2Q5BA

High resolution structure of plastocyanin from phormidium laminosum
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
b'ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
molecule tags Electron transport
source organism Phormidium laminosum
publication title Plastocyanin at high resolution from Phormidium laminosum and the double mutant D44A, D45A
rcsb
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2q5bA00
4DPBX 3T71A 1NWOA 2XV3A 2R7EA 4W9ZA 5I5MA 2UX6A 4YSPA 1ZV2A 2OV0A 4GY4A 5I26A 3OMAB 3UACA 2JKWA 2YAMA 3C75A 3TBBA 1SDDA 2CAKA 1AZNA 4AI7A 1RKRA 2FTAA 3D12B 1ET8A 2FQEA 2J5WA 4EF3A 5A7EA 1BQRA 3NT0A 3FQ1A 2GSMB 5B7EA 3ZIYA 4HHWA 3WKQA 3NJNA 2UXGA 3PPSA 1NDTA 1JZIA 1BEXA 2LLNA 4JHVA 1AQ8A 1B3IA 2AZAA 1ZDQA 2DYRB 4DPCX 2GC7C 2ZONA 2DV6A 1QLEB 4A67A 1YLBB 4M4RB 1J9SA 1MZYA 3NP3A 4YVUA 4GP4B 5PCYA 4E9WA 1SHXA 1ET5A 4HALA 1CC3A 3HB3B 3CVCA 3T6VA 1PNDA 3SBRA 3CVBA 3PXLA 3OD3A 1E5ZA 4QLWA 4NERA 1AZUA 4X4KA 4WKXA 1KGYE 2IH9A 4BWTA 1SFHA 2UXFA 2VMJA 2YARA 4CSPA 1MG3C 1PLBA 2VN3A 3N2JA 2YQBA 1FWXA 3CDZA 5B7MA 1ILSA 1A3ZA 4F2FA 5B3SB 2RACA 1QNIA 1X9UA 4YSQA 4KO6A 1N70A 1T5KA 1BQKA 1HAWA 1MZZA 4YSRA 2YAHA 3IBOA 3S8GB 3CVDA 4YSOA 5F7AA 1ASOA 2ZOOA 4E9VA 1OE1A 4HAKA 2FQFA 2BHFA 3FQ2A 2AFNA 2WSDA 3OQRA 2CCWA 4QKTA 3S3CB 1ZPUA 3ZBMA 4DP4X 2BO0A 1TEFA 2W8CA 5AZUA 3IN2A 3QPKA 5I6LA 1XB8A 4PAZA 2X88A 4FAAB 1A4AA 2PCFA 1NINA 1W6LA 2H47C 2IWFA 3QJRB 1KBWA 2BP8A 2PPEA 3BQVA 5B7FA 4MFHA 3ABLB 1A65A 3FU9A 1L9SA 1TU2A 1ZDSA 2EINB 4K9JA 2IDSA 4KNUA 3AG3B 1OE2A 3IN0A 2UXTA 1AACA 4A2DA 2BWDA 1GS6X 5B1KA 3FSWA 3NJKA 4N8UA 1IBYA 4AKQA 5EHFA 1SJMA 3OMNB 1BQ5A 1M56B 1FA4A 3NJIA 3FQYA 2TSAA 4YSTA 1WS8A 3T6ZA 2PP8A 4AX3A 2EIJB 3FSVA 7PAZA 3PLYA 4HZ1A 5B1BB 2W88A 1OCRB 3WNIA 5I6MA 4L0PB 1KYAA 4ZK8A 1L9RA 1WAEA 2J57A 1AANA 1V10A 2HX9A 3FPXA 1JOIA 4GXFA 4KNTA 1ILUA 1PZCA 4DP9X 3BVDB 3ABGA 1NZRA 1E65A 3AG2B 3S3BB 4F7KA 3ABKB 2BZ7A 1L9TA 4NB7A 1L9PA 4DP5X 2PLTA 2XX0A 3WI9A 2B08A 4ENZA 2IDUA 4HCIA 6PCYA 1JVLA 2I7SA 5I5IA 2GBAA 2XV0A 4YSDA 1PMYA 4G7SB 1IUZA 1HAUA 5I6KA 4BDVB 2WO3B 2P80D 3OM3B 2IDQA 3NJFA 1XMEB 3PAVA 1BXVA 1M9WA 3SBQA 5TK4A 1XB6A 1E30A 1AS6A 4FA7B 5I6PA 3AW5A 4YVNA 2FQGA 3FU7B 3TU6A 1PF3A 2QPDB 3S3DB 4YSUA 2XX1A 1JZEA 3X2QB 1PAZA 3NJJA 1NPJA 2E86A 2BWIA 5I5JA 3UGEA 1W8EA 1NIBA 1KCWA 1MDAA 4UAHA 3DTUB 2AVFA 2XYBA 3T6WA 3AY2A 4PCYA 1NICA 2HXAA 3IEAA 5D4IA 1AG0A 1J5DA 9PCYA 1FFTB 1JZHA 2XXGA 1DZ0A 1RZPA 1URIA 2IDTA 3AZUA 3CG8A 1GYCA 4G72B 4A2GA 4KO7A 1OE3A 1MG2C 2ZXWB 3FSZA 1AS7A 1RCYA 2FJSA 1SNRA 2YXVA 3QJTB 2JXMA 3NJLA 2VW7A 2DWSA 3WKPA 1IBZA 4BXVA 1GR7A 2HLEB 4E9XA 1PZAA 1AOZA 2FT7A 2IWEA 1SF5A 2NRDA 1OOWA 2YXWA 4KNSA 3JT2A 1ASQA 4Q89A 1ETJA 2FT6A 1QHQA 4E9YA 1IKOP 1NWPA 3UABA 2J56A 5ANHA 2GC4C 4HCGA 1A4BA 1BYPA 4A66A 1NIFA 6PAZA 4UF7C 4BWWA 3NYKA 3FS9A 2BP0B 2Y69B 1OCCB 3DKHA 1SDDB 3T6XA 2CBPA 1SFDA 3L45A 3V9CA 2HRHA 5I6NA 3NSCA 2XU9A 1J9RA 4GP8B 1CYWA 1VLXA 1PNCA 5PAZA 1V55B 1PLAA 2OJ1A 3NSDA 1WA2X 1AS8A 2DY2A 3TA4D 2JFCA 5TK2A 2UXVA 3X1FA 3TBCA 1IC0A 1ASPA 1L9OA 2XWZA 1WA1X 3ASOB 3FYIB 4UANA 4YSCA 3PAZA 2B3IA 4G71B 4DPAX 2IDFA 4BWUA 3EF4A 4G7QB 1GY2A 1TKWA 3HEIB 5B1AB 3PCYA 3WG7B 3G5WA 2BP0A 1ID2A 2BW4A 4P5SA 3UAEA 2PPFA 1M57B 1W6WA 2PCYA 3ZDWA 3SBPA 2YAFA 4E9QA 3FSAA 1E5YA 3EHBB 1CUOA 3T9WA 3GDCA 2VSKB 1ET7A 2YAEA 3X1EA 3QJQB 2Y1AA 4A2FA 1OCZB 2DWTA 4E9RA 4YSEA 5IY5B 4F2EA 4KO5A 3OMIB 1XB3A 1KDJA 2X87A 4BK5C 1SF3A 1N68A 4E9SA 1E67A 8PAZA 4DP6X 2TSBA 4M3HA 3NSFA 3FU7A 3NP4A 1BYOA 1NPNA 4DP0X 1I53A 1AG6A 1J5CA 2QDVA 3EH4B 3FYEB 2AANA 3KW7A 4AKPA 4Q8BA 2P80A 3V9EA 2QDWA 3U25A 1OV8A 1R1CA 1CYXA 2GI0A 1PLCA 2CUAA 2YAOA 2FWLB 1JVOA 3H56A 1KCBA 5FC9A 1BAWA 1EZLA 1JXFA 2UX7A 1AZCA 1BXUA 2HZHA 3SQRA 2PP9A 3MBWB 2YAPA 1DYZA 2GHZA 3ZX1A 3ERXA 2J55A 3KW8A 2AZUA 3DIVA 1PCSA 4JHUA 2VW4A 2VSMB 3X1NA 2N0MA 1KBVA 2YAQA 1A8ZA 2GB2A 2GIMA 1GW0A 2PPCA 1AR1B 2I85A 4YL4A 3QJUB 1NTDA 2XUWA 2MRYA 3N55A 4DP7X 2OCCB 7PCYA 1WS7A 3AG1B 3FU8A 1WA0X 3PAUA 5I28A 2I7OA 1PY0A 3X1GA 1PZBA 3FPYA 3ABMB 5AKRA 1UATA 3WIAA 2EIKB 2IH8A 3QJSB 2H5UA 1CURA 1JZFA 3FT0A 4RH4A 1HFUA 3NSYA 3GYRA 1TEGA 1EHKB 4KOBA 2HX8A 1AZRA 3IE9A 2HRGA 3TASA 1NIAA 1KV7A 3AG4B 3NJGA 1AAJA 2BZCA 3QQXA 2BW5A 5E9NA 2VM4A 5F7BA 4BXSV 3H4HA 2FQDA 1ZIBA 2WO2B 4HHGA 2CJ3A 5D4JA 4AKOA 2QPEB 4HCFA 1V54B 2CALA 2EILB 2H3XC 2IWKA 4GYBA 4CSZA 2Q9OA 3RYMA 1F56A 4HIPA 5I6OA 3S8FB 5D4HA 4G7RB 1JZJA 2R7EB 1NIDA 4BDVA 1JERA 2XLLA 1AIZA 2PP7A 3CDZB 2EIMB 2VM3A 2XXFA 2HX7A 5B1JC 1J9TA 4NAJA 2XVBA 1RZQA 4YSSA 3JTBA 4JKNA 2BP8B 3GXUB 4E9TA 1SHWA 2Q5BA 2PPAA 1A4CA 1OF0A 5LDUA 4WTQA 3QJVB 4G70B 1GSKA 3UAAA 4YSAA 4GP5B 4A68A 1X9RA 1JXDA 3H4FA 4DP2X 1ADWA 1OCOB 2XV2A 2DYSB 4KO9A 1KDIA 3MX0B 2A3TA 1L9QA 2VW6A 2QT6A 4DP1X 3UADA 3NJMA 2PPDA 3CZUB 1J9QA 4A2EA 5B1JA 1AZBA 2MTAA 3EH5B 3EH3B 2ZWNA 4W1TA 2FT8A 1JZGA 4A2HA 3ASNB 4DP8X 1GS7A 4N4YB 3X1BA 1JXGA 4AZUA 1GS8A 1NIEA 2IAAC 3NJHA 4KOCA 4TXVB 1BXAA 1ZIAA 2FNWA 4P5RA 5AFAA 3WNJA 1GY1A
chains in the Genus database with same CATH superfamily
4PJCB 4PSRA 1G5GA 1EMTL 2EDOA 4MD5B 3ZHNA 2OV0A 3PHAA 4Z7QF 43C9A 3ULUL 3FQWB 4P48A 2HJLB 5DO2D 2YAMA 3EJTA 4KXZI 3TBBA 3GJFK 3LEXB 4G6FD 4HWBH 4XNZB 4JN1L 1U3HA 1OB1B 1PX3A 3BFWA 1YNLH 1BQRA 3E38A 3JUZA 2F5BH 3W5MA 3TF7C 1MWAL 3FUFA 4ZX4A 4ZFOL 3BMVA 4UOQA 4AZ8B 3WLWC 2QEJA 1FFOB 4BZ2A 1GGYA 1NM9A 3OWEA 3ARFC 4XP5L 2H45A 5KS9E 4H26A 4JM2A 1TTRA 5I1IH 3EYFA 1QLEB 4JRYB 3SDDD 3G5VA 2WKOF 2BSDA 3MREB 4W93A 3QWNA 5DD0H 3QQNA 3P0YH 4MVBD 3O4LE 1G84A 1SM3H 5D7IB 4NM4L 5DJZB 5AYQA 3MAWA 3FO9B 2WP3O 4JO5A 1FI8C 4LVEA 2V9QA 1S78C 4LVOB 5ICUA 2C4FU 2E0PA 2VAJA 4UZUA 3CZNA 3R19A 2FL5B 5CNHA 3VG0H 2V7HB 4F92B 3V6ZB 4ELMB 1NMBH 2ZKHH 1KXVC 1TVHA 3RVVD 3W39A 3HC3L 4UTBL 5ITBL 4OUUB 2OZNA 2BNRE 4DGWC 3LKOB 3QZBA 4YSQA 2FHCA 1FH5H 4FMVA 2OX5B 5SX5H 1QG3A 5DRNB 1VEPA 3P4OB 2Z34A 3CVDA 3TYGL 5KSUB 4UQDA 3CFCH 4DEWA 5H35A 1PEZA 4BGDA 3BZEA 4PR5A 5ALBL 4ZZFA 3RA7H 5C08A 5C9JB 3AM8C 4U3HA 4WHYG 5BRPA 4NT6B 4TVSa 2AW2A 3EHBD 3L1OH 5D7IA 5CBEA 3BQUA 4ODSL 1NQBA 3B3IA 3WMQA 4JVWA 5E4AA 1INDH 3BZFB 3FTSA 2OL3A 3S3CB 4NUGL 3FQTB 3ARDB 5KS9F 1G9HA 3CXFA 5EUKA 2FO4A 1U8KB 3CFDB 1NINA 2E9BA 4RMVA 3KLHD 3VVWA 2IWFA 4KQ3H 3CMOL 1A65A 3FU9A 3KLAB 2EINB 3QEUB 4HXAL 3W39B 3GK8L 1WFUA 2OL3H 4KC3B 1MCEA 2H3KA 5KYYA 5ADOL 2VITA 4P57A 3ZE2E 1EEZA 3AREC 4CMHB 3AM8A 2K6ZA 3MFGB 5ICYB 3IMWA 4KK6C 4AKQA 5SWSB 2P5EA 5J6GA 2OTWB 4ZW7A 4B9KC 1FA4A 4TVPE 3D3VE 4OCMC 1QQDA 4BSJA 4KZEL 2YD3A 5LCVH 2ORBH 3UP6A 2QVFB 3QUXC 1FJ1A 2VH5H 4OV5A 3OL2A 4EBQH 3L3JB 5K59F 4JO2H 5HDOA 2VLRE 4PB9H 5C6PB 3HG3A 5DR5H 4ZXBA 3ARQA 2X6CA 5IVZA 2R27A 3F12B 4QGTA 3CTTA 4M1CC 3VMPA 4TN9A 2DMGA 1S7QB 1RH8A 1NEZA 4E42A 3OR6A 1DBJL 1U6AH 2XX0A 4XGZA 5CZXD 4WU7B 4ZFQA 5C09D 3TH2T 3KLLA 4X9YA 5IFHL 2VQ4A 3JTTB 1EEZB 1IGIL 5J1AB 2XQBL 1PMYA 2NXYC 2DI9A 1AE6L 4TOYL 1WD9A 4M6OH 4N1EA 1A4KA 2CMRL 2IV8A 5AD0A 5BNXD 4E36A 2P5EB 2P80D 4JHAH 1U8HA 5J6GB 2VQ1A 2A74B 1M9WA 3T0AA 1IFHL 4DK5A 1CG9B 1AS6A 3KYNA 4GXVL 4N5ED 2NW3A 4YBLB 1ZV9A 4HFUL 5SWQB 15C8H 1NCTA 1XH3A 2EDNA 3FU7B 4R84A 4EE2A 2X4TA 1FFNA 2GITA 5JZ7D 3BE1L 4OFKA 1BWWA 2NY5H 4OF5A 4ZXBB 3MRQA 4QRSA 3U0WH 3VSUA 3NBNA 3B8SA 3I9AA 3IU4L 3HG2A 1K8DB 3DTUB 4HQQL 2XYBA 5A16A 1T0MB 3AY2A 3OKYA 1G7HB 5L0QB 2O6EA 3MLWH 1IKNC 3NIFB 3MROA 2AI0L 5GRWA 4PLJC 5FYKL 4LSVH 4YUEH 1G9NH 3BAYA 3FB5B 1URIA 3MA9L 3ULVC 3ARGC 5C0FB 2FWUA 4ELME 2BNQD 1UJ3A 2CBOA 5M94B 2AJZA 1DQVA 3EYUL 4G1EB 4LBEB 5CEZH 2ADIA 5JUEL 1OQXA 4NSKB 2JWYA 1OOWA 2AABH 5D1ZC 1ETJA 2QSQA 5EU6B 3O0LA 3ZZSA 3NZHH 5MP6H 2J56A 3CFMA 2R2BA 3QIBC 1S3KL 1A9BA 3QDME 1WZAA 4URTB 1A4BA 1OGPA 3A4DA 3SPIA 4MNGA 3QVAA 4N8CH 3PDOA 1KFGA 4X9BA 3X12A 4BWWA 4J3VA 1TQWA 2Y69B 3FS9A 5DVMA 1EJOH 3NIGE 4A1RA 4R0LC 5D7LB 2COQA 4UNVA 4GMSH 5I0VA 5JW3H 3L45A 3HC4L 3V9CA 1JGDB 3ECQA 4PJBE 1MFUA 2EAEA 1YCSA 3VQLA 3IFLH 4PRHB 3VFMB 4Y19D 4EZKA 4RMQA 3GJFH 1DVFD 1G5AA 1ID5I 3B2VL 3IDIA 4P07A 3EBGA 3VD3A 3W0WD 1AGEB 4DKDC 4LOUC 2HVKA 2C34A 1FBIH 4L18A 1YYMH 4C58B 4GKNA 2IALB 1M7XA 2MOQA 2AK1H 4PJ5B 4MNHA 4GRWE 3FB7B 5EUOF 5AKTA 3QFDB 3QRLA 1BZ9A 4JFUA 4F37K 3V0EA 3G6JA 4G3YH 1RJYA 3NA4A 3HN8A 1EFXD 3BDXA 4G8EA 5DD1L 2IAMA 2JKJA 4ELMF 1TETH 3ESVF 5B1AB 3L3GA 2Y9RT 5DZOA 5IM7A 2DYPB 4YHKL 4KXAA 3ULVF 1BCIA 5KVGE 3PJSA 4Q6IC 2X4PB 3WSQL 3CU7A 3JWNC 3TT3L 3VI3F 3EDKA 3DGGB 3PXHA 3BESR 1JGIA 3EHBB 4PRHA 3T9WA 5IHWA 3EDEA 4I89A 4EZJA 5F2FA 5IJVB 3IDGB 4KKNA 2ZJSH 1R3KA 3UG4A 1B6UA 4GLRI 5AVUB 5C08E 1R9FA 1HE8A 1E0OB 4L3FA 2E9IA 4WWNA 2HFEB 4PGJA 1O6SB 1YMMB 3BVXA 2DQUL 1OD9A 32C2A 5DTFA 2ZCKL 4Z7UE 5I75B 2PCXA 2BSCA 3T1FB 4N24A 1MPAH 1C12B 1MAKA 3HUJA 4K9EL 4JFFD 1HHJA 3TCTA 3CPLB 4HUUB 3O3AA 4K15A 1AXSA 1IC1A 3MRRB 5IW6A 3SHSA 4L3AA 2P80A 3H9HA 5DJCA 1KTLA 2X4PA 1W8NA 5EC1A 3S48A 1ZKAA 3FO0L 1L9MA 1U93A 5T1DL 1ZLUH 4GG8B 4M9OA 5FC9A 1S5IH 3MV9B 4HS6A 3RNKA 1CFVL 1FV1B 3DX0A 4OLUL 1JMXA 3ESMA 3DIFB 3S8WA 1JXFA 2R2EA 4PJ7E 3O11A 2PP9A 5C08D 1NDMB 2ISDA 4B7IA 2C8NA 1U58A 4NHCH 5HYJA 3DOIA 3OR7B 4UMGA 4IBUA 2Z92B 5C0BE 2YPLE 3G5XA 3GDBA 1KXTB 4FTVA 1AHWB 1NJ9B 1AY1L 4PFEA 3TH3T 5GRJL 1ZXKA 3BGFC 3FTGB 2MQ3A 3EFOA 5LGJB 2B39A 1BMZA 3OLDA 4PJGF 1RL1A 1G9ML 3W0WE 4FHJA 4WDIB 2AC0A 2BDNH 2JKTM 2NT0A 3W5NA 3CN3A 1M3JA 1UZ8B 2ICCA 4X6CF 1CTNA 1XH0A 2V17H 2DI8A 4G7VH 4K7PX 1GCYA 3PWJA 4PJ9B 4X9GA 4ZO6A 4HA1A 2X05A 3RDTA 1Q0XH 5GS0L 4Y8DC 1DLFH 1T1XB 2NZ9D 5C0CE 2JNZA 2I9TA 2QFPA 3VWKD 3VI4F 1ZA3B 3AC0A 1UXMA 4I5BB 3L5WB 1RHFA 5K9JH 1YEEL 2XQYA 3HPLA 5L8JB 3WTWA 4HOXA 3IDYB 4HEPA 5AVRB 1F3DJ 1F8TH 3KWTA 1PKQB 2BVQB 3TBSA 5DDHA 3ZMNA 3CZGA 4NCDA 3RWGA 4UM9D 5KZCB 2OR9H 5GZOD 1QLFA 2XTJB 5FGCE 3IMTA 3WFDH 5F88A 2X5PA 1KC5L 1XTLA 5LN4A 3TASA 3EFOB 5SWZB 3LJ3A 2BZCA 3L81A 3Q8CA 1XAKA 2GBUA 1GYAA 4NZRH 2WZ0A 2CJ3A 2VUYA 4M4PA 1NCAL 5JIKA 2CALA 3OKKB 2EILB 2Z93B 3QNYB 2FO1A 5FOBA 1KFAL 5JA9A 4JG5A 5JR1H 1AR1C 1JWSA 1YN6B 3OXSB 1JZJA 3CHQA 3MJ9H 3V2AR 4FA8A 1RZFH 1JNNL 1IVLA 3QZNA 3Q44A 4HUWB 3BQUC 5FHBL 3CDZB 1VIWA 4MHHG 5D1QB 3X3FH 2D4FA 4JREB 1J9TA 4F8QA 4AYGA 4YSSA 4WEBH 2R1YB 5BO0D 2D7MA 3IJSB 4HDIB 4IMKC 1KBGL 5EC2B 5FYJD 2YPLB 3WDIA 1OF0A 4TUJB 2EDFA 3C9NA 3KGRA 3V4LA 3QEHB 4TV3A 4FFWD 4NQSB 3WJLA 1X9RA 2JTDA 4PBVC 4XNDA 1QPPA 5TF1L 1LILA 3I6KB 4BZ2L 1DVUA 2P5WB 4PJ8D 5CZKA 5DHVH 4NKMB 4W6XB 3ARSA 3PL6C 4KBPA 2CK0H 2HT3C 3U4KA 4JN2B 1E9QA 1NGYB 2NSQA 1XGYH 3QQDA 12E8L 1GC1H 3X17A 1A02N 1BZEA 1L0YA 1JWSB 1YN6A 1JDAA 5HJ3B 4JM2D 2AEQL 2Y07L 4APQA 1JPGA 2ATAA 2B9BA 4ZJ9A 1QHPA 4O5LH 4OF0A 4NJ9H 1QACA 1NIEA 4M5YH 4QHLA 1EX0A 4MAZA 4J6RH 4TXVB 3GFUA 2DQHL 3LZQA 4MMYB 2BOCA 4PWJA 4XMKL 5HDWA 3IWVA 2BNUB 1HXYA 3CSFA 4F8TA 4RGNE 1CVRA 3EUUA 4ZXBC 2PYEA 3VB9A 5HHNB 2AK4A 3MV9E 1EXUB 4J28A 3UTZA 1D7BA 5EZOH 3C9NB 3IJHA 1D2PA 3QEHA 2AMUA 4JM4H 5GHWL 4JFYA 3P11L 1SDDA 2A9ML 2LFEA 3LKSA 4EI0A 5BMFH 2FQEA 2J5WA 2N7BA 3SO3C 4F7EA 2FWOA 4EZMA 2BK8A 4R83A 2L7QA 3WKQA 4HLEA 4JFEE 2WUCL 4NCC2 3MLUH 1CICC 2ARJA 3KDMB 5C2UB 2WQ8A 1L3NA 1GHFH 1N3NA 3BKYH 4BJLA 1I1FA 1L6ZA 2B4CH 3DO3A 2ZOKA 4HG4K 1IT9H 2XN0A 4DPCX 5TF0A 2H3NB 2A73A 2F15A 1T7ZA 5F0PB 4CRPA 3STZA 4ZMNA 1I1YB 4ODHL 4LLWA 3RVWC 3BN3B 1K3ZA 4P2CG 2B59A 3HPJB 4PLOB 3ZKNC 4JDVB 2IQAA 4ECNA 1VCBC 3BH8A 5GISH 5C7XL 3IJHB 5EEVA 3LQMA 3CBKB 4HH9A 4P2OA 4X4KA 2X70A 1IEBA 4L8CB 2EDWA 2EO9A 4WKXA 1QOKA 4AQOA 5F1OB 2Y23A 1WPCA 3CVHB 5IBUB 3S34H 2YBRA 1BIIA 5TQ0H 1AYOA 4R26L 5B39B 3AAZB 4TSCH 3QUXB 3BP4B 3FHAA 3B5HA 3KR3H 4RISH 4E2OA 4NNYA 1IGTA 4OKVA 1I8MA 3MUY1 1T5KA 4X9HA 1BQKA 4NC0B 1MZZA 3DURA 1BX2A 2CLZA 4XC1H 5DEGB 5FCUL 4BELD 2FUQA 2BSRB 3BWUC 2R4RH 4I9WE 3LN5B 2DWYA 5ISZB 1AMYA 4F58H 3WIHA 5BXFA 5E7FA 3OPZH 1FAKT 1GZHA 2FX9L 1B0GA 2RQ8A 4UM8B 3MBWA 5T3ZL 4HVBA 2VZSA 1F3JB 2PO6D 1Z0NA 5IFAH 3IN2A 4OCSL 2FHBA 2XZCH 3BRDA 2ZP8A 4GEJA 2PCFA 4YHMH 2H0EA 3Q6GH 1LK3H 2C3VB 1V3MA 5CCGE 1U8OB 2N4IA 3VXUA 5FHAL 1JHLH 1L9SA 2WIMA 1E5AA 1T1WA 1BF5A 3OTTA 3AG3B 2HLFD 1EBPA 3KAAA 1AACA 4JW3A 3QDMB 2ADGB 2VDPB 3SOBL 3N40F 3HS9A 4PRAA 4ZPTA 4NO5A 5FFLA 1IM3A 2ILLA 2XRAL 1LHZA 1RZ7L 2Z64C 1IBYA 3P9LB 2XIBA 3FQWA 5EUOB 2E8ZA 4HKBB 3OKMB 1QSFE 4XBPA 4HLJA 3NJIA 2IAMC 3FQYA 4XPTL 3TBYA 3GHEL 4PG9B 4YXKL 3PLYA 2OJEA 4LHUD 4C83A 5HGGS 1B4RA 1BZ7B 2BIIA 1S7TA 5I6MA 3ZDZF 1KYAA 2DRUA 4MLIA 8FABB 2VISA 3O9WA 1F3JA 3LD8C 5EOCH 2W0LA 1OANA 4O4YL 2EIZA 1CVSC 1V10A 3BWUF 4WFFE 1HWHB 3DHMA 4M7LH 1DVTA 3X11B 2K4WA 4PGBA 4DOHE 1CZ8H 3ALWA 5D6CA 4RLDA 3MJWA 4NI6A 2BZ7A 4H26B 1ECZA 2PLTA 3G9VA 3VG9B 5CCJA 1S2EA 3M8OH 5CLTA 1YEFL 4O2CA 2PTVA 1D5ZA 4NC2B 4G5ZH 1CXFA 1K2DA 4WHTB 3ZYZA 3TO2A 5EO0A 1H3XA 2BSEA 1T1YA 4P5TC 4AIXA 4BV1A 3S4SA 2WO3B 2M26A 3A6CL 5IVXF 3NOIA 3SKOB 4XBPB 4EN2A 5C86A 3GXDA 3KHOA 3ULUC 3U0TA 2OI9C 1XXFC 4XHJD 2V37A 3AW5A 5EIVA 1NC2B 5D55A 2NY1B 1TCMA 1BGXH 1FFOA 4N0CC 3S3SA 2V3EA 3SYQA 4RGNC 4J3BA 5ESQB 1XWVA 3D39E 4MXQC 3W9EA 4KMQA 4D0BB 5I1JH 1IZJA 4JGMA 4C59B 4JG1L 1UJTA 3ETTA 4K5MA 4PJBA 5I1EL 1UGNA 2MWCA 2VXSH 4X50A 1U95B 1YJDH 1HZKA 1NFIB 3PDDA 1HXMA 4JVUA 1A6UL 1NICA 1L6PA 1SZNA 2G9HB 4LGPB 4WJ5B 4BE5A 1JYXA 2XVLA 1VERA 3D39B 4EDWL 2VDLH 2YK1L 3M17B 4P5MB 3VRJB 4DTGH 2UZIH 1DEEB 3IGAA 2FUTA 4QYOA 4R2GB 3RKDD 3HZYA 5F71A 2FEDC 4NZUH 3CPUA 5DC9B 2ZXWB 1T4WA 4B9YA 3DVFA 2O5XH 5EUOE 2BHYA 2OKMA 2BSSA 3TO4D 1S7RB 2Y3NA 1LDPH 5L0QC 3T04D 2E7LA 1F4XH 1HHIB 4GQZA 4QKXB 1U8KA 3TWCL 4J3XA 4Q89A 2BZDA 2LU7A 4LSSL 3RUGE 4K4KA 3TTYA 3QUYC 4HETA 2LTQB 2WSPA 3J7HA 3WNPA 1ZMYA 2X10A 3QXAB 3R4RA 4DO6A 3DJZA 4N5UA 2EKSA 2OMZB 2P8LA 4M7JH 4APXA 3GI9L 1A6WL 3QUZB 4TUOB 4NT6A 5E8PB 3O3DA 3FB6A 1NOLA 4P5MA 1LO5B 1KJ3H 5DO8A 1P7KA 1NGPH 2DKSA 3CSPA 3DSNB 4FYRA 1XCXA 3CZSA 5IOPB 2D3NA 1KJVA 3BHBB 2J8UB 2EVGA 2EYTB 3QG6B 1PNCA 1IC5L 3QARA 3TONA 4TNFA 3SE8H 1NGZA 5LBSH 5CJBA 5E6RB 1AS8A 1V7NH 3QZPA 3I6SA 2UXVA 3ZE0E 3HG4A 1TFPA 5K9OA 3PABA 5BRZE 2OM5A 4CVZB 4N1HB 2GEEA 3LPFA 1KXVA 1N8ZB 3KYOA 1CB4A 5BW7C 3VXOA 1CFBA 3DVNB 2NPLX 2ED8A 4RMWA 4R5XA 5DRXA 2CBMA 4RETB 4DUVA 1TZHB 2WSKA 3BH4A 3NFPB 2ZNXA 5F7UA 5K39A 3V0FA 4MJID 1Z66A 2VXUL 2FH8A 3BLBA 4KUZH 5JLZB 4C56A 5JW5A 2PPFA 1XZ0A 3QQ9D 2QQQA 4E5XB 2P28B 3IJYB 4KGJA 5HGBA 4NUMA 1CG9A 2F19H 5T3XD 5JOEA 1GGIH 1MJJB 3NSXA 2J8UA 1J8SA 3K72B 1IAII 4NBYB 3UJTL 4BUQA 1I4FB 3QUML 2ZXGA 5D7KE 1RZIA 5D1XC 4YSEA 4ZS7H 1CLVA 4G43B 5J8OA 4NLAA 2VKWA 1DE4A 4DGVL 2EDXA 1F4AA 3PIQA 1E67A 3DXAA 4YR6A 1CIUA 1D6VH 4B53A 4YHOH 5IB4A 2D7TL 4X8GA 1SJEA 4PRPE 1EHAA 2P26A 1IBBA 1Z32X 3RBGA 4Y7MA 4WJG3 3T0ED 5BQ7B 5F3BA 1T66C 1UWEL 1HWWA 3I74A 3G6JF 1UM4L 1RUAL 4WF7A 2AJSH 1P4IL 1UA6L 4XNXL 5DUPH 3WFCL 4E5XA 5E1AA 1N6VA 5E5MB 1HS6A 2L7JA 3BISA 2WZPA 1JVOA 5GGVY 5JO5A 1IL1B 3DI3B 2EDRA 2C26A 3A4AA 2Z31C 1UTDA 2DDQL 1A9BB 1AGCB 4U1KB 1ED3A 2BWQA 2QTVA 4FNQA 3VSQA 5B38B 2Q10A 3MACL 4MS8D 4TUUA 3KW8A 4YIQB 3VG0L 1CI3M 3FB5A 1PCSA 4PRBB 5IGXH 1XSOA 2ZWLT 1S9WB 3APCA 4B9FA 2N3JA 3PFQA 2BNRA 5CLYA 3GMQA 3S35L 5JZ7C 3Q1EA 3MRKA 3V4UL 2P8MA 5I66A 1OGAD 1DBBH 1P1ZA 4GKZA 1T04A 3QRBA 4ZO7A 4CMMA 1N6QH 2ID5A 3TYGH 1HZHH 4PD4K 5GSVB 5T3XH 4RBPH 2WD0A 2CKBL 2IH3A 1JK8B 1L4IA 2F53A 4Q14A 4ANKA 5J11B 4E0RB 3GJFA 3O2DA 4BRVA 5LQBL 5EZLB 4HV8B 5J9PA 4PIRF 5DQJB 3MYJA 1H5BB 3DECA 4IU3A 4QAMB 5E7BA 5DC0A 4OQTH 1WZMA 4FOMA 5EIIG 3NSJA 3MODL 2PUQT 4LDLB 5TGBA 4ZMYA 5EIQA 2FIRT 1JXJA 5EN2B 4V11A 1JRHH 3CH8A 3THMH 1CLCA 3O6ML 1FN4B 2IGFL 2K4AA 1CXIA 4KHXH 1W0WB 3GK8H 3NRQA 5D7JC 4X0NA 4JCWA 1FNGA 4YZFF 3MRKB 3U7WL 4AKOA 2CXKA 3HMXL 1P1ZB 3GBML 1E2WA 1JK9B 4GKZB 2DJMA 5C07E 3BEVA 3WN6A 4OGZA 3U4AA 2PCPA 2J88L 3BYTA 2L7UA 1N64L 3DUUB 4C4BA 5DZPA 2R7EB 5D4QA 3QZWB 4NKIL 1AIZA 5F6HI 5DA0B 3RX8A 1PSKH 1FF5A 4Q56A 2DIEA 4YWGL 4PP2B 4KZDL 3MYJB 4TTDC 1I7UB 1TDQA 1UT9A 4OFPA 4LSQL 4PRPD 5DJ2B 4M56A 4PB9L 5MENA 1DBKL 2APWA 3OKEB 2HN7A 4UDUA 3VFTA 3D85B 5F3HB 4G6AD 5IBLD 1CE6B 1A4CA 2A6DA 1XDTT 3NEEA 3GS7A 4GS7B 1MVUB 4YBQC 4I1NB 4L3EB 3L3OB 5FYJL 1K5NB 2JJVA 2EE0A 4HWEL 4BSWA 1AKPA 3L3DA 1OLLA 3P0VL 3QG7H 3QJOA 5FO7B 3CZLA 1DDHA 2J6EL 2V7NA 2NYKA 1DSWA 4QOKA 4Y19A 5C07A 3U46A 2VC2H 4IRJC 1D5XA 1L7IL 2CRYA 4OQ1A 4NYLB 1XIWD 1RZJC 2O61B 1X5MA 4M43L 1CIDA 4OLZH 3INUH 4MQSB 1IFHH 2VLRB 2XG4B 1XCQA 4GXVH 4DWHA 2WJ7A 3ASNB 4KX8A 1JXGA 1NMAL 1IGJA 2W07A 4QPEA 1N19A 4K94L 4H2CA 1AXSB 3BE1H 1CFTB 1AYRA 1HN1A 1YO4A 2HN7B 3WE1A 5F72S 1NC4A 1Z9SB 4AM0Q 5I23A 4OZIB 1IGML 3LNFA 1O0VA 1VFMA 1UZ8A 1VADA 1MVUA 4OFDA 3NJVA 1KLUA 2A6KA 3GSXA 2X40A 4JO1H 1WK0A 2CAKA 2KUTA 2DH2A 3K5SA 1FV1A 1RKRA 3MKGA 3Q9QA 4JFDA 3D12B 4LSVL 4AGPA 1G9NL 2YD6A 3V6ZA 4QTHB 3LIZA 3U6RB 1CMOA 1H9VA 1MY7A 2GSMB 4XOEA 4N86A 1KTCA 4ZS6C 3M7FB 4YLBA 4KDTC 4AMXA 2ITFA 1AQ8A 4AIZB 1KYOK 4FFTA 2F53E 3LZFH 3WJJC 2WKGA 3IF1B 5CHNA 2CE6A 4WW1B 3FCUB 5C9KA 1FC1A 1FFPA 3IFNL 4OLWH 3WS3B 5T33L 3ZT6A 1MZYA 3BWAA 4GFTB 4LQFH 4MCYA 4GP4B 2IIJA 3GM0A 5AAWC 3FQRA 3VFRB 4OIAA 5C07D 4D9LH 1Q9OA 3G6AA 1VB9A 5ANME 1DJHA 1M05A 3CSTA 1BW8A 2L8AA 2WNGA 2NY3C 1AMXA 4POUB 5B4MC 1KGYE 5DMKA 1WUZA 2MNWA 3MZTA 5AOMA 4RGMB 2G4EA 3CFDA 4I0CC 3QO0B 3QQ4A 1OPOA 1E5UI 3IFLL 5EN3A 4XCNA 1W72A 1EAOA 4PJEE 2EXWC 4Z7VE 2OSLA 4EI6A 1V7MH 3CDZA 3K46A 1MIMH 2RACA 5FDWB 1QNIA 1Q72L 4YBHA 1MLCA 5D7HA 4APQC 3MXWH 5ABDE 2P5WE 1BBDL 5SWZA 4P2YA 3VXTB 4YSRA 3OLEA 2BVOB 5C0DA 5HHXH 5E0FA 2FBJL 4F57L 1BVNT 4IDLA 1CLYL 3KPSB 1QQDB 2H0JA 2JTYA 4GT7A 5T3ZE 2CR0A 2J44A 2Z93A 3QNYA 3QDHA 2CJUL 1ZLWK 2WIIB 3B7SA 4HIJA 2HPTA 5AUMB 4G42A 3OQRA 5EZJB 4ISVA 1U8MA 2JB6B 2VDOL 3TT3H 4FAAB 5E70A 4NUJB 5JPNB 2X42A 1JZ2A 4JJOA 1XGTA 2RBLA 1BF8A 4ZOEA 2CO7B 4R97C 3WFBL 4LLMB 4MZRA 4GRWH 1TU2A 5DJ8A 2IFFL 4P3CH 5BZDA 1WIOA 3VXQB 3WYRA 3MRLA 4G8AC 3J8F7 3GLAA 5GGVL 2YD4A 3A24A 4C56E 4M7KL 2RHEA 3CFJA 1I9RL 5EHFA 4BFJA 1A5FH 1UENA 3LN9A 3U0PA 2CJTA 3IJ9A 4LF3A 4TM9A 1U8LB 4Y4FA 5I30H 3L3KB 3DX2A 2TSAA 3KYNB 4U6HA 5LNGA 2MH4A 4J23A 4OLYH 3FSVA 5HVFB 5KYXB 5B1BB 3SDXE 2W88A 1OCRB 3WNIA 1SHSA 1CGSL 3IJ7A 3WNLA 4LASH 4ZK8A 4TRPL 4XNYH 2IPUK 1TTGA 3H2PA 3WLBA 2AXFA 4MCZB 4JPVL 3FO0H 1E65A 3N3EA 2B1OA 3SJVB 4RDQG 5DXWA 2X2JA 3SSGA 1AIFB 3HCVA 2ITDB 4OLEA 5IV2A 2IC2A 1OZUA 2AK4B 2GUYA 4QHNB 5FGBC 3KZ8A 3REWA 2HT3D 2I25N 3QXUA 4LSUL 4R7XA 3WEAA 4Y9CA 1NA8A 2X6VA 1QFOA 3HPJA 3CCHB 2WZ5A 5CXPA 3KPQB 5I6KA 4RWYL 5IQ7L 2EO1A 3B2UC 1BQLH 3T8XA 3MV7A 1IB5A 4A7SA 3RUGF 1YY9D 5KW9H 4L4VA 1G9MH 2VM9A 5IREA 4FA7B 4YL9A 3F64A 2F08A 2YMXH 3D09A 3QQ3B 2AJYL 4JGUA 5HI5C 1I9JH 1XIWB 3S3DB 2XX1A 5F21B 1ORQB 1PTZA 4IS6A 1Q94A 1PAZA 2ZOLB 4FLSA 3UPRB 2A73B 2BMKA 2ZSVA 2QKIA 4YDJA 4LLYB 3B34A 4Y5XB 2XA8L 4PCYA 1JGUL 4UQCA 5DUBB 5AB0A 3IU3B 1L5GB 5K9JL 2GHWB 2NQCA 1CXHA 4QRUA 2WKLA 3ILPA 2QVIA 3MRJA 2XXGA 4H1LG 4JJHA 3OPUA 3ZZLA 4LLUB 5AWNH 3VGFA 3MJ8A 3EXJA 1IRAY 1DSYA 3MUZ1 2QELA 4GO9A 1B0GB 2A83A 3LXCA 3MLXH 4X7SH 4XXCC 5CJOL 4XVOA 1AHWC 3ZZQA 1KT2A 1YJDC 1Z9PA 3BN9C 4X5XB 1WFJA 3M6DA 1LNUA 3FFDA 4Z18A 2ICWI 1OL0A 3CIAA 1KB5H 5KAQG 1RJYB 4JKMA 1I8MB 1IM9B 4MDJA 2R0KH 2NY4C 2APVA 2XWJB 4XO5A 3QAQA 5E2WL 1A21A 5JPMB 3EJYD 4UF7C 3L3GB 1UYWL 1XIWC 2W95A 4P23B 4AUYA 3NYKA 2WCSA 3T0EA 1JUFB 2BP0B 2FBRA 4KK8C 2XPYA 2QGEA 5FCSH 4HMCA 3PS6A 3T6XA 1FVCB 3FCTB 4K73A 1LEKA 2VQTA 2FR4A 4L05A 2A4ZA 1YMHA 3K2UL 1GYVA 2CD0A 2WXLA 3QNXA 4L4TA 3KPOB 4WI7A 3ZGIA 3FB8A 2NDGA 5CD3A 3QIBA 3QIUC 4J3UA 4FLRA 1QBMH 1J05A 4ZODA 2H26B 2JJSA 2KC0A 4QHMB 5JHLL 3II2A 3N9GL 1M7DB 2HA1A 2IGLA 3U7YL 1A3RH 3P3UA 3CFUA 3TBCA 3LS4L 2D9CA 5SX4H 1PLGH 1TQBB 3QO1A 2XWZA 1LGVA 1JYWA 2DLFH 1I1AC 1T7WA 3VQ2C 4MQ7A 5GS2D 1TLKA 5D1ZB 1J7VR 5DJZA 1DCEA 4IW4C 5L2JA 4WEUD 4JO3H 4N9GB 5EF0A 2AEPH 3ESPA 3LEVL 2WTOA 1KCSH 3EDFA 4Y5YC 5DT1L 5T1KB 2V2XA 3EOYG 3S4SB 2CUHA 5GGTH 2OJEB 4I2XA 3JVGC 1OEZW 1S7TB 3SBPA 3T3PF 4OM1H 3HVNA 1M6OB 1CXEA 5IMOA 3HLAA 4GW4A 1X5ZA 2AK4E 3MV9A 4HS6B 3RNKB 2VSKB 1KBPA 3LIUA 4PH8A 1ET7A 1FHNA 1MHPH 3GS4A 3DIFA 4OCYL 4M5TA 3TEWA 2NSXA 2XKNB 4BQ9A 3SDYL 1VACA 2X4RB 4JRXE 4JM4L 1L9NA 1KPRB 4AQAA 3OMIB 3UH8A 4R3SA 5AOZA 1N68A 2BS8A 3AWFA 4MD0B 5D1ZA 3QPQD 2FX8H 1BYOA 1NPNA 1QTYT 1I53A 3LHPL 1QUPA 2RA1A 2HH0H 1JZDC 5A2BA 2V2XB 3FXIC 5BS0B 1L7TH 4PJ6A 4JM2F 4DKAA 1M1SA 3G5ZB 2X4QA 2FB4H 4DK3A 2WN2A 4I3SH 4ZMAT 4YHPB 5IF0B 1QYGH 4LL4A 4QXGH 4U1IB 3RTQB 2UX7A 3PGFH 4Y4HD 1FNAA 3C12A 1MHCB 2AQPA 3TCLA 2ZP9A 4JS7A 1V8HA 4MJHA 4N2MA 4WJ5A 4F5CE 5SWSA 2FGWH 1MFVA 2W9EH 4TNVF 1IMHC 3QIWB 1RJCA 1WBXB 4A6YB 1NCWL 4OUOA 5IWLC 5KZCD 1P7HL 2XZZA 5BZWB 3ZE1B 1B0IA 4DH2A 2COVD 1FJ1B 2GIMA 5AAMC 2YUZA 2IEPA 4MDRA 4WENB 4JY4A 3QCVL 1IIIA 2WNWA 3BHBA 3H0TA 5BO1H 4LCVA 4LGRB 4OF8A 2A1WH 1FE8L 3SKMA 4U33A 1K4CB 5KVEL 2X4QB 3GT6A 4X6CB 4X5WA 4Y4HA 1M9SA 2I7OA 1JV5A 4HWBL 4L29B 5EEZA 1MWAA 3W0WA 1PY0A 3QGVA 2LFGA 4IIQB 2JKRM 3AMLA 2IANB 4FJ6A 1N59B 5T3ZH 3TIDA 2CDEB 5A6MA 3ARGD 1YAIA 1U2HA 1IBFA 1DJGA 4RQQA 3TVMD 5IHLB 1ONQB 1Q9WA 4JB9H 5D1QD 5DRXB 5IFAL 3U9UB 1UD2A 4UT6H 1A4KB 25C8L 2BVEA 2XKSA 4KOBA 3EO0B 5F9OH 1X6LA 4XX1E 4XP5H 1OTTD 4I0PC 4NC1E 2J73A 3MCKB 1JFHA 3NIDE 3LZOA 5FHAH 1DQJB 4MNGE 2G3ZA 1UXWB 3DHJA 3KWWA 3LXUX 4ORGB 2HTKC 4P2RA 1TZ8A 3ROOB 1ZHNB 1J5OH 2WVVA 4JFXB 4GSDL 4G2AA 4IKIA 2Q9OA 4GBXA 1S3RA 3POCA 4NM4H 4OLXH 1BZ8A 1CT8A 4TSBL 2W91A 5EIIB 4FF9A 4HIPA 4O2FA 4PRIB 1FZOB 4NWUH 1BD2E 1MCPL 4X5WB 1I8IA 5CD5C 1BFTA 2R4SL 2VR6A 2XVKA 1SYSA 1WC7B 3SGDH 2EIMB 2VM3A 3SCMC 1AGDA 2C9VA 2Y4SA 2YFOA 1A7OL 1YYLL 2QSCL 4J27A 4Z7VB 5F7EL 4XP6L 4X99B 1ZLVK 3HC3H 2ZYRA 3P9MA 4UTBH 2GI7A 3WHXB 1SHWA 5HHNA 3VE0A 4P23D 2W9LA 1DN0B 1FH5L 4WRLA 1GCFA 3RTQC 3TIEA 4X6FB 2X2HA 3MRIB 1FO0L 4JL1A 3UAAA 4JRXB 3Q2CA 3FFCD 1A1NA 1Q90A 4BUHA 4N2BA 4DW2L 2FCBA 2P1YA 5JPMC 1I3UA 4XZUB 5EBWB 1H19A 2MPAL 3I3DA 4X6DA 2Z6FA 4ZUUB 3FNKA 3H3BC 3L1OL 1YEHL 1MLBB 4Q6IB 4LSPH 4QXWA 1X7TA 3TEXA 3A6CH 3T3MF 3CXDH 3MYZA 1KSRA 2YPKA 1EEQA 3SD2A 1OWWA 1RZKL 4OVUA 4LCCC 5E5UB 1J1XH 4N2NA 3X1BA 1BFOA 1QFWI 3NJHA 1T83C 2JQMA 1P5UA 2R0LH 3CMOH 3EOBB 5MEND 4XXCA 3GO1H 4G9DB 4NQDE 5D1ZD 4CSTA 4PJEA 2OYLA 1AVAA 1A1OB 1GY1A 4XCEB 1AHMA 2GW5A 1NWOA 4X6EB 4ATWA 4KK9D 3L2NA 3L17A 2IVFC 4W4OA 3FT4B 1A3LL 2DMKA 1BZ9B 5T5NF 4GW5A 4P3DA 3OHXA 4XZUA 2X1OA 2OXHB 3B9EA 5CCKL 3MOBL 3A47A 3VXNB 2HKFL 5ESAA 3FMGH 1J8RA 4MLSA 3N40P 3DV6A 1E90A 4ONOA 3F2LA 1GMIA 5ITFB 3MLSH 3LKQA 1E8ZA 2GSIA 3PV6B 4LIQL 2FBOJ 2AP2A 5EB9A 4JFWA 3A22A 4QHPA 4CUCA 5L9DL 2JELH 4FNPA 3ZXAC 4P2AA 2NCEA 2FYVA 3RGBA 2DKUA 2VR5A 1OP9A 2VOTA 4JJ5B 2ROYA 3BAJA 5IVOA 1PY4A 4PCKA 2V0AA 4W4OC 3HLKA 1IEAB 3QJHB 5CEYB 5JYMA 4DN4L 3BEVB 1AZUA 3FU0A 3APNA 4GW1A 1BQHB 1DCLA 1SFHA 4DCQA 2NX5D 2CMRH 2YARA 1W80A 5DTFB 3ZQ9A 5KSBE 4GXUN 5AL8A 2KPWA 2CNYA 3MRFB 4PYGA 5FA4A 1XGPA 2NNAB 3L4ZA 5KG9B 1WUNT 3DVGB 3KYMA 4HH8A 4KO6A 2R8SH 3CC5B 5AVZB 3WD5H 2FE0A 3L13A 4RX4D 3P9LA 4QCIA 5HP5A 1OARL 5DSCA 3AB0B 4KRPB 2ZOOA 5I18H 4H7VA 4GG8A 1Q9LB 3V6BR 5I2IA 4OTXL 2ZYIA 3H3PH 3NTCL 4NHUA 5BOPA 2EEAA 4AT6B 1Y6MR 4ELMA 1IEAA 3L8QA 3BSZA 1OGAA 1BG9A 1VAHA 1KJ2A 4UTAA 5IT2L 1ZTMA 3MUUA 4KUZL 5A2KH 4YDKL 1PQZB 5I6LA 1MY5A 4AJYV 1A4AA 4OCRL 4OZHB 4XNAA 3C5SA 1E4KA 4FZ8H 1HCVA 5I1KH 2J5LC 3N41B 4L1HA 2LV4A 4NQDD 4QJ4B 4K9JA 4NJAH 2IDSA 1FHGA 4C4KT 4PJ9C 3NMEA 3WTUA 2EDQA 2FH6A 2IBGA 1CFTA 1WT5C 2JMRA 2D7NA 2W94A 1QO3A 4RFEA 5FX3A 2OMBA 2NDFA 2X1PA 5A3ID 4YPGB 5KN5A 4K9EC 2CO2A 4WI5A 4F8NA 2PF6A 3T6ZA 4FQIL 4EVNB 5I9QC 2EIJB 2AV1A 5CBAB 5F7HA 5IMLB 2Y5TB 2NTFB 1JJUA 35C8L 1KJ2B 5DRNA 2F8OA 3MGOA 5F96L 1P4IH 5IFJA 1C5CH 1M53A 4FI7A 4LEXH 2WVTA 3TA3A 1GJWA 1GOFA 1YYML 4GXFA 2ZYSA 2EH8H 4KKLD 3SGJA 1QAWA 2KQMA 3AG2B 4MB5A 1B9KA 1LO2H 4W6WB 1T89C 1T21A 3N1FC 2X41A 1ACYH 4N2IA 3IF1A 1CE1L 4NPJA 3HE6B 1BP3B 3KVQA 2NY6B 4G3YL 5D7IE 3T77A 4J1UB 4A6YH 4AEHH 2IBZX 5J56B 4PWKA 6PCYA 1KEGH 2HAZA 3IYLW 3FQRB 3K74B 1Q9KB 3EO1A 2ENQA 1OLZA 4OV5B 1HAUA 3G6AB 1P4LA 1WBZA 4LP4A 4XMZA 4F15C 2CKBA 3MRHA 5AKVA 4BDVB 4LHQB 1GOGA 3ARGA 4YPGA 5EORH 4FCHA 3B9AA 1DQIA 1M7UA 2DQGL 2AEWA 2XDHA 1Z3RA 5AVYB 1U0QA 3R06B 3BPNB 1VGKA 1WIUA 1G7JA 1T3FA 2H2PC 3S35H 4QOKD 3SDXB 1NEZB 3IETA 5GJTH 3GS0A 5FKPA 3U2JA 1KXQE 7TAAA 1MFAH 3HI5H 1HESA 2DKMA 5FDWA 2CKBH 4PY8J 3QDGE 5CSZA 4Q7DA 2ZJSL 5J1AA 1PKOA 3UGEA 4KKPA 1OSZB 5T8IA 3T6WA 1ZS8B 5JA8B 4L4VD 3AU0A 3MRNA 2DEXX 2ARJQ 1JGVL 1A0QH 5DRWA 4J1UA 1EUTA 2DBLH 3F6JA 3DSNA 1KJMA 3GRWA 5IOPA 2E7MA 2I32A 4YDMA 2GIXA 4JUTA 3SDCB 3EJJX 3LD8B 3CDGB 3TVMC 2R0ZL 2XN9E 1AS7A 3F12A 1NGZB 1BM3L 1MCWW 1LO3L 2J1YA 1W72B 3NJLA 4XN1A 3WKPA 5FYJE 3MNZA 4KJQC 2DMCA 2HPOA 3OR6B 4XGZB 4CMHC 3C08L 5I1GL 2FZ3A 2R29H 4HJJL 2E7DA 4FXLA 4LXFA 3U4EB 1VGEL 5DC2A 3CN1A 5CWSB 1S5IL 1HL9A 4FXTA 3RUGA 5EA0H 5C0CD 2Z35B 2BVOA 4WI2A 4UQ2B 1KG0B 1E4JA 4ZOCA 1E7UA 3VFUA 5C0FA 3GPEA 2WBKA 4R4NC 3KPSA 1YY8B 4NKIH 5CN3A 4XXDB 2H32B 3BDYL 3M1BA 4JPQA 4KVPA 3ZTJH 2QPFA 3R18A 4OZHE 3PAYA 5SWQA 4QWWD 5DA4A 5HGBB 4XAKE 4YFLF 1O7DC 1WAAF 4WFFD 4LK4A 1IM3D 1ZEAL 3LKRA 2YD7A 1XHHA 3QEQE 2DLTA 2RQEA 5PAZA 4JVPA 2VDKB 3ME0B 4LCCA 1QSFB 1E50A 3D25B 2R23A 4YDLC 2C1OB 5L2KA 3RWDA 4ESKA 1CK0L 3HNVL 5HHMB 4G7VL 4KTDH 5TK2A 1QSZA 5CGTA 3AQDA 3X14B 3A3YB 1DE4B 5FO8B 2NY7L 3VJ6A 3VNZA 3SIKA 5CZVL 1WDAA 1GAFH 3O9WD 1U8CB 1RU9L 5C8JA 4MHHI 1OALA 3ZKND 4I9XA 1P6FA 3KJ6H 4GRLC 1G7MA 2VLJA 2GK0B 3P4NB 2PO6C 4XMVA 1TKWA 3IXTB 2GT9B 1SXBA 4XN7A 1F2QA 4YN3A 4ONGH 3CAFA 3CHOA 3WFDL 1A7QL 1W6WA 1FIGL 1OK8A 3B83A 4WU5B 4PJXF 5F89B 4PWGA 3L1FA 1LLAA 5DZ9A 3QFDA 4AG4H 2OSYA 3O41A 3LKRB 1M7IB 2ZOWA 3G6JB 1U8JB 4AQZA 2UZPA 1LE9B 3FU6A 4MCZA 3AY4A 3RWFA 5I8OH 5KVMC 3QORD 2R1WA 1BX2B 2CLZB 2GJPA 2K70A 5JR1L 3L3OC 5DD3L 1T22A 3OJ2C 5LG1A 2BMKB 4Y16A 3REWB 1FDLH 1RZFL 2D03L 1R3IH 3F5WA 3FF8A 1KB5A 1KNOA 4PS4H 4I7ZC 1L5GA 3IU3A 3L54A 4P2RE 3TCXA 2CNZA 1G9EA 2HRPH 5IIEB 5C0AE 2GK2A 4XNZC 1RLWA 4K7FB 3WN5C 2ZUQB 3EH4B 3TYFA 3WTVA 3LZFL 1F6AB 2XIDA 2XG5B 2FSEA 1W91A 3L4UA 3O2WH 1TR7A 4LE8A 3ASWA 3D30A 2EEFA 4OBSA 4FD0A 4P46D 5HHOD 3WBDA 4IBZA 4GAAA 1W72L 4OJFL 4MMXC 3BUIA 2A0LD 3JTSA 4OJCA 2KPNA 3GSNA 4KJYB 1DDTA 3QNFA 3AB0C 4KRPC 2QKIB 2XWJA 2XIIA 3GBDA 12E8H 1GC1L 1QNZH 1P4UA 3S36L 1SUHA 2BNQA 1R3JB 4L3EE 4ZFZB 3IWUA 4M48H 2H4EA 4UDTB 4EI5A 3PWPA 3UBHA 3FF7A 2E6JA 3E2HC 2CZNA 3KPRA 3D2UD 5GZND 3LEXA 4XMLH 2CGRH 4GPVA 3KLHC 2O6PA 4LGSB 3OBAA 4AMWA 1MIML 5IB3A 2A83B 1ROCA 1R3KB 4LFHG 2MNUA 3TZVD 5LVEA 2J1WA 3BOVA 4ZFFA 3FB8B 3TTSA 1G87A 2C4FT 2W81C 2CDFB 3EDDA 1OAQH 5HHXL 5JHDA 5EZOL 4PGBB 5KS9A 2DIBA 2ZXCA 3H9SD 2R1XB 3RY6A 1MI5D 1P9MC 4BZ1H 3NH7H 1WD8A 5EU3B 1I7ZA 3JWOH 4N2HA 3UCRA 2WXHA 1ZHKA 2TRHA 3UBGA 2ZG1A 1J87A 2ZCLL 3DX7B 1SOQA 5H37H 4UM9B 4C4KO 3WAJA 3QJSB 2R51A 4ONFH 3PGDB 5FFOA 2V4LA 4FNLH 3RIFF 1LEKB 3WJMB 3QPXH 3RVTD 5EBLB 1S9YB 3IE9A 5T1MA 4WCYL 1IAIM 4HK3J 1IT9L 1H3PH 3QQXA 4BSWB 3L3DB 2E6PA 4LCWD 4P3CL 3BVNA 4MZ3A 4N6RB 3MV11 4ODHH 2PW1B 1J88A 3BWZA 1IGFH 4HHGA 4XPHL 3JV6B 3GRBA 4I9WD 5DU7A 3MLRH 2QR0B 5GGVH 5IESL 3MRCA 1YECH 5GGRB 3S8FB 5F6IB 4G7RB 1B0WA 3K1DA 1IBHA 1NBQA 2Z8SA 3HOGA 1TJIL 5JHBA 3S35X 5I30L 2APSA 4RRPG 5B8CA 1BZQK 4XH2A 1ITCA 3ULVH 5TQ0L 4X7DC 3RKDC 4KV5F 5KBPA 4DEUA 3KBFA 1KGCD 5KBDA 1Z0MA 4YGVB 3ECBA 3OKOB 4N0CD 1ZLVH 4WK2B 2CM5A 3WE6B 4DKEL 3TBWA 1Y6KR 4YHLH 1E6JH 1TQBC 3IDYC 2CSPA 2IMMA 5D5MA 1QI5A 4DN3H 1TENA 3FQTA 3FTZA 2OPCA 4PJ8B 5ALCL 5JIDA 3WIHL 1HHIA 2B9AA 4NIKB 2JI2A 1QUNB 3K2MC 3TFKC 2PYEE 4I77H 4L9DA 4R6UA 2EDTA 4BFKA 3EUDA 4F58L 5AVWB 4ANWA 4L4TD 3MV8B 4JM0A 4MX7B 1WGOA 2VDPL 3ROLA 3WNKA 4HPHA 4S1SH 1QSFD 4HGWB 4UOZA 3MX0B 3QORA 4ABVA 1L9QA 2DIJA 5F9DC 3KPNA 4LAQL 1MHCA 3TCLB 3WN5B 3WEMA 2BIOA 2ZXDA 4HK0B 4W1TA 4AV0A 2KDYA 4N8VB 5T1LA 4YHML 1LK3L 2NQ3A 1NAML 1ITBB 4FQLH 4DHLA 3SQOL 2G5BA 5CJXA 4UT9H 4BUGA 1I9JL 3N1QC 3MBEB 3QUYD 5D96C 3QAZB 3RL2A 4OW6A 5HSFA 1UM6H 2Z4TA 1D7CA 4ZSOA 2BSTA 1G7IB 1OGSA 2GJ6B 1F4YL 3P1VA 4FNTA 1AZVA 2LVEA 4XOCA 1MW0A 3BSGA 4IKKA 3L5IA 3EOTH 5IBUG 1RZ7H 2G75A 2VR8A 4L1DA 4P2QE 2D3LA 2FTAA 2D0FA 2V9TA 5EOTA 1DJSA 3OG4B 3RGVB 3FQ1A 1PX4A 1P4BL 5K93A 4JFOB 4DSYA 4D9QD 3NJNA 3Q8AA 1EH9A 1P2CA 1IE5A 1UM5L 2WNXA 3NGBB 1BLNA 3OG6B 5EOCL 5AW7B 2F7OA 2WHVA 4X6DF 4OI8A 1XZ0B 4NGHH 4Z0BH 1XSJA 1ZDQA 4FXKB 4GUQA 5EV7A 4L8BB 4H0IA 2D31B 1LD9B 2XXCB 5AOJA 3ZW3A 5KYUB 3OKDB 3UAJC 2LHAA 4RMSA 3LKSB 3MBEA 4PSPA 5BRZD 3TZVA 4F7TB 1E2ZA 3KPSD 4GRWB 1K4CA 2ZF9A 3CUPA 3N43F 3SYOA 3PQYA 1UYWH 3ZDXE 3CVBA 4YDIH 4ZX5A 1T0OA 4NQED 4QLWA 3D34A 3H9SA 1BLIA 2IH9A 3RWCB 4IIQA 1UD6A 1NKGA 2CDEA 4N0YL 1DHKA 3QQ9C 4LSTH 1CICA 2Z0UA 3HRZB 4X8JB 1KGIA 4JHWL 1QBML 3MQIA 4IK7A 5JOPD 2VDQH 4JG0L 4LLWB 1TITA 5I1JL 3PP4L 1DVFC 1CF8L 3C60A 4H8QA 4S0SD 4Y1TA 5D2LA 3E6FA 1D9KC 4WKZB 3U7YH 1C5BL 1QR4A 2VZ1A 4ADGA 1A3RL 3C8KA 3B4NA 3VFWA 3PJLA 2R2HA 4YSOA 1MXGA 5FO9B 4HH9B 4L8BA 1CLZL 4P2OB 1IEBB 4KKCD 4L8CA 5I17A 4DO5A 5FV1L 2DLFL 3L3KA 4U6HB 5LGYA 3ZT5A 1H9DA 3VXSB 1FYTB 3DO7A 1LP9E 5SV3A 1IC4L 2I07A 3TZVB 2ARJB 3KDMA 5A2CA 2Z31D 1T5XA 4JANB 4XNQB 1ZK5A 4JO3L 4NZUL 3UYPA 1MNUL 3N1GC 3OKNB 1ZVNA 3WO4B 5D5ME 3HG1A 1HC1A 5FM5O 2KLSA 3O4OB 5DHDA 5JXEC 5HYFA 2O5ZL 2V5SA 1W6LA 4XN9A 3X13B 4AVHA 1S7UA 1F4XL 1KBWA 1SXZA 3VE0B 4DGIH 4OCYH 3LDBC 3F3HA 4ODVH 4N8VG 5BUAA 5DK2A 3NZSA 2BWDA 4WTZG 2XN2A 1EJ6A 1XF4A 1OTSD 4H0LC 4ABWA 3MVSA 2NYYC 1CS6A 1AKJB 3GGWA 3BVUA 3GPSA 4FQXA 5D70H 4LCWB 5TPWL 2NOYA 1IE4A 3L7FA 5DQJA 3WY3A 1KJ3L 2PP8A 4IBVA 1NGPL 7PAZA 4JFEB 4NNYB 4OKVB 5EULV 1SY6A 2W65A 4ELKB 3LHPH 4OJDH 4U1NA 4XVJH 3EOBA 2X4NB 3HA0A 3NPZB 4WUUD 4ZOBA 1F6FB 4NQCE 3VFGL 1L9RA 4G6FB 4XP1H 4CN4A 4DVBB 1CJYA 1WLHA 5ID0B 4KNTA 1C8QA 1PZCA 4LVNC 3GRWL 4BFEA 1BFOB 5AQ0A 2P24A 5I8CA 4KFMA 1V7NL 2DTSA 2WV3A 4XCEA 4P4KB 4XT1C 4EN3D 3EBAA 2QQKL 5BV7H 3F6LA 4K3JH 5DK2B 4H5SA 3NA9H 4H2AA 3F6IA 1A66A 3LPOA 1OAZL 1Q1JH 3DUUA 2MFNA 2VISB 2WCPA 2VXUH 3U2SB 3NPSB 2VDRH 4QY8B 1NCWH 2IDQA 1DJXA 4U7MA 1PD1A 3I6GB 1FGVH 1U3HC 2LOEA 1F11B 5JHMA 4IGBB 4F9PC 3Q5OA 2DLGA 2VMCA 4J4PA 5C0RL 4H4NA 3NCYP 3QCVH 1M2VB 5IBTL 4YFEA 1U3ZA 2FQGA 3TV3L 1OHQA 1JZEA 2NXYB 3TOPA 3UJTH 5DHYA 5TD4A 4PJXB 2BWIA 4QRQA 3DARA 3TNNB 5KVEH 3DK0A 3HFML 3MRRA 5EO0B 5IW6B 3EH2A 3AUWB 5J6HB 4HYTB 4ADIA 1AG0A 1U41A 3MBED 3HZMA 1WT5A 2JCCE 3SPGA 1M71B 4LT7A 3U46B 3V4PH 3AREA 3KNBB 4RRPA 1WTGT 3CG8A 4MB1A 4YHZL 1YUKB 1TPXC 4GW1B 4UV7L 5H37G 3ZL4L 3SZ6A 2FJSA 1U58B 1UM4H 2YXVA 1FP5A 5I0WA 4ZFGH 5SV4A 1EDHA 4HD9A 1M7DA 3QWQB 4BXVA 1OGAE 2W07B 4Y88A 4ZDHB 4QD2E 5LLIC 1DUZA 4R90H 1ASQA 4LP5A 1QHQA 1UA7A 4WY7L 5IKCA 1J5OL 3D18A 5EEYA 4P9HC 1SXSA 3RZCC 3L4TA 1LP9B 1BYPA 2NY0D 2YC1B 3APFA 2OYKA 1T20A 1RSYA 5DYFA 6PAZA 4AYID 4N9GA 5EOQH 2EACA 3QUHA 1M1XB 2IFGA 2G30A 3MACH 3BZ5A 4GKSA 4JM2C 4OGXL 5C0EA 5I76A 2FYYA 3A4FA 2CHXA 3K3QA 3LKPB 4QF1B 3CSYA 3ES6B 1MFMA 5BVJB 2JKXA 1RZGA 3MRGA 2ADFL 5T1KD 4LSRL 4Z8FL 3WJJA 4JRWA 5F7DB 2VXTH 1AO7E 5IQNA 3RGHA 3RIAF 1NGQL 4FQ2L 4OZGE 3V4UH 4GG6E 1FG2B 1DBBL 1VFAB 2WQVA 4UYQA 4E68A 1FO0H 1H3VA 3GMMA 3VYNA 2EVHA 1MQKL 3O3EA 5FR3A 2CA4A 1JWUB 1DEEA 3IGAB 2HP4A 3QK0A 2EC8A 3GQFA 2MPAH 5DZNA 3NABH 5H2BA 4D8PB 1JTPA 2BJML 4GB9A 4JRYD 1KCRH 2JCCF 4LLQB 3GM8A 4EQ2A 4FN0A 5CINH 3IDNB 5ILTL 1WICA 4KVNL 4YDNA 5GGUA 3EF4A 2V6HA 2FATH 2A99A 4GKSB 4PJIE 4HEMA 5I76B 3BX7C 4R4FH 4PS7A 3A6BL 4WWOA 4HMEA 3E2HB 2F74A 3RVXD 1R0AH 3U4BL 4A7GA 4FX5A 3HKZA 1KIPA 1DL7H 2Z31B 5L4IA 4XWGH 3RDTD 3R06A 1XBDA 2X0VA 3TA3B 3HE6C 4MNQB 1XTMA 2XSKA 1NSNH 1HL4A 5TE4L 3P3RA 4N8PA 1A3LH 3CLEH 4K3EL 4E9RA 4F2EA 3MGAA 3O6FD 2I9LB 4LLAA 3QYCA 4UB0H 5FECA 4X5RA 3MOBH 3ELQA 5KVEE 1S7VB 4BK5C 3HAEH 3AS2A 1B0RB 4E9SA 2HKFH 2D4DA 1R5WA 4KZDH 3VFSB 4BBWA 2SODB 4PRDB 2QV2A 2DBJA 3NP4A 3KH4A 3ZKMD 1QKZL 1AG6A 3VFPA 3QFGA 1DBKH 2ICES 2YPVH 4QRAA 2R0WH 1AKJD 1MI5A 1D9KD 1BBJB 4KAQL 4LZKA 4X9FA 1R34A 2AJUL 2J6EA 5IJKC 3U25A 1L6XA 3MOAH 3QDJB 4G43A 2YEVB 5A2IH 2ZP0T 5EO9A 1CBJA 3DUSA 2A4EA 3U4EA 3ZSTA 1KYUA 4U1GC 1O7SA 3DOSB 5E2UH 3REVA 3SGKC 5EWIL 4N90E 3H2QA 4DN4H 4PTTA 4PUBH 4LPYA 3H42L 3QDJE 3AQZA 4M43H 1ZLSL 1KULA 2RGSA 3D06A 1YEJL 3GZQA 4XXDA 2ADIB 5KVDE 3GIZH 3D50A 4GKOA 1NMAH 2WOYA 4NC1C 5AB2A 2UUDK 2N0MA 2TAAA 3OJVC 2HT2C 1RY7B 3LCYA 1LQBC 1JGEB 1NGWA 1O6TA 1UH3A 4LARL 1NANI 3BLPX 4CU7A 2WZPD 2FLRT 1CDGA 4Z5RB 5FYKE 3T65B 5D7LA 3GSRB 4G11A 1ZTXE 3QDJA 2WINA 4JO1L 3NTCH 5HYQB 3ISWA 1ZRUA 1E27B 3FCBA 1AGDB 2VMEA 4MASA 1JN6A 2YGVA 4XC3L 4FJYA 2I5YL 4JFHE 3FDWA 4GRWF 5FYLD 2X09A 1SDAB 1OCWL 2OMWB 3MV7B 2ITCB 3ULAB 4EDXB 4GMTH 1S8DB 2CUIA 3H7BB 4LNVA 4CKQA 5I1KL 4PJ5A 2WXJA 1QFPA 3DDGA 4XPFH 3CX2A 1N4XL 4Z7VF 1NLDL 2W80C 3KHQA 4JDZB 2GJZA 1GGCL 2FJHA 2WLYA 3GJFB 1DVQA 4OLWL 3WY1A 5KEZA 2P43B 2RIKA 1FYHB 3ME0A 2NLJB 2WO2B 3EBIA 1H8OA 4P5KB 5D4JA 4X4MA 1NBZA 4HCFA 1JPFA 4D9LL 2RR3A 4S11A 1H5BA 1N2RB 3UPCA 1YVLA 3EJUA 2X0UA 5I1LA 1PG7X 4WGVB 5C0AB 3J07A 4PRPB 4ZMOA 4TLKA 2PP7A 3E8VA 3WL9B 1AGFA 1JF5A 1Q0EA 3KVDD 1HH6A 2E7CA 3OX8B 3F84A 2ERJB 3HE7D 2XVBA 4V1DB 1RZQA 3QI9D 4XHJC 3UO8B 1MQ8A 3C2AH 4LOVA 2NZ1A 1OB1A 5IJVA 1JPTL 5H8DA 1RJLB 4JFPA 1BVZA 4QHUB 4XNUL 1RMFL 2RCSH 5SWSE 1Y7VA 3AWEA 2J2ZA 1BBDH 3EIFA 4OF6A 4QRRA 1LO2L 4F7CA 3WNMA 2PR4L 3FFDB 3FUEA 5CSGA 2GJZB 3US9A 5JHAA 1FCCA 4NN7B 4J3OC 4GI6A 4PTUA 3VXNA 4WQOA 4ABQA 5CP3A 2C3WA 4KO9A 4RZKA 3RX9A 2GAZA 4MYPA 4FG0A 5IVNA 3LKQB 2VABA 4Z1PA 5I16A 3WKML 1J8HA 1FVCA 1YQVL 4IGBC 9CGTA 4DPRA 1U93B 1GS7A 4N4YB 5E8NA 3GRGA 4U1SA 3S96B 2BNQE 3HHSA 4IBLT 4L3EA 4BCZA 3WFBH 2CM6A 2DWDA 3DRTB 2BRRH 3RY5A 2O6CA 3ZDXF 1MFAL 2K1MA 3IM1A 4EN3A 2V7HA 5G4MA 3T71A 2Q8AH 3AS1A 2J2ZB 1RLBA 2R7EA 4TPRL 2V9UA 1GZQB 1YEIL 3H1ZA 4FEMA 3OR7A 5AG9A 5I5MA 5IP4A 3T6QC 4GY4A 2CDFA 1E8WA 3LKOA 2AGJH 3VTMA 1XVSA 1LTXA 2W92A 4PGEA 2JK5A 2XN9A 2EDKA 4Z6AT 3L4YA 4KJYA 4NQTA 4UNTA 4EQ3A 3CFBB 4BCXA 4D0CA 3EFFA 1ZGLB 5I1HH 5DMIL 5D96B 4Z95H 4EUPA 4OZFB 5EFIA 1BM3H 1GXEA 1UG9A 3PWPB 2LU3A 2CLRB 3UTPD 1UQSA 4RCAA 4XNYL 1HEZB 2BCKB 2WBJB 2A74C 3QW9A 4XO4A 1OAUH 2B1AL 3G6DH 4HJJH 5C2BH 5EEXA 5C07B 1ZPLA 3SB3A 3DRTA 1DBMH 4GW4B 4M4RB 4ZAKB 4YVUA 3P40A 4JPKH 4KRPD 4M1GL 5E2TH 1JI2A 2HB0A 4RA3A 1N26A 1TCRA 3OD3A 4NERA 5H35B 3MXVH 3BDYH 3BPCB 3BZEB 3CXHK 4K2UH 4WW2F 2XN9B 2UZXA 4FXKC 3IMUA 4NZTH 4QRRD 3DX7A 2DTMH 5EF2A 3K4ZA 1EWHA 3KMDA 2Y06L 3UTOA 5EU5A 2QKSA 1EERB 4W9EC 1XF2A 2BHUA 4EUPB 3VXME 5EBLA 1VADB 2YQ3A 5F7YC 4G6JH 3D3VA 4XWOD 5BS0A 3UG3A 4PJXE 3ARRA 1XEUA 4X7FC 3D6GA 5AVVB 1I3VA 1JV2A 4W81A 2EUZA 3LPWA 4TLSA 2D2CC 3KJ6L 1QX1A 3RPIA 4GG6B 2VLKB 3EO9H 2DS4A 4FG6D 1V05A 4UZSA 3DXAE 1TSRA 2ZQKA 5ICYA 2WLJA 1UOVA 2HMIC 5D9SA 4DP4X 2EEDA 1JYNA 4X7SL 4ALAC 1EZSA 1JZ5A 4KH2A 4PAZA 4L0YA 4JFSA 3FBKA 1WISA 3UTSD 3VXRD 5IOKA 1EEUA 1MDTA 1T21B 2R69L 3ZR5A 4PJHF 3D33A 3QJRB 4KI1A 2BP8A 4ZBJA 3RVXC 4E9LA 2MMXA 3U1SL 1IBGH 5TTRA 1KB5L 1RVFL 2AQ1A 5HGDB 4OF3A 4MXWL 4Y2OA 4UT6A 1QLEL 4K8RC 2WIIA 3ULUH 5JQIB 2WVUA 4L1TA 5EG6C 1YYCA 5F1IA 1MFDL 3L5XH 3UYRH 4XBEH 3IMRA 4YHIB 4YSTA 1M2OA 4B9JA 3S9DB 2YKLL 3ILDA 4ZUTA 1PG7W 4LO9A 3TT1L 4LEOB 5D1QC 3VXUE 5A2JH 3KWXA 1T66D 2W9DL 2VUKA 2VN7A 3ABGA 2CDGB 2F0CA 3E7JA 4H44C 5JHLH 4CDGC 4Z7WF 5I1AA 5I1DB 4Z7QE 3EGSA 3HIZA 4GBXC 4PGDA 2Q8BH 4Y7OC 3KWWB 4ORGA 3LS4H 1PLGL 3U0PB 2XXMB 1NH6A 4MZ2A 2BSTB 2FEEL 3C5ZA 3O4LA 4F7EB 1KTDA 3P2BA 3CDCA 1XF3B 1E43A 3ARTA 4CDHA 4CSSA 1S46A 4H88L 5BV7C 2DQJL 3IT8D 1I31A 5D71H 1MJ8H 2H1XA 4XODA 3JUYA 3JV4B 3FN0H 4UT7L 1MW1A 1Z9OA 2AS5M 1XGTB 3DA0A 3LEVH 4XCFL 4MS8C 3CJJA 3KD4A 2M2DA 3VB8A 3E80A 3STZB 4CW1A 1NCNA 3DXAB 4YDZA 4YR6B 1PG7L 3ZJAA 3P9MB 2ODIA 3ZTJG 5E5LA 3P30L 2IQAB 1MKFA 4P23C 1OAQL 5KYWB 4KY2A 2DIAA 3CLFL 3I6LE 4P5TB 1YY8A 3BVWA 2UVEA 3CFCL 4LSDA 1I8KB 3SDDB 4PGDB 1EPFA 1FZKA 4U4IA 1ZHBA 1F0LA 2YD0A 3RWJB 2ZCLH 3N6YA 1QPKA 1Y18B 2IG2H 4IBQA 1AQMA 1MFEH 1NGXB 3QRGL 4UMSA 2JJTA 4G72B 1HH9A 3ZDZE 5LKNA 1A6PA 1IX2A 2WYTA 3RPBA 1T83A 3CIQA 2C1OA 3NG5A 5L2KB 2AJ3B 1HHHA 3FT3B 2YPKB 2OMXA 4IS6B 4PJIA 1Q94B 2X3CA 4TQPA 1X4YA 1QABA 3HRZA 5C6WH 2H8PB 1QWNA 3K8LA 1A7RL 3EG9B 3DOHA 3VH8A 3OZ9L 3T0BA 4NO0A 4UIMA 1X5HA 4HCGA 3QJZA 2M8XA 4Z3IA 5LJYH 2MCG1 3PGFL 3CVIL 1MELA 4L8SB 1UWFA 5JDSB 4MNHB 5SWZE 2KS0A 3Q3GA 4KQ4H 1MEXL 4LVNB 4TQHA 1HXKA 1T5XB 4G8EB 4JANA 2NUPB 4OD2B 4KZEH 4DJMA 3UBXB 3S6CA 2Y7LA 2WLKA 3A6OA 1NGXA 5HVHB 4XBMA 4O9HL 4AIOA 1VLXA 4HAGA 1WFMA 4YHLL 3HRZC 3UEQA 4K5LA 4Z3TA 2J6WA 2UZYB 4L23A 1NAMB 4G6AC 5IBLC 3VWJA 3I50L 3MU3A 4P99A 3X1FA 3L08A 4F20A 1YPZA 2OCFD 3VH8B 2VDPH 2AJVH 4S1SL 1KCUH 2Y6TE 1BD2D 3V5HA 1XX9C 4N3UA 4PW3A 5IFHH 1MXDA 4UANA 3EADA 4P9HL 5KSBF 4W4NA 5DMGC 4TKWA 3D2UA 2D2OA 2A9AA 5GZNA 3Q2NA 4X5XA 3S5ZA 4DQOL 1CFMA 3H6JA 2HKHH 2NW2A 4KZ0A 1VFOA 1J05B 25C8H 3OAUH 3R0NA 1N6UA 2H9GA 1Z3GL 1SGKA 1TJHH 2APXA 2OCJA 3GIVA 2LVCA 3G5XB 3CWGA 3S36X 2VLKD 4HIXH 3GBEA 1RPQA 1UM6L 2OLDA 4GT0A 1F4YH 4KKBD 3X1EA 4DQAA 1JUFA 3OKEA 4OLXL 4ZOAA 1CI5A 2OQJB 2X44D 2XNAB 3ZO0A 4JHZA 4HQQH 3V4VL 2X87A 2AV7A 3HI6L 1K5NA 4B3VA 2IGTA 3PWJB 4HISA 1E4WL 2FL5A 5FYKH 1R19A 3VXMB 8PAZA 3QUMA 1YYLH 5F7EH 2H26A 4B96A 3D2UB 2BVUA 3HLAB 1UT2A 1R24B 2VXVL 4J4PD 1UFUA 1MJUH 3AT8A 1R33A 2J1ZA 4K3DH 1BECA 2H9GB 3PREA 3L9EA 5DF0A 1M42A 5JUEH 4HS8L 4LHUG 1IKFL 2CUAA 2YAOA 4M7LT 3PQYE 1WWAX 5MP6L 4HUKB 1YSOA 3QC5X 4P4KC 3D18B 1QHOA 3LN4B 3D0LB 3EHBC 1YEHH 1QD0A 2A77H 2BS9A 4N8CL 2AERT 2BSSB 1RPUA 3MDJA 1EJOL 3WY2A 3VD1A 5CU9A 2H6OA 3HMWL 2AZUA 4BD4A 5HGAB 3QEQD 4JHUA 1N0LA 1R17A 2OMUB 3B6SA 1SMDA 4QTHA 2ERJC 2YZ8A 4LCUA 5CF3A 1QFUH 2B7DT 4WO4B 3JZYA 3OC5A 1GKOA 2DN7A 3RWGB 1C5BH 2I85A 5J12B 3QJUB 1NTDA 4RMBA 3NFSL 3ARED 1BMWA 3WXWH 1WE5A 3BFQG 3IPEA 3AXLA 5E8PA 3N06B 1P7QB 1WA0X 4KDWA 4MMZC 2P45B 5I28A 5KVGH 1X5LA 3QIWA 4WFED 3BO8B 4Y5VA 5TE7H 4H1LH 3R1GL 1YDPA 3AU1A 5DD1H 2HWZH 3OJMB 4JQIL 5T5FL 4OGAD 1TTFA 3D0LA 4UQBA 3FMGL 5EU4B 1FFQA 4RH4A 1Q9OB 3F65A 4QUOA 3LKPA 4UCFA 3O4OC 5IQMA 3CHRA 2DLIA 2UUDH 4UQIM 3BGMA 4KKLC 1NIAA 4CVZA 3N5AA 5D1QA 1CDIA 2BP5M 4DGIL 5T3XE 3SY0B 5KJ7E 4FQCL 3SDXA 1AQKL 2IWGA 1IQDA 5DJAB 1OPGH 1MH5A 5J1SC 4PRID 2QPEB 3Q2WA 4CSZA 2FECL 1BVLA 2CQVA 3F01A 3JWOC 5F9JA 3RAJH 1PDKA 4F33B 3EYOA 2J12B 5D7KD 1IARB 4JPWL 4PJ5D 1AFVH 5H2BB 5J12C 4D8PA 5JW5B 5D2NC 4CU8A 1JXKA 1DQDH 5CN2A 5KTEL 4OJAA 3UPAA 1ZVYA 3BZDA 5HJ3A 2NSMA 3IGKA 3CHSA 3EAKA 3NCFB 3QNZB 1DR9A 3MNZB 1H6FA 4HULB 1F1AA 3P2TA 1XFPA 4MXVE 2ZPKH 1K8DA 1LMIA 4M1CD 4AEIH 5I18L 1I3GL 4PVBA 2VLJE 2J4WH 2CO7A 3LPGA 4UTAL 4OTXH 3V6OE 1EEYB 1XO8A 2AEIT 4MZIA 1G9MC 4Z7UF 1RK0A 2A3TA 5IT2H 4DK6A 3T4AC 2VO5A 4DUWA 4XCYA 4JDEB 1AZBA 2DQEL 3EH5B 4IRSA 1UWGL 2Z7YA 2PWDA 2FWOB 1MN4A 1A1NB 3KGTA 5HHQB 1LYQA 3N42B 3RGVC 4I85A 1PCXA 2Q76B 1D5BA 3RFZC 4TULL 1O7VA 2EDMA 1UWXH 3Q5TA 1E28A 2PYFA 3GHBL 4YSPA 4ZW8A 5BRZB 2YMTA 1MFCH 1IGTB 5IUCA 4RMRA 2DH3A 3SPHA 4L1BA 5I15L 1DLFL 1RV6X 4HEME 1C7TA 4NO2B 1E9OB 4OD3H 3IJ8A 4YHZH 1YEEH 3KXFE 4UV7H 4UILH 4WI9A 3LVTA 1G7MB 5B7EA 1F6LL 5L6YL 4X6FA 5ECGA 1AGEA 1JZIA 4PW9A 2FJFA 2YEQA 4CGTA 4X6EA 3V7AE 4WUUE 2ZXBA 4RFOL 2XBDA 3AY4C 2DV6A 2JLLA 4HV8A 2X6MA 5A6IA 4IMLA 1YLBB 2WLIA 5J9PB 2QADC 3Q8BA 1S9VA 3ELAT 3OHXB 2OMNA 3MRMB 1KEGL 4FQHA 3B5TA 4R5VA 1NCAH 4GUCA 2NLJA 4L4VE 4OCXH 3FUJA 1WZLA 3PXJA 1RIHL 3RJOA 4Z0XB 4BWTA 2UXFA 2GSIB 3PV6A 3F5WB 1W0WA 3KXFD 2VXTL 3N2JA 5AOKA 1AGFB 2ZXAA 1FWXA 3DK2A 2Y2WA 1BVKA 1SMAA 2WMPB 4LAJH 4MGXA 3VCLB 3HG5A 5FYLH 5E08H 3K1KC 1XZWA 3V0GA 3QORC 1TFHA 2YAHA 4FQXB 3GD1C 3JWDL 1CFSA 2HTLD 3P69A 1HEJC 5FUOH 3K8KA 3LH9A 1H3TA 4U6VL 4NKDA 1A0QL 4WO4D 1NCOA 1XXDC 5ILTH 3T08A 4KVNH 1KB9K 3C6EA 4ENED 1QEWA 5FA4B 3NK4A 4PRHE 2BNQB 4BSVB 3LH2H 5IHZA 4U49A 5F7NC 2EXYC 1TEFA 5AZUA 2Y07H 3OKMA 3HC0B 5D93B 3WOVA 2A6JA 2VDMB 3IDJB 5E00B 4M5YL 2W38A 4MAYA 4J6RL 3RLSA 3T0EE 3MUJA 5D7JD 1MRCH 3O81A 1YMHB 4BA8A 5M7QA 1WFOA 2HRLA 3BFOA 1IZKA 1U33A 2WMPA 3QJHA 3VCLA 2G2PA 3IN0A 1R4XA 1JIBA 3S3JA 4P4KD 4EN3B 1IFRA 2W60B 2A9CA 1OGAB 3DVIA 3CN0A 2VLRA 2XG4A 2ZAGA 2Z92A 3WNNA 3OMNB 2AJXH 1M56B 1BAFH 3II1A 3LZRA 1WS8A 4MA7L 4M8RA 3NEXA 3HBQA 1QKZH 1BPVA 4PRHD 2XBTA 4TVPL 3MJ7B 1S9XB 5DQ9A 4M6AA 4HAFA 3TZVC 4AC4A 2AJUH 1U92B 4JMNA 5E8NB 3DX1A 3TNNA 2FNBA 2YLKA 2B2XL 5MHSD 1HDMB 1Q9LA 3QT2A 4TL4A 2NY6D 4P2OC 1SJHB 5I5RA 4Z78A 4MWFA 1N7MH 1AH1A 7CGTA 1WFTA 1L9TA 3LB6C 4FLQA 2BIPA 5KN5B 3VW3L 4NDMB 2F1AA 3JV6A 1JS4A 4FKHA 4WWKA 3HPLB 3S88L 3LZPA 4I18B 3WO3B 5GISL 2NTFA 4A38A 2VITB 4P57B 2CO1A 4GINA 5E94B 4R96A 1YEJH 1M4KA 3O6KL 3GIZL 4GAJL 5CR1A 4XH2B 2J8UF 3NN8A 4W9HC 2DYPD 3PAVA 3CZKA 1JPEA 1OSPL 5DWUH 1A7QH 5JOPE 1JZ4A 5GGSA 1H6UA 3FSOA 2V2TB 3QUZA 3DI2B 5J13B 4MJ6A 5JOFA 3WS6A 1ZT1B 3BUPA 3DMMC 3FTXA 3V0WH 5C6TH 5IW1B 2E56A 3NZ8B 2E86A 3Q06A 3Q2VA 4YBQD 3KYKH 2V9RA 1KCWA 2J71A 3GZOA 5J7CC 2QGDA 4BH7A 3QO0A 3UJIL 1ZT7B 2HXAA 1C1EH 5DHMC 3ARDC 3VFVA 3Q2LA 4L3ED 4PJAF 1R3IL 4PS4L 1TCRB 4X5PA 3T2PA 2VSCA 3OPZL 2FX9H 1TO4A 4QMEA 5D7IF 5J0BA 1MWAH 2DQMA 2WYHA 2M83A 3DHPA 4I18C 4XPGL 2EZ0D 2XZCL 5GGQH 2DWSA 3NFPA 4HF5L 3O2WL 1EHNA 2Y2TA 3T77B 3HZKA 2YXWA 4NQSA 1UOLA 5AVTB 4PJBF 2FT6A 4FERA 3V0DA 4FTVD 5DI8B 3R7QA 3MRNB 4DNLA 3O0RH 5DURD 3RL2B