CCV Z;  4MD7 A;  3PFE A;  2LFU A;  1X12 A;  1WJ2 A;  2QEX Z;  3RYO A;  5IT9 f;  1I3Q I;  4PK2 A;  5CM2 M;  2C6G A;  1K8A 2;  4MON A;  2IV2 X;  3KIH A;  1K83 I;  3R95 A;  1YJ9 1;  3I4M I;  2WZN A;  5LRJ A;  3MZL B;  4H2K A;  3WC5 A;  2R98 A;  4C2Z A;  3FH4 A;  3CME Z;  1ZH1 A;  4KOV A;  2F7V A;  2ODF A;  2REF A;  1IYL A;  1KC8 1;  4A3M I;  2B4D A;  3IX0 A;  4CGN A;  2P28 A;  4JD6 A;  2GTH A;  3B2Y A;  1VQ5 1;  5FLM I;  4DK1 A;  1VQ7 1;  2RB7 A;  3CT9 A;  1YHQ 1;  2RBL A;  3M4O I;  2ZXV A;  4B10 A;  4IAV A;  1TKH A;  4H89 A;  4E33 A;  3SHP A;  1VQP Z;  2JS4 A;  2EWB A;  1YJW 1;  3EXN A;  4A2Z A;  4MFZ A;  3CPW Y;  1FY7 A;  4NSQ A;  3SJF A;  4B6Z A;  2B5G A;  2JBJ A;  5HVF A;  3QAH A;  2OTL Z;  1JJ2 Y;  3CDX A;  2O53 A;  2E7Z A;  1HDQ A;  1IYK A;  2IL4 A;  1B87 A;  3B35 A;  2AFX A;  4RUH A;  2AFW A;  2PJ6 A;  4UEZ A;  3KQX A;  4CS0 B;  3I1U A;  1K73 2;  1ON0 A;  5KTA A;  2WPX A;  4R8F A;  3PB8 X;  5C4X I;  1S7F A;  3H8F A;  4KUB A;  4NFR A;  2QEX 1;  4R87 A;  4E0A A;  2BEI A;  1Q86 1;  3JAM f;  1LQL A;  2R8V A;  1YJN Z;  2OOY B;  4ZBG A;  3F5B A;  1LFW A;  3K9U A;  2PJ3 A;  1VQ9 Z;  2PRQ A;  3EER A;  4W9Y A;  4NGP A;  3GTM S;  3CXQ A;  4RVD A;  3EO4 A;  3LWU A;  3KKW A;  4B12 A;  2ZW7 A;  1R43 A;  4X2T A;  3IWW A;  3BI1 A;  4F9V A;  3J81 f;  2R1I A;  4UWJ A;  1F57 A;  3CCR Z;  3BJ7 A;  3RAM A;  4C7I A;  1S5K A;  2JUB A;  5JH9 A;  4MJ8 A;  3NA6 A;  3A9L A;  4RI1 A;  4RVH A;  2Q7B A;  3T90 A;  3PB9 X;  4XPD B;  1W2B Z;  3W6X A;  2PRB A;  1X10 A;  2CNT A;  1IOF A;  2CF4 A;  3CCQ Z;  4OC1 A;  1Y7R A;  2AKL A;  3P2H A;  4CAV A;  2OTL 1;  2V45 A;  3D8P A;  4CAW A;  1U6M A;  1VQN Z;  2Q4V A;  1Z8T A;  1K9M 1;  4P4F A;  4R76 A;  2PJ9 A;  1MJA A;  4ONU A;  2QYV A;  1S7L A;  4NBE A;  4UBR A;  4DGL A;  4QC6 A;  4OC0 A;  4QB9 A;  1VQL 1;  1VGY A;  2EUI A;  4JXR A;  4QBJ A;  4E2W A;  1CBX A;  1USP A;  3CXC Y;  3FQM A;  2HU9 A;  1NJI 2;  2BOA A;  2G9D A;  3GUX A;  4JZ0 A;  1QVF Y;  1M90 2;  6CPA A;  4HGZ A;  2QML A;  4Z65 A;  4P4J A;  5G20 A;  2PJ5 A;  3CCU 1;  5A2Q b;  2W04 A;  1VQK Z;  2QRE B;  2VPY A;  1K8A 1;  3EFA A;  4UF4 A;  3I07 A;  4KVX A;  5CPA A;  3J80 b;  3GTJ I;  2AFS A;  3DNS A;  1Y0R A;  2X7B A;  4P6Y A;  5H84 A;  2FL4 A;  4A3C I;  4FD6 A;  2JMO A;  3PB7 X;  4C68 A;  3H3V J;  3TOA A;  1IGB A;  4L89 A;  4E2X A;  1PFT A;  4QTT A;  3V7Z A;  1KQS Y;  1YUK A;  2NVQ I;  2JA8 I;  5FVJ A;  2VQY A;  4FUU A;  4U5Y A;  4UFV A;  3RZA A;  3CCQ 1;  3SXN A;  1ZB9 A;  3F3P C;  1NE9 A;  2VI7 A;  5LYL A;  3K7A I;  4KLV A;  2BSW A;  4NBC A;  4YFJ A;  1ZO0 A;  2CTB A;  3PFO A;  1VQN 1;  2ZOF A;  5LL6 f;  2AJ6 A;  3D2P A;  3I55 Z;  1RLY A;  4KOT A;  1N71 A;  3VAR A;  2JR6 A;  3DLJ A;  3IF8 A;  1XOV A;  4BBS I;  3TFY A;  1QYP A;  3B3S A;  1QST A;  3IFU A;  1BOB A;  1IY7 A;  4ZY1 A;  5JPH A;  3FKI I;  3D4U A;  3I3G A;  3KHX A;  1X3Z A;  1K73 1;  2F8H A;  4IF5 A;  3DR8 A;  3CMA 1;  2ZEL A;  4ONW A;  3S6G A;  2V8V A;  2F4O A;  3N5F A;  2Q4Y A;  2B63 I;  5JGF A;  1VQK 1;  1VLA A;  2E2I I;  1YIJ 1;  4NXY A;  3CCS Z;  4MBU A;  1Y9W A;  2QR1 B;  3FYN A;  3Q87 A;  2PJ1 A;  4YU9 A;  3U50 C;  2EK8 A;  3S17 I;  4J3G A;  3CCE Z;  1PCA A;  5GCN A;  1SQH A;  3GYA A;  1RNI A;  4HKF A;  4NGM A;  3FIX A;  2O4H A;  2PJ2 A;  1HEE A;  4UA3 A;  3BG0 B;  2Y0S A;  3SXO A;  3S9L A;  3SJX A;  1CJW A;  3SJG A;  3S16 I;  4OC3 A;  1R3N A;  5IV0 A;  2Y0M A;  3NDJ A;  1IID A;  3SJE A;  2ARH A;  2AFO A;  3CCL Z;  3H5Z A;  4KOW A;  1QSO A;  1Q2Y A;  2WSA A;  5C88 A;  3LMS A;  3S6K A;  2QRC B;  4BXX I;  3B3W A;  3KR5 A;  4AB7 A;  2YND A;  2JA7 I;  3D7D A;  3DGV A;  2RC4 A;  3D7G A;  3H8E A;  3TOB A;  3PGP A;  4PPZ A;  2ZOG A;  1YLE A;  1Q82 2;  1WK4 A;  4MFJ A;  3OW2 Y;  4DQY B;  1VQM 1;  1LOK A;  4ZY0 A;  3S14 I;  3SI0 A;  4IK2 A;  3HOX I;  3KHZ A;  1RQF A;  2I79 A;  4HNY B;  2QVP A;  2JDC A;  4MHD A;  4XPL A;  2PSW A;  2QEC A;  1YX0 A;  5C3E I;  3HOY I;  1RTQ A;  3D6W A;  2NAP A;  4A38 A;  2REE A;  2ZEP A;  4O23 A;  3B8G A;  4PSW A;  5FLX b;  1NJI 1;  5KTD A;  2VPZ A;  3CC7 1;  3VB9 A;  4CGL A;  1CP6 A;  2ZED A;  4EME A;  3BG1 B;  3MRU A;  1YSJ A;  5K8O A;  3IC1 A;  1RO2 A;  4FBE A;  4NEX A;  4KS9 A;  2M48 A;  2HC9 A;  4DJL A;  2DF5 A;  3NDI A;  4BY1 I;  1ZG8 A;  4F0X A;  5J8F A;  1OBR A;  5EBV A;  2P3Y A;  1I50 I;  2B58 A;  2QKD A;  1Q2C A;  4A39 A;  3CC2 Z;  2W03 A;  2NVT I;  1Q2D A;  3IWG A;  2Q0Y A;  4B5P B;  5F47 A;  2POK A;  4UFX A;  1P4N A;  1CP7 A;  2F5I A;  3M3Y I;  4GS4 A;  1GYT A;  2JDD A;  3HOV I;  4MMO A;  3S6F A;  1SFO I;  2C1C A;  5T64 A;  2FIA A;  3B3C A;  4A3D I;  4YWY A;  2O28 A;  3V8I A;  4A95 A;  3CCM 1;  1Z4R A;  5AGE A;  1VQ8 Z;  3FEE A;  4MD8 A;  5HVH A;  3ZJ0 A;  4U9Y A;  1LRZ A;  4I49 A;  5D8N A;  4NOZ A;  2M6N A;  1MK4 A;  2RT9 A;  3FMC A;  5C44 I;  2VZY A;  1JQG A;  3MN8 A;  1MJ9 A;  4R57 A;  4BD9 A;  5F49 A;  1B6B A;  3HOW I;  1AA6 A;  3K2K A;  1TKF A;  2QIR A;  4JXQ A;  2C27 A;  4CYQ A;  3G8W A;  3S6H A;  4F0Y A;  1VQ6 Z;  4RVF A;  3FNC A;  1AUG A;  1VHE A;  3WC6 A;  2J8M A;  1QF8 A;  5K8N A;  1LAM A;  1Z02 A;  2NVY I;  3G71 1;  1M1D A;  4OAE A;  1TF9 A;  4A30 A;  3WAB A;  3JVN A;  4A32 A;  3T4N B;  3KL9 A;  2Z11 A;  3GKQ A;  3I9S A;  2BUE A;  4LQG A;  2ZW4 A;  5IT9 b;  3RZD I;  1PUA A;  5F46 A;  2GAN A;  4F9U A;  3MGD A;  2PJC A;  4AVC A;  1KUX A;  4B11 A;  1QMU A;  2WB1 A;  3F3F C;  1NSL A;  2V77 A;  4MCP A;  4JJX A;  2YNC A;  3LAC A;  2XEI A;  5HXD A;  2OTJ Z;  3TO6 A;  2E9H A;  4KOS A;  1QVG Y;  1VHO A;  2BL1 A;  4OAD A;  5H86 A;  3CCV 1;  2V8J A;  3I56 Z;  2GIV A;  2GTI A;  1YW4 A;  4IUS A;  5ELY A;  1LAN A;  2K3R A;  2R92 I;  2PJ0 A;  4CAF A;  1XIX A;  2WPW A;  3H0G I;  4MHY A;  2JIO A;  2ZEM A;  3WT4 A;  1Q82 1;  4Y49 B;  5D29 A;  2ZEE A;  3GLJ A;  4H6Z A;  4MY3 A;  3GTK I;  4C2Y A;  3CME 1;  5T6B A;  2FSR A;  1P0H A;  2Z10 A;  2PJ7 A;  1KD1 2;  1I1D A;  2YGW A;  3IWE A;  3QAY A;  1NP6 A;  2PK7 A;  5THW A;  4E2Y A;  3PO3 I;  3GB0 A;  4A3K I;  1QSR A;  5G1Z A;  1Y1V I;  4A3L I;  2PJB A;  4P44 A;  4UIB A;  2D4O A;  3JRU A;  3HOU I;  1Z8W A;  4A94 A;  1VQP 1;  2CNS A;  1XMB A;  4XNH B;  4CYP A;  2Q7S A;  1USP B;  1EE3 P;  2F4M A;  4RV9 A;  2FIW A;  2KI7 B;  2VEZ A;  2ABZ A;  3TO7 A;  1HDU A;  3DSB A;  2R7Z I;  4ZX8 A;  2V8G A;  3NE7 A;  1Z03 A;  2GLF A;  3PZJ A;  2OTJ 1;  1YW6 A;  2DE5 A;  1H8L A;  3S2D I;  3LUS A;  4M6I A;  2EBJ A;  3HUV A;  3J80 f;  2PR8 A;  4DYO A;  1FDO A;  1VQO Z;  3S1N I;  3FF3 A;  4YGO A;  1ELM P;  4HPS A;  4KSF A;  1YVK A;  1TKJ A;  1YR0 A;  2JIP A;  1J4J A;  5JQ4 A;  2VL1 A;  1YJN 1;  4KOR A;  2A4N A;  3D7H A;  1XFO A;  1P9N A;  2GRE A;  2XEJ A;  3CD6 Z;  1VQ9 1;  1UFH A;  1Z4E A;  2FXF A;  3FXT A;  1PYT B;  4A3B I;  5IP7 I;  3VH9 A;  3HOZ I;  5C4J I;  2FVG A;  4E2Z A;  4P4I A;  4L8A A;  4WJB A;  4DUK A;  4OIW A;  5AG7 A;  2C6P A;  3VWD A;  5LYD A;  5HVG A;  3G6E Z;  3CCR 1;  1XMT A;  3BHX A;  3CPA A;  3SI2 A;  5I0C A;  4KOX A;  1M4L A;  2R6M A;  1IOI A;  3BJ8 A;  3B7I A;  4AVB A;  3IFE A;  2Q44 A;  2OH1 A;  2YNC C;  3LD2 A;  1YI2 Z;  2JEW A;  3S1Q I;  4X8I A;  5G22 A;  1Y8C A;  5IX3 A;  3I4N I;  3GIU A;  3P2F A;  1S7M A;  4XX2 A;  2EO8 A;  2PVV A;  4UWI A;  4OME A;  4LX9 A;  4ZY2 A;  1N2F A;  5IB0 A;  1VHS A;  4R3K A;  1Y0Y A;  2PMZ A;  1FNO A;  2OZH A;  3KIF A;  1VQO 1;  2V3V A;  2XEG A;  4OC2 A;  2Q51 A;  2ZEN A;  1BPM A;  1ELL P;  3VWE A;  3FED A;  1TWC I;  1UWY A;  3KAS A;  3B3V A;  1XBU A;  4PXC A;  5LYI A;  4AG9 A;  3FBU A;  3NH5 A;  4KSI A;  5AG6 A;  5IB9 A;  3H8G A;  4CGO A;  1JWH C;  1AYE A;  4NGT A;  3R96 A;  3CC4 Z;  4KZT A;  4AXV A;  2JBK A;  3D7F A;  4M6G A;  3B3T A;  4MY0 A;  4BY7 I;  2NMT A;  2PCU A;  2FS5 A;  3FJU A;  2AFZ A;  4AYB A;  1KD1 1;  1Q81 1;  3HKZ A;  7CPA A;  1I21 A;  1N8R 2;  1QQ9 A;  5I4M A;  1TWH I;  4KVM E;  4PXD A;  4UEF A;  4BMH A;  2GU2 A;  1KWM A;  3CPW Z;  1NSA A;  2Z3P A;  5D1O B;  2P0W A;  3NH4 A;  4YRH A;  3R9F A;  1ZB8 A;  3PB4 X;  2ZPA A;  5JM6 A;  4A3E I;  4KLW A;  1JJ2 Z;  4MHP A;  4CGP A;  4EFD A;  2PQ8 A;  5KTC A;  1W2B Y;  3EED A;  2AFU A;  4UCP A;  3VAT A;  2IJZ A;  4CYN A;  3I55 1;  5A27 A;  5D1P A;  4NBD A;  5LRK A;  4CYO A;  3PB6 X;  2K5R A;  2LEX A;  2ZEF A;  4F8Z A;  3PP9 A;  2J6A A;  5FLX f;  3R9G A;  3CZX A;  1XE4 A;  2JNY A;  4OP4 A;  4OID A;  3S2H I;  3SI1 A;  4XPD C;  3WR7 A;  1Z01 A;  4NBG A;  3S15 I;  2GFQ A;  3D2M A;  3KR4 A;  3IEH A;  2DXQ A;  2P6F A;  5HH1 A;  2B3U A;  2XEF A;  5AN9 F;  4A31 A;  2Z3M A;  3CCS 1;  2PJ4 A;  4PQA A;  3GTL I;  2ZEO A;  4RS4 A;  1F2P A;  3IU2 A;  3MON A;  2ZEH A;  1YJ9 Z;  3CCE 1;  3J7A 4;  4KVO E;  3TCV A;  4ZYQ A;  2PR1 A;  2NVX I;  4K30 A;  4U9Z A;  2OZK A;  4FD7 A;  1WCM I;  3TC8 A;  1RO0 A;  2GE3 A;  1FT7 A;  4P4E A;  1QSM A;  1IU8 A;  1YIT Z;  1VQ5 Z;  3TT2 A;  3CCL 1;  2V8I A;  1SIW A;  1VQ7 Z;  4C2X A;  2JLM A;  1YHQ Z;  2PVW A;  1CG2 A;  1A2Z A;  2C6C A;  2DPT A;  2IZ4 A;  1Z2L A;  4E30 A;  2OZU A;  3F0A A;  1KZF A;  1Q7Y 2;  1NUI A;  4PV6 A;  1I12 A;  4MFK A;  1YJW Z;  2YNE A;  4PXB A;  3VTN A;  1XRY A;  4MHZ A;  1Z5R A;  2B4D B;  4AG7 A;  3D3S A;  3ESW A;  4NBB A;  2JA5 I;  2D4P A;  2P6G A;  1YQE A;  2RPR A;  4M6H A;  3KQZ A;  3IO1 A;  4LUA A;  3KZW A;  4Q36 A;  1TXR A;  4CL1 A;  4EWC A;  5F09 A;  3FQQ A;  3CXC Z;  1VQ4 Z;  1CX8 A;  4UCN A;  4MCS A;  1QVF Z;  2H85 A;  4NB9 A;  1X0T A;  3IR7 A;  2B5G B;  4ZGY B;  2B3V A;  1QXF A;  1M1K 2;  3L2N A;  5J1Q A;  3FX6 A;  4HGY A;  4B5P A;  2Z3K A;  2J8N A;  1BO4 A;  2K5T A;  3W91 A;  3GTM I;  1OZP A;  4NCZ A;  2FCK A;  1KUV A;  4A3F I;  2OOX B;  5F48 A;  1KQS Z;  3D66 A;  2Z3O A;  2LIY A;  3VMI A;  2PE3 A;  3CXP A;  3PRT A;  1YIT 1;  3CC2 1;  2I3C A;  2EVN A;  1ML8 A;  3NH8 A;  1TF8 A;  2Z3L A;  2ZAE B;  3CPX A;  2FE7 A;  3EC4 A;  5DWM A;  4FWU A;  3BLN A;  1N8R 1;  4OC4 A;  4MI4 A;  2QA4 Z;  1WZN A;  4CAE A;  3BI0 A;  5A28 A;  4MFQ A;  3S9M A;  4K3N A;  4DNC A;  2AFM A;  1VQ8 1;  3S1R I;  4A37 A;  3FRM A;  3GTQ I;  4GXH A;  4JLY A;  3MZK B;  2JIR A;  3D67 A;  2PJ8 A;  1YVO A;  2CXA A;  1YK3 A;  2G0B A;  3VMH A;  3RBU A;  3GY9 A;  5IP9 I;  1VKC A;  2V8K A;  4NJR A;  1VQ4 1;  4QTU A;  2PIY A;  3RZO I;  2G3T A;  2OOT A;  3FVL A;  1K4J A;  4B14 A;  3S9N A;  4MCR A;  2ZW5 A;  1DL6 A;  1RO5 A;  1Z9U A;  2OR4 A;  4UIA A;  1VQL Z;  1VIX A;  3HLP A;  4XPK A;  3D68 A;  2WYR A;  1VQ6 1;  5LRG A;  1XF8 A;  2ATR A;  3IIB A;  4TWE A;  2WUU A;  2Q43 A;  4FD4 A;  4IHM A;  1Q81 2;  4EVY A;  4Y52 I;  5DS0 A;  1ARL A;  4MD9 A;  3CCU Z;  4BBH A;  2P6E A;  1CPX A;  2PC1 A;  4A33 A;  2RFH A;  3W6S A;  4RVG A;  1CPS A;  3BXM A;  2PM9 A;  2OB0 A;  4KOY A;  3QB8 A;  2YU9 I;  1IIC A;  5C82 A;  1S72 Z;  2WAQ A;  4C7H A;  2EGT A;  4UFW A;  2PIZ A;  3JAM b;  1TWA I;  2NYQ A;  3FEC A;  2KPI A;  2JEV A;  1FDI A;  2QA4 1;  2Q4Z A; 
#chains in the Genus database with same CATH homology
 2Q51 A;  4DK1 A;  2ZEN A;  5A2Q f;  2ZEP A;  1BPM A;  1VQ7 1;  2RB7 A;  4O23 A;  3CT9 A;  5FLX b;  1YHQ 1;  1ELL P;  4WWV A;  1NJI 1;  3CC7 1;  3PBE A;  2NSM A;  2RBL A;  3VB9 A;  3M4O I;  1LAP A;  3FED A;  4IAV A;  1TWC I;  3J81 b;  1TKH A;  1DE4 C;  1UWY A;  3KAS A;  1CP6 A;  2ZED A;  3I56 1;  4EME A;  3B3V A;  3BG1 B;  4A3I I;  4E33 A;  1XBU A;  3MRU A;  1VQP Z;  1Q7Y 1;  1YSJ A;  2JS4 A;  4R6T A;  4PXC A;  5LYI A;  1YUA A;  2EWB A;  5K8O A;  1YJW 1;  4KSI A;  3NH5 A;  3IC1 A;  1RO2 A;  5IB9 A;  3CPW Y;  3H8G A;  4FBE A;  1JWH C;  1AYE A;  4NGT A;  2J9A A;  3SJF A;  3OW2 Z;  4E32 A;  1DTD A;  4B6Z A;  3CC4 Z;  2M48 A;  1ZG9 A;  2JBJ A;  5HVF A;  2RHB A;  2OTL Z;  2HC9 A;  1JJ2 Y;  4AXV A;  3CDX A;  4DJL A;  2O53 A;  2JBK A;  3NDI A;  4BY1 I;  3D7F A;  1ZG8 A;  1OBR A;  1ZG7 A;  3B3T A;  2DE6 A;  2P3Y A;  1I50 I;  4X3R A;  4MRI A;  1HDQ A;  2QKD A;  4A39 A;  3CC2 Z;  3B35 A;  2W03 A;  2NVT I;  2AFX A;  4RUH A;  4BY7 I;  2AFW A;  2PJ6 A;  4UEZ A;  3KQX A;  4Q7A A;  2PCU A;  3I1U A;  1K73 2;  3FJU A;  3VMG A;  2AFZ A;  4AYB A;  2POK A;  1CP7 A;  3M3Y I;  1GYT A;  1KD1 1;  1Q81 1;  3HKZ A;  4R8F A;  7CPA A;  3CMA Z;  3HOV I;  3PB8 X;  1N8R 2;  4MMO A;  5C4X I;  3H8F A;  1QQ9 A;  1SFO I;  1TWH I;  5I4M A;  4PXD A;  4NFR A;  2QEX 1;  4UEF A;  2GU2 A;  2C1C A;  3QWU A;  5T64 A;  1KWM A;  3CPW Z;  3B3C A;  1M1K 1;  4NB8 A;  4A3D I;  1NSA A;  4YWY A;  3CCJ Z;  5D1O B;  3NH4 A;  3CCM 1;  1ZB8 A;  1YIJ Z;  3PB4 X;  1VQ8 Z;  1Q86 1;  3FEE A;  4A3E I;  4MHP A;  1JJ2 Z;  5JM6 A;  3PO3 S;  4MD8 A;  3JAM f;  1LQL A;  5HVH A;  4EFD A;  1YJN Z;  1KRL A;  1Y1V S;  2OOY B;  1W2B Y;  3EED A;  3NFZ A;  2AFU A;  1YME A;  3KI9 A;  4NOZ A;  4BBR I;  2IJZ A;  5D8N A;  3VAT A;  2M6N A;  1LFW A;  3I55 1;  4NGR A;  5D1P A;  2DEA A;  2PJ3 A;  1BLL E;  4NBD A;  1VQ9 Z;  3EER A;  2PRQ A;  2RT9 A;  5LRK A;  3PB6 X;  3FMC A;  5C44 I;  1S72 1;  2K5R A;  4MCQ A;  4W9Y A;  2ZEF A;  4MXU A;  4NGP A;  3GTM S;  1WW9 A;  4F8Z A;  4RVD A;  2J6A A;  3LWU A;  5FLX f;  4A3J I;  1R43 A;  1JQG A;  3MN8 A;  4BD9 A;  4X2T A;  3IWW A;  1ZLI A;  3BI1 A;  2JNY A;  4OP4 A;  3HOW I;  3J81 f;  4F9V A;  4OID A;  3K2K A;  1TKF A;  4FAI A;  3S2H I;  3SI1 A;  3PEI A;  1F57 A;  3CCR Z;  2VUM I;  3RAM A;  1VQ6 Z;  2JUB A;  4RVF A;  1Z01 A;  5JH9 A;  2RIQ A;  4NBG A;  3NA6 A;  3S15 I;  1VHE A;  3WC6 A;  3GCF A;  3KR4 A;  1TWF I;  1QF8 A;  4RVH A;  3IEH A;  3PB9 X;  5K8N A;  4GM5 A;  2VF1 A;  1LAM A;  3QNV A;  1Z02 A;  2NVY I;  3G71 1;  1W2B Z;  2XEF A;  2CF4 A;  3CCQ Z;  5AN9 F;  1TF9 A;  4NJQ A;  4OC1 A;  3WAB A;  2AKL A;  1RO4 A;  4NH1 C;  3T4N B;  2G2K A;  3CCS 1;  2OTL 1;  2PJ4 A;  3KL9 A;  4PQA A;  1TWG I;  3GTL I;  2ZEO A;  4RS4 A;  3ISZ A;  3GKQ A;  2BCO A;  1AMP A;  1F2P A;  3MON A;  2HB6 A;  2ZEH A;  1YJ9 Z;  1VQN Z;  4LQG A;  2IQ6 A;  5IT9 b;  3CCE 1;  1X3W A;  3RZD I;  3CD6 1;  1K9M 1;  3J7A 4;  4F9U A;  3V7Z A;  4ZYQ A;  4P4F A;  2GLJ A;  2NVX I;  4R76 A;  2PJC A;  2PJ9 A;  2V8H A;  1VQM Z;  2OZK A;  1WII A;  1WCM I;  3TC8 A;  2QYV A;  1QMU A;  2WB1 A;  3F3F C;  1KC8 2;  2V77 A;  4P4D A;  3P5J B;  4MCP A;  4NBE A;  4DGL A;  1RO0 A;  2XEI A;  5HXD A;  1FT7 A;  4P4E A;  4OC0 A;  3ISX A;  1VQL 1;  1YIT Z;  1VGY A;  3G6E 1;  2OTJ Z;  4P45 A;  3CQZ I;  1VQ5 Z;  4NGS A;  2E9H A;  3CCJ 1;  3GTO I;  3CCL 1;  2V8I A;  4E2W A;  1CBX A;  1USP A;  3CXC Y;  1VQ7 Z;  3FQM A;  1Q7L A;  1YHQ Z;  2PVW A;  1QVG Y;  2HU9 A;  3CC7 Z;  1NJI 2;  1VHO A;  2BOA A;  1CG2 A;  2G9D A;  1QVF Y;  3GUX A;  1Y1W I;  4JZ0 A;  3V38 A;  2C6C A;  1M90 2;  4EWT A;  6CPA A;  2IZ4 A;  3CCV 1;  1Z2L A;  2V8J A;  4E30 A;  2HF1 A;  4HGZ A;  3I56 Z;  4Z65 A;  4P4J A;  2GTI A;  1YW4 A;  1Q7Y 2;  1NUI A;  1YI2 1;  2PJ5 A;  5ELY A;  1LAN A;  1YJW Z;  2K3R A;  3K9T A;  3CCU 1;  3KGQ A;  4OKO A;  5A2Q b;  2R92 I;  4HH4 A;  2PJ0 A;  2W04 A;  4PXB A;  3VTN A;  1VQK Z;  2QRE B;  1K8A 1;  2E2H I;  1XRY A;  4X6A I;  4MHZ A;  4UF4 A;  1Z5R A;  3H0G I;  4A3G I;  3I07 A;  4MHY A;  4JYW A;  3ESW A;  4NBB A;  2JA5 I;  1Y7E A;  5CPA A;  3J80 b;  2PJA A;  3GTJ I;  1ARM A;  1XJO A;  2AFS A;  2ZEM A;  2RPR A;  1Y0R A;  3WT4 A;  3KQZ A;  3IO1 A;  4P6Y A;  1Q82 1;  4A3C I;  4TNU A;  2JMO A;  4CPA A;  3PB7 X;  5D29 A;  2E2J I;  2ZEE A;  2IZ3 A;  3GLJ A;  8CPA A;  3KZW A;  4Y7N I;  3GTK I;  1TXR A;  2BJO A;  4CL1 A;  4EWC A;  3H3V J;  5F09 A;  3FQQ A;  3CME 1;  3CXC Z;  1IGB A;  1VQ4 Z;  1CX8 A;  4E2X A;  2EK9 A;  1PFT A;  2VUG A;  3D9X A;  4S1T A;  4QTT A;  2QRD B;  1YUK A;  1QVG Z;  1KQS Y;  5T6B A;  2JA8 I;  2NVQ I;  3WC7 A;  1QVF Z;  2H85 A;  2PJ7 A;  4FUU A;  4NB9 A;  1X0T A;  1KD1 2;  2R93 I;  3RZA A;  4NBA A;  4NGN A;  2V8D A;  2JA6 I;  5K8M A;  3CCQ 1;  1BAV A;  1NP6 A;  2PK7 A;  2QJ8 A;  5THW A;  4E2Y A;  3PO3 I;  3GB0 A;  1ZB9 A;  4A3K I;  1LCP A;  3IJ3 A;  3F3P C;  1M1K 2;  3L2N A;  4MHN A;  2YAD A;  5J1Q A;  1Y1V I;  4A3L I;  2PJB A;  2QLV B;  3CCM Z;  4P44 A;  5LYL A;  3FX6 A;  4HGY A;  3JRU A;  4UIB A;  1R9T I;  2CTC A;  3K7A I;  1Q86 2;  1I6H I;  5CBM A;  3HOU I;  3G4S Z;  4NBC A;  2DE7 A;  4A94 A;  2CTB A;  3PFO A;  1VQN 1;  1VQP 1;  3GTP I;  2ZOF A;  5LL6 f;  1XMB A;  3GTM I;  2ZEG A;  5LYF A;  1L1O C;  3I55 Z;  1RLY A;  3PO2 I;  1USP B;  1EE3 P;  2F4M A;  4ZI6 A;  4RV9 A;  3VAR A;  2JR6 A;  2KI7 B;  3DLJ A;  3IF8 A;  4NGQ A;  3CC4 1;  4BBS I;  4A3F I;  2OOX B;  4A93 I;  2ABZ A;  4ZX9 A;  4R7M A;  1QYP A;  3B3S A;  1KQS Z;  3D66 A;  5D1O A;  1HDU A;  3IFU A;  4MH4 A;  2R7Z I;  1F2O A;  4ZX8 A;  2LIY A;  3VMI A;  2V8G A;  4PXE A;  2PE3 A;  1Z03 A;  2GLF A;  1IY7 A;  4ZY1 A;  3PRT A;  1YIT 1;  5T67 A;  3CC2 1;  2OTJ 1;  2I3C A;  1YW6 A;  3FKI I;  3D4U A;  3KHX A;  1ML8 A;  2DE5 A;  3NH8 A;  1TF8 A;  1X3Z A;  1K73 1;  1H8L A;  3S2D I;  2IMO A;  4G1P A;  2ZAE B;  2F8H A;  3CPX A;  4OC5 A;  3LUS A;  3TE5 B;  3T8W A;  4NBH A;  3TX8 A;  1ZLH A;  1M90 1;  4FWU A;  3HUV A;  3CMA 1;  2ZEL A;  4ONW A;  1N8R 1;  4OC4 A;  3J80 f;  2ANP A;  3G71 Z;  4DYO A;  2QA4 Z;  2BO9 A;  2V8V A;  2F4O A;  3BI0 A;  3N5F A;  3S1N I;  1VQO Z;  3PBB A;  3FF3 A;  1ELM P;  2CIJ A;  2B63 I;  3S9M A;  5JGF A;  1VQK 1;  1VLA A;  2E2I I;  4K3N A;  2AFM A;  1TKJ A;  1YIJ 1;  4P4B A;  1VQ8 1;  3S1R I;  4A37 A;  3CCS Z;  3GTQ I;  2QR1 B;  2VL1 A;  3Q87 A;  3MZK B;  1YJN 1;  3D67 A;  2PJ1 A;  2PJ8 A;  1BPN A;  4YU9 A;  3U50 C;  2EK8 A;  3S17 I;  3D7H A;  1Z8L A;  1XFO A;  1P9N A;  2GRE A;  3VMH A;  3CCE Z;  1PCA A;  2XEJ A;  3RBU A;  5IP9 I;  3CD6 Z;  3GTG I;  1VQ9 1;  1RNI A;  1K9M 2;  4NGM A;  1PYT B;  2O4H A;  4A3B I;  5IP7 I;  2PJ2 A;  2V8K A;  1HEE A;  4NJR A;  3BG0 B;  2Y0S A;  1VQ4 1;  3VH9 A;  4QTU A;  3HOZ I;  2PIY A;  5C4J I;  2FVG A;  5K8P A;  3RZO I;  4E2Z A;  4P4I A;  2OOT A;  3FVL A;  3S9L A;  4WJB A;  4DUK A;  3S9N A;  4OIW A;  3SJX A;  3TDH B;  3SJG A;  4MCR A;  1DL6 A;  2C6P A;  3S16 I;  2OR4 A;  5LYD A;  4OC3 A;  4UIA A;  1R3N A;  1VQL Z;  5HVG A;  3NDJ A;  3G6E Z;  3CCR 1;  1VIX A;  3BHX A;  3CPA A;  4UEE A;  3HLP A;  4P10 A;  3D68 A;  2WYR A;  4NBF A;  3SJE A;  1VQ6 1;  3SI2 A;  4E31 A;  2AFO A;  3CCL Z;  5LRG A;  1TFI A;  3S1M I;  1M4L A;  2R6M A;  3IIB A;  1YLO A;  3G4S 1;  4TWE A;  3B7I A;  2Q43 A;  3IFE A;  4IHM A;  3CCV Z;  1Q81 2;  4MD7 A;  3PFE A;  2LFU A;  4Y52 I;  2QEX Z;  5DS0 A;  1YI2 Z;  2JEW A;  1ARL A;  4MD9 A;  5IT9 f;  3S1Q I;  3CCU Z;  4X8I A;  1I3Q I;  3LMS A;  2QRC B;  5CM2 M;  2C6G A;  4BXX I;  1K8A 2;  4MON A;  3B3W A;  3KR5 A;  3KIH A;  1K83 I;  3I4N I;  2JA7 I;  3D7D A;  3DGV A;  1S7M A;  1CPX A;  4XX2 A;  3D7G A;  1YJ9 1;  3H8E A;  2RFH A;  4RVG A;  4MCS A;  4PPZ A;  1CPS A;  2ZOG A;  3I4M I;  2WZN A;  3BXM A;  2PVV A;  2PM9 A;  1Q82 2;  5LRJ A;  3MZL B;  2YU9 I;  4OME A;  1S72 Z;  4H2K A;  3OW2 Y;  4DQY B;  4ZY2 A;  2WAQ A;  1VQM 1;  1LOK A;  3WC5 A;  2EGT A;  4ZY0 A;  2PIZ A;  3CME Z;  3FH4 A;  1ZH1 A;  3JAM b;  3S14 I;  3SI0 A;  4IK2 A;  3HOX I;  4OC2 A;  2F7V A;  1RQF A;  1N2F A;  3KHZ A;  1TWA I;  2NYQ A;  3FEC A;  1KC8 1;  2KPI A;  2QVP A;  4A3M I;  3IX0 A;  2QA4 1;  2P28 A;  2PMZ A;  1FNO A;  1Y0Y A;  5C3E I;  2GTH A;  2Q4Z A;  3HOY I;  1RTQ A;  3KIF A;  1VQO 1;  3D6W A;  3B2Y A;  1VQ5 1;  2XEG A;  5FLM I;  4A38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...