2Q5OA

X-ray structure of phenylpyruvate decarboxylase in complex with 3-deaza-thdp and phenylpyruvate
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
537
structure length
529
Chain Sequence
HMKLAEALLRALKDRGAQAMFGIPGDFALPFFKVAEETQILPLHTLSHEPAVGFAADAAARYSSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEGNAGLLLHHQGRTLDTQFQVFKEITVAQARLDDPAKAPAEIARVLGAARAQSRPVYLEIPRNMVNAEVEPVGDDPAWPVDRDALAACADEVLAAMRSATSPVLMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMGRGLLADAPTPPLGTYIGVAGDAEITRLVEESDGLFLLGAILSDTNFAVSQRKIDLRKTIHAFDRAVTLGYHTYADIPLAGLVDALLERLPPSPHAYPTGLQADGEPIAPMDIARAVNDRVRAGQEPLLIAADMGDCLFTAMDMIDAGLMAPGYYAGMGFGVPAGIGAQCVSGGKRILTVVGDGAFQMTGWELGNCRRLGIDPIVILFNNASWEMLRTFQPESAFNDLDDWRFADMAAGMGGDGVRVRTRAELKAALDKAFATRGRFQLIEAMIPRGVLSDTLARFVQGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phenylpyruvate decarboxylase
publication title Molecular mechanism of allosteric substrate activation in a thiamine diphosphate-dependent decarboxylase.
pubmed doi rcsb
source organism Azospirillum brasilense
molecule tags Lyase
total genus 189
structure length 529
sequence length 537
chains with identical sequence B
ec nomenclature ec 4.1.1.74: Indolepyruvate decarboxylase.
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q5oA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q5oA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2q5oA02
1MCZA 5K6RA 5C4IA 3EXFA 2JGDB 1OZHA 4D5EA 5IMSA 3EXFB 1Q6ZA 4C7BA 2BEWB 2AG1A 1V16B 2R8OA 2XT9A 5FEMA 5FYQA 4KXUA 3HWWA 2Q28A 2PDAA 2W93A 2QTCA 4HD8A 4GG1A 2HJHA 1V11B 4GM4A 3CLSD 1UMDB 2Q29A 4JSRA 3ZGOA 2J9FB 3EA4A 1YHZA 1POXA 2BFFA 1Y9DA 1L8AA 4JUDX 4UTNA 2C42A 4UTZA 4GP9A 1M2KA 3FLMA 2EZTA 2NYRA 2C3PA 4KGDA 1UPBA 2C31A 4FEGA 1ITZA 2VK1A 1NM5C 4JUCA 2H2DA 1AY0A 4KXQA 2BFDA 4QPZA 2BEUA 2BFDB 4RMJA 4BVEA 4MPPA 2V3WA 1V5FA 4R8MA 5EJ8A 1PT9A 2BP7B 2B4YA 4MPJA 2JI6A 3AHIA 1POWA 5MGNA 4BN4A 3ZGVA 1NGSA 2C3YA 5DGDA 5BWNA 2PANA 1OZFA 2IHTA 3L84A 1X80A 4UTXA 3DUFA 4C7XA 3RIYA 4L3OA 5I4IA 2YICA 1UMCA 5EJ4A 1UMCB 4JUBA 1YD7A 1OLSA 2BFBB 2BFEB 1Q1AA 1R9JA 2FWNA 5MFPA 5EJ7A 1V1RA 4KXYA 2OZLB 1Q17A 2FN3A 2VK8A 4UUAA 2OORC 2XTAA 3D7KA 3EXIA 5K6TA 1OLUB 3ZHQA 1BFDA 4RJIA 1YHYA 1Q14A 4D5GA 1TRKA 4KPUA 3LQ4A 4JD5A 1UPAA 4K9PA 3E9YA 4K9MA 1PO7A 4JUAA 4K9LA 5K3SA 4X3PA 3ZHVA 3LQ1A 2X7JA 2A1UA 2BFCB 4RMGA 4BV3A 4QELA 2H2HA 2VBGA 4JU8A 3M6LA 2JLAA 3PDHA 3ZHUA 1U31A 3EXG2 4Y6QA 2JGDA 1DTWB 3ZG6A 3OOYA 1UMBB 2BEWA 1V16A 4Y6LA 1TKCA 3ZHTA 5K2OA 1OLXA 1T9DA 1UM9B 4I5IA 3D81A 4O8ZA 1OLXB 4IAOA 3AHJA 2H4HA 1YC2A 1DJLA 2H4FA 1QS0B 2VK4A 5EJMA 3CLRD 2WVGA 1V11A 1UMDA 2J9FA 3FZNA 5BWLA 1EFVA 1PVDA 1U2GC 3CLUD 3M49A 5I5GA 2JI8A 4Q9DA 3AHGA 3UK1A 1S5PA 3IAFA 2E6KA 3AHHA 3CF4G 1X7XA 2BRUC 1N0HA 1X7XB 3DVAA 1WCIB 5EJ5A 2Q27A 3DVAB 1W85B 4RMHA 1V5EA 4K9OA 2JI7A 4BUZA 4G1CA 2H4JA 3GLTA 4L2IA 1PNOA 4ZZIA 4UTVA 2UZ1B 2BP7A 1U5BB 4XEUA 2VBFA 1QPBA 4X3OA 5HYVA 5MF6A 3HYLA 3OE1A 3RIMA 3MOSA 1IK6A 1QGDA 2UZAA 2PGOA 5I51A 3GLUA 3HWX1 4V1CB 1T9CA 1XLTC 1TKBA 3EXHB 4GPEA 4COKA 3ZHSA 2AG0A 2OO5C 4JUFA 2Q5JA 4IG9A 2BFEA 2BFBA 2R8PA 5BWOA 4RMIA 4J1TC 2OZLA 3DV0B 1O96B 1W88A 4ZP1A 3RIGA 1OLUA 1W88B 3KOMA 4UTRA 1RP7A 3FSJX 5HJEA 4KXXA 2QQGA 1V1MA 2EZ8A 5ERXA 1V1MB 1Z8NA 1B0PA 2BFCA 2OD9A 2XT6A 2WVHA 5HHTA 3AHDA 1M2NA 3GLSA 2FR8C 1D4OA 1DTWA 3EXG1 1ICIA 3JR3A 1UMBA 2BEVB 1YTLA 2IHVA 4RJKA 1UM9A 5ESDA 3EYAA 1TKAA 4UU8A 4JT8A 2C3OA 5I5EA 4F56A 1X7ZB 5HGXA 3EXEB 4BVFA 4F4UA 1U2DC 1QS0A 1M2HA 2EZ4A 2R5NA 1M2JA 3AHCA 1V5GA 1J8FA 5EXDA 3EY9A 2O1SA 1NI4A 2VBIA 1UPCA 1NI4B 2FSVC 1U28C 4IF6A 4K9NA 1HZZC 1M2GA 2QQFA 2Y0PA 2VJYA 2Q5QA 2H2FA 4BVHA 5EJAA 4C7VA 3JWPA 5EXEA 3PKJA 1WCIA 1W85A 2G67A 3M34A 4MZXA 2G28A 3F6BX 4HDAA 2OD2A 2BFFB 3UPTA 1E3TA 4J16C 1OZGA 2O1XA 4BVBA 2UZ1A 1U5BA 4FEEA 4RJJA 4JU9A 1X7WA 5DGTA 2FRDC 1X7WB 4GM1A 3U31A 1OVMA 2H2GA 3IAEA 4K9KA 3ZHRA 3D4BA 4MPRA 2BEUB 1X7YA 3CLTD 5ERYA 1X7YB 4KXWA 1GPUA 1YI0A 4BN5A 4C78A 1YNOA 3AHEA 4V1CA 2JI9A 3EXHA 5AHKA 3M7IA 2PGNA 1O97D 3PKIA 1YI1A 1YBHA 1T9AA 2DJIA 4FVTA 5D7NA 4UU7A 1JSCA 1KEKA 4JT9A 4UUBA 2EZ9A 3DV0A 1SZCA 2EZUA 2A1TR 2WVAA 2OD7A 2JLCA 1SZDA 1X80B 3DUFB 2C3MA 4BVGA 4FZ3A 3AI7A 5EJ9A 2Q5LA 4BV2A 1PTJC 3AHFA 2Q5OA 4K9QA 2G25A 5MFZA 1PNQA 2H59A 3GLRA 1OLSB 1T9BA 2IHUA 3F6EX 4MQ5A 3EXHC 2IEAA 2JIBA 1V1RB 4TWIA 3EXIB 1MA3A 4TWJA 4QQ8A 4GM0A 3K35A 1PI3A 1S7GA 2BEVA 5EJ6A 1ZPDA 4KXVA 4Y6OA 1PYDA 1EFPA 5DEIA 3U3DA 1YC5A 2C3UA 1X7ZA 4WBXC 3EXEA 2QTAA 3LQ2A 2H2IA 2NXWA 2YIDA 4V1CI 3LPLA
chains in the Genus database with same CATH superfamily
1A8SA 3RYTC 1GTVA 3I2GA 4M21A 4DSAA 2O7SA 4D9EA 2REQB 2V6BA 3HNRA 1HL3A 2DG2A 5CIYA 5I48A 4IBOA 1FFWA 2J0UB 4OAQA 2AW5A 4D5EA 4I2NA 1RYEA 1DIAA 1EFUA 2PXHA 3N2GB 5KYYB 3I6MA 3D2BA 3LSYA 5G53C 3G5AA 1YBMA 1Y1LA 2OPBA 1MEJA 5GWXA 3I5XA 1LLDA 4BFZA 2RCNA 3IAS1 1ICEA 1KQFA 2FFRA 2I5PO 2VZEA 1AN0A 3NHMA 4G4GA 2JGEA 1K4MA 2BFMA 3PR2B 3G9ZA 4JXJA 4KC0A 4ALJA 4WLNA 1EH5A 1RCUA 5K45A 1EVKA 3I6YA 2DFKB 5KJCA 2HNBA 2P3OA 2FQ1A 2Y77A 1IAVA 1Y8CA 2O8NA 3GEPA 3F73A 5C5CA 1TT7A 3DM5A 3A32A 5K3CA 4O4JA 4OQXA 5A4JA 2H07A 4QNRA 2YRFA 5DTMA 2LD4A 4YAIA 1SXJB 4MW0A 1G8KA 4YMGA 2WM3A 4QO7A 1T34A 4XGQA 3CZ5A 1P3JA 4DSOA 1K06A 1AO0A 1YHZA 4ESEA 1F6WA 2F1KA 4XCQA 1WHTA 2IFTA 3HH8A 1V8OA 1NQUA 3UJ7A 1DNPA 4MVJE 4EMBA 1Y9AA 1Z0UA 1QTRA 4B84A 4I4IA 4DQ0A 4E6EA 2R4TA 3WB2A 1WZUA 4ILEA 4XLLA 4YJFB 4UOQA 3UB3A 4A0QA 3GU3A 4V02A 3GPCA 1DMSA 1ZGCA 2R7AA 4V3CA 1Z0JA 2JKZA 4OB6A 4JOCA 5ALTA 3AWDA 1NM5C 4HYYA 2GN4A 5FR1A 3D7NA 3B3AA 1TM3E 2CFOA 2EATA 1DCMA 3M33A 5F64A 1CFJA 2WTEA 2XUZA 2XTNA 3B1KA 5EUQB 4RFLA 1WSAA 5HCIA 1ZNZA 2LDXA 2LPMA 1VRVA 2PBLA 1J2YA 4COOA 1TB4A 1PJZA 3C3YA 3PEUA 2FAXA 3GGGA 1GITA 5HF9A 3UXYA 5B55A 1SKYE 2UYGA 4TL8A 4LHEA 1XZBA 4TL6A 4EGFA 4EYSA 2AD1A 5KSZA 2V3WA 3RS0A 2FMHA 4EB3A 4TPKA 1RBMA 4NONA 1ZH2A 5CDGA 1UJNA 4OLAA 2V4UA 3CJRA 5GOZA 5LZ4A 2VF2A 4H7HA 5BO5A 2QE7D 4HZIA 4RPCA 1L5VA 2Z2IA 1E89A 4TLLB 2W2VA 1KBZA 4KUHA 4MJ7A 2PXCA 1ZN9A 1KVSA 1TGYA 3H6KA 5DMHA 4A0GA 3P9CA 4D42A 2ZBEA 1KI6A 3CEHA 3WNQA 4E70A 2PFGA 3B3FA 4WXHA 4BNUA 2Y0DA 1L7OA 2IIPA 3FTPA 4LDZA 1QFXA 1NF9A 2J5XA 5F78A 1C9JA 1EWYA 2NSLA 3B9RA 3ZZUA 3ZD7A 1Y6QA 3IEPA 4DWOA 4W82A 1ZH4A 3TRFA 2J31A 1QZ3A 5F7ZA 1DAPA 3H04A 3I9MA 1SVNA 2XZOA 1UR5A 3PX3A 1YRWA 4A2QA 2H92A 2R00C 4TLAA 2SCUB 2V58A 1ZMXA 2YMQA 2ZSHA 5EJ4A 1JWBB 4I6JA 3H5VA 4EWLA 2PKWA 3OKPA 2JLBA 1MMFB 1E58A 4GYKA 3RUFA 4C6SA 4FDTA 5MN6A 1W36D 3CLVA 2OM6A 3G17A 4GE3A 4MGYR 4RY0A 3BXPA 2VJQA 5CLIA 3H17A 3ZWDA 1R9JA 2Q3EA 2ONYA 2VYCA 4RKWA 2V4ZA 2PVCA 3U6BA 1E69A 3W9BA 2AKYA 1OJLA 1U0OC 1RXVA 2AOXA 3I28A 4B71A 2XTAA 3DPSA 1U8FO 1QNLA 2FWMX 5I8PA 2OWDA 4KQKA 1OLUB 4E03A 2OFWA 3MBKA 1LPNA 3P2EA 2J7PD 5ECWA 1F8GA 2X4DA 3C3DA 3ETNA 4ZDKA 4JD5A 4F85A 2IZ5A 1I3MA 3HR8A 1P4GA 3LH5A 5IVDA 1IB0A 3QX8A 4R81A 3T4PA 1GQSA 4B7XA 1E1MA 2X2EA 4F8YA 4BAGA 3G8DA 4ITUA 1TVCA 3FSEA 3LGAA 1DDOA 3X1YA 2QM0A 3HE3A 1JB1A 4B5KA 7YASA 3WGJA 4A23A 2PLNA 1GRVA 4GRDA 1IULA 4NFSA 3HBLA 1FSFA 4D9MA 2EEPA 5EMKA 3UICA 1U3CA 3GUHA 3BCHA 3TM4A 2GD2A 2IRWA 3ONFA 2J33A 5CLLA 4PGFA 3RB8A 2XB9A 3ZPXA 1DC7A 3ZG6A 1U7UA 1SHLA 2FI1A 3CCCA 3ANXA 5D01A 1QF9A 4E31A 3JQBA 4C7OB 1DX6A 1UBOS 4EGJA 1IOVA 2CZCA 3ENVA 1XRQA 5KCZA 1KDZA 2H08A 3MD0A 2HCJB 2WU4A 3I6QA 4RK5A 1Q1NA 3LUAA 4XGIA 4H0FA 4C0HA 3V00A 3MTEA 1Y9JA 1ZH0A 1B0UA 4BMCA 4KN6A 5HE9A 1ZGAA 4YCBA 3NHSA 1H4SA 3PX7A 3KAJA 1ADCA 1GA4A 3UQZA 4GKKB 8MHTA 2QRJA 5LMUB 5BPFA 1YBVA 3CV3A 4GR9A 4F71A 5EZQA 5IAKA 3NOOA 4YP1A 4YGYA 1HTWA 4R98A 3FWKA 1PFUA 2PLAA 4HB4A 4HGNA 1F0KA 1UC5B 1DQPA 3IKVA 3CVOA 2ZYAA 4MS1B 1U1GA 3GGPA 5UKDA 4EUEA 3ZKAA 1PQPA 3BDVA 5LKAA 4DEXA 4NK4A 4EQ6A 2ZIUB 3DWGA 2I33A 3BGIA 3ZZ0A 1OHHD 1SPXA 5T41A 4X64B 4D99A 1ISRA 3RWBA 1FK8A 1DKPA 1W0KA 5JDIC 2I76A 4G9EA 4HSGA 3UEOA 1OI3A 5I3CA 4MR7B 3G9QA 4KIGA 1ZMBA 2BHRA 4Z9AA 3DFUA 3JQ7B 4EYEA 1QIIA 3NPAA 2HZBA 1Z3IX 2XCQA 3D3WA 4WCDA 3JSAA 2F1JA 4IKPA 3TL6A 1RACA 3PVCA 2H7CA 3NC0C 2H4JA 4G1CA 1TW3A 1PNOA 4GZ6A 3VUEA 4BLPA 2J3HA 4Z9BA 3TLGB 4ZZIA 3ROKA 2Z2ZA 1QFMA 1YT5A 3OTGA 4LYAA 2KB0A 2FEOA 4WVLA 3ZX5A 1G42A 3OLXA 5B6PA 1GGFA 1RAHA 3O1HB 4PZAA 4QM6A 1PDOA 5EKUA 4QDXA 3FZYA 1VSQA 1QYIA 3TR0A 1Y6RA 1T36B 2VZ9A 4K5QA 5T5QA 3TSAA 5IABA 4RTSA 4I4NA 4EF4A 3AM4A 3FI0A 2X0JA 1LRJA 3MOSA 1PTJA 5EQTA 2YJ3A 1DJPA 1KJYA 3QWIA 1ZJ6A 4DA6A 5JZOA 4WESA 1LJLA 4C4RA 4NE2A 4EPWA 3HWX1 1RJFA 1H1LA 3BIFA 1P5ZB 4V1CB 4CCWA 3BDIA 3NRJA 3PIDA 1H5QA 4LJ7A 4CL3A 5AVTA 1PFKA 1XBTA 3IIKA 3JPWA 4HY3A 5DLQC 2EW1A 1XWIA 3LL4A 2A67A 5DCUA 1ORRA 1RBYA 1SULA 1HC7A 4IDGA 1ZU4A 4UVIA 4B81A 3O7WA 4TGLA 4FFRA 4L8FA 4X7BA 2IH4A 3J7AC 3B2QA 3IBFA 4QTUB 4XVRA 4CN9A 5EKXA 3AFNA 3KQWA 4PYNA 3GUYA 2RHJA 2H1RA 1GOTA 2ACVA 4CV2A 1BH6A 1FU8A 3DMYA 4RFSA 4JI6B 2H54A 4AJ4A 5JADA 3V8PA 4DV2B 1LFDB 1VJRA 2FWJA 2ZI6A 4H7PA 4PQFA 4WNYA 4DBLC 3P9NA 4RULA 5JXWA 1BSVA 1VB5A 4TSFD 4ZOLB 1YR3A 3CINA 2G9ZA 1IUNA 3ZWAA 4OHWA 4F5DA 3M6WA 3CW9A 2B35A 4G0NA 3D8UA 2B6HA 2X8LA 3M5PA 5FWDA 4DWJA 3IVRA 4HLUA 5HUJA 2Q6VA 1TMGE 2F3PA 1JX6A 1WVMA 2ZRNA 1N2XA 3DZIA 3P9XA 5EHQA 3C4QA 1V1MA 1CRZA 3EBPA 3AZQA 5JZ9A 1IM2A 1II8A 2VWQA 4MWZA 3MJ4A 1AHPA 5ESXA 4XW2A 4HYTA 3MELA 1T3HA 4UBLA 1NMZA 1YRQA 3LCJA 1B7GO 5TPZD 4D8TA 2O0JA 1T8WA 3EVCA 3NTOA 2JFXA 1W0JA 2FSVA 4YMHA 1VDZA 3O8DA 4F45A 1U28A 3ROMA 1N9GA 3N2KB 3GVXA 3PHCA 3T7RA 3QUSA 3WO0A 4FLEA 4PLTA 2C61A 5DU2A 2BDEA 5LDDC 2O3JA 2WE8A 3JTMA 1OX4A 1RKQA 1VLQA 3P2KA 4M9ZA 4AY5A 1C1HA 4IYJA 4QG7A 4HXYA 5FL7D 3CMCO 4JJAA 1RRFA 4AJKA 4PGMA 3L4SO 5HX7A 4OP2A 3O8OA 4K6FA 3DCYA 5AW4A 2CLCX 3VZRA 5GZ1A 4DCJA 1YZ3A 3DL7A 4BEBA 3QWFA 4KQWA 1P1HA 1C7RA 1S1CA 1AQIA 4AK9A 2YW2A 4RK0A 4K88A 4LCJA 5IH3A 1PN3A 4KAJA 3BD6A 4BQFA 1SXPA 2D0IA 4FC7A 1JEDA 3CR3C 4H7EA 1X13A 3JU3A 4L6IA 2LCFA 3HACA 4FDAA 1ZR4A 2F3QA 1S2IA 3Q6IA 4HUQA 2IC5A 3ANMA 5BN3A 2B1IA 3H2HA 1Q0UA 1J33A 2AC7A 1OPRA 2XQJA 5F1KA 3ZWMA 2V1UA 2YJNA 4YT8A 1NVWQ 2XVYA 4PLVA 3A6FA 3FPHA 3TMYA 4NY1A 4EDHA 3PFNA 2WD9A 1EFTA 1YQQA 1SVWA 2RI6A 2MSWA 3I4LA 3L6EA 4MR9A 4CRWB 2OBYA 4R69A 4CIAA 3IL2A 1IBLB 3I4CA 2H5LA 2YN0A 3K1ZA 4G0WA 2GVDC 1IXSB 1TYZA 1HEUA 1A4UA 3FUXA 4E1VA 1I30A 5GZ6A 4E3WA 2QZJA 3FYTA 1J21A 1ZW6A 5FOXA 4K6HA 4BB6A 2W6NA 4KR7A 2IXTA 2Z5GA 4GMGA 5ALKA 5BUCA 1D6JA 3Q7PA 3C3MA 1HFEL 1OYWA 3U37A 1P6QA 1RVDA 1D9XA 3O47A 4US2R 1T5TA 2UV8A 3Q7EA 4MUXA 1QHGA 3AUUA 3GFBA 5CVCA 5EXEA 5ILQA 4B3GA 3VPFA 3MMXA 4O4JB 1N2IA 1E2UA 4O4IA 5CH8A 3EF3A 3M34A 2P1DA 3TKAA 5BVGB 1O03A 1MX3A 3FDZA 4LPKA 1DAFA 1WHTB 3SZMA 4YRBA 1GGHA 5KX5A 2HD4A 3DTVD 4LXUA 4ZVKA 3VV3A 4B6EA 5JEDA 4ZO9A 2FXVA 4DJAA 4IGFA 2R11A 4HX9A 3RUDA 2O1XA 5JAQA 1YQDA 2GZAA 1IQPA 3LLMA 3QFCA 3P0JA 1WY5A 2P9QA 3RF7A 2IHKA 2JBWA 3DKIA 1FBTA 3H5IA 3HEAA 1L5QA 3N07A 4IQ4A 2G9RA 3HZOA 4NAHA 1SD1A 4DA9A 2BM9A 4WUTA 2VVTA 1T3SA 5ERYA 3AUYA 5U9CA 1LQTA 1OF1A 2W9XA 1GQQA 3N2YA 4A27A 4ARVA 2IZ0A 1YS6A 5TGTA 4C78A 4ZAVA 5K7SA 4FEYA 4FBMA 3RRNA 2DY1A 2ZI9A 3EMDA 1J5XA 4MV4A 4WKPA 3O4HA 1CX9B 3DXZA 4UARA 2QN2A 4XTRA 4EELA 3VPBA 5HILA 3VR4H 5IRCD 2OORA 2CL0X 2WU3A 2BMWA 2AEEA 1A9SA 4X1KA 3V7UA 3TUJC 1KTVA 2CWWA 3IKTA 1N6IA 2ZIVB 4JOQA 1DLIA 1ONSA 3EA5A 3KZCA 2ZLBA 3N1UA 5ALHA 4AJNA 2GM4A 3OPYI 4KXNA 5GQSA 4EMUA 4OA5A 1QDEA 1KI6B 3EJ6A 1RAEA 5T4BA 2VRNA 3RJ5A 3BGVA 2C88A 3QUQA 4ARAA 2XSZA 3EJWA 2GJAA 4M9SA 1R4AA 3H5NA 2Y92A 2FPLA 5EI5A 5DRTA 2PQMA 3QXGA 5JPIA 1GKUB 5TARA 1ZOLA 3QK7A 5DCYA 2FPKA 3CSUA 1WSDA 3B1XA 1VCIA 3F71A 4H18A 1QE5A 2XMRA 2IZ1A 4IOKA 4MV6A 4W6QA 1T6YA 1EWVA 4XYLA 4ASUD 3EIOA 3WLNA 4D9KA 3F2VA 2HA4A 3W5IA 3V8QA 4TMZA 1Z35A 4BRZA 1GYRA 4BKQA 5IS2A 4ZOEA 3OECA 3V9AA 5LYJB 4X65B 3RSQA 4FYHA 3V80A 3PQ3A 4QULA 1Z28A 3ESZA 2H1FA 1CJUC 3AM3A 3CXRA 3HSYA 3QYPA 4I5DA 2BLNA 2ZJ2A 3GLQA 3R7BA 3LC2O 1NLUA 1WUKS 1XTKA 3HXTA 1CR2A 2OFOA 2ESRA 3DEAA 1CC1S 3GG9A 3GBPA 2BHSA 3L5KA 3P5BA 1MA3A 4B09A 4RJ2A 3K9HA 4K86A 2NXEA 3U3MA 5BV2P 1HYGA 2GBIA 5F2NA 5IWCA 5DYWA 2WPNA 3DHWC 4G5YA 2PX0A 1LSUA 4GP6A 2CEAA 3DKRA 1XWFA 3FUVA 3VO9A 5JE8A 1U1EA 1M1ZA 3SEFA 5U4XA 1A8QA 1MGPA 3KELA 1NXVA 3P4UA 4HAYA 1T8TA 1GTL1 1N0VC 2ZVQX 3EXEA 5JFOA 4M1TA 4MIYA 3WBKA 4D9BA 1GN9A 5JHHB 2IUFA 5DSTA 1PF7E 5ISMA 3VKWA 5CX4A 3HYNA 3NT4A 3KDAA 3URKA 4XM2A 3RSCA 3PUZA 2Z58A 2WOOA 1T10A 4RZ2A 4ZV7A 1LBIA 1Z7BA 1Z62A 1V35A 2I6SA 4IMIB 4UVDA 2FDXA 2HWWA 1CR6A 2BLLA 4W4TA 1CUSA 4BX8A 1EUYA 4MYTA 3RC8A 1N57A 1LV8A 3JWJA 4MUJA 4EKNB 4N3NA 3IAM6 1RPJA 3U19A 3FOEC 1P73A 1OFUX 3LFUA 5ULLA 4KSBA 4F5WA 1C3OA 1YDWA 3FKJA 2BF4A 1XKQA 3Q2OA 4J76A 4JYZA 3HCFA 2J5BA 3F8WA 2A9PA 4LGMA 4GSKA 4D45A 1BJKA 4ERXA 4ABTA 4AUMA 4G5HA 1Q0SA 4R4JA 1BEUB 3AJEA 5BURA 4J6EA 4EBBA 1SD2A 3RUPA 5C0OE 5DGHA 4EP1A 3HO1A 4H4CA 4J7AA 1YZKA 1L6RA 4I50A 3LKDA 4L5JA 1KY2A 2EV9A 4TT3D 1VJ0A 5F3DA 3ADCA 3IDOA 1BVUA 1EHCA 4Q47A 1GGNA 2O7QA 2X6RA 4FW8A 5H9WA 2GERA 3I04M 5AXCA 5JBIA 1H3NA 2XD4A 5LDGA 1AE1A 2M2IA 3A9CA 3QGMA 5EG5A 3OMXA 3L9WA 3OIWA 1MO3A 4OK5A 2HXYA 3OT1A 3PUXA 3HGMA 4P4SA 5KCMA 3F6SA 2RH8A 5CDSA 4MJXA 1B6GA 2GPWA 3ZVKA 1RWXA 3K2QA 4QNNA 2HPVA 2SICE 3N0WA 2ORWA 4QYSA 4YFYA 4B6GA 2E1RA 4W5JA 5BYBA 5KVQA 4UD6A 2D2IA 1OIXA 4KGDA 4EQ6B 3ZNNA 5JS6A 2GM9A 1I4TD 1M2OA 2IS6A 4QUAA 1UDWA 1LU9A 1A2QA 1LKZA 1GPKA 2EBFX 3CNLA 2I8AA 1XXHE 3IQXA 4CHGA 1Y8ZA 4ZO4A 3RS8A 3EEOA 3U9SA 3IIEA 4NOMA 3UJ9A 3E8SA 1PD1A 2FEWB 5KSYA 4G1MB 5JJKA 3D3WB 2IEBA 4PR0A 2KSQA 3PYXA 3UXMA 1E1KA 4FFDA 4GBED 3I45A 5EWLA 1E4EA 1NBHA 2D2VA 2VAMA 2YCLA 4G8BA 5JVDA 1ISIA 2PKXA 3NDRA 3V42A 5A5VA 3I9V6 2A9KA 2IZ6A 3ZY4A 4NCKA 1PJBA 1GZSA 4R0NA 1UZLA 2IK8A 1RRMA 1N9KA 1R37A 4YASA 3MQFA 5DM70 1ZDMA 2BI7A 2D59A 1ST2A 1FQOA 1WL8A 2GCIA 3Q1LA 3GG2A 1H94A 1H66A 2OFFA 1L8XA 3LZDA 3OVMA 3T94A 4ESOA 2IJGX 4WESB 1TI7A 2HYDA 4UTXA 2XB2A 3GRKA 1H1LB 3CZMA 1CUDA 1JG1A 2X22A 1T2CA 2UVDA 4PFQA 5EJIA 3AI3A 1F2TB 3T06B 4B85A 4TQAA 3R4VA 3MWEA 1ZM2A 1JHAA 5LQRA 1TCVA 4BCDA 3L18A 1CUIA 1SXJD 3K9NA 5D84A 3H5OA 3HDVA 3B6ZA 1NQVA 1TYDE 1V26A 3E2MA 1QOZA 4AY2A 1KH2A 4XWAA 4HPWA 4P7KA 3WJ7A 2BKXA 4RFSB 4EITA 2ZSJA 2OZVA 2I4IA 1A4RA 5F4BA 2FUCA 4IGAA 4R8SA 4KACA 1ZBQA 1UXJA 4CMKA 3D7KA 5HF8A 2JGAA 3AMVA 3EXIA 3GDGA 1L5ZA 4MEJA 4DVJA 1PNVA 4KAXA 4F11A 3DXXA 2I7CA 1N2BA 1T1JA 3F7TA 5EKTA 3FOAA 3DDNA 1R0SA 1YHYA 4ZV9A 1JJAA 3NR2A 2HQBA 3SZGA 3JQGA 3QY0A 1ZCZA 5HR5A 4PAMA 3CNQS 4YUVA 2ACEA 4WY5A 5B7NA 5AW2A 2E49A 3M8KA 1YMUA 3I9LA 2A3NA 2XLBA 3H9QA 4EA9A 4WOCA 1II8B 3PQ4A 3P52A 4JC0A 4UNIA 4DV3B 1BOOA 1H2YA 1XZEA 1O77A 3CZ4A 4LECA 5C32A 4FPXA 5TQJA 1L5MA 1S8OA 3IUEA 2FFQA 2IYWA 4QELA 2HL6A 3MGBA 3NTVA 2VBGA 3FMGA 1KFCB 1N9GB 1P7ZA 3N70A 1ZWKA 2XHEA 3PR1A 4TWBA 2BJVA 3EF0A 3M6LA 2ECOA 1COWA 1GZ3A 4RK4A 3V8RA 4DY6A 3T0IA 2FRVA 1OX4B 4A8JA 3T9EA 4MUNA 2EHJA 3A4VA 4BE9A 1A2KC 2YJ6A 3FF1A 4J9UE 4LJYA 1NONA 3I2JA 4PO1A 3DCJA 2E4XA 4CUKA 2ODTX 2BEWA 2E4VA 2RBEA 2YV5A 3O8OB 3ZJYA 2HBRA 3IEUA 4NJEA 3V8BA 2CYAA 4EPRA 2QYHA 1PK8A 2PZJA 4O8ZA 3SHFA 1DZ3A 2Z09A 4RY9A 4Y18A 1ZJYA 1GV0A 3O74A 1DPFA 2H4HA 3PNPA 3KKZA 1YFJA 3LDUA 3RIEA 4RDCA 4QLAA 2VK4A 3AJDA 3TO5A 5B3KA 4HUQB 3MWFA 2TMYA 4NZPA 4EI2A 5BN3B 4XJSA 5EJMA 3MJRA 3CLRD 5FTJA 1QPZA 1BHO1 3QTTA 2N0SA 1SIUA 3MLAA 2QQ0A 4Q9NA 4N6GA 3Q6NA 4DLWA 3ASVA 2ANBA 2NQ2C 3DONA 1GSIA 3A8TA 1VP9A 3PA8A 3HL4A 4IH4A 3V34A 3TDKA 4E5MA 4XWOA 2XBMA 4B6JA 1A8HA 4OFXA 1ZD5A 1PR9A 3GD7A 4ZZ1A 1MDFA 4R84A 1KJ8A 2RAFA 5EXPA 4MR9B 2ZIEA 3HB9A 4RORA 1P2BA 3GMTA 1JEQB 5I5GA 2JI8A 4GPZA 5TQVA 3RSSA 3N39C 3P7MA 5FPTA 4L85A 2H0QA 4CHTA 1WQ3A 1LV7A 1KAHA 3GN2A 4CPDA 4QGSA 1JECA 2E2WA 1T25A 3TLMA 5KTRA 2CUKA 1X8XA 1FMLA 1R0WA 2ZUWA 4U2KA 3AYXB 4RGQA 1BHJA 1K66A 2WP0A 4TQGA 5KIAA 1DT3A 2GBPA 4R6WA 1G16A 3GB9A 4D98A 2GZSA 4CG1A 4O4IB 4Y2RA 1KOFA 4YCJA 1CIVA 2VDQB 1I3LA 1KMIY 4G4IA 4LZNA 2P6OA 4UUQA 5AJWA 1U0FA 1NVVR 1L4FA 4IJWA 1OTXA 3FDZB 3MBIA 4TYWA 1RYZA 5KX5B 1C7QA 3NP7A 2PZFA 2B8TA 1O95D 2E82A 1W34A 4RQTA 3U4MA 1IPEA 4F5EA 4HQFA 1QPBA 3KAQA 3GFQA 1MNQA 1MR3F 1U65A 3GGJA 3BHMA 2JDIA 2NNLD 3HYLA 3W6UA 1XDUA 3F78A 1A4XA 2Z98A 4LTDA 1ZW1A 2XGMA 4KPGA 5K6AC 1Z82A 4XOIA 3NO4A 4IIJA 3ILVA 4KO4S 1PLJA 4NWIA 3OIUA 1N32B 4BP1A 2AYZA 4R71A 4YCCA 1CUWA 2WV9A 2BH9A 2VYND 3D5TA 4JP8A 4AJHA 4AUKA 2HMAA 1ZKDA 1T9CA 3TTYA 2IXEA 3EDOA 1XQ9A 1P1IA 3JWIA 2NU6A 4HGYA 4HQNA 4JSTA 4ZALA 1K6IA 4QUHA 3PQ7A 4C08A 3U44A 4B35A 1RXIA 1VC2A 5KQGA 1XNQB 2YZ2A 1EK0A 4X1KB 4DLSA 5L53A 1ZFNA 2H2AA 2PN1A 3IQWA 1MRZA 2O2JA 4KXLA 3RG8A 3UFXA 4F5ZA 1A8IA 2R87A 3OLCX 1GR0A 4UFNA 3GH3A 4J1TC 5EJGA 1KRXA 4EBFA 4IVRA 3WFZA 4LOLA 2IZZA 1BRTA 2JS7A 4WLEA 3U3RA 2C5SA 3WV4A 4ZGWA 4ENWA 1N3BA 1R8JA 2OMKA 6GPBA 3SVLA 5TVGA 1K4YA 3DCNA 2E1PA 4Q93A 3II6X 5B1EA 5JXHA 5CM9C 1H4QA 1P2UA 5E1MA 1RP7A 2C7OA 1AHHA 2AHRA 1ECCA 2DTEA 2WB4A 3PLNA 1J2UA 1RYFA 2VNAA 3L5OA 2HIHA 5JLJA 5E2BA 4HAUA 2FEAA 2F9LA 4F4DA 3SDZA 5IUNC 1TC1A 3VHQA 3FTEA 2FWIA 1F5NA 2GEFA 2Q5CA 2N3ZA 4JKIA 3EW7A 4BB5A 2F8TA 4G5GA 1KYTA 2XIQA 2PH7A 3A2MA 5PGMA 3RSLA 4EB6A 2D2EA 1KKMA 4QUDA 3B6JA 3EC7A 1NVGA 3P27A 3KQQA 2UZ4A 3WFIA 4AY4A 2QENA 4UHJA 3UCFA 2XMDA 5LYYA 4BBZA 2WFLA 4H0NA 4DQDA 2XE4A 4UHFA 5LXTA 1QZXA 1UMBA 3JZAA 1P1JA 3STYA 2FLKA 2NXNA 4IV5A 2XTMA 3KP1A 3H2KA 3CLUC 1UM9A 4UHCA 3PHGA 1HE8B 4ZHQA 3CIFA 2D00A 2DH5A 5HCNA 4EPVA 1GVNB 1NLMA 4ZOBA 1G5HA 2XXAA 3EXEB 1NZDA 3CUWA 3OHSX 2V1XA 4Q1CA 3FHTA 4CUJA 3AVTA 3BH7A 5IZCC 1SCKA 1ZI8A 4DXHA 5E0KB 1F7UA 1PR3A 2B4KA 2EC5A 3LCMA 1U0NA 3PDUA 4HDCA 1KO7A 4Y2GA 4NICA 1CCWA 1GRQA 4HX5A 5G40A 521PA 1QKKA 3M83A 2QMQA 3AY7A 4KIWA 1P33A 3U4DA 1FTYA 1AKTA 1JEYA 1NUUA 1VA4A 3NEAA 5HRUA 1KJQA 3COVA 2GN1A 2I7DA 2ZKLA 1NI4B 1UIMA 2OTCA 1C3OB 2QXUA 4PHGA 3PNKA 1ZHOA 4DNPA 1HFJA 3QLTA 1W52X 3IBTA 3O4IA 1JJIA 4TXMA 3A4TA 2PR2A 1F3OA 1JPUA 1UBKS 4MB2A 2OLEA 4L5YA 5EINA 1IXKA 5LM3A 4J90A 1TYCA 2G36A 4LBWA 1Z2AA 4DC9A 4Q12A 2PSJA 1CD5A 1FZTA 2ZSAA 2B25A 4WCVA 4DDTA 4LJAA 2CLKB 2CLOB 3CX4A 5CLGA 1T1EA 4P36A 2HIMA 1XD2A 1NURA 2P91A 4LE1A 2I71A 4TN1A 3RVDA 4ES6A 1KWGA 1OVGA 4UQLA 3EH1A 1E9CA 4K1LA 4X8HA 1QO0D 1QNFA 2NZXA 3OT1B 3KT8A 4P4SB 5CVDA 3EB9A 4ARZA 1Y80A 3R41A 4DUYB 2PJZA 1R66A 3OX2A 2VNJA 4KBYA 4AUEA 3BM5A 3X1DA 4BO5A 1CY4A 1SHZA 3BMNA 3MTIA 3OTIA 5IJWA 1CXZA 2JZNA 4GUAA 2HRZA 1NSTA 4AB1A 4MYUA 5DGTA 3RRMA 1JFFA 2FSUA 2FRDC 1M2OB 4K6KA 3JQ9A 4WACA 4RF4A 4TV9A 4X92A 5P8WA 3ZD6A 1YB1A 1DADA 3ENKA 4PSDA 5CPFA 3OZGA 2GZRA 5IAEA 1YI0A 4URUR 1LLCA 4RPGA 1IN4A 3KKPA 1SVIA 1XZJA 4AX8A 1V3VA 2O2ZA 2C84A 3MWYW 3UT6A 1GTG1 2I78A 3TQRA 1FNBA 4EL5A 1H85A 3OZIA 1M1UA 1E4EB 5EWLB 3WZLA 1YI1A 5JVDB 2ZTMA 3WYNA 1KP9A 4CCAA 3G8AA 1QANA 4GH5A 3RUCA 1K0FA 1KI1A 1PQWA 2RIRA 2V96A 3BL8A 3T7CA 3SIRA 5JO0A 4UTVA 1FFYA 1EJ0A 4YX9A 3S2SA 2YQ4A 3MZ0A 1VLVA 1XRMA 4QPJC 4TKVA 3PC3A 3QH4A 2A1TR 2YWXA 3OKCA 1TIKA 5FI5A 3EIWA 3BJMA 1I24A 1W5FA 4QRDA 5GTDA 2TMGA 3RUIA 3CCFA 4NQZA 4OQQA 4ZC8A 4RD0A 1JEAA 2MSCB 1SC1A 2NAFA 2WWTA 4JDUA 5KOIA 2MTBA 3IVAA 1P4HA 5KEIA 3FB4A 3MWEB 1M6WA 4LGVA 1QCCA 4KR0A 4OBWA 3T1VA 5A04A 4MRNA 1CZUA 1ISSA 2Q4TA 2TMDA 5DM2A 3DQPA 5IM5A 1U2EA 2V7EA 4MWCA 3TLJA 5BP7A 2Z0MA 3C1AA 2QRGA 2RHMA 3GLRA 3NNDA 1O94A 3RV4A 4XUEA 4R3NA 2F59A 1Z17A 3W2EA 2IEGA 1J2TA 4RDXA 3S3TA 2Y93A 4L76A 5DB4A 2EKBA 3T9FA 2MMCA 3ENWA 4HBZA 4QL3A 3INTA 1RDFA 4WNAA 1Z6YA 3QOXA 3EXIB 1NRJB 1U0RA 3RTDA 4QARA 4UCFA 3TXAA 4BGEA 3HVRA 2OC9A 3F8TA 3KT6A 1P7WA 1CV2A 1YFZA 1RT9A 1X14A 2Q3MA 2YC2C 3ANSA 1T5LA 2W7TA 3DE7X 3E0XA 2XKBA 3JQGB 4RYLA 4DRYA 3IERA 1A5ZA 1EK6A 2OYRA 5LP6A 3Q4GA 1G5QA 3AVWA 2AN5A 3BD8A 3ONDA 4AJEA 1GG8A 3TI9A 2Y0BA 1Q84A 2BKAA 3LZ6A 3KUCA 3FPGA 3X0DA 3QRWA 3BD7A 3QENA 1S3GA 3ZLJA 1UT5A 2X42A 4CEJA 1JYFA 2RC6A 1KK2A 5TMEA 3GNQA 4B2YA 4ZOCA 2G76A 2ZB7A 1R5JA 3OF5A 4FCTA 4A8JB 4LFCB 4LV6A 3GEMA 5CHEA 5E9QA 3EXFB 1Q6ZA 1BMQA 2Y1DA 3LLCA 1RI2A 3EUAA 2OAQ1 4MCHA 3GRVA 1H3EA 2BEWB 3ZGNA 3WQHA 2OBLA 4CMGA 4LOIA 1PR5A 1SY7A 2OHGA 2WABA 3WLJA 3ZY5A 1XTRA 4NJEB 1L5FA 2BUBA 1XLUA 2ZJZA 4JN6B 1PEDA 4W1RA 3R0QA 4M8IA 3RS3A 2EKZA 5FYQA 4NCAA 1Z4PX 2FK8A 1NY5A 3QFFA 2Q2VA 1A9TA 4OI0A 4TLCA 3CF0A 4ZO8A 4AT1A 3SC6A 4AMVA 3KLNA 5FADA 3UJ6A 4A82A 1UXIA 4LKOA 2Q28A 2JLVA 3IQIX 1S2NA 1J09A 3TBKA 1AF4A 3QUAA 2X86A 4RKQA 3MPUA 2ZU0C 3AOGA 1T5IA 1TQHA 2Z3VA 2O7NA 5HSGA 3EGDB 1O08A 3GCWA 1RI1A 1GPNA 4I55A 2PX8A 5I9MA 1RHUA 1QVRA 3PIIA 1RZUA 5KWIA 4RD3A 1MB3A 4ZOLF 1Y9DA 3C45A 3PNOA 2GKSA 4JLMA 4KR2A 2DPXA 4JUDX 5K3BA 4BVLA 3NFYA 1CJVC 3UK0A 1PBNA 4BMYA 3ONWA 2BOVA 1OV4A 1Z8HA 4AS2A 3HSKA 1OBVA 2F8LA 3COPA 1KA9H 5DLDA 5FF9A 1JI3A 4CKEA 3ZWWA 4OQPA 2IHYA 3E5MA 2VHJA 4TTIA 3MJEA 3HLKA 1JDTA 1L6IA 3NV7A 4JI3B 3R9WA 3E48A 3FKQA 3QVXA 3UJ3X 1KK1A 2NO4A 4KO1S 3A4NA 4RE6A 4RM2A 3UJBA 3GA5A 1OU0A 1JAIA 2ZJ8A 3UAYA 1JHXA 2FZCA 4B4WA 5BYKA 2JAWA 3EXAA 3IE0A 4J9VA 4P81A 5G41A 3LF2A 3FKSA 1UJCA 2R6CA 4JY7A 1GEGA 1MN6A 2BGUA 2Q6LA 3EVFA 1UZAA 1VECA 5A2GA 1VE6A 2XEXA 4QDTA 3WWOA 4CYMA 3PDWA 3TINA 1Z83A 1ISFA 3IT2A 3ZWXA 5DYNA 4E09A 3G13A 3RAFC 3LMKA 3HUUA 1W96A 1Q1GA 3BQ9A 3MAAC 1MC4A 4L8GA 2GD1O 1DKUA 4O1IA 4Q7JB 4TRRA 3RBAA 3GYBA 3T4EA 1W9MA 4DT1B 1QRAA 3GZ4A 4Z7NB 4XRRA 1WOYA 2J3IA 1B41A 1EG2A 4BLVA 3IIIA 5K3AA 4ZT2A 5MGNA 2XYGA 4WOJA 2VS1A 4JBNA 3ZQ6A 1E98A 4OATA 2C3YA 2WA2A 4H3SA 1N5RA 3UUFA 1KXJA 2A5DA 1X80A 2DYKA 1UFOA 1Y3IA 4RY8A 4FGZA 1CY0A 1T9GR 1D2GA 2PZBA 1U9IC 3ILHA 3MT7A 1Y4DE 2H1SA 4OU4A 4PCUA 2DB3A 3WE7A 4TKZA 4KX5A 2Q4RA 3U44B 4IIXA 2XCSB 2A94A 1KO1A 1UK6A 2XAUA 4XDGA 1O0SA 3EVZA 1P2GA 1NY6A 4YAGA 2IDJA 3BAZA 3LBYA 4B6FA 5DPMA 3UG6A 3QQ5A 4W5NA 2A1IA 3SR4A 4TLDA 2ZDGA 3WDLA 3UFXB 2VDNB 3JALB 4IDOA 2FPXA 3FFWA 1ECFA 4UFPA 1ISMA 3GCXA 4IWXA 3B3QA 4L5AA 1BJTA 4V0MA 1NR5A 2QSUA 3WFJA 1Q1BA 3ANNA 3B6EA 2VTKA 1DIGA 3D7RA 3E7PA 4J0GA 4OOFA 3TRHA 4NECA 1RD4A 3F46A 1QHIA 3I9OA 4GWLA 5K6TA 2FMTA 2IU0A 1DCFA 3FOFC 4UEQA 5KB3A 4WK4B 5GVSA 1F6DA 3OZSA 3WGNA 1BFDA 1W0KD 2PAFA 1MH9A 1TRKA 3R1IA 4O4JF 1VIMA 5I47A 1R5OA 1I2CA 2O1WA 3EZ9A 4M8NE 4EA7A 3B20A 4KYUA 2WZBA 3IGFA 2HAEA 1NX9A 5BW5A 2QMEA 1H93A 2XF2A 4JT4A 1OBHA 1UKAA 2P2GA 3MWDB 3I0NA 4KQ9A 5F33A 2G5PA 5A9TA 2N1BA 1BWSA 4E2XA 4EB6B 5JBNA 3R24A 2CL5A 4H4DA 3B9PA 2E5FA 3MJHA 13PKA 4LVOA 4NOLA 2AMYA 3IEXA 4L9AA 4JBIA 2WFLB 1RAAA 1AXEA 3F3KA 5J59A 3PUKA 4JR1A 5LXTB 2SKCA 3H4MA 1UMBB 1XMXA 2FG6C 2NUPA 1RXUA 2UZ0A 3E81A 3OOYA 4DLUA 3RFCA 4ZTUB 1X2EA 5G02A 2BJWA 5K2OA 1ZYUA 2Q9BA 4FN5A 1UM9B 4ZHQB 1QGUB 2FHSA 1IEWA 1JYSA 2BTOA 3MSXA 2J5KA 3REOA 2H1WA 5K0TA 4WL0A 5LQAA 2XVMA 2XXAB 1U04A 1SOMA 2BKVA 4PR3A 3R23A 2XYQA 4BQQA 1U8EA 1DQZA 5IJZA 2FJUA 3NM5A 1GRCA 1CF9A 5DASA 1AB6A 1NNI1 4E5NA 3AVXA 5A62A 4HGRA 4RZSA 2O8EA 3V4VB 3L7IA 4G4SO 3UH1A 1Z9BA 4EGSA 3AF5A 3H97A 3N8NA 3QXSA 3EVGA 3VOSA 2DHCA 4PLYA 4F1JA 3VA7A 4Y2PA 5CYFA 2JD1A 2X3FA 1CZRA 2BEJA 4J0IA 3VPXA 4ARBA 3Q15C 1PVDA 1BXRA 1FX0A 1NMQA 3LP8A 1E1CA 1Y1PA 3BCSA 4YJ3A 4OLJA 3VYRB 4MW6A 2I2WA 5GM2A 3PD7A 4D0NA 3ER6A 5AQEA 4ZVMA 4D79A 2PAAA 4OBEA 4PZEA 1RJGA 2FYTA 5DV9A 2YNMC 4WY2A 3LUCA 5DNWA 3C3PA 3TRIA 5C8ZA 3KYCA 4Q34A 1ZO8A 3AHHA 3QFTA 4CDRA 1IG0A 5KU1A 5E6UA 3NFRA 1KYVA 4JLAA 2C54A 1CUFA 4MA4A 3WIVA 5ARBA 4K0KB 1TGVA 1FVOA 1CDZA 2CHUA 5TR9A 2ORIA 1XD2B 4GZ5A 4FYJA 4YXWA 4OH1A 3G2IA 1W0JD 2ZW9A 3GFSA 3KDSE 1UKBA 1WIWA 1JKJB 3DCIA 2NP7A 1E2QA 2E89A 5EIWA 1SU4A 4NOJA 3T61A 3A2KA 3D6TB 2I3ZA 3MILA 2YOFA 1J0BA 2IU3A 4L5IA 1GNVA 3BMNB 2PQ6A 4KQIA 3R75A 2FKNA 1UADA 3T0GA 1GSAA 1EFHA 2CBXA 2HMYB 4HWSA 4B3FX 1YZUA 3PRYA 5JSHA 2Y0EA 1NDQA 1JFFB 4W9NA 4TV9B 5DXFA 3RIMA 5CDHA 4C7MA 1PZGA 1GADO 2I65A 4Z4FA 2OE2A 2DVMA 3Q7TA 1UAGA 3ZZNA 1NBOA 2AC2A 2FR1A 3UWOA 4KG7A 1UBTS 3CY6A 3F4KA 3IEMA 1MIOA 1MG5A 4MGKR 1G3IA 1B93A 3B6KA 3B6MA 2GBCA 1G6Q1 2BEKA 2OCXA 2P5SA 4IDBA 3FWZA 1AU9A 4ZPJA 4D8YA 1L4BA 3ZDYB 4E94A 2SBTA 4RZIA 2I0FA 2I6GA 3D4PA 5KDLA 3V55A 4F2WA 2I62A 2Z83A 3ROTA 3TLEA 1ZA2A 1RAIA 3CNNA 2JPDA 2HRRA 4OHMA 4G4JA 1X19A 4N4AA 4OQLA 1XTBA 4EENA 5K0ZA 2E4UA 1UJ5A 1VHDA 2BGJA 2VRCA 2HTFA 4IIHA 1PEKE 2ID7A 4TKVB 2H8GA 1W88A 4KI7A 4Z6KA 1ODKA 1NOIA 1J49A 4M76B 3AVUA 2WTXA 3FNEA 2B34A 1D1PA 2GPBA 4JP1A 4UZFA 5BRNA 3RI3A 2FZGA 3SFZA 4KYTA 2C1EA 1U2DA 3A3PA 1K4KA 5BSWA 3BGSA 5HM6A 2WT8A 4FBGA 2AN4A 4CEIA 3V46A 4FZRA 4N48A 3UMYA 1B42A 4B3BA 1GAJA 3FTCA 4C20A 1TT5A 1VPWA 2QRQA 4Z3OA 4AICA 2H1LA 5AVOA 3CUTA 2A0UA 2AFRA 3OQBA 4PLHA 4XQEA 2HWKA 2YWRA 3CHYA 3G0IA 2H0RA 3E58A 4YROA 4EY3A 2XT6A 4MIEA 1CU1A 4YNBA 6ABPA 3IYLW 3KVOA 2ENWA 3P97A 1YL5A 1HNZB 5B4UA 3VBCA 1KI8A 3R3SA 3BMCA 4FFMA 4WNAB 5KQMA 2NG1A 4W5WA 2GHQA 2CE7A 2FF7A 2ZBFA 2BMJA 1M34E 2WUFA 4JCCA 3OCWA 4EW1A 3QYJA 2PX6A 1QR2A 4PHFA 4DR5B 1P31A 4JYBA 3ZCVA 4V2UA 5LMZA 1RRCA 3V6MA 4GKBA 5J40A 1YTLA 4KMSA 4Q1BA 2ISSD 1RW4A 1TCUA 3LHIA 5ESDA 3OPVA 1C9NA 2L18A 4TMVA 3B70A 3KQHA 1MEOA 4FGWA 1UBEA 3ILXA 4GQBA 3CRW1 4A2PA 4W5OA 2CV1A 1Y6JA 4RU1A 1ST3A 5JPCA 2CE2X 3E4DA 4YJGA 5HF5A 4ZOAA 2NNWB 3SSNA 3N28A 1S3IA 3O8CA 5GONA 4CEJB 3RDPA 3P9QA 3QZUA 4RZXA 4UEJA 1TXGA 3RG2A 4HXFB 2JFVA 2JLUA 3CH4B 1X7GA 1XTPA 3WNZA 4FMCB 3KSMA 4UKDA 3BA1A 2NU8A 2OBNA 1DQRA 1GA6A 1UXGA 2ZREA 3KKOA 4YRTA 4BU1A 1DTSA 5BXQC 3PGLA 2J9YB 2XSZD 3HDHA 3C6MA 1VBNA 1PE0A 4J1NA 3ZE2B 1B6TA 3BB1A 4KAFA 1U3TA 1EZ4A 1SQ0A 4UZSA 3WGKA 3B1JA 4HLQB 4XWYA 1YRBA 1U5CA 2OEPA 3L0PA 2XMBA 3DT8A 3DLIA 4OJNA 3ANLA 4G24A 1N6RA 2NYUA 4DWVA 2V0GA 4K6GA 4PYQA 1NW5A 2I1QA 2WF9A 1ZEJA 3FJ1A 2RBGA 4OLHA 2VJMA 1A9QA 1J9EA 1KAEA 2GNOA 4CIXA 3IJRA 2NZYA 5EJEA 4C5AA 1CY8A 2DWOA 3JQAA 2OOSA 2AIRA 2ZAOA 3MRSA 2A0YA 1NRWA 4I55B 4XASA 1M2VB 5F21A 5KI6A 3OE5A 1A9PA 4FINA 1A9RA 1QOQB 2A6PA 4GLFA 3GT0A 4HDAA 2A57A 2UUOA 4EO9A 2F17A 1NRIA 1QYRA 1RM3A 621PA 1E3TA 1W4CA 3WWEA 3UPTA 4MIOA 4DW8A 4ZYVA 1FQJA 1YUMA 3VBEA 1MJ5A 1DBPA 2VDWA 4ZCSA 1QQBA 3O4FA 5TEWA 5U4QA 4RWZA 4AJJA 2IP1A 3W8NA 2PUEA 4Q3AA 3H5LA 2R00A 2VRBA 1T26A 4ZVPA 4B83A 1ZRNA 4AJIA 3M6AA 4IP0A 5J2TA 3D4BA 4KFTA 3VSCA 1L4NA 4LCEA 4J0JA 3IMKA 3LK6A 4FCCA 2ZT6A 4ZVLA 2BMAA 4KXWA 4Q21A 5TRTA 2IYAA 2WILA 4M0MA 5A2QA 1URPA 4PZUA 1JR3A 1QH8A 3ELBA 5DHTA 1VL0A 1U0LA 3GUUA 2PGNA 1G6KA 3KXPA 4E4TA 3PKIA 1KOLA 3VPHA 2WBLC 3FHCB 2ZWIA 4DA7A 2R7MA 5I3ZA 2YQ5A 3VPSA 2WFMA 3ETHA 3H5WA 4EKYA 1NBAA 4NNOA 3RFVA 4CNBA 3C5HA 4ZO7A 2G1AA 2OHJA 4OB7A 3S8YA 3ELYA 3EYWA 2IQ5A 4FB5A 1RZRA 4B5LA 3RGWS 1Z5OA 1Z5PA 4DV7B 2W4QA 4R1TA 3RT9A 3GZNA 4H3VA 2H1HA 5C80A 2WJPA 4WIAA 4LY9A 4C88A 1XDZA 1CS0B 1O9GA 2QR3A 4MH0R 1X80B 1Y3HA 3MIZA 5EEHA 2RAPA 1QH1A 1HE2A 1OD6A 2VXOA 2ZQZA 3OPXA 5G0VA 2G07A 4FZ3A 1XZCA 1EXWA 1W4BA 4UVGA 4BTEA 3EOAI 1ML3A 3LBHA 4Y2UA 3SM3A 2Q45A 3VJMA 2FMFA 2GT1A 8LDHA 3CTMA 1E1QA 1O9BA 3G2JA 1C8VB 1NW9B 3S0JA 5IK2D 1JJFA 1P9LA 1I0IA 2WF6A 3HUDA 5CXSA 1RI3A 2H59A 5TT1A 3RSHA 1UJBA 2PKRA 2PPVA 4LK2A 1N5LA 4ZICA 1OAOC 3N0VA 4P4UA 1R9GA 3BERA 3DHVA 3LNCA 4KSYA 5C52B 2DLCX 3CWQA 4B46A 2EQBA 1X9IA 1JH8A 2A5JA 1AGXA 2PYDA 1Z7EA 3IQFA 4J7UA 3W5SA 1XX6A 5KYXB 4NARA 4PRZA 4IOMA 1GL7A 1EM6A 2VP3A 2C94A 2V6JA 421PA 2JVKA 1DC5A 5JAPA 4R8KA 5TB5A 3T38A 4ISCA 5JXGA 2P2YA 4JROA 1XL1A 4JQYA 3LBIA 1JXAA 4I2VA 4U7TB 1P80A 2ZJ7A 2Q4DA 4O4IF 1BX1A 5CDUA 5HIMA 1E6KA 3O2JA 2KLHA 1IPHA 3C41J 1RHJA 1HT2E 2HEIA 3G1TA 5KQSA 3CISA 4WBXC 5EJFA 3ST7A 4XUGB 4M0CA 4GECA 5KX5F 1GSOA 5LLSA 4KUEA 1Z88A 4K8OA 3NNNA 4U6NA 3NQ41 3KWJA 1U1IA 3UT5A 4IDAA 1HNNA 3FFXA 5B64A 4AZ3A 3OWXA 1J0DA 4L78A 2IZ7A 3OQOA 4LIPD 2J3KA 1B8OA 1JF8A 3I5UA 3PNQA 3EQ2A 3QA3E 4HZGA 3R7WB 1XIVA 2PUTA 2Y9PB 2PSHA 2CMKA 2WYOA 4GF5A 1WMEA 4XSHA 2ETVA 2NUPB 2XTJA 4YJ2B 5P21A 2IKQA 2C7BA 3JQ6A 2W00A 3WLIA 4H3HB 4PG6A 4JJGA 3T3HA 5MGBA 1LSOA 3DW3X 1WM1A 2ZWAA 4PFSA 4B2LA 1IN5A 1T0BA 4FU0A 4FHEA 2HNKA 3ZCTA 2WHQA 1W9HA 3IV6A 1JDVA 1AX9A 3K9WA 4JL8A 3W78A 5HFJA 4DKXA 9LDTA 1SUFA 4DJFC 1Q0ZA 2C2BA 2OY0A 3C3CA 3JQEA 4C4PA 1AN9A 5FOSA 1WMBA 5F23A 4N01A 1SN7A 3HWWA 4EHLA 3S68A 1RVV1 4YRGA 2QTCA 4X62B 3T3NA 2FFAA 1DP4A 2CFRA 5T6MA 1OFIA 5C3MA 1BE6A 1VLMA 4CM3A 2QN9A 3UOAB 4WZ6A 4ZARA 3TQTA 2CFSA 3H3JA 5CYOA 3LG2A 5DYYA 3VR3A 2NP6A 4E15A 2GI4A 3W4KA 1XNHA 1BXRB 4O3FA 1FX0B 3ET4A 3TB6A 4YJ3B 2CZGA 2VYQA 2Z4SA 4FS3A 4MVJA 4GC5A 4F92B 4JV5B 1J0XO 1NV9A 2IYSA 3A1NA 3UYKA 3F9CA 1KMQA 3D54D 4I5EA 2UAGA 4RXMA 1A76A 1GD1O 2AR9A 4ZCTA 5DRYA 3KYCB 3IO3A 4LYYA 5D3QA 4DCGA 1K5DA 4X90A 3A37A 3F8SA 1UKEA 5E6UB 3O8QA 4YECA 3EDCA 4B3XA 4B9AA 3PUJA 5I7RA 4LZJA 2BFDB 3R3WA 4CKCA 3HA3A 5FFMA 4RK6A 2ZIZA 2Y4OA 2Y1CA 5EKSA 3WQSB 1YIDA 2GF2A 3DD1A 3JQCA 4HF7A 4MPDA 3TLCA 3FE2A 1JIKA 3ZEAA 2GO7A 3LE8A 4MLDA 3B53X 4CTMA 4AC9A 1DDIA 2RGXA 4H0CA 3LUBA 3DJYA 2R3SA 4IDQA 4OHVA 3GFGA 1COWD 4WN9A 2BHLA 1GZUA 3N8KA 1E61A 2COEA 2VJOA 2ANCA 5EE9A 4K9KA 1R0XA 2HF7A 2WJ4A 3FLBA 2Q3JA 3I3SR 2J3LA 1EVQA 3DHNA 3VO8A 4XWGA 1J56A 5F9HA 2HSDA 1IHYA 4G8JA 4UU0A 4B7ZA 3H13A 4ENSA 2X15A 1G9TA 3KR2A 2PT9A 4CCYA 4H7JA 1TU4A 1VSVA 2ALJA 2IXAA 5ADVA 4B48A 2ZUUA 3K72B 2PANA 2TECE 4MEAA 5AI4A 1MIOB 1VBKA 1J1ZA 2EDAA 2GR9A 3CEMA 2GN0A 3FLAA 1AK1A 1UDAA 1F4VA 3PUHA 3G1WA 4KAAA 1D4ZA 4M0KA 2IXFA 4X97A 4AVYA 5KNBA 3S1SA 2O14A 1SIBE 3E1GA 2QT0A 3C6KA 1E1YA 4Y6GB 3DYBA 1HRKA 3NYQA 4C4TA 3KQPA 2DEUA 2XXBA 1OPXA 4PWYA 1N2EA 4K2HA 1XELA 3P5SA 2X1LA 1S3FA 2AKAB 3S8EA 1HGXA 3BRQA 1P29A 5C2JB 2PD6A 4PX9A 4QSHA 5ADUS 3OFNA 2HHHB 2WF5A 1N75A 1TPZA 2P3LA 3I2IA 4O63O 3EVEA 3AEQA 3NPMA 3RVJA 2FW1A 3SR0A 1DKOA 4I7EA 1JQ5A 3G0DA 2RCYA 3KPVA 4F3RA 5LC1A 3TL3A 1E66A 4I50F 2Y2UA 3LHFA 2IV2X 3QE4A 1I6MA 3M89A 1XI2A 3GZJA 1EPUA 3AL2A 3Q3GE 3KTDA 3V7FA 3AV0B 4EI7A 2LCIA 4HNSA 4V24A 1QYCA 3M1YA 4CEIB 3DDUA 4GI3A 2FW0A 2O50A 3F67A 1PO7A 1TT5B 3B1FA 4F1WA 4JUAA 3IALA 4FX5A 3L07A 2X7JA 2X2OA 3WRWA 3BE5A 4Z7OB 3A9UA 1OWMA 1Z4KA 1CLEA 2RC5A 1MENA 2G8NA 3KEFA 5C5DA 3KKQA 1U6IA 1Z0AA 3C98A 3OQJA 1B76A 3ZWCA 5LKRA 4R9RA 2J08A 3BMCB 2BGNA 2PMDA 2RONA 1LNSA 1VLJA 2JDID 3IHLA 3K94A 2A9OA 1B14A 2CDNA 4FGKA 2QAIA 1KEPA 4IFIA 4B3IA 1SOWA 3FD8A 2F8SA 3CM0A 3V32A 1I13A 5B3JC 3OF3A 2G0AA 3VNQA 4JJFA 3HBNA 1LVUA 4K87A 3KAKA 1YRAA 1OLXA 1ZM4A 1KC1A 5LCXA 1QP4A 1C1YA 1Q0RA 1XF9A 4MR8A 3T4XA 2DR2A 1HORA 3W2FA 1YU6A 2Q62A 3ZOZA 2MMGA 4KNVA 4KQCA 3DPIA 5E7JA 1PT7A 5JVDF 3NIFB 4J0HA 5A3VA 2IWHA 1V8BA 4F3NA 1V8ZA 4YJGB 4LJ8A 1RJEA 2YWFA 2NAPA 2MSNA 1ZXLA 5GONB 1L5RA 1NIPA 4YMVA 4XFJA 5JALA 1HE4A 5KOHA 4LE0A 3FVVA 1Y7PA 1VCOA 1NQ5A 3NXSA 4M1WA 3SX2A 4E5DA 2WM8A 4EX7A 1JE0A 1PGOA 4P1ZA 2NU8B 1B73A 1BC5A 3IIJA 4AZ0A 1E5XA 4OHOA 1ADBA 4PW0A 3FHJA 4P2BA 1FDVA 1ZD1A 3W9SA 3W5DA 2VDPB 1F3LA 3CPEA 4XH9B 4P4NA 1QHXA 5EERA 4IOJA 3EPHA 1AG9A 4F21A 3FN4A 3LPDA 4MUIA 3ZVRA 3FM9A 4DZTA 3KQMA 3MRVA 2DWUA 4ACBA 3V3KA 1SOUA 1XZAA 2NU9B 2YOHA 1VG0B 2E9SA 3BBLA 3GJYA 1E3QA 4Q7KA 1M1NA 4QJ3A 1U8AA 2LWIA 4AWBA 4FYWA 1I3OA 2OFXA 2AE1A 1N0HA 2VJMB 3H99A 4J49A 3WTBA 3WLHA 2X3YA 5A5GA 1VYVA 5BV1A 1P3DA 4ALIA 2F8MA 3D3QA 3L82B 3B3GA 1EDZA 1A72A 3DVAB 3JQAB 3LU1A 3PXEA 3WDSA 2VC2B 3OZUA 5BOSA 1RIFA 1YE5A 3QV2A 1JIIA 2E4ZA 3AXTA 2QPTA 3K2BA 3L1VA 4AP6A 4PFJA 3Q7QA 4R8LA 4AKEA 1P2DA 2A0KA 4HYEA 3WLLA 1ZD9A 3H05A 5BRAA 1J99A 4DLBA 4FYYA 3WHKA 5CVVA 3M3PA 1IY2A 2VDWB 5AMXA 1BVYF 1TMOA 2W2PA 1SUCA 2WJ6A 3N2NA 2GK6A 4XEUA 4QTXA 2HV9A 3WKAA 3W4IA 1FZQA 4DR4B 4NE7A 4L74A 1A04A 2XCOA 3U3KA 2YIVX 1KYQA 2XQKA 1X92A 4B45A 5J2TB 1W2HA 3F5SA 4DLKA 3HHPA 3K92A 2NW6A 3GWGA 4A6XA 2CMHA 2P9TA 2FEPA 2R7NA 3SIPA 1V6CA 4NZNA 4TRJA 3TNYA 4I5FA 1A3CA 3GAMA 5JBQA 1QH8B 3O4RA 1NC3A 2RHCA 5JY1A 4ECAA 4GPEA 4H4EA 3NC1C 4GMHA 4C5CA 2N75A 2I1WA 2VH1A 1XZIA 1PUXA 5BYJA 2ZBDA 5IT4A 2CDCA 3Q9LA 5LDHA 2RH5A 4NYJQ 3UMSA 3OZ7A 3U4QA 3HG7A 2BFEA 1UJ6A 2WTNA 3A4IA 4MWDA 3EAGA 4JXZA 1VXOA 3OEHA 3AYZB 1M66A 2JHPA 2PYZA 2JKYA 4P7GA 5HDQA 5E4YA 5CD9A 3HCRA 2O8DA 1R8SA 2IPOA 4EJMA 5IFLA 3OM9A 4XLZA 5FB3A 1X39A 2IPLA 4L57A 5ICEA 4RD2A 2CL7X 3BORA 1H8EA 3VDNB 3RABA 3TKYA 2WM9B 2WJZB 4DQKA 1VGRA 2DUUA 2XNKA 2H52A 4YMUA 2Z1MA 5L6MB 4YP0A 1QH1B 1YZVA 3RIXA 2ZFUA 1NL3A 2Q99A 4JB3A 5H0IA 4BX9A 3ORFA 4ZWNA 3DWEX 1DEKA 2ZR9A 9LDBA 4Z54A 3THXA 1HURA 2XMZA 4DUZB 3E5NA 4NCNA 4B79A 3VZCA 3F1LA 2OHVA 3M1AA 4XRGA 1FPQA 4PLWA 2JD2A 3FYSA 4M1YA 3QE3A 4QU5A 4WSOA 1AHNA 2PEYA 3ABSB 4HP8A 4OM7A 5ALEA 3TDMA 1W7AA 4BWFB 1P0PA 1HSZA 2NX2A 3ISTA 2ZRDA 4XTCS 1MU0A 3TR5A 2NM0A 3CLRC 3FUTA 1TDJA 3SY8A 1RM4A 2PUHA 2IIBA 3HI4A 1ZEMA 3EXG1 5BR4A 4BY9E 1IIBA 1S2DA 2HY7A 3C7KA 3RJZA 4RENA 4XIJA 5AT1A 3ZE8A 3HO8A 3HBJA 1XRPA 2BDUA 2I7XA 3TUIC 3WBBA 3HP1A 3R6TA 4BV9A 4CM1A 1X38A 4L0CA 5C8XA 4IV0A 1H2WA 1OROA 3N2ZB 4R68A 4JT8A 4WXRA 3UHAA 5K0FA 1ZINA 1T4BA 3NHYA 1M8PA 3QF4A 5H70A 4ZDJA 1Z06A 1EG7A 3NBYC 1KJIA 3RC9A 1M6VA 4DLLA 4EX6A 1VMIA 4OY3A 3USZA 3UT5B 2AUTA 4F9GA 1V2GA 2SKDA 1ZWLA 3IJEB 1QH9A 3F9IA 4AZ3B 5HQTA 1U0EA 4W7HA 1XCOA 4HGOA 4M4SA 4UC0A 3WGTA 5DTJA 4JYPA 3TTSA 1FVFA 3CEPB 4K6CA 3LPAA 3KLMX 4LRXA 4UVHA 1I01A 1KY4A 4IIJF 5CXQA 3D43A 3GVCA 2P0AA 3QOFA 5DBEX 3A1VA 1KI7A 4D57A 2AOTB 2P9ZA 4HDKB 5C31A 3S2UA 2CXRA 1PZXA 1WKBA 2ZXUA 5TEVA 4NEQA 4TMWA 2NIPA 3V8EA 3WGMA 4C05A 1IOZA 3GW8A 2PRYA 3JYQA 2IQIA 4NIMA 4IILA 5BUQA 1A2OA 3C3JA 4I99A 3S81A 3ORHA 2DUNA 4R1QA 2H0AA 1M83A 3FDXA 1GUFA 1P19A 3VYSB 4QKQA 2PMWB 4YAUA 5JSYA 1Q77A 5A7FA 4PCVA 4C2TA 4O2BA 2HHAA 4GYWA 5GJWC 4UTPA 1WPRA 4NYMR 5IJ0A 1PJQA 1DBQA 5ALSA 1E0AA 1EXNA 1O94D 4KH1A 2Q3LA 1LDMA 4UHKA 1SBTA 4O5AA 2G67A 5D85A 1EU1A 3ANTA 1XZ8A 1SG9A 3NG1A 3X44A 4CMAA 3IE2A 2KM1A 3PYLA 4MJLA 3K6JA 3CT4A 2F43A 3CJQA 2WUWE 1QVWA 4XYMA 4B80A 4BX3A 4DV1B 2P4SA 2Q3DA 4UM7A 2QI9F 4QODA 3K71B 1QBGA 1Y3DE 3NAQA 1V5WA 1YONA 4LOHA 2CXPA 2RGAA 3ZX4A 4EUKA 3F3YA 2VCEA 1XDGA 1C1XA 4IRMA 3IURA 4D1YA 4R2IA 4BLSA 4LF4B 1ZUWA 1MUUA 2QIPA 1V9CA 2C9OA 2KS6A 2RG1A 1E1RA 1JXMA 2EW8A 3O8QB 4FNAA 1ZK2A 5FQOA 3WLEA 1I7SB 2O59A 3CLTD 4IHQA 4ZK6A 4CKCB 3WNBA 1AVTA 4YO7A 1R8YA 4YWHA 2F1HA 5IW8A 1KDPA 5JI3E 5G4LA 1FLDA 1G8YA 3KHKA 4Q1VA 2QLFA 1F5SA 1XCGB 4OQNA 3GGSA 4ZQEA 5FKJA 5JV5A 2VHYA 2EGGA 2G1JA 3VVMA 1N33B 5THQA 3L7BA 2DT8A 4BJ3A 1O97D 4WN9B 2QD4A 5LXTF 4FYKA 1YBHA 1XKTA 3KU1A 4DNOA 1XQWA 3VYVA 3GELA 1KEKA 4TYQA 4MQUA 2V45A 4OKNA 1X1RA 2BHTA 2G63A 4TZKA 4ZHQF 1XYVA 4R40A 3DKVA 2BFAA 4IX1A 4D0SA 1P60A 4H15A 4UXJA 4RZUA 4C89A 5KO2A 3WLKX 4CCYB 4LWQA 1J42A 2JLCA 4FI3C 5H5JA 2P8SA 2Q4OA 3UK7A 1VDMA 4KDCA 4WLFA 1YR2A 3N53A 1ZGBA 3VPCA 3X1MA 2XZDA 1G55A 1KI9A 2EFYA 4OXKA 1WSBA 4II3A 4DFDA 4OCZA 3TMAA 4W5QA 4UHBA 2PWPA 1UBCA 1DG1G 2NSDA 1WCYA 4MV8A 4Y2YA 1KU6A 1JTVA 3LHDA 3LKZA 2VQSA 3TR6A 3TTTA 5KU7A 3HVJA 5DE3A 3NS7A 3NWOA 1YVEI 2JF0A 4IGIA 3V4PB 2JJ1A 2DFDA 1PNQA 4ER5A 1LPAB 3T4UA 3ZVMA 3TE6A 1E9DA 1TJ3A 2NZ8A 2HMSA 3K1AA 1J0CA 2QAGA 3WG9A 1D0IA 5CFZA 4URVR 1LZKA 1RYBA 3AEQB 4UM8B 1FYVA 3K30A 1JDSA 1E0KA 2QRPA 2QNBA 1WMAA 5HZGA 2W2QA 1CSEE 1PQYA 1R0RE 3LY5A 3QFSA 4G23A 3UBTA 1IRIA 2EP5A 2C2GA 3FH0A 3MYRA 1IZYA 5HEKA 4NCIA 4KYVA 3S2GA 1O9HA 5BMVA 5JOQA 2OCDA 4MV3A 4N7JA 5JAUA 1T0JB 3D2LA 4RGBA 1RWQA 3FJYA 5IXYA 2PMEA 1GQ2A 3FKSD 2QSZA 4YRNA 3BGWA 4ZI7A 1NC1A 3DZDA 2P9FA 4ND6A 2C83A 2IS1A 1YRLA 1T2FA 4V0OA 4RHFA 5CBPA 2WD8A 2B8JA 2GXQA 1NG1A 3PQCA 1TUBB 2VHTA 1ZHFA 3QEMA 3H9EO 4JBWA 1R6AA 5FNZA 1SBZA 2YIDA 1SXHA 2G1KA 1TQ2A 1ISHA 4DDMA 1LWNA 1SEPA 3AVPA 4MCAA 3I2FA 4AKSA 2PKQP 3MXOA 2E5LB 1KI3A 1QIEA 4TV9F 3VGPA 1KQPA 4DILA 5CYPA 4DCCA 2IS2A 2JFWA 3AXSA 4WBNA 4O08A 4JC4A 4HB2A 3VAYA 1SHUX 3NP9A 4IG4A 4IDPA 4LXYA 1U0SY 2AG1A 4LISA 3OTOB 1OASA 3L0OA 4EYQA 4CMJA 3UW1A 2CB9A 1D6NA 2H6EA 4JNKA 1RZ3A 2JA1A 5YASA 4MR8B 2WAAA 1E1DA 2I34A 1YMQA 3WHLA 3BFJA 4LOKA 1CR0A 1MRSA 2C5LA 3C8MA 2UYYA 2P2SA 5IDWA 2PDAA 2W93A 1QTQA 1HQYE 3GP8A 3OZAA 2DBYA 4QEKA 3WL5A 4GG1A 5AIBA 1NJ8A 3DBOB 3FA2A 3GJZA 3MINA 1E2EA 2PWZA 3LVBA 1TW2A 2Q0SA 1VG8A 3L06A 1XHFA 2VHZA 3LIPA 3MCVA 3QVSA 4U7HA 3HDGA 3IOEA 5CJJA 3R7SA 3U1VA 4TN5A 2WIKA 3OCCA 1Y6GA 3DMDA 5K6AA 4EVQA 4JYCA 2WJVA 1UFQA 4HV4A 2O8BA 1KK3A 2EYQA 3MJFA 3R7FA 1EZZA 4PZ9A 4C4YA 1S8NA 4AKIA 1MAHA 2YFYA 3MHPA 2C31A 4FEGA 2IW3A 3RWOA 2MWMA 3A58B 3UWMA 1T8SA 4RNCA 4JUCA 1ZUD1 4LG1A 1Z7GA 4ITRC 4ER0A 4DR7B 1TZ2A 5MHTA 2VG8A 2R8ZA 3WYGA 5BR7A 5BN4A 1PKEA 3TD9A 5I9IA 1AS2A 1H1DA 4ZEWA 2PLRA 5BOSB 4EUFA 5IVKA 1FYXA 1ZHHA 5SZIA 4BVEA 1I4EB 2GTIA 1T8YA 4MP3A 3RBXA 3TZ6A 3BJEA 3ON5A 3IP7A 1SQSA 4GXQA 4JI5B 3D5QA 4M7PA 5FLYA 7AT1A 3WGLA 2CBZA 4F3YA 1LBHA 3ZE9A 3DMGA 3VU0A 3TVYA 1FB5A 1C4OA 4J29A 1PT9A 1WLYA 2GCPA 4Y2HA 3UTDA 1Z2DA 5LP6F 1POWA 3ZR4B 4FWTA 5KYNA 2YVKA 3MWJA 5JPDA 1P5JA 2F1RA 2HCRA 3DM9B 4XGNA 4BN4A 4JVOA 4PGAA 1D09A 3ZGVA 3BSYA 1KGDA 1U9ZA 2GK3A 5M5BA 1WE2A 3LWNA 5BWNA 2ZRQA 3DUFA 2GXUA 2JFZA 3DZCA 4C7XA 1G2OA 1ADGA 2WJWA 1Z39A 2WE7A 1MO4A 1NE2A 2VOJA 4QYXA 5FP0A 3ZLUA 1PZFA 3KQSA 1YL6A 4FDLA 4FYPA 4WQMA 4FWIB 4P33A 3GPLA 1A1SA 3CUYA 3TIVA 4FMCF 1W73A 3W06A 3DVRX 4PE5B 3GT7A 4MI1A 3U4QB 2BFEB 2RB5A 1I5EA 2CMFA 3R9XA 2VDVE 1G0OA 1YCDA 1GQFA 3UOWA 1VQ1A 2O8DB 4RL4A 2WICA 1E62A 3ZY3A 4D46A 3O26A 4JLWA 4WBSA 3WGVA 1QUFA 4NG5A 3B13B 5DF1A 1ZUHA 1ZMTA 1J0AA 3HA2A 3BICA 1AZWA 2XMSA 3HDTA 1A1VA 4RJIA 1Q12A 3G2LA 1W93A 1PT6A 2AQHA 2XYVA 3S1LA 1TZKA 5ITZA 3OZVA 2PUFA 1YS2X 2HH9A 2P5TB 2PMBA 3GRCA 3I9KA 4XD2A 3THXB 4I55F 4P7BA 1P62B 2P9JA 4KWTA 4I3GA 4V0NA 2FQWA 2VOEA 3ESXA 4AM8A 1SQFA 2CXXA 3VVBA 4YXWD 1Q11A 1Q1EA 1VGVA 4OBXA 3RK4A 3U1TA 5KHOC 1W0CA 4RJTA 1G20B 1P7PA 1XP5A 5CBKA 4CL2A 2WKQA 4I3FA 3ZBPA 4H7KA 1F06A 3BWEA 1T91A 4PN7A 4RTRA 2IODA 1PFVA 1BEZA 5EMMA 2JLAA 3C5WP 3HK2A 3DO8A 1U31A 4BECA 4LVNA 1W47A 2VSFA 5K01A 4HDSA 2IPNA 1MABB 4XIIA 5FTNA 4EM6A 4CETA 3NBMA 1ZRMA 1SKAA 3GOHA 1XEAA 1SAYA 4ICIA 1ZVVA 4BNJA 3R6DA 1DAGA 2LIPA 2VSOA 3C6QA 3D64A 4DCMA 3BHIA 1O5OA 5E38A 1OH5A 4N7RA 3A1DA 4RVGA 4M98A 1NU8A 1GILA 4E4YA 3K09A 1KEZA 5KYTA 4BRWA 1Y8RA 2ZIFA 1E2LA 2YZMA 5HWSA 2P0YA 4UE3S 3QF4B 3OPQA 1RKVA 4YS6A 2HXGA 4I4LA 5C5EA 6ADHA 1SZPA 3WGIA 3K5IA 1M6VB 1H2BA 1ZS9A 2YX1A 1XEWX 3AUJB 3GCDA 4OHFA 2KYRA 1A9XA 3AUKA 1DAHA 4FHCA 3ZU6A 2C2XA 2ZANA 3UGKA 2BMFA 2GDZA 3P9KA 1JQKA 5D6NA 2PQ2A 1N6LA 4QJBA 2DX7A 2FRDA 1CF2O 3E70C 5AKHA 2JH9A 2VRCD 2X9GA 1JU9A 3GLVA 3OOHA 2OYCA 3AINA 1XPUA 3U4GA 4CDMA 3HXOA 3L0CA 4FGJA 5G4KA 3R40A 4YRMA 4CMEA 2Y1GA 3U60B 1A0OA 4PAGA 3C7TA 2J41A 4BFYA 1E79A 3EGCA 4RSRA 1QP0A 4OV6B 1CUJA 5FTMA 5K2MA 3T52A 1M8GA 1LS1A 3JQBC 2W42A 4E6PA 1B43A 1IATA 4O2BB 1QGOA 3V4ZA 4CQLA 1G2PA 1P39A 1YS1X 4KQMA 3KBBA 4ABYA 1W5SA 3CB4A 1P9NA 1FCJA 5CFPA 1GL6A 4LYHA 4DAEA 2EYUA 4IXNA 3CTPA 3AY0A 3AU9A 4RMHA 4HJRA 5CGQB 4EKEA 2LGJA 3F5DA 2F43B 1XROA 5C37A 3FNIA 5JRJA 3A0RB 3D31A 2JCXA 1X7DA 3OPNA 1EQAA 4LDPA 1T5OA 1DBWA 1NKSA 3SS7X 1FFAA 2NZUG 3D8SA 5DTRA 1U3FA 3V9PA 4TYYA 3ZWNA 5E95A 2VT7A 2GCNA 2QJOA 3W8EA 4ADSG 5AIAA 3OX1A 3S2EA 1C1XB 1UEJA 3M3HA 3GI1A 2GZ2A 2P4UA 1YQXA 2FEKA 4OX9B 1XHLA 2ZVPX 3ICVA 1LNQA 4REQA 5CURA 2EKDA 2B94A 1JG3A 4N3AA 3VO1A 1MO5A 1Q21A 1QGDA 3KALA 4U2BA 2HCTA 1ZK0A 3ZHXA 4NEHB 5JXIA 2AA3A 4EABA 3KKEA 2BR5A 3I0MA 5ARDA 1I10A 1ODLA 3CZAA 5AKYA 2H2WA 2W98A 3GUZA 5GM1A 2D7CA 3BH0A 2AG0A 4KQXA 3JAKA 5EZ6B 2A35A 2GAIA 5ALVA 2GLUA 1UBSB 5BV7A 3AF1A 4YPOA 5DGIA 4XJVA 2LW7A 1OOEA 1Q91A 3PK0A 5LUBA 3UM9A 2JAHA 2VNHA 3KJIA 3PEYA 3Q72A 1JR6A 1YA6A 3F49S 4MKRA 2JAOA 2L2QA 3I4FA 1BYIA 3RFFA 2H8KA 3GMDA 2DECA 2ZI5A 2HM7A 3RGGA 4PGHA 2ZEJA 3RIGA 2PBZA 3NVAA 4LNHA 2ZJ5A 2YXEA 2P65A 3SKYA 4LYEA 1JDJA 4GMFA 3FSJX 5DDIP 1AKWA 1YQTA 3UIEA 4KX3A 1YDMA 1RMQA 2QQGA 4YHBA 4C3VA 2AMJA 4HH0A 1TAUA 5J2UB 2A2ZA 1EK1A 3JQAD 1YUNA 2EZ8A 4C43A 2C9ZA 1W94A 3QXCA 3HGTA 3RS7A 3SN6A 4YJ3F 3GLKA 1PR1A 1BQ4A 1Q7EA 3M70A 4O33A 2QAGB 4WGFA 5SY9A 5K9ZA 3E22A 4OMFG 3D8RA 1E8NA 3KQNA 1G8JA 1H0HA 3L7DA 2ZT5A 3PE6A 3L7MA 5JNVA 1UUFA 3UPUA 4GIBA 4RQAA 3K9BA 3MS4A 3OQVA 4N3CA 1ICIA 1SVOA 5BMVB 2TMKA 3CG0A 1EK2A 3I09A 4TVSA 1W75A 2G06A 3N7TA 4ZVTA 2C2ZA 2PUVA 1N2GA 3T5CA 1NVVQ 4EI8A 1AXGA 5LN1A 1Q1QA 1WDLA 3B52X 1PZNA 4Q03A 3K9CA 2C82A 3EYAA 3NGMA 3GAZA 3HEBA 3N5KA 3IESA 3OJWA 3VISA 2VHXA 3OFJA 4ZI7B 5HIAA 3TW0A 1JR3D 4BNVA 4NBUA 5CBPB 2Q3FA 4BFWA 4DRXA 2I2XB 4IZHA 4M0UA 2C4UA 1KYWA 3DZJA 5I9NA 2VUTA 2GRUA 2Q7XA 1GDHA 5JLAA 1F2DA 1NFQA 1IVNA 4HN2A 5EL0A 3WL6A 2WJ3A 4JYMA 2C98A 4O4LA 3EISA 3OJOA 5AI0A 2WJJA 1YV9A 2QPAA 1RZRD 2H57A 3EX7C 3I5YA 4PNEA 1IJBA 4D92A 1G3MA 4CI9A 4NV1A 4WBNB 1LSJA 4OGLA 5EIXA 3GEEA 2FSVC 2QL6A 4Z49A 1U28C 2F7SA 1SUBA 2XCLA 3UV6A 4XEHA 3U5TA 1BTOA 4H7FA 3AUTA 1A71A 1U0GA 4KQFA 4Q18A 4P98A 3K16A 1PK7A 5DM4A 2AOWA 3K1TA 2PGAA 4JP3A 1K92A 3EY4A 2B9VA 3M81A 3HYRA 3VR5A 2I9KA 4YH1A 5ADWA 1JPNA 5A71A 5FBLB 2BH2A 3FNHA 3DJFA 4KK3A 2WZQA 2A0FA 4E22A 3NI2A 1CQXA 3JZDA 4LSMA 1OXKB 2Z1DA 4OHPA 4WNCA 3DZHA 5FPYA 2EQAA 3RFXA 4H1WA 1E0DA 4JLBA 4PC2A 5L7YA 2BMDA 3GZTB 4CT4B 4Y1FA 4E5PA 1CDEA 3HVUA 1MC8A 4TZ6A 1LCIA 1KK0A 3PQ8A 3F6PA 3ESBA 4MZXA 4IIDA 3F6BX 4UNNA 4O1MA 3KJFA 1HQDA 4MYHA 5AUQA 2WM2A 3KC2A 1LC3A 2GEJA 2IHZA 4NZZA 1RRKA 2BGIA 2EVWX 1D0SA 4LRTB 1VPEA 5AI8A 1JFLA 3NHFA 2O8BB 2OZPA 4G84A 4WJLA 1PUJA 2DFPA 1THMA 2QVGA 3CEAA 4RE5A 2CF5A 3G8BA 1M5TA 2F3UA 5DLPA 3VU3A 3WADA 4D9HA 2BGTA 4UAVA 4QPDA 1OVMA 2H2GA 3IUBA 3TRDA 1BFKA 1G64A 4B32A 4LXHA 4E5VA 4F3CA 3ROXA 4JLKA 2IXBA 4CU5A 4ZCIA 2RGDA 3KJNA 3LYLA 4ZMSA 4LRYA 4ZA2A 5BN4B 6AT1A 2I6TA 3EVBA 3DS8A 3K0CC 1YH3A 5HIIA 4HB3A 5K09A 1YMVA 3RD5A 5EZYB 2ZCUA 1EE1A 2CW5A 1E3LA 1EVZA 2WT4A 3VMFA 1PJ3A 3TXXA 2AOUA 3S27A 1OW3B 4CMIA 2F9MA 4CI0B 1CUYA 3OHPA 4HB0A 4BNDA 4E07A 3V8MA 2D13A 2HJVA 3AETA 4UU7A 3I8XA 5TX7A 4WCFA 2OV4A 1Z7YA 3B5JA 4X7RA 5EKDA 1DOZA 4IMJB 3VRHA 2CXSA 2XDAA 4TQ9A 1L5GB 1CUHA 1WMFA 2I87A 1OQAA 3L7YA 4DEYA 3I1JA 5DLYA 1PEYA 2HU2A 4P4GA 5F1PA 4ZU3A 4DB2A 3DUFB 5K4HA 5IAJA 4BE7B 1RBZA 4JKOA 2ZVJA 2HMUA 5GONF 5A0TA 3D1JA 4HGZA 4LZOA 3UV7A 4E7PA 1E8MA 1XTQA 5BNZA 1LQ2A 4BV2A 3IODA 2FUKA 2VJLA 3DOOA 1LF5A 2QX8A 3BYZA 4MWOA 2OLKA 3CT6A 821PA 5FWYA 1VE5A 1DUVG 4ACAA 4CODB 4DL9A 3VR3D 4S1WA 1KIMA 1DRJA 5JARA 3R5FA 3R9XB 4C6TA 4EZIA 4D3DA 1ZNYA 1NI3A 1UKZA 1KGSA 1LTQA 1U6JA 3G2PA 4MVJD 2YHUA 3UAOA 4II7A 3ND8A 3P32A 2I22A 3NTRA 1KFB<