2Q5BA

High resolution structure of plastocyanin from phormidium laminosum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title Plastocyanin at high resolution from Phormidium laminosum and the double mutant D44A, D45A
rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q5bA00
1GY1A 1SHWA 2A3TA 1VLXA 2XX1A 1BXVA 3FQYA 2HX8A 2QDWA 3FS9A 2UXTA 4N8UA 2IDQA 2FJSA 1GW0A 1PLCA 1L9OA 4G71B 7PAZA 3T6ZA 1BYOA 1IBYA 4A68A 4M4RB 1NIAA 2FQDA 2YAPA 2JXMA 2LLNA 4N4YB 2I85A 2AZAA 1PLBA 3AG2B 2CCWA 1WS7A 2XVBA 1HFUA 2Y69B 3CDZB 1L9PA 3SBPA 3PPSA 1JZJA 3NJIA 7PCYA 1IC0A 3GYRA 2BZ7A 4BWUA 1XB8A 2FQFA 1OCCB 4JKNA 1N70A 2CUAA 2GHZA 1ZDSA 1NPJA 3S3DB 5B1AB 4RH4A 2WSDA 4BK5C 1WAEA 3T6VA 1JOIA 3CG8A 4UANA 2MRYA 4YVNA 2BP0A 1AACA 2XWZA 4KNSA 3TASA 1E5ZA 3G5WA 3NSDA 3WI9A 1ASPA 1OE1A 3TA4D 1PNDA 3FQ1A 3KW7A 4YSOA 2TSAA 5I6OA 1JZFA 1AZBA 1IUZA 1A4AA 2UXVA 3NJGA 4KO7A 1JZGA 4DP5X 4E9VA 2IH9A 5I6KA 1KCWA 1FWXA 3WIAA 1MDAA 4A2DA 1DZ0A 3X1FA 2PCYA 5B1KA 3IN0A 1BQKA 2FQEA 4YSTA 1OE3A 2UXGA 1ZIBA 3ZBMA 3FSWA 3ABKB 4KO9A 1JZEA 2Q9OA 1BAWA 1WA0X 1QLEB 2EIJB 1J5DA 1KBVA 3NJJA 4ZK8A 1NDTA 1ET7A 2BO0A 2J5WA 1GSKA 2UXFA 1AZNA 4GYBA 2DYSB 3UAAA 3N55A 2YAHA 4AZUA 5D4JA 2JFCA 1NINA 2X88A 2W88A 2ZONA 1MG3C 3EF4A 5F7AA 4W1TA 1GY2A 1EHKB 2GBAA 3OD3A 5TK2A 1BQRA 2GI0A 1NPNA 1A4CA 2IWFA 1OE2A 2XX0A 2H5UA 3WKPA 4YSPA 4HHGA 1SF3A 2H3XC 2B3IA 2P80D 8PAZA 1M57B 3X1GA 5I5JA 4UF7C 1AS6A 1A3ZA 2Q5BA 1JXDA 2Y1AA 4YSEA 1XB6A 3QJSB 1ET8A 2YAFA 3S3CB 2VM4A 5B1BB 4E9YA 1AS7A 3PAVA 4HIPA 4A2HA 4E9TA 2EIKB 3IE9A 5PCYA 2VM3A 1ID2A 3ASOB 3T6WA 3CVBA 1CYWA 4G70B 1TKWA 1SFHA 5I26A 1FFTB 1HAWA 2H47C 2XLLA 4KO5A 2IDFA 3UABA 2IWEA 2XXFA 3FQ2A 1MZZA 4BXVA 1RZPA 1AANA 1ADWA 2VN3A 2PP8A 5I6PA 2YXVA 1URIA 1ET5A 3IBOA 3PXLA 4KOBA 1SFDA 5B1JA 6PAZA 1W6WA 3AG4B 3EH4B 1ZIAA 2DV6A 3EH5B 4YSSA 1RCYA 1KCBA 2P80A 1FA4A 4YSCA 2CJ3A 1A65A 3WNIA 1GR7A 2RACA 3KW8A 2GSMB 4P5RA 1T5KA 1W8EA 1WA1X 1QNIA 2J55A 1J9SA 3SQRA 3ZDWA 4YSUA 1ASOA 2VW4A 3OMAB 1AOZA 4YVUA 4AI7A 5B3SB 1TEFA 1OF0A 1GS8A 4HAKA 3FU9A 3QJRB 3NJMA 3U25A 2BWDA 1ILUA 1CUOA 4AX3A 1J9RA 4PAZA 4DP0X 3ABGA 3NJLA 3T9WA 1L9QA 3X2QB 4HALA 2HLEB 5E9NA 4KNTA 3S8FB 2BW4A 5AKRA 2FT8A 2R7EA 4FAAB 2PPFA 3JT2A 2QPEB 4E9RA 2FTAA 4BXSV 2XUWA 1JVLA 2YXWA 4JHUA 4Q8BA 3QQXA 5PAZA 4AKOA 3CZUB 5B7EA 3FT0A 2VMJA 3MX0B 5I28A 1KDIA 3ZX1A 3SBQA 3X1EA 2XV0A 4DP4X 1DYZA 2YQBA 4X4KA 6PCYA 3S8GB 3CVCA 3ABMB 3UACA 2FT7A 1NIDA 4F7KA 4QKTA 4NB7A 2IH8A 4BDVA 1QHQA 2XU9A 1E65A 4GP8B 1WS8A 3NSFA 2BWIA 2DWTA 1XMEB 1NIFA 4DP2X 1GS6X 2JKWA 1J9QA 1PF3A 2XV3A 4DPCX 3JTBA 3BVDB 1AR1B 2I7OA 3DKHA 3FU7A 3H56A 1R1CA 1AIZA 2HX7A 2AZUA 3NYKA 1SJMA 1BQ5A 1E5YA 2J57A 2QPDB 2YAEA 2I7SA 2BZCA 2FT6A 3AW5A 4PCYA 1MZYA 3X1NA 1JXFA 1I53A 1M56B 4Q89A 2BP0B 4A67A 1F56A 2YARA 2R7EB 3D12B 3OQRA 5IY5B 1XB3A 3N2JA 3UGEA 2IDSA 4QLWA 2UX7A 3EH3B 2BW5A 3QJTB 1BXUA 1ETJA 2PP7A 5A7EA 1MG2C 1ZDQA 4GXFA 5I6LA 1HAUA 3ERXA 1V55B 4L0PB 4HHWA 2MTAA 3V9EA 9PCYA 2IWKA 1AG6A 5I5IA 1SNRA 1IBZA 3H4FA 1ILSA 4DP9X 1EZLA 1AG0A 2PLTA 2CBPA 1NICA 1UATA 5EHFA 4GP5B 1NIEA 2YAQA 4WTQA 3NSYA 1PLAA 1NWPA 2IAAC 4GY4A 1BYPA 2TSBA 2VSKB 2EINB 1GS7A 5D4IA 4DPAX 3AY2A 4NERA 4M3HA 3TU6A 4W9ZA 2NRDA 1V10A 2HRGA 1L9TA 1PZCA 1PZBA 1AZUA 1PZAA 3FYIB 1OCZB 1AZCA 1E67A 4E9XA 3FU7B 3T6XA 4YSAA 4A2GA 1KYAA 4F2EA 1OV8A 3ABLB 1SDDA 4YSQA 1L9SA 3H4HA 2ZXWB 4G7SB 5I6NA 2PPAA 2DY2A 1PCSA 4HCGA 1ZPUA 5B7FA 1TEGA 3PLYA 3FSVA 2OCCB 3PAZA 2W8CA 2HZHA 3TBBA 4AKQA 4E9SA 3NJFA 4MFHA 3X1BA 1PMYA 4EF3A 2J56A 1J9TA 1A8ZA 4DPBX 3MBWB 3RYMA 4WKXA 2IDTA 2PP9A 3OMIB 1AQ8A 4A2EA 5D4HA 2UX6A 2DYRB 1RZQA 3FU8A 3NT0A 1CURA 3IN2A 1OCRB 1GYCA 1M9WA 2VW7A 1PNCA 2QDVA 5FC9A 3NSCA 3HEIB 1PAZA 1AAJA 3QJVB 1E30A 5ANHA 3EHBB 1JXGA 1JZHA 4DP6X 4E9QA 3FPYA 1AZRA 2DWSA 3V9CA 4F2FA 2VSMB 1PY0A 1KDJA 3WNJA 1TU2A 5B1JC 2AANA 2CALA 2FNWA 2N0MA 3HB3B 1J5CA 1KBWA 3NJHA 1N68A 4E9WA 4UAHA 5AFAA 2BP8A 4DP1X 1OCOB 3QPKA 4KNUA 3FSAA 2YAMA 3GDCA 4YSRA 1SDDB 2HRHA 1V54B 3UADA 1JZIA 4CSPA 5AZUA 5I6MA 3GXUB 4AKPA 2GC7C 4BWWA 1X9UA 4YSDA 2EIMB 4TXVB 2HXAA 3NP3A 4HCIA 2WO3B 2EILB 3TBCA 3WG7B 4G7RB 1KGYE 3PCYA 2XXGA 3AG3B 2PCFA 2GC4C 1RKRA 3NJKA 3AG1B 3FYEB 3NP4A 1SF5A 2FWLB 2PPDA 3WKQA 3OMNB 1JERA 2CAKA 2GB2A 2IDUA 4K9JA 2X87A 4CSZA 2ZOOA 5LDUA 4DP8X 1B3IA 3L45A 4GP4B 3BQVA 3FSZA 5I5MA 1BXAA 3ASNB 2OV0A 3OM3B 3QJQB 3UAEA 4ENZA 2E86A 4JHVA 1JVOA 1W6LA 3CDZA 4YL4A 3SBRA 1ZV2A 4HCFA 2GIMA 3PAUA 2B08A 4HZ1A 2XV2A 3C75A 2BHFA 2VW6A 1WA2X 4G7QB 5F7BA 2PPEA 1NWOA 1BEXA 1CC3A 2YAOA 4BDVB 2BP8B 1CYXA 3NJNA 1NTDA 4P5SA 1IKOP 3ZIYA 1NIBA 2XYBA 5B7MA 1L9RA 1X9RA 4KO6A 2FQGA 4KOCA 4G72B 3AZUA 3IEAA 5TK4A 2WO2B 4A2FA 1AS8A 2OJ1A 4BWTA 3S3BB 2ZWNA 1ASQA 2PPCA 2QT6A 3DIVA 4NAJA 1A4BA 3T71A 1NZRA 2AVFA 4A66A 2AFNA 1KV7A 4FA7B 4DP7X 3CVDA 3FPXA 3DTUB 1SHXA 2HX9A 1YLBB 1OOWA 3QJUB
chains in the Genus database with same CATH superfamily
1E0OB 1CXIA 1PEZA 2C3XA 3QB7C 5ACZB 2V9RA 2XX1A 2AK4B 1XEUA 5J12C 4DH2A 1RIUL 4MDIB 3RY5A 2X2YA 1JGEB 2PWEA 4HBCH 1A6ZB 4N2LA 3STZB 4GIAA 4BFBD 3BKJH 3ECWA 5LQBL 5F9JA 5HHMB 4R4FH 5ICYA 1QUNA 4QRPD 2R59A 1UYWH 1BM3L 5T5FL 5E6IB 1EZSA 1CXLA 1IGML 1B0RB 1SXBA 4TYUA 1KT2A 2GEQA 1SRDA 1J8SA 3KYMB 1IC5H 2BZ7A 4PHZA 1JZ4A 4L29B 1BGXL 4TF4A 3RGVB 1XR9B 4DOHE 1U8QA 3IJEA 5DYOA 2RFXA 3KLQA 5EZJA 2ZUQC 3NIGE 5D5MF 2WJ5A 1U8MB 5HHOB 4XE5B 2WZPA 4KKZA 1Q4NX 3AMKA 4UTAH 4R4NC 3GBNH 2YXMA 5FUZH 1E2ZA 3SGKC 2B0SH 3MRRA 4M43H 4CSTA 5I9QB 3PIQB 1FVDB 3GSXA 3QDGB 5FCUH 3RVVC 4I3SH 1E5ZA 5CBAB 1G9MH 2WLHA 2X89D 4M9OA 3FQ1A 2ZX8A 5F1OB 1EQWA 4KMLB 2O6PA 4UQ3A 5F8RC 4JRYA 3H85A 2ZYRA 1YC8A 3D08A 5F7DB 1A2YA 2FX7L 3FUIA 1JZGA 4HS8L 4OLUL 1MFAL 5EBWB 1A6AA 4F8LA 4CA4A 3L5IA 5DUBA 3JWNC 4N2KA 4AL8H 4QHKJ 4X8JB 3NACH 4H1LH 4A2DA 3X1FA 3DUSA 4EKXA 2M8XA 4QR7A 4U1KA 3IFLL 1GAFL 5DFTA 1QO3B 5AZ2L 3DX6B 4DAGL 3ILQD 5E00A 1IV8A 1NSNL 5D72L 1E27B 1T1XB 2ZIDA 3D0VB 1HH6A 3GI8L 3RUGA 5JW5B 2LLLA 3BUDA 2I07B 2VDLL 3TN0A 1PX4A 4GEIA 4Y4HD 3MOBL 4GYBA 4X7SH 2VDOL 3P4LA 4U1JB 4HUXB 3GZOA 4N85A 4IRJB 1XGUB 1ZK5A 4OGXL 5DT1H 5F7AA 2FYYA 1EHKB 3GMOA 1NFDE 3NCJL 3OD3A 3QFJE 4JKPL 1BQRA 4MAZA 4MJ5B 3RY6A 1D9KB 4FYRA 2DQ6A 1IAIM 4QRAA 3BRGC 5DHXB 1P5UC 2FJFB 2Z1KA 3HPLA 5DI8A 4EI5A 4MAUH 5I5JA 5L4MA 4U6YB 1CICC 2VAAA 2Y7NA 4BSVB 3DK2A 5IIEA 4NDMA 3P69A 3S3CB 4NM4L 4FNQA 1DQDH 5CILH 1AS7A 3KLSA 3BCFA 4MXWL 3BAEH 2A6KA 3WJJC 4IIQC 4R90H 3LZNA 3FOMA 4OF7A 5JQHC 1NGZB 1C16A 2HLAB 1FG2A 1HI6A 3QZWG 3PHQA 4ODHH 5KVFE 4AITA 2F53B 3HE6D 3ESPA 1AJ7L 2G5BA 5A2BA 1I9EA 3HBPA 1TYRA 1FFTB 1HAWA 4I3RH 1MEXL 5C0AB 3FQUA 5BV7C 1KB5A 2W59A 4WWKD 4O2CB 3TH3T 5BVJA 1GTNA 4L9LB 3MRMB 5DJYB 4BXVA 5DFAA 3TTSA 4MXQD 2WWMC 1CVRA 3BVXA 4IJ3B 1KBKA 1Q72H 4IDJH 2B4CL 1XL4A 2CR0A 2LV4A 4PLOB 4PP1C 1HQ4B 4HIEA 3DV4A 1RJYB 5E4EC 4DKFL 5DU7A 1KZYA 2DV6A 1AZZC 2EUWA 3BHBB 1JF1B 2F7RA 1KCBA 3QUYC 3BN9C 4RMTA 3PWPA 2YEZB 3UTOA 4Z7WE 2VN4A 3NPSC 3RTQA 3S9DB 3JTTA 3WNIA 1SY6A 2N01B 4HIXL 1G7JA 3O6KL 2VAJA 2IAMA 3CZLA 2FHCA 3Q8FA 4JZOB 5CU5A 5D7LD 4K3HA 3CX5J 4PS4L 3UYRH 1KB5L 1X6LA 2HUHA 1PGRB 4P0DA 4OCRH 4UV4H 5LGKA 1FGNH 5M95B 3NG5A 5F9DC 5BO1L 2ADGA 2ROXA 4QIRA 4PGEA 1ILUA 1KF9B 1MWOA 3LVTA 4HYTB 3FF7A 3RKDC 3VGGA 4QRUB 4BUGA 4JM0A 1TKWB 3S8FB 5EA0H 3ZLQC 3LRGA 3D52A 2IGFL 4JQXA 2HYMA 4X50A 4DK3A 3FTGA 1EO8H 2DBJA 4W6XB 3O6FD 1LO3H 1CXEA 4WZ9A 3WNNA 5HDLA 3SCMB 3A4DA 1K85A 1SY6L 2XZZA 4N1HB 1JNNL 1CWVA 4IS6B 3PP4H 4PJ9B 4ANXA 4ERSL 4ETQA 4Y9GA 3F6IA 2V4LA 3IJ8A 4OJAA 1YG9A 2BVQA 4D9RD 3MLTB 5DUPL 4DP4X 5B22A 2OS7A 4HH9B 3F85A 3FF8A 2DZEA 2CO3A 5CGYC 4HAFA 2M1KA 3ZL4H 3QHZL 2AP2A 4V2BA 4M8QB 3OB0K 5DFWH 4X5PA 1S9VA 1WS8A 5E9DA 12E8L 2H7WA 1U8JB 2Y7MA 2VZUA 4G6JH 1MHCB 5DD3L 3DUHA 5DD6A 3C6EA 2X4QB 5F6IB 3D4CA 1CD0A 4EDWL 3RWCA 3G7TA 3ZTJH 3T4YB 5IB4B 3UGXA 5FHAH 1JGUH 2AJZB 1NCDH 4R97C 5IQNA 2IBGA 1OHZA 3WJMA 1KTKE 1ZEAL 3MNWA 3LNEA 4N24A 3FU7A 4PRPA 1T66C 5G55A 4R4ND 1S7UA 2FJUB 5C0EB 3CPUA 3MPCA 2F9BT 4YOKA 5AWNL 1A4JA 4JFOB 3I50L 5CP7B 5B1BB 2NYYC 3QDMB 3RVVD 4KHTH 4FQQB 1MZYA 4XMWA 1M53A 1KIPB 3MR9A 5DMIL 1ED3A 3CMOH 4A38A 4LF3A 3ARTA 5IUCA 4WO4C 5DEZA 1YPZF 4YDJA 3BEVA 1TZAA 3HHSB 4CUCA 1BXUA 2PP7A 1ESOA 4IHOA 1S7WA 5L88L 3BAWA 1IM9B 1AO7B 2APXA 3BUTA 4GUQA 5FB8A 3N43F 1A7PH 4FP8H 2EVHA 4L0PB 1P69B 3T4AA 3TZVA 2MTAA 3P2BA 9PCYA 2IWKA 2FX8H 4OLVL 5AEAA 1NCUA 4PD4K 1OAQL 3BDXA 3OKNA 3H4FA 3DSNA 2J88H 2HFFA 2QVIA 3AS1A 1TPXB 3NSYA 1RPQA 2Y7QA 3SSGA 4YHNB 2XFXB 3FFCA 4KVNH 1QUPA 2VSKB 3VO0A 3VD3A 2XZQL 4JG5A 4IKJA 4M3HA 5JNYB 1Q8MA 1CFQA 3CLFL 2VWEC 3LPWA 3UH8A 1FL5B 5BXFA 2OP4H 4MQXC 1AZUA 3B3IB 3FYIB 5HYSA 2A9NL 1ZT1B 1KFAH 4LU5L 5E8NB 3KR3L 1A0QL 5F6HI 1FL6B 3I9IA 3IGFA 4AV5A 4KROC 4MMYB 4U4IA 1EZUA 4G1MA 1CICD 2Z0UA 4F9PC 5JYMA 1T22A 1AGBB 4MDRA 5EU4B 5CSZA 5C0CA 3KXFA 3MLVH 3HW7A 2VISA 5F6HJ 4TPRH 3PWPE 2O1AA 4EF3A 4Z7VB 4GAYB 4DPBX 4ALAH 1JK9A 1Z5LA 3MV8D 3JQOB 4G6MH 2IDTA 3S36L 1X9QA 5C08A 3TFKC 1CF1A 4BQCA 2C9RA 2BLFA 4RVBA 2XN9E 1RPUA 4ZNCD 5B38B 4XRCA 1BREA 5KVDE 4R7LA 3CWGA 1M7DB 5K9JH 4DGYL 2DYPD 2WWMD 5FC9A 4Y1AB 5F3HA 2Z4QA 2WQSA 4I77L 2Y1YA 1XBRA 3CDFA 1TDQA 4LARH 4XCNB 5CIPA 4PP1D 2YGVA 3U1SH 3QZMA 4L4TA 4QYOA 5ALCL 4TKWA 2QHRL 2CPUA 2D31A 5FUOL 2R4RH 3EBIA 3CK0L 3KL3A 4X6CA 3QUYD 3BN9D 3SQOL 3PJNA 4OD2A 4K73A 1FSKB 5C9KA 3MUGA 4KH9A 1AQKL 5GSVB 2C8NA 1MJUL 1QD0A 2ENJA 3NJVA 4NKDA 3ZHFA 2WCGA 5JIQA 3GDCA 1XXFC 4O2FA 4UIKH 3V0WH 3DGGB 1GIGL 3ZQWA 4AT6B 1XF2B 2C7UB 4Q74A 4Y7OC 4URKA 4BFJA 2CCVA 2OXGB 4E42B 3C6SB 3CH1A 3FO0H 3KVQA 4XHQA 1WGOA 1OP4A 2A6JA 4R7NA 2OMZB 4GXUN 4V33A 5E9DE 3RKDD 1KLUB 4XO4A 2OMVB 4LCUA 1I9IH 5L9DL 4MMXB 3UJTH 1BBJB 3VXMB 4ZD3L 3THMH 1FNHA 3GK8H 3GMRB 2FWLB 3NP4A 4ODWA 5BZWB 4BK8A 4FYTA 5FV2A 1HESA 1WBZB 1B0GB 2X0WA 2WIIA 4LAJH 4NQDE 2Y07H 3B83A 3U7WL 4MNQA 5LDUA 1T1YA 5C70A 1YSOA 2J7LA 4P2OC 4PRPE 3V55A 2XQBL 1CBVH 3WIFB 2F15A 4G7YL 3S5ZA 2DQDH 3TGXA 3FO2B 1F8TL 5CGYD 2DM3A 5CXPA 4YL4A 3Q8EA 5LWYH 4PLKC 3ULVF 3SBRA 4FKEA 4OFVA 4H25B 4X4XA 5C0GA 1DFXA 4UUJA 3CBJB 4L3CB 1KIRA 1PFCA 1QKZH 4C56B 1M1SA 4HJIA 2PPEA 4ZPTA 5IWLA 5E6SB 3BZEB 3OKYA 4LCCB 1CYXA 4NQSA 1C7TA 4P5SA 3O0LA 3MJ8A 3K74B 3VXRD 4DTGH 4PG9A 3VVWA 1YUKB 1K5NA 3D9AH 3F7QA 3SYQA 3L4WA 3AGVA 1THAA 3PDDA 1RUKH 2FQGA 5LXGH 3RL1A 3MCYA 4NAJA 3DHMA 2A9AA 3KVPA 1T66D 2EH7L 4JCMA 4X6EA 5AW1B 2O4EA 4MD0A 2GYSA 3T71A 1KN2L 5IT2H 3RWIB 3IAQA 5JMOC 2NY4B 2IEPA 4EJ1C 2NYYD 5D8JH 5HYIA 2YFOA 4PTTA 1DSYA 1OGAA 2A73A 2DLHA 4XO3A 3FFCE 4X8GA 3JWDC 1U8PA 3VWKC 2HX8A 1S9YB 4U7SA 4WO4D 2UZIL 4DCQA 5C8JB 1JI1A 3IFOA 4GIPD 1JFHA 1J8HE 2IANA 1MUJB 3J2PA 4UQ9A 4C54A 2UY7A 7PAZA 3D39E 3NESA 3VFRA 4DVBB 2X4NA 1IBYA 3ZOAA 3WSQH 5EO9A 4D94A 4F3FB 4HUWA 4PWGA 4R4BB 4OV5A 3X13A 2DH2A 3R8BB 2XVBA 1L9MA 2Y69B 5KYNA 1RZFL 1SEBB 1UXLA 2J71A 1T5WB 4JDVA 5T1DH 1CL7L 4HCRL 1T20A 2VXTH 1EAJA 2E7DA 4P2RD 4QRSA 2ZYIA 5JPMB 4NKMA 1MSPA 1BYNA 1D5BA 2AXJA 5EZPA 3VH8A 3G5XB 2BSSB 2FJHB 1Q0XL 3MN8A 1N10A 2QGBA 3QQ4B 4PMEA 2A1WL 5ID1B 1KSRA 2OMUA 3Q44A 4MXVE 4M9PA 4F7CB 3ULUH 2KLSA 3T1FB 1O7DC 4MQXD 2GY5A 4YFLF 1CXFA 4XVTL 5DJ8A 3MNDA 5EEUA 1BQSA 2VDQL 4BFEA 3TX4A 2G4GA 3SE8H 4JKLA 5SV4A 1G1YA 4KROD 2MTPA 4O51A 2CLVB 5LG1A 3VDCA 1A4AA 1RK1B 3UTZA 4KO7A 4N6QA 4ELMF 3QZNA 4E9VA 4L4TE 4GT0A 5J5EA 1UA6L 5D1XC 3RB5A 3QR2A 1QLRA 3CFIC 5DD0H 1R0AH 5L4IA 3VA2C 3IU3A 3QJZA 5F7UA 3O6ML 1KACB 3Q9PA 3L95B 2XYCA 2C9PA 2NX5A 1PEWA 2Q9OA 3GSQA 2RCSL 3SDXF 3EO0A 5J6HB 3TFKD 1TUPA 2IALA 3VACA 1I3GH 3LN5A 4KJYA 3QUMB 2CZNA 4JDEB 2L7EA 3CSYB 3VX0A 2R0KH 4BE5A 1QPXA 2LOEA 3FKUS 2DMCA 3V10A 1PIGA 2GBUA 1MG3C 4M3JA 3EYOA 4NM8H 2B1OA 3FQ4A 1XAKA 2H0FA 1IC7L 1DVQA 3NPZB 2RD0A 4XP6L 3HE6B 1CFSB 2FGWH 2NXYC 4H8HA 4DF9A 3MA7B 1ZA6A 1ZE3H 2QZ5A 5SV3A 4OZHB 2FEDC 3QZPA 4AQ8A 2ZAIA 2GCYA 1SF3A 5TE4H 1YECH 2B3IA 3GGWA 5ABAA 3BUPA 2EO9A 4M6OH 1R3LB 3TNNB 2AQNA 3TYFB 1FZJB 1JXDA 1RZKH 3U36A 1QRNA 4F8TA 1RIVH 3L5WB 1XB6A 5CZRA 1K8DB 2W9EH 1LEKB 1NFDF 5B1CA 3VE0A 1MCPH 4HS6B 2IQAB 5SWSB 3S2CA 4GS7B 4NZTH 5JPNA 3ULVC 1K4DA 1L0XA 5FV1L 1LM8V 5CFAA 3KYOA 5LCVH 3NSXA 4KKPA 4P2AA 3QPQC 4DEUA 1DJZA 1WT5C 2R23A 3GKWH 3KPPA 1H3WM 4R83A 4C83A 4EUPB 2F7PA 3ARGB 4KO5A 1ND0A 2VXSL 1DDHB 4Y5YA 2B1AL 2XXFA 1UVQB 5HVHC 1OW0A 3RFZB 1OGPA 5AAMC 2GVYA 1O0VA 4J8RB 1YMMD 2VO5A 3WDJA 2H9GA 2WZ6A 4NZDA 3PXLA 1X5LA 4GLRH 1AFVL 4LLVB 1OQOA 4AEHH 3SJVB 3ZYZA 4AG4L 4P2OD 3A67H 3LKNB 5EOCJ 2P5EE 4U05A 1QWUA 2VL5B 4Q4EA 2DJMA 2L8AA 1FA4A 3TXAA 1EXGA 3LHPL 4GI9A 5C0FB 1VGKB 1R24B 4PLKD 4H8UA 1N6QL 5F88B 1K6QH 1MHPL 4LPTA 3E80A 3G5VA 3QJHA 4X8XA 3L2LA 4M7LL 4F37F 2Y5QA 2ZCHL 4BFFA 1P0SE 1F90L 5KS9B 4UNUA 4N68A 4NNXB 2O30A 4AI7A 4ACTA 4X4MA 4GAJH 4GI8A 3VI4B 5KN5B 1LE9A 3NAAL 4U4BA 1U8HA 3MBEA 4MB3A 4GBXA 3STBA 3WEXA 3WJLC 3ZQ9A 4Z7WF 4KZCA 4UM9B 3CX2A 3G5ZB 3HUJB 5C0DB 3HHRB 3MRCA 3QS3A 1HHKB 4HS3A 1P6AB 2CHZA 2FATH 2X12A 4CKVX 3VFUB 4FFTA 1QI5A 2AAVA 4YWGL 1Z0MA 3UTTD 3VWKD 4JO8A 5B7EA 4JGNA 2YPKA 2ILLA 4QRRE 1RHHA 4XBEH 4K94L 5EZIH 3M17A 4XXWC 2NY0B 3BQUA 3DI3B 3I6LD 3ETTA 2WCSA 4FQHA 3KYNB 3L6FB 4G8FB 2V8LA 1JHLL 1GGCL 4RNRA 5T1LD 1QVOB 3K8LA 4FQXB 1MCJA 3QR1A 4K3EL 3FCSA 4GP8B 3TP4A 1KGCE 3BP5B 4C47A 3TBVA 4F1ZA 1T89C 1H3GA 1CD9B 1YEWA 1DHKA 1PDKB 3L9EA 3R0MA 4KUCF 4QTHB 5ABDE 4L18A 5GGTA 4HPOL 2C4FT 3MOQA 4EI6B 3CC5A 1PJ9A 4PV9B 1NLBH 2JKWA 4TS6A 1J9QA 3T0DA 5D1ZA 5DA0B 2ZKYA 1NH6A 3IMSA 4Y2DB 1UM5L 5FKAA 4XXDA 4D8OA 2X4SA 2Y6TE 3L08A 3MRQB 1R1CA 3H2PA 1KYFA 3VFSB 1F1DA 3MXWL 3ZSSA 3E1ZA 1BQ5A 5CFHA 4AIZB 5GPRA 4F20A 2D2CC 1BCIA 4AENA 2BP0B 2BVOA 3T3ME 1ZANH 2J1ZA 5FA3B 4PJ5D 3A23A 2ORBL 2RIKA 2ICEC 4DGWC 5I18H 3KPQB 2KL6A 4JRXE 3GJFA 2VLRE 2VC2L 2VTFA 2ICES 3I2CH 2WHVA 1Z9SA 5F71A 5D1XD 5I30H 4OJFL 1Q94B 1QSZA 1V55B 3S2AA 3U0PA 3WHXA 3L5XH 1KXTA 2EIZB 3Q5OA 4UB0H 1JZ6A 2OMYA 4IMLA 3B9KB 2EUXA 3TO4B 1E8XA 1RZGA 1CG9A 1LO2H 4XZ4A 3D2UA 5E8DH 3D07A 4BFOA 1T7VA 2YWZA 1JRHL 1NIEA 4OCYH 5DZVA 1CK0H 5A1AA 5DRXA 4AQZA 2TSBA 1E28B 3CDGA 4L5FL 5I17A 2XY1A 5E99L 5A40E 3AY2A 1FO0A 3KPSE 3DBXB 3CC1A 2HKHL 1U8CA 4XN8A 5BVPH 3MV8B 1U6AH 2OPCA 4HX1B 2NXYD 2B2XH 5GRUH 1PZBA 3CXHK 4F15C 4KKNA 3W0WE 1FFOA 5BNXD 2FEDD 4X99A 1CDCA 5BV7B 4I85A 1F58H 1Z3RA 5DC0A 3RQ3A 4JGMA 8FABA 1GYAA 4M3KB 1EHLH 3QRGH 1SJEB 1HQRB 2R69A 3BEWA 4XN5A 2GTQA 3QEUB 4PI0A 5DRWA 3T65B 3U4EB 2NNAB 3EJUA 3OR7B 1ZPUA 5B7FA 1AY1H 3OX8A 3D87B 1TEGA 3F04A 2FIRT 4YUEH 1GC1L 3O3EA 3QUZC 4E5XA 5MHSD 3KDMB 1M2VA 4K7PX 3ULVD 5ENWB 3UGUA 1A3LL 4JO2H 1H0DB 4DEWA 1HCYA 2J56A 1TFHA 4FLQA 1EJ8A 1FO0L 3QPQD 2X7LB 5C07A 2Q6WA 1TT6A 4PM1A 3FU0A 3AT9A 1NCWL 4RMBA 2NY7H 1H5BB 3OB0H 3IBEA 3NFPA 3CZGA 1BDYA 1AQDA 4PRHB 3LKOB 2V7NA 1GHFL 4P5MB 5EBGA 4U0QB 1W9XA 2OBGA 5D96C 3LEYL 1QABA 1X5FA 5DS1A 3HC2A 5C1MB 4G43B 4NKOB 3ZE2E 4I87A 2A6IA 5F96H 4AZ8B 5CBEB 4E9QA 2XWCA 2XZCH 4IOSA 2ZCKL 1BZ8A 1D3CA 4EDXB 1J18A 3UZQB 1X4YA 2K9UA 3JWOH 3V5HB 1KXQA 3IDNB 1IFRA 2OYMA 3ALPA 4EZLA 1DVTA 1SHSA 4E9WA 4WTZA 3EOAA 1AGEB 4RRPA 1ACXA 2YZ1A 2AEQL 2PYED 5D5MB 3H42L 5K9OA 4ZTPH 3QWOB 5HDBE 1SDDB 1HL9A 2HRHA 1V54B 3IM1A 3QQNA 2JK5A 1QA9B 4Z7AA 5DQJA 1VFBA 2OAAA 1U8NB 2JB5L 1U8IA 4IJTA 1FCGA 3ARUA 5F1NA 2Y4SA 1X9UA 4JN2A 3QIBA 4JCWA 1P1ZA 4X6BA 2YPVH 5DZAA 5HYQA 5CNHA 3DX8B 2YBRA 3L4CA 3DBSA 3EO1A 4ONGL 1BIHA 5H2BA 2IQ9H 4G80B 4G7RB 3ATBA 3CPLB 4YIQA 2BK8A 4BQ9A 4NKQB 1MNUH 2FL5B 4ZUUB 2R56L 1DUZA 5KJRL 4XPBH 2GB2A 2VDKL 3D0LA 2GK0B 4IKIA 4H8WH 3FCGA 1ZVSA 2WAHA 5FO9B 1BXAA 3W81A 1UUNA 3Q6FB 5J0BA 3V0HA 4JHVA 4P59L 5DK0A 3WHE0 1W6LA 3EAKA 1QLFA 4FTVB 4XWGL 2V0AA 2Z3FA 5BUPA 2MKLC 1AC0A 1HINL 5F70A 3NCYS 4AQOA 1NC4D 1SOKA 1WA2X 4NLAA 3UZVA 4ODTL 3O0RL 4P3DB 1X7QA 2KQMA 4Q9RH 3GI9H 5HHPA 4YN3A 3TN0C 1J86A 5K39A 2UZPA 1SLXA 3KCPA 1XV8A 5E2UL 1J8RA 2H4EA 1PG7X 3P4NB 2V6HA 4G9FB 4UT6H 3TL5A 4B27A 1UCBH 4NO0A 5TK4A 2K6ZA 4F8QA 3L9RB 3MRKB 1NZRA 1BOGB 4ESKA 2R8SH 4HEMA 2F54A 1VFAB 5AVXB 3BO8B 3U2JA 4OD1H 3VNYA 3L3HA 3QI9A 2MNWA 3GTTA 4KTDL 1FNSH 1JGLL 2VDPL 3U9UB 4P2RB 4LVOC 2FGZA 3CFCH 1ZS8B 2DQJL 1H3UA 4Q2ZB 1QWHA 5KYXA 4RBPK 4S1RH 5CZVL 1QBMH 2B4CC 1BVKB 2XQ0A 3MRIB 5ERWB 1BYOA 3T77A 2Z0BA 4TUJB 2UUDH 3BPCB 4OFIA 4HIHA 3C2SA 3KPRE 5EN2B 3VM5A 2VITA 3WFEL 3N04A 1CDGA 4GSDH 4X0NA 2FO1A 5LBSA 4N26A 2JVUA 5IVXA 4DESA 3FTUA 4GQRA 4LVNC 4A6YL 3HHMA 7PCYA 2C9XA 1FFPB 3HAEB 3QFJD 5C7ZA 3O8XC 4WENB 4X0KA 4JFEA 1LGVA 3MCLL 5DJAA 1HZLA 4K23H 5B1AB 4OFDA 4BKTC 3QHTC 3PDOA 5ITBH 2W07B 3M88A 4PRDA 1IL1A 1GGIL 2DEWX 5IEKA 1M2OA 1IGIH 2ARJQ 1T2QL 5T33H 3TASA 2OSLA 3CSPA 1ASPA 1OE1A 3GXPA 2H8PA 4M8UA 2Z91A 4Z3IA 4YEEA 2OTWA 2LAGB 4AH2B 3RTQC 3QA3A 5LBSL 1AZBA 1OD9A 3DO4A 1G7HB 4HDIB 4JL1A 4P5KB 5C0JA 1HN1A 2WINA 2ZCZA 3M1CA 4HISA 5HYJB 3PWUA 5DHVH 2BSRA 3LN9A 2F5BH 1U8KA 3FTVA 4E5XG 4JG1H 4MXVF 5GS0L 2DKUA 4L8DB 3DJRA 2OSWA 5H4YA 5B1KA 1YAIA 1KXQE 1IT9L 5I19H 3MC0A 5JORA 2FBOJ 1IAIH 1YUHA 1F4YH 1EAOA 4LSPL 1UD5A 1BD2E 1KTRL 2GG1A 3L3OA 5I1JL 4DVRL 2YD5A 1OL0A 2F08A 2H26B 3FU6A 2X6UA 3LNIA 2VDRB 4HMEA 3K71A 5C92A 3F58H 4JQXC 4KK6C 2JQMA 3PJSA 3Q5YA 4OZIA 4X6CF 5FGBA 1JPSH 1OAKH 2BERA 3KYKL 4KKLC 4U3SA 3ZIMA 4DKEH 3W5NA 5HY9B 3QW9A 2GBAA 3IDIA 3VJ6B 3UROR 1OP5K 1P7QB 1YVLA 2ZT9C 5CN1A 5JHDA 4LSTL 2J6EA 3NIFF 4N3TA 1EGJL 4JKKA 4L3EA 4C4KT 3Q9QA 2WLJA 3P9MA 4KHXH 2H3XC 2QEJA 1H3PH 2PETA 3BGFB 4WTZG 4DQOH 2A9CA 4RRPG 1R5VA 5LB1A 1PSKL 4O02B 1Y0LB 2VH5L 3LPPA 3US1A 1LMIA 5CO1A 4TQEH 2BS71 4AVJA 4WNSA 5I1IH 3MNZA 4GAAA 1NAMB 2OL3A 1P4BH 1MVYA 2R51A 3ARFB 3B9DA 1X3DA 5FX3A 3CVBA 3IU4H 4NNYA 1XGRB 5I76A 2R2EA 4JM4L 2CO4A 1JZDC 2V3DA 2BMKA 3UERA 3VFVB 4OB5H 1OT4A 3MLXH 4KUCD 1AGFB 4LBEA 3MRFB 2WZPD 3LMJL 1I8IA 5KBMA 2J4WH 2J6EL 4FJZA 1UACL 3ROLB 3NBNA 3MLZL 3UMTA 1A4KA 3ECBA 3ZYIA 4JZJC 3WNPA 2N7BA 5DJ2B 2VN3A 4HXBH 4JY5H 2E7MA 4PJXA 2XSKA 4TL5A 2XWBA 1U21A 3S4SB 3X3GH 1SLUA 4NUGL 3L3KA 4NZRL 4TLKA 3WN5A 1JBJA 1WV7T 5AVSB 3S5LG 4JRYD 4DSYA 2KDGA 2W92A 1ETA1 1F41A 2C3HA 3BH4A 3QT2A 1MY7A 3GRWH 1DCLA 4QHNA 4EPSA 3ZUCA 1SHMA 5K9QI 3ML8A 4BQBA 1ZY9A 2ZX5A 3G6JB 3DOHA 4OLYL 3NEEA 1GR7A 5KYYB 3CJJA 1NCNA 2RACA 2JKJA 4HWEL 3S35H 1ZOXA 4N8CH 3VFWA 4N8VB 1EANA 5J89A 2P46B 1JV2B 4UDTA 1J9SA 3CHSA 3EYSH 1ASOA 4M1GL 1ZJAA 4OUUB 4JPVH 4RFOL 4NYLA 3TBSB 3TN0D 1TEFA 2GJPA 3F7VA 3ZYOA 4LLDB 4U6VL 5EU6B 5E9AA 4YHLH 1D6VL 2NQ3A 1M7UA 5T1LB 1HK6A 1MIEH 1OSPH 1CUOA 3MAWA 4OZFG 1H15A 4FN0A 1WLHA 4S0HA 4OLXH 2APWA 4DO5A 4QRFA 3Q8CA 1YN7B 3WUWA 5E94B 1WO2A 2R7EA 2IBZY 2YMOA 3OJDA 4E9RA 4HZLB 4JFEE 4ZFGH 3VRLE 3LV3B 3L7FA 4JY6B 4WI7A 4CN6A 2G60L 5DRNA 1IM3D 3ZX1A 1DE4A 1Q9KB 4ZW8A 4NP9A 3O3UN 3OR6B 3PQYA 2E9IA 3HLAB 5INCB 3OG4B 5TPWH 3C2AH 3MTXA 3VDBA 4TRPH 2EDWA 4BDVA 2XU9A 5KYUA 4GT7A 4KJQC 5EO0A 3UCQA 4BUQA 3W2DL 1HVXA 4WW2A 1GL4B 2G30A 1I7RA 3JTSB 4FXKA 3AM8A 3WD5L 3W9EA 1J11A 5KBNC 3O8XD 3CVHH 1YEEH 1I31A 3IDGA 4XBPB 4Y2OB 1JCKA 3C5SA 3QCVL 1GGBL 3N40F 1QSEA 2WSPA 4M5TA 2ZWYA 4XP9L 2PYFB 2J44A 1N6VA 5IEHA 1VESA 1FZKA 4AYID 5KZCD 2ZP8A 4RQQA 1XIWB 2D4FA 3B9AA 4Y5VB 2Y5TA 3RNQA 3JT0A 4ZFOB 1O5DT 3CXFA 1AXSA 4U6HA 2AZUA 4QCIB 4PJ7B 3BKCL 4ODUA 2LU5A 5ESVA 2QVMA 3EADA 5E6ZA 1E4KA 2H1PH 3PWPD 3KM1A 1OLLA 4XPHH 3RTQD 4OH2A 1BWWA 4OZIE 3QJFA 1P7HL 1E3ZA 4W9EC 2ITDB 3QJTB 3QNFA 2IXQB 3S37H 3MRHB 4XP4H 2KS0A 3V4UH 1UT2A 5I6LA 3HC0A 3Q7JA 5JDSA 4K8RH 4RDQG 3T04D 4OM0H 1K4CA 5FUCC 1XZ0A 2NTSP 4C59B 4XP1L 1HHJA 4EVNB 1N3NB 1ZSHA 4DUWA 5BZDB 4ODXA 2VE6A 1F4XH 2CU9A 3B9EA 1IE4A 5IB2A 2EIBA 1AG0A 4POUB 3HI5H 2FECI 2CKBH 3LD8C 4WFEE 4M5YH 3UPAA 3PL6B 2I32A 3FT1A 1HNYA 4R2GB 1RUPL 4KK6D 4YDMA 4G6AC 1GS7A 5D4IA 4KKLD 1DQLH 1XGYH 2H1LM 2NRDA 5ALBL 3PFUA 4GRWH 5DD5L 4HLJA 4Q6YA 1JTTA 1M6OB 3WEBA 2X5PA 1S7RA 3PUCA 4JHWL 2CH8A 2PW2A 3II2A 4JB9H 4LQFH 3V6FA 4XMPH 4QRQB 4N2AA 1NBQA 4PGCA 1IIKA 1NDGB 1WFMA 3BD4A 2NY5H 3QXUA 4WFFE 4OCLC 5KTEL 5B3JF 3QWQB 3EXLA 3HZ3A 4OT1L 3FSVA 5E9DD 1K72A 2OCCB 2JKXA 4HXAL 4GAGH 2YK1L 3BC9A 4Z3FA 4G42A 3ORJA 4YXHH 4UMGA 3T0EE 1EV2E 4HIQA 3MJWA 4PYGA 1IO4C 4XNMA 2BFGA 3QVAA 4WKXA 5CLWA 4Z0XB 2COVD 1BW8A 3L3GA 1WZAA 5FFOA 4PRPD 4HFUL 4HUVA 2DQHL 4V1DE 4AQ1B 5EEZA 1OCRB 2DWXA 1H6UA 1AMYA 2BY1A 4HP5A 3RJDA 1DJWA 3F7LA 3KM2A 4FFVC 4PRIA 3L5JA 1PAZA 1AOHA 2WQAA 4NRYA 2BXYA 5DS8B 3O3DB 5TD4A 1HXKA 2DWSA 4Y8AA 3G6AA 2E7CA 3MMEA 1G7IA 4Y1SA 2XA8L 2CM6A 4MJJA 5B1JC 4Z0BL 3K4AA 2IPKB 3DTXA 4R3SB 2LVCA 3LZOA 4Z76B 5HP5A 4EOWL 1HEZB 2F2HA 1R5IA 1N68A 5TDPA 4ZXBA 3L5HA 2R9HC 4S1QH 5DGRA 3RDTA 3FSOA 3FCBA 3Q06A 4KVPA 1I3RB 4MJIB 4G6KL 4B9CA 3CV5A 4KNUA 5C0BE 2VZ3A 4UZSA 3TIEB 5JIPA 4PJEE 3AACA 5IB5B 3DOSB 3UO1H 4NQXA 1U4EA 4Q52A 4UTBH 3E6FA 3U1QA 5DJ6A 1G9EA 2VABA 4ONHA 4BWWA 3QXAA 4CADB 4AGOA 3UP6A 1L7TL 2EIMB 5KEZA 3FFCD 3KG5A 4FNLH 4EBQH 4X7TA 2BSTA 4PW4A 2J1WA 4KUZH 3SE4A 4ZTOL 3V6ZA 1WFNA 2VKWA 4HF5H 3WUWG 4J4PC 5DR5H 3D39D 3HA0A 4H5SB 2PMZA 3WKQA 2AJYL 5KSAC 1FNGB 1R46A 3L1EA 4JN1L 1F2XK 1QSEE 2IDUA 3ATEA 1ZAGA 2XVKA 3GLEA 3QDHA 3UTPE 3I02B 1NA8A 3LPGA 2KDYA 1FPTL 1YAZA 3MLYH 1T1WB 3UAJC 4F33B 2UV3A 3SDXB 2WLLB 4P3WA 2O5ZL 1WWCA 2UWEB 4ODVH 3WHE1 4OQ1A 3DHUA 2ZKHL 3A21A 3RWHA 1UGNA 5C0CD 4ZYKA 3CDZA 3EYFA 3OGOE 4I9WE 1ZHNB 1ZV2A 3NCCB 5A16B 2B08A 2DQCL 5D2LA 2AEIT 3WXWL 4KJQD 2VW6A 3ROOA 3SE3A 1SUHA 3CD4A 3HKZA 2E6QA 4IBTA 5K59E 3KYAA 4HIIB 4JREB 4OGYL 3H2QA 1TZGL 4GEJA 3QRFM 2YN3A 3GXFA 4FNUA 5HVGB 4BWTA 2BS9A 5C09B 4WY7H 1UM4L 3WEOA 4XVSL 5DVPA 2BNQB 2AFNA 2W0FA 3TA3A 4LLWB 4L4TD 4KK9C 2IADA 1UZGA 1T5XA 3VXUB 2X4OA 4LASL 1RFDH 3IWUA 1OOWA 4PJDA 4RFNC 3WNMA 1DQIA 3ATFA 4JMNA 2AAAA 3HNSH 4FX5A 2D0GA 3GHEH 4XPFH 2FJSA 3KPLB 3RZCA 3II3A 5IGXH 3AREC 5KSBE 3JV0A 4HV8B 4OBSA 3T6ZA 4HK0B 3F12A 4YC2B 2H3NA 3U6XA 1NIAA 4LFHG 1QR1B 2MIZA 3AAZA 1SVZA 3VXTB 1HE7A 4OF6A 4OFPA 4XGZA 2FVNA 1IKFH 1Z5HA 3EDDA 5ACLA 3UPRA 3FRUB 3PPSA 2GJRA 1AKPA 5DJXA 1EDQA 2XHNA 2EVJA 4XCFL 1MRDH 4ZOCA 3NZ8A 4F2ME 3RJQB 1TVBB 2F19L 3WIHH 4LVHC 4WCYL 1OW0C 5GGVL 2ZJSH 3MRLA 4H88H 4G6AD 1ACZA 5CJQH 2QQNL 2V8MA 4PWKA 1KB3A 4ELKA 1DLHA 5EIVA 1UWXK 3O41B 3VGBA 4PLNC 2E9JA 4JDTH 1WAPA 1YEKH 5DWUH 3W82A 2NTFB 1EO7A 1MHEB 3GHPA 3QIWC 3CFMA 3P30H 3GZQA 1SEQL 1FBIL 1RJCA 1PNDA 3IDJA 4J3OH 1T21A 1KJ2H 1JUFA 3KL0A 4PRIE 3WKMH 4EIGB 3O2WH 1E8YA 2WXQA 1TTAA 1RU9H 5D7SH 3RFRA 3GHBH 1XF4B 2DTSA 3ZDXB 3INUH 5AW8B 4K94C 3FQTA 2O6FA 2CLZA 4W93A 1FYTE 5JHLL 1J5HA 1U4FA 2E75C 3VI3E 1WUZA 5F9JB 2ARWA 1XCQA 3MBEC 1BAWA 1JN6A 4GBXC 1MCWW 3BDYH 3NIDE 5CCKH 1JPFA 1TZOA 3P3YA 3F7PC 1ET7A 3RBSA 1H9VA 2C26A 2WVSA 2UXFA 3MGTB 3VD5A 3F84A 1KT2B 1DEDA 5D93C 1ES0A 3MFGB 4B9IA 4TUOB 4PRNA 3FB8A 4FFVD 4K07A 3FT2A 2X4TA 3QQ3A 4IRZA 4M7JL 2DD8L 1YEJL 2YUWA 3IJEB 2DWEB 4OJCA 5EZJB 1SUJA 2PTVA 2DIEA 2EO1A 1OE2A 3WKPA 1BFOA 1CGSL 2R0WL 2VDLB 4GUPA 5E5RB 1QFWM 1RUAL 3CQPA 3MRRB 3IDXL 3KS0H 2R9HD 5J1TC 3D4GA 1AS6A 1A3ZA 2CRYA 5K69A 2B9AA 4K9EH 5IBUG 3T8XB 3ZRFC 5A6LA 1N19A 2CR6A 1Z66A 2X6MA 3LKQA 4PWEA 1ET8A 4JRYB 2Q7AA 1MI5A 2X9XA 4FNSA 2MCG1 4E9TA 4X9GA 1MAKA 1A2YB 3IE9A 4JAMA 4XP5L 2QBWA 1KJMA 5T1KA 1A6AB 2KKQA 5BOPA 4X80L 4PJHB 5DUBB 5BRZE 2HRPL 3SGDH 4G8GA 4IRZL 4JPSA 3NEXA 5D1ZC 3DUSB 4NGHH 4PJAA 3ARBC 5FYLL 4L1DA 1DQKA 4HIJA 5E00B 3DX2A 2DJUA 4KMTH 4QRRD 3RUGB 1JZ5A 4J4PD 2YQ3A 3NABH 1MJJA 4PB9H 2J1XA 4RWYH 4DN4H 4JFDA 3BAIA 5KSAD 1HOCA 1TTBA 4FI6A 5FECA 1ET5A 5E4IA 4U1MB 1B4JH 2K3TA 3NEOA 4KOBA 3WL9A 3UAJD 1KGCD 3LJ3A 4Q9QL 4EI0A 2P7TA 3BOVA 4OLEA 4ORGA 2FYYB 1NCHA 4Z3GA 3TIDA 4FABL 1NGPH 3SKMA 2PUQT 3JWNH 1W2KT 4NNPL 4TUKH 2ED6A 4PJDE 5I71C 1YEIH 3P0VH 3MLUH 3VXNA 4QOKA 3HPLB 3RA7H 2F1EA 5JO5B 1IAOA 2NX5D 3MJ6A 4BJLA 4EI5B 4YSUA 3NOIA 2EXSA 4QRTA 1PY9A 4M56A 5DLLA 4JKMA 2VAAB 1DTUA 3EDEA 3N44F 3O4LE 4CN1A 2LU3A 1GC1C 2BPBA 3AU0A 1DVUA 1ZCRA 2B39A 3IE4A 5L6YL 3S48A 4I18C 1I9JL 1RZIA 2ARJB 4RMWA 5DQDH 4ZX6A 4FZEL 1S3KL 4Y4KA 5EUOA 2DKMA 4WU5B 2CDFA 4PAZA 3ABGA 1C16B 1FG2B 1HI6B 1C12A 5TE7L 4DO4A 3GMNA 3PGFL 5HYEA 2EEFA 2VZTA 5AKRA 4KK9D 3GSOA 4BD4A 2G5BB 4ISVB 4AVIA 1P84J 4YHPA 3IJHB 1RMFH 4RCAA 4L3AA 1BX2A 3FQUB 1UM6H 3GMLB 3OPZL 2ZYHA 4BE6A 2E4TA 4GRMA 2NDGA 1BV8A 3Q2LA 5KZCB 1QRND 3EUDA 4TVPL 5FYJE 3ARED 2BJML 1NJ9A 4X4KA 4ZUVA 3HE7C 2NSXA 4J2XA 4NRXA 3DV4B 4YXKL 4O58L 1OP5H 1NGQL 1BWMA 3HC4H 1RJLA 1MWAA 3CZEA 4ANWA 4F8PA 1M7IA 1JF6A 2VJ8A 4A2MA 3ZDZF 3KPSD 1PKOA 1BPLB 4IEFB 3JTTB 1MRFH 3DSFH 4PJCE 4XOAA 1VACA 1G9NC 1EFQA 3LHAA 2AQTA 2PF6A 1UD4A 2IAMB 3DV6A 3I3EA 3LKSA 3QEGH 2CJSA 1JZ8A 2D7MA 1GZQA 1LK3L 3U4BL 1T83A 4UINH 5F1SA 5J1AA 1M4KA 2V9TA 5E23A 1SM3L 3N85L 2AV1B 2FCBA 4B9KC 2AERT 3FB5A 2PXYB 1VJSA 2QVTA 4PGEB 3QIWD 1I9RL 2EJ1A 3NJXA 4NRZA 5ACZA 2AK4A 2BZCA 3FRPB 1WIPA 4AGNA 5I75C 1M56B 1MWAL 1VIWA 4PHXA 4BCXA 1P6WA 1T7YA 3C5ZA 4RDQF 3WO3B 1B6DA 3STZA 4D0DA 3QUKA 2LHAA 2MSPA 1KCRL 4ZT1A 4D7BA 2FD6H 3EH3B 3FQNB 2ZD0A 1O7SA 2YPLB 1SMDA 1I1AA 3R06B 2F61A 2VZ1A 3DC0A 1HAUA 4ETQB 2V2TA 1NANH 5E6IA 2BVQB 4HHWA 2CKNA 2ITFA 5C2BH 1Z9OA 2IC2A 3KYMA 4KPHH 3VQMA 3OJMB 4NAQA 3LY6A 3MBED 4GBXD 4EO5A 4OZIF 1WEJL 5MENB 1ZS2A 2ZG2A 1CF8H 3D3VE 2WWKT 4FXLA 4OI9A 1S7TA 1FRGL 4OQTL 2DDQH 1UATA 1JFQH 1T0MB 4WTQA 1S9VB 3Q13A 5AG9A 5JHBA 1CLZL 4HU8A 1U8MA 3GXNA 4RGMB 1J5OL 3VG9C 4KQ4H 4NZJA 2ZKMX 4DGIL 4G1EB 3SD2A 5CP3H 4M7ZC 3RWCB 4W9ZA 5BMFL 3SDYL 1L9TA 5CBAA 2FIKA 4BZYA 4J7RA 3WJMB 1SVBA 1WFTA 4LSVL 3HG2A 1LDPL 1A6WL 3FU7B 3H9ZA 2WXIA 5AQ0A 2LVEA 2AQ2A 1G1OA 3AB0B 3OHMB 4LSQH 2OYKA 3ZDYF 1A4JB 2CGZA 4GXUM 5EDSA 1QSFA 5F0PB 1PZ3A 2MMXA 4X8JA 5I6NA 1FORL 5D7JC 3UDWA 3V4LA 3MR9B 1H8LA 1WZ1L 1ED3B 5AOKA 2CUIA 2E8ZA 4LF3B 4PN6A 2Q8AL 1KBGH 1Z9PA 3BSHA 4YFLI 1T1XA 5DFVC 3QEQE 5JW5A 5EOTA 2I07A 1S7WB 4IHOB 5FB8B 1PX3A 1Z5YD 3MBWB 2HT2C 5D1ZD 5EG6C 3U82B 2EE9A 4UILL 3ARBD 4JFWA 4PJXF 3T4AB 3TZVB 1JSYA 4AJ0A 4Z18A 1N0XL 3BWAB 4U1JA 3LIZA 4TVPE 1E9OA 3OKNB 1GYCA 4IRJA 3WV0A 1S3RA 2BNUA 3B5GA 1SJXA 3QI9C 2DMHA 2QDVA 35C8L 2YSTA 3DSNB 1WICA 2HFFB 4QXUH 2BSCA 1KLGB 4L1LA 1MFBH 2Y7QB 3B2DC 1Q1JH 1AZRA 3WGUB 3GRBA 3U7YL 2FJFA 2VSMB 5IQ7L 1KDJA 2ADFL 1XT5A 2CALA 1CFQB 3ZTCC 2CWRA 5BXFB 1A7BA 5HYSB 2V17H 5KW9L 1J1XH 4ZAKA 4AM0A 4W9DC 4QEGA 3MQIA 2YAMA 5J9PA 1F3DH 3LIZL 4G1MB 3D2UD 1T22B 1YYLL 2NXZC 5GXBB 1NGWB 5CSZB 5GS0C 5LVEA 5C0CB 3KXFB 3ARPA 1MCFA 1SXZA 3SKJL 2WQUA 2JWYA 5L4JA 2FUQA 4O2CA 1UOKA 4GKNA 3WY4A 3ZSTA 2D7TH 4BIKA 4L9LA 5DJYA 5IM7A 1E8WA 1F4AA 1GJWA 5C08B 2WKGA 4RISL 3HN3A 2B1HL 1U3YA 5DVKA 1HQ4A 3KPRD 2DQEH 4XRCB 3TEXA 4CSZA 2KZBA 2GJ6A 3ES6A 2XRAH 2AK1H 2X40A 3L45A 4K7PL 5JA9A 4XCCH 2YGQA 2Z4QB 5F3HB 3GLZA 2APBA 4XAWH 5I5MA 1UXSA 3M1OA 3OM3B 5CIPB 4WW2F 3HE7D 3QUXA 4QYOB 2AK4E 4F27A 4CL7A 3OZ9L 5T3ZH 1V3LA 2D31B 3FC8A 2RA1A 2VT0A 5I15H 4JZOA 4X6CB 2XBDA 4ZBJA 2HT4C 3LQMA 4I0CC 5C07D 1CFVH 2ZP0T 3IJ7A 3L4VA 1QP1A 3MUGB 5DS2A 5ESQB 1S5IH 5HHME 3L3OC 2B5IB 5DJ0A 2VLLA 4M6NH 1XSJA 4O2FB 2HA1A 3IMUA 3VW3L 4L1BA 1S2EA 2P52A 4G72B 4QRUA 2M83A 5FGBC 3BIAX 3KWTA 1KYUA 1KV7A 5DQ9B 5IJDC 4ZMZA 4R7NB 2DLGA 3DTUB 4F8NA 1NUFA 4EXKA 1FCCA 4IS6A 4KKCC 4PJ9A 3T2NH 4LLAA 5J11B 1SHWA 5HHOE 4LCUB 1LJMA 3QQ9C 1LD9B 1WITA 1BEYH 1I8MB 5HJGA 4CJ1A 2QDWA 3FS9A 3HLKA 4ODWB 5CJOL 1BD2D 1ZGLP 3QDGE 4XN1A 3C6LA 4KDWA 1KGWA 1RXLA 3CFBA 5BQ7A 3DRTA 4AK2A 4MNQB 1T1YB 4M8QA 3WLBA 4OCSH 1TF4A 2FQDA 4X42A 3UC0L 2APVA 3LNDA 3N1QC 5FGSA 1W0VA 5I5RA 4M5ZH 4WNJA 4FG0A 2E27L 2V5SA 2LLGA 1HFUA 4PJFA 4R96A 1BZDA 1CI5A 2AS5M 5J06A 2A9ML 3B37A 3V6OA 4X4XB 4NXSA 2O5XL 1A6UL 4TSCL 4KRLB 1ZLSL 4UUJB 2AJZA 1QFPA 4OSUL 1KIRB 3C8DA 1R3JA 1X4ZA 4ZPTB 3DETC 5KSBF 3POHA 1FGVH 1EZVX 3GXMA 5IESL 3F7RA 4NQSB 4TN9A 5ES4B 1U92B 4H4NA 4FFZH 2JJWA 2BSEA 3WN5C 5I8OH 4FQQA 4UANA 2K8MA 3TYGL 1R4XA 3RL1B 1KIPA 2HAZA 4X6EB 3G5WA 3SODB 4MD0B 4D3CL 1ZT4A 1IGTA 2DW5A 1E2WA 2QGEA 2ESVA 3GSNA 1G0YR 3CUPA 4GKSB 3HHSA 2BX5A 4H8QA 2N4IA 5ESAB 1IUZA 5IHUH 3T0EC 3BLKA 4JGJA 4DP5X 1OGAB 2A73B 3VFNB 5L7XL 5D7JD 1ZLUK 1E7VA 5HTSA 1DR9A 1PG7L 4PBWD 3ATDA 5BUGA 3PXHA 3V8OA 4L4VA 3AXIA 4DCQB 5LGYA 5DFVD 1Z9NA 5IMMB 3N42F 1HHHB 3QXVA 4H0HB 1UGKA 2IANB 2LTQB 4NAMA 1RULH 1KB9K 2UY7B 1ZIBA 2DLTA 2X4NB 2HT2D 1XGPA 1AGCA 3TNMA 2OQJB 3D6GA 4ZK8A 3MV9A 3SPVB 3NH7L 4OV5B 1NDTA 3X13B 4KQ3H 2BO0A 5G5DA 2F54D 1MVFA 2JF1A 3KDPB 3LS4L 3ZQXA 3ZZ1A 5BS0E 3DIFB 2BY2A 3QI9D 4NWTL 2F53E 3UJIL 5KVEH 4UYPA 3TONA 3T0WA 2IFFH 2Y5EA 1FL5A 1T20B 1FVCA 2UVEA 3ARZA 4BFNA 3UL4A 1DBMH 4XPGL 4N9GB 5C0AE 3N50A 5TK2A 5E8NA 2G3MA 3Q1SH 2GI0A 3OAWA 1D5BB 5DZLA 1F6AA 4F1SA 3DPBB 3NIDF 3VH8B 1BAFL 5JQ6L 1ERNA 1FL6A 2AGJL 1U36A 3LCYA 3RZWA 4XO8A 1GRWA 4LVEA 3B2XA 4MMYA 2IGLA 3PWNA 4D9LH 4HJJL 3K6FA 4OZ4B 3H9SA 1LO4H 3T0XA 3OPUA 3U9PL 5A2LH 5DJ8B 1GPOL 2Y1AA 1EERB 1I8LA 1QFUL 1HEHC 3FDWA 4MQTB 4H2AA 4HIPA 5F9AC 3EZJB 3GSWB 3UTZB 4OF3A 3GMQA 2H32H 3AM8C 4FXKC 4GAYA 3M7FB 2XOTA 4R9HA 2NXZD 5L8KB 2VRKA 4JFED 5DHMC 4LSRL 5GS0D 3EH1A 4WSGA 4X6FA 4DNLA 4R0LA 2YKLH 1QLRB 5B38A 4Y7MA 5AL8A 1M7DA 1CE6B 1WGVA 2MEJB 1BVNP 2NX5B 3GSQB 5AKVA 3VMNA 3EO0B 1J1OL 4IGBA 2PR9A 5ECJE 2IALB 1INEL 3LN5B 4KJYB 5CJ8A 1BQHB 1TSHA 4P4KC 2Q1EA 3Q48A 5D1QB 1FE8H 1TETL 3OMZA 1QAWA 3EKCA 4H8VA 1QZ1A 4LL1A 2ZZUT 2DM4A 4U7KA 3F8UB 2QSCH 1GOFA 2XQYA 3EH5B 3X17A 5F7EH 1TJGL 1MCOH 3QYMA 2YBGA 1IC1A 4OM1H 4FTDA 5DLMH 1UWXH 2WOYA 1ZA6B 4ZUTA 1D5IH 5HGBA 4K5PA 2XKSA 1MJ8H 4N2GA 5IKCA 3DGGA 3PDGA 4AT6A 1XF2A 4JFPA 1RUQL 2HT4D 3ZZQA 1FV1A 4P46A 1VENA 3LPOA 3GGWB 4FLHA 4ZS6C 1UFUA 3C6SA 3HI1B 4JMXA 3U36B 3QNXA 1GS8A 2WN3A 4OTXL 3QJRB 1NL0H 3VE0B 2OMZA 1S9XA 4OF0A 5H94A 4FRWA 4MKMA 1KLUA 2OMVA 5JPNB 1K4DB 4OZGA 1A7RH 1B0IA 3KJ4B 2QELA 4PJDF 1KYOJ 3NJLA 3VXMA 4I0PA 5B4MC 3D18A 4UTAA 2BW4A 4HBCL 2R23B 1G9HA 4BM7A 1H3TA 3KPPB 4JVWA 4FG6D 3BKJL 4KKCD 1UEYA 1ND0B 1QR4A 2ZYSA 3BGAA 4AYDC 3TF7C 4Y5YB 1C1EH 3QQ9D 4AKOA 5F3FA 1TZIA 1UYWL 1ZHLB 4CVXA 3FO2A 3OC8A 2CJUH 3E1F1 5MEPB 3RE0A 2H9GB 3P40A 3QDME 3PP3K 1MCBA 4HKZA 5A2AA 1CLYL 2FT7A 4H1LA 2VUYA 1DP0A 3ARQA 4L3CA 1Z9MA 4FLRA 3K7UA 2P4AB 2X3BA 2IPUK 2Q20A 3EYVA 1AO7E 1BM7A 3SGJA 1WHOA 4XX5A 4UTAL 1F4WH 1SQMA 2HUEA 3GBNL 3G5VB 4TM9A 1KEMH 3QJHB 4XN9A 5FUZL 2V5TA 4M43L 3T8VA 3DETD 1MREL 4Z7NB 4RFEA 2WLKA 5FCUL 4I3SL 1IRAY 5KBKA 2Z31C 1G9ML 3S96A 3KH3A 3MDJA 3O81A 4QD2E 3CN1A 2C1OA 5L0QC 5IOPB 3WEXB 2OI9C 3FNKA 2YAEA 1BZ9A 2WAQA 1FG9C 3NACL 3BVVA 4HS3B 5C8JA 2YARA 1BVNT 1AQMA 3O45A 4ZXBC 3T0ED 4L4JA 2CK2A 3QPXH 1SBSH 1LP9A 3RDTC 4DVBA 3RHWK 4RGOH 1WCQA 3DJSA 4ZO8A 2AQSA 4PH8A 1LE5A 4QHUB 2C3GA 25C8L 2YPKB 3S35X 1YZZA 1RHHB 4J3VA 1TQWA 4X7SL 5IJVB 3M17B 3BCDA 3BQUB 2BIOA 1SNRA 1V3MA 4FQHB 2JIXB 4JHBA 1ILSA 5DT1L 2CNYA 3IETA 3QO1B 3AQDA 5JPMA 3SE4C 4LIQL 4BRJA 2J6WA 3FCSB 4XZUA 5TQ2L 3TBVB 1NWPA 1KN4L 2MOQA 4Z7VE 3QQ4A 1X7SA 2VC2B 5DJCA 5GZOA 5C7XL 2NY2C 3CC5B 4F7CA 1JWUA 4MAUL 2IH1A 1YEGH 5E2TH 3MROA 4OLWH 5I66B 5C0BD 3TPUB 1PZCA 5EULV 1D7FA 2YA1A 2X4SB 3GXTA 5CILL 2WXGA 4Y1AE 5LBGA 5C3TA 3PQYD 1EX0A 3EGSA 4MD4B 1E6JH 4OCMC 4R90L 4QAWA 3DX0A 5TQ0H 2HJFB 2EC9U 3AJ7A 2BDNL 3M46A 4OV6F 2NY1B 3R1GL 5I23A 2BVOB 1G43A 4MLIA 5FXCH 5I1CH 1F1AA 1XCTB 3PS6A 4PJAF 4TNFA 4OCXH 3EOBA 4DN3H 2HZHA 3KLHC 4ETYA 2ADIA 3WMPA 4HJUA 3MKKA 3BSGA 3BUYA 3KBHE 1Z9SB 3H3BC 1QSED 5B38G 3SGEH 3CSYA 2GSIA 3OMIB 3UTPD 3WHXB 1Q72L 1KXTB 4IDJL 2BVYA 4WVRA 2Q86A 4AWJC 2C3WA 2KPWA 2OMYB 1KTBA 2NW3B 3BLPX 5A3IC 1HZHH 3M8OL 4XODA 2C9VA 3SDCB 5H35A 2CBQA 4P4KD 3MA7A 1X6NA 1WD8A 5DRXB 4NKIH 5FF6A 3NCMA 3CDGB 4OI7A 5I17B 5HD8C 4I48B 3BD3A 3VXME 1LK2A 2XQYG 4Z3TA 1MFNA 5AW7B 3WNJA 3F5WB 4IRSA 3UYRL 1U8CB 4LEOA 3RWFA 1R3LA 1QX1A 2X2IA 2QKSA 4OCRL 3VRIA 1QQDB 3L5WA 4LFHD 4NUQA 4X99B 1K8DA 3QUML 5CSBA 1FGNL 1GGTA 2IQAA 5SWSA 1QATA 5CINH 2Z9TA 3GS0A 1OB0A 2YD1A 4ZS6D 5EUOF 1PS3A 3BEWB 5DRWB 2AC0A 1QBAA 2GC7C 5EA0L 3OX8B 4E5XB 1EO8L 1MXDA 3GINA 4J6RH 1NM4A 1Q9LB 1LO3L 3ARGA 4C56E 4DEPB 3ESNA 1YHPA 2EILB 3PP4L 1UVQA 3WFBH 5B4MD 5C07B 2Q6WB 2XXGA 4NPJA 1UD8A 1RUMH 2PPDA 4LLVA 1FNEA 1JERA 3SJVA 4B95C 3NFPB 5D2NB 2EYRB 5DVOA 1AQDB 3P9LB 4NQEA 2V7NB 2VL5A 4DP8X 1B3IA 1MAMH 4GP4B 3AU1A 4WK0B 1VGKA 3D48R 5KVFH 3BRDA 4G6JL 2A6IB 2WCPA 4LIQE 5LGJA 1NOFA 4Z5RB 4H1LG 5DZNA 5GRVL 3NA9H 3IDYC 5I75B 2XV2A 1JGUL 1NCDL 4PVMA 3P2TA 5KS9A 4PB0L 3EUUA 4JRFA 3TJHC 3Q2WA 3TT3L 3QRLA 3EOAB 3HMWL 2EDYA 1BVLB 5D6DA 3QWRA 3UP1A 2VDKB 1ZLVK 3VG0H 4BFIA 5KN5A 4XPTH 1EWHA 1JK8A 5M94B 3C60A 2IJ0C 3RIAK 2VDNH 2FYVA 4A7GA 3OLIA 3GO1H 4KHTL 3G5ZA 2Z31D 3EOYG 4KOCA 4F57H 4PRID 3SBWC 1AS8A 1OAYH 5F1NB 3CMOL 4WSJA 4JN2B 2D3LA 4JDZA 3QIBB 1YQVH 1P1ZB 2WUCH 5HYQB 1KGXA 2YBRB 3EF7A 3SQBA 1PL3A 3EO1B 1SHXA 4YQXL 2D7NA 3CZNA 3OHXC 3SOTA 2XPZA 4FP8L 1FYTD 1VLXA 3IAPA 1GMIA 2F58H 4ZXBD 2H3KA 2VXQL 2XTLA 2FX8L 5GSRB 3HC3H 3RDTD 3RIKA 1EH9A 4N2DA 1DUZB 3ESMA 3KYNA 3L6FA 4G8FA 2IOIA 4KMQA 3D0LB 2NQCA 3F65A 1KJ3H 5ANMA 4W4OA 4AEIL 2EDEA 2J88L 4FQXA 1ZVSB 1XWVA 4WHDA 1YQ2A 2FX7H 4HS8H 1MFAH 5LNDA 3QZLA 1E2VA 1PDKA 2I26N 4KVNL 1XH3B 5DK0B 2GW5A 1QLFB 3CFDA 2H32B 4UYQA 5F7WC 4HC1H 4PV9A 2QGCA 2L7UA 3GPEA 2E6PA 5AZ2H 2OP4L 5D72H 3UZVB 5CSGA 4OI8A 1XGQB 1ZDSA 4LP5A 2WVVB 2PWDA 1QFOA 3GJEA 3MRQA 5HHPB 1BF5A 1KMGA 2NY2D 5GRXG 2QLYA 3LOWA 1VEPA 4OKDA 3VFSA 3KCPB 1JZ2A 2OK0H 4YE0A 1JOIA 3CZFA 2J8UA 4AIZA 4PTUB 4GNKB 1UOVA 4NO0B 3ZTNL 3UBFA 4IBUA 2BP0A 4YGVA 5D71H 5E24E 3N44B 3MLVL 2WVTA 2F54B 1YA5A 4N0CC 4OGXH 5D7EA 3KW7A 3KPQA 5JW3H 5TTRA 1B4RA 4TPRL 5BRZD 3L3HB 1N59A 5DDHA 1OCWH 5BZXA 4GG6A 3MA9L 1DVSA 1IVLA 3C12A 4ALAL 5LO7A 3TEYA 3PY9A 4G6ML 1BJ1H 4OZHE 4YLCA 1XSOA 4GKLA 1N64H 4BZ1H 5JXEA 3WU1A 3KLHD 5KYXB 2ZCLH 3B9KA 3TO4A 2XPYA 3RWEB 1EMTH 1OE3A 3AITA 5K9JL 2XG4B 3B7SA 3OSVA 4U3CA 4NSKA 1QFWH 3FFDB 1VB9A 4B9ZA 2VITB 4LARL 4MXWH 5SWSE 4Y2LA 3U1SL 3N0PB 1OZUA 5DA4A 5SWZB 5IVXB 5DVLA 4EZKA 5A3ID 2IOMA 2R4RL 2W60A 1AJ7H 5HGAB 1AYRA 2AV7A 1BLIA 3HN5A 1A7QH 3IT8D 4D9QE 5DJAB 3LRHA 4HK3J 1PD0A 4ZMPA 1PZ5A 5HD8D 3ELAT 4K3GA 4WGVB 2V2WA 4UIKL 2H5UA 4X98B 3V0WL 3OJ2C 3O4LD 2FJGB 1HQRA 5MI0C 3MNVA 3FTXA 3U4EA 1B2WL 4IKKA 5IEKB 4LGSB 3SJVE 2OSLB 2H2SC 3I6SA 1L9NA 1FC1A 2H8PB 1NANI 3K46A 3LNHA 3SDAA 4AMXA 2AKRB 5EIIA 1V7NH 3KDMA 5L8JB 5E08L 3QA3B 2N1TE 5C0JB 4LQ1A 4XMUA 2WINB 1MVUB 1I9IL 2X7LA 3PWUB 3VRJB 3QORC 4ZMOA 2B15A 2TRHA 2NOYA 3ZE0F 1BF8A 1U8KB 4Q7DA 3GK8L 3EYUL 3ZTJG 1NMAH 4PS4H 2ZSWB 3CIAA 4TLSA 4ZO7A 5DJDA 5BZZA 1T83C 2Y07L 3Q05A 3LKOA 1YUHB 4LSDA 2Y7LA 3SDCA 5KSVB 2IDFA 4E41B 3VI4E 5BO1H 1JTPA 2DQDL 4NKOA 1F11B 4OAWB 2WTOA 4ONOA 5LNEA 5A2CA 5LWYL 4M00A 4LP4A 1OARH 3HUJE 2KLTA 4EDXA 3TEUA 3UZQA 3V5HA 2HFEA 3C5ZC 5JR1H 1TYEB 2ZUSA 2BCMA 1YYML 4CC1A 3PJSB 2IGFH 1W6WA 4MTMA 4U3SB 4YSSA 3ZU8A 3HVNA 1JNNH 3EDJA 2HTKC 4DTGL 4ERSH 5E6IC 5JHDB 3D9AL 2XPGA 1ZV5A 4Y89A 1E50A 5EFIA 5KVDH 4L3EB 5DUPH 5LBVA 1QA9A 2UZYA 1RUKL 4W9CC 5FYKU 2FECL 3TJHD 1T5KA 1CGVA 3STLB 5AZEH 5HGHA 3PYCA 3G5YB 4NO5B 1CR9H 2BSBA 2EECA 1R5VB 1OM9A 1X5KA 5IT2L 1QLEH 5E70A 2AEWA 1ZLUH 4QF1A 4CU6A 3NJMA 4UQIM 3Q43A 5JA8B 2JTDA 5D8JL 2DQFB 3V0EA 3ZDYB 3CPLA 3R4RA 2OL3B 2AJSH 5I9QC 1L9QA 2X3AA 5FAAA 1H9DA 1OP9A 3K8KA 3ULSB 2FT8A 2BMKB 5FW7A 4TNGA 1JXJA 2ICCA 1UASA 1I8IB 2VLJA 3WSQL 3BESR 5LDSA 1A4KB 2LAAA 5AWNH 2EP6A 3A5VA 4PJXB 3VQ2C 2XWBB 1X5HA 5K9QG 1XH1A 4NUPA 3D3VD 1MFEH 1HJBC 3L3KB 1DYZA 4IK6A 3DWTA 5DMIH 4MYPA 3ABMB 2I9LB 1KCVL 1NGXB 1GXEA 4WWID 1BMGA 3OF6A 4QHNB 4YL9A 1ITBB 2CK0L 4G8GD 2KQNA 1U58B 4LB8A 2BWIA 5AVZB 4LT7A 3F2LA 3SDDA 2FR4B 4YE4H 1ZV9A 4DP2X 3ULUL 3P4NA 2AQRA 4G9FA 5CLTA 1USQA 4BA0A 1KEGL 1PFOA 1SJVA 3BVNA 1U42A 5ID0A 3MRKA 2RGSA 4IRJC 3VYPA 3DKHA 3SE8L 2CBOA 1JS4A 2HVKB 1JGVH 4ZS7H 4KRPB 5D1ZI 1D9KC 3H8NA 3D30A 3RBGA 2XN2A 3F7KA 4PJGA 5FM8A 1G5GA 3VU1A 1SJMA 3FZUC 4NO3A 1J10A 1YN6A 2J3SA 4N5EC 3QEQD 4Q2ZA 3UIZA 4N0CD 4Q89A 1R0AL 3WUWB 5DD0L 1KCSH 1Q0EA 4MQSB 2R7EB 1JRHI 4WI4A 4WDIB 3MV8E 1BVKA 4X4ZA 2HWZH 4LHUA 2UX7A 1AKJA 1KC5H 2COQA 4QOKD 3WFCH 2YWYA 1NUGA 1TYJA 1PYWA 4GW5B 4ODBD 5KAQG 3AS2A 5DRNB 3BP7A 4TVPD 1X7TA 5DURD 1DE4B 2R1XB 4PWIA 2AXHA 3PQYB 3EXJA 3BE1L 3RPKA 5LCVA 1A7NH 4JFZH 1IBZA 1A1NA 4LAQH 5EU3A 4WIQA 2IWGA 2P43B 5FR3A 2BNRB 2FGWL 4L9LC 5EO0B 5KYUB 4M03A 1PTZA 3KBFA 4WW2B 4IJ3C 4MNHB 3GEWB 1I7RB 3IRPX 1IBBA 3W9EB 2VLKA 1GJIA 5TE4L 1YECL 3BUIA 3UCRA 1SN2A 3IDGB 5I1EH 3CZKA 4OCWL 2W0PA 4DGYH 4PRHE 5IEHB 3T1WA 3U46B 5M7QA 4RQQB 2A4EA 2W9EL 1MCPL 3RNQB 3TC9A 5CWSB 4HDIA 1KYAA 2YEVB 1ML0A 4U6HB 3D85A 2C9AA 3ABLB 5HYJA 1EJOH 3LZFH 2WZAA 4KK5C 4U1GB 2QQKH 5LCVL 2H2SD 2Z34A 4TVUA 4F24A 1DQQB 3CMGA 3RB7A 5EIIG 4F58H 3MRBB 4L8DA 4M62H 3GKWL 1ORSA 1AE6H 1OAXL 2QLVB 1T2XA 2ODIA 1AQKH 1DANU 1U3ZA 4MFHA 3Q01A 3QORD 4TQ8A 3NCXA 4P2QA 1J9TA 1YEDB 4PVNA 5D5ME 3ZVVA 1M71A 4BCZA 3SPCA 5JDSB 3PP3H 1NFIA 1XZ0B 1QRKA 2EICA 3IPBA 3D69A 3A67L 3H1ZA 4ODXB 4WV1A 4O00A 3ECVA 1M9WA 2QPFA 4F92B 3SCMC 2EKSA 2AK4D 1V27A 1U9KA 4PJ9C 1CD1B 5AB1A 3E0GA 3EHBB 3UAFA 1YEFH 1K6QL 3C5ZD 4ZD3H 2FDBP 4IBYA 3G04A 5HHMD 1ZSDA 3WY1A 3C6LC 4PGDA 1HDMA 1SDAB 1J5CA 4JRWA 4B7LA 3NJHA 2HTKD 1ZD6A 3REWA 2OW6A 1Y0LA 4GAJL 5E6ID 2CO2A 2ATPA 1S7RB 2VDRL 1HEJC 1MXGA 2PW2B 2ENSA 4YSRA 2G0KA 1F8TH 4PGCB 4OZGF 3ARFA 3V6OC 2ZQKA 1BOYA 4NZ8A 4FTVE 3JXAA 1SQ2N 2XICA 4S1SL 4NUJA 2FATL 3VFVA 4CC4A 4M7KH 2G0LA 5HDRA 3VCLB 5F7HA 1P4UA 4BSWB 2Q76B 1AGFA 3C09B 3MRDA 5HHOD 4LPXA 3V5KB 4BGLA 2BINA 5TGBA 5EBLA 2DM7A 5LXVA 1F6FB 2MCPH 4G42B 5IFAL 3QDGD 3HS0A 2VM9A 4XOBA 3B6SA 5I8CB 3S4SA 2OR8A 3Q6GL 3KHOA 2CA4A 3L3GB 5EZIL 5IR1B 1SF5A 3HI6H 43C9A 5EBMB 3N42B 1V3JA 4HUVB 3T5WA 2X87A 1U30A 4RESB 4FEIA 4OIAA 2ZOOA 4BV1A 3LEVH 1QSFD 1NAML 1NMCB 3Q2VA 3BGMA 3FSZA 3G6JA 4WGWB 2MPVA 3OB8A 3LZPA 4JQIH 5KYYA 3JYCA 4AYSA 4P2RE 1WBYA 2OI9B 1MFVA 4EIZC 3A24A 5D6CA 2MOVA 5IHZB 3G6AB 4N8VA 4FLSA 4Z7UA 5FM5O 3V0VA 2CDGA 4N3UA 4GSRA 3DTXB 4HLZH 1BP3B 3FULA 1R5IB 2F8VA 4G7QB 5TDPB 2OJZH 2E3VA 4XNDA 3U4AA 1TPXC 1IKOP 1XCWA 4GFTB 1GH7A 5IBUB 4BSJA 2IV9A 3LVEA 5EU6A 5HHNA 5IFJA 4WLCA 4NQXB 4O9HH 1JNHA 4IRJD 3E6FB 2XNAA 5DJZA 2RTTA 2WO2B 5DJ6B 2VABB 4ONHB 4HCRH 5E94A 1D7CA 1ZANL 3QXAB 1D9KD 3KGUA 4MHHI 3MU3A 3RX9A 1SOXA 3NVQA 4HWNA 3TH2T 5I18L 1EFXA 1LP9F 3LV3A 4DW2L 3FZUD 2BSTB 4X7TB 1UB6B 4LEXH 3I2CL 4N5ED 1HSBA 2QJDA 3MV7B 1DBBL 3V6ZB 5I30L 1GY1A 2RHEA 5MEOA 2AITA 3CFUA 2YR3A 4D8PA 4UB0L 4HPYH 1REIA 2UXTA 2IDQA 3HLAA 5INCA 4MS6A 3MUJA 4B7IA 1LO2L 1G7QA 5E8DL 5HI4C 4OCYL 2WXNA 5A2JH 4N4YB 4AGMA 3K6SA 3BPNB 4MRBA 2LABA 3RWHB 2EYSA 3JTSA 4ZYKB 3CDZB 4LCWB 1HXMB 5E8PA 1QEXA 3VXSA 4N0FA 4GH7B 4Y2OA 5D2LB 5C97A 4H20H 1U6AL 3MV01 5GRUL 2FQFA 2BIIA 3F64A 2YRBA 3ROOB 3N1MC 2J1YA 2PYFA 4BZ2H 3C08H 1NPJA 1NBZB 4MAYB 4IGBC 1E90A 4FQIH 4P4RA 1A21A 5A6MA 1ZPLA 3ZZLA 1F58L 1U3HB 2WXJA 1T7XA 1EDYA 4BK5C 1TIUA 3MRPA 3QRGL 4QCIA 2E9GA 5FM4A 3IDUA 4PJ7A 4B5EA 1AY1L 3PHOA 4YVNA 4DK5A 4PBDA 1FSKC 4NN5B 5H4ZA 2HP4A 1T2JA 5SX4I 3TA3B 4B0MM 4EN3B 4JO1H 3ZPDA 2IADB 4KK5D 3TV3H 2IXQA 1T5XB 4JO2L 2NPLX 3QJXA 4MZRA 1W91A 1DJSA 1XHHA 2DS4A 2OSXA 4NCC1 2XN9B 3FN9A 3HIZA 1S9WA 1CFMA 1CO1A 2NY7L 2XFGB 3IJSB 4YSTA 3RZCB 3L9BA 2VKXA 3AY4C 4F7PB 1LL1A 4LSUL 1KZQA 1PZSA 4JUTA 3F12B 4KO9A 2CIKB 2H3NB 3B3BA 2YPVA 1QLEB 4UOQA 4XOCA 1IILE 3T2QA 4LGRB 5F96L 3MLSH 3PL6A 2V9QA 2XZCL 2YN5A 4MMXC 4XGZB 2XTSA 4U3XA 4FXGB 5AAPA 3ZO0A 3MKGA 2DYSB 2OJEA 3OAUL 4I9XA 3SCMD 4NHCH 4KXAA 1VDGA 3RJOA 4PJ9D 1NINA 3NZ8B 1CTNA 4PRAB 2ZONA 3K81A 1ZLVH 3QCTH 2ATAA 3SN6N 4XVUC 5IQMA 1G9MC 2RBLA 4AUYA 1Q9OA 1M6OA 3MRLB 4I4WB 1QWNA 4ELKB 1XR8B 3C6LD 1DLHB 2WLYA 4QRQA 4YSPA 2ISDA 4HHGA 3LDBB 5GGVY 2VB5A 3IB4A 2P80D 1DUYA 1M57B 3P73A 4AG4H 4UF7C 5L4FA 2Q5BA 4NZFA 2F8OA 4JO4H 5GRZA 1ACYH 2YPVL 4YSEA 3IDJB 4LCCC 3MJ9H 2VM4A 3AWGA 2IQ9L 1R9FA 3G6JE 3FT4A 3MACL 4HJTA 5FYJU 1NCGA 5T1JA 4JPQA 1ID2A 1UWGH 2YLKA 5FLUA 2ZCHH 4IDLA 4LPVA 4UT6A 3FQTB 1HIMH 1KNOB 4NQDB 1A1MA 4XPBL 3VFMB 3HG1A 4H8WL 5SWQA 2C7FA 2FAUA 5I26A 2EADA 2XLLA 2BSED 1DL7H 2NY4C 4AMWA 1XCQB 2N3JA 1JN6B 3NAAH 2QVFB 3S4SG 3FQ2A 1WAAA 1JPFB 2R1WA 1H8OA 1RZPA 4FEMA 5EU6E 4LOEA 3P3SA 4HEPA 2FRGP 2A38A 3D05A 4M7LT 2JELH 1ES0B 2C4FU 2E5EA 3NCEB 4QXGL 2IPKA 3ZKXB 1MQKH 1QHOA 3AG4B 3BH9B 3FT2B 2X4TB 1IM9D 5DXWA 5ISZA 3RDJA 4EQ2A 4U1HA 5KS9F 2WJ7A 4LEBA 5IQ9A 2DQGH 2IH3A 1F3RB 1WTLA 3V5DA 3VI4F 1TZHA 2ZXQA 4N8VG 1A65A 4B5ZA 3R19A 3JVGA 1BFOB 2P47B 4GUPB 2B14A 3LAFA 4UT6L 4A7GF 3PV6B 1XD1A 4K94H 2W0LA 4P5RA 5K9KB 2AABL 1QNIA 3EJSA 2WXKA 2VW4A 1O7DE 4H26A 2BOBB 3MJ7A 4MA7L 4CADA 2R8SL 3FN0L 3MV9D 5JPMC 1JHKH 2Q3AA 4GMSH 3KPOB 4FLOA 4OD1L 3SGEI 1JD7A 2Q7YA 1MI5B 4FULA 1FNSL 4JAMB 4RX4A 3K1DA 2IBZX 5GZOC 5T1KB 4L1HA 5TFSL 3CFCL 3K4DA 4HPOH 3FAWA 3GWJA 5C86A 5CCJA 1J8HB 4S1RL 1TJIH 4L23A 4BKLA 1QBML 1FH5L 2EABA 3JT2A 4PRBB 5D1XE 3WE1A 4WEBL 2K1MA 3I02A 3LZQA 3OKOA 1T1WA 3NRPA 5EUKB 2UWEA 4LEEA 2KYIA 1MJJB 3H9SD 4GSDL 5AD0B 4DKTA 4MD5A 1C5CH 4UNTA 4JFDB 4FQJH 1HOCB 4PJ7E 3SE9H 2K4AA 3ZK0A 3QK0A 5DHVA 5HI4D 3DRQA 3WL9B 4RA3A 2RB8A 1WCBA 2P7TB 4NX0A 3C5JB 1OXYA 4ORGB 4EKJA 3V79C 3TIDB 1QACA 2WWNA 4Z7IA 5I73B 3MUZ1