2Q5ZA

Crystal structure of imazg from vibrio dat 722: ntag-imazg (p43212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
HMKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTRELKEVLNKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
molecule keywords Hypothetical protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q5zA00
2Q5ZA 2Q73A 1Y6XA 2Q4PA 3CRCA 2OIEA 5IE9A 2GTAA 2P06A 2YXHA 2A3QA 4QGPA 2Q9LA 3C90A 2A7WA 3CRAA 1YXBA 1VMGA 1YVWA 2OIGA
chains in the Genus database with same CATH superfamily
2X0LA 4LH6A 4B3MO 3OW2U 4JI1B 4K8XA 4X1YA 1GM9A 2A9HA 1OCCB 1Y76B 2ZXWC 1S5HC 3T4ZA 1N32B 4MVOA 4UCSA 4K0KO 4IIJB 2WPDG 3UM7A 5C8YA 2IW5A 3ABUA 2YXHA 2XOKG 3AG1C 3ZHSA 1P4RA 1Z5WA 2PI4A 3ABKB 2Q9LA 2EIKB 4C7UA 4X66B 4WBNB 4WF9V 3CHXA 1OJHA 1HNWB 3L71H 3RFRA 1XUQA 4FVMA 2DYSB 2KSDA 4MTXA 4RUFA 3BABA 4IYIA 3CXCU 2A0LA 4RUEA 1XQ8A 2G38A 5EC2C 2CDYA 4NXNO 4W4KA 2P4KA 5LL6Y 4LF6O 2Q7EA 5IE9A 1HWYA 1Y4MA 3BFRA 3K5LA 3R65A 5LOVB 2IBZH 4DV4B 3TK1A 4CBCA 3KG2A 4GX5A 3ZN0A 3D3QA 1YF2A 2FYUH 2Q69A 1EM1A 2ZDIA 1KKCA 1DLBA 4LNUA 3FB7C 1K7DA 3JSLA 3AG4C 4YY3B 3CCJV 4KFMA 2JVDA 5LP6A 3DC5A 3JYCA 4X20A 5KLVH 4WFGA 4DV1O 3BCCH 3E35A 4FLXA 4FFBA 2QJ1A 3ZHRA 5H9CA 4Z2WA 4KXRA 3FB8C 1SA0A 1SKVA 2ZIMA 4NYKA 1U96A 3D8CA 3JASB 3QF7A 2IM9A 5A9GA 3K3WA 5IWAB 4LCUC 4YHHO 3BEHA 2ZDIC 2AHYA 5BZBA 2ETNA 4DV6O 3ZMSA 3GB7C 2RJZA 3ASNC 4ZHQB 1SQGA 2HHHB 5LA6B 2LP7A 4KHPO 1WAZA 5ITZB 5GTIZ 5LXTB 2CK3G 1CPYA 4ZBMA 5LP6B 1OZ0A 1FKAO 2OIGA 1N32O 1X4TA 1L1FA 4LFAO 1LUVA 4H37A 4NR1A 1RSOB 4LF7O 1V55B 4X1KB 4LF7B 1P84F 2QKCA 4XBFA 1IBMO 1GAXA 2FMLA 3MD0A 5LOVA 1H38A 1SETA 2V4DA 3HKCB 4QJFB 4MVUA 4NKGB 5CN0A 3B77A 3LNMB 4MVRA 1AJPA 1PL4A 1KB9F 4DV5B 3ABMC 2LQTA 4JZGA 4EFBA 2GTAA 4FZ0A 2HHHO 2MK3A 4DV0O 1OCZB 1UPGA 3JD4A 2R9IA 2R9AA 1DF5A 3SGIA 2EBOA 3RYCB 5EC1C 4DR6O 5J2UA 1Y74B 3UKMA 5KAIZ 3UQ8A 3G71V 3RYCA 2W6IG 1XHXA 5KHHA 5E79Z 1M90W 3H9VA 3VQYA 2OIEA 3OT7A 5KX5A 3RYFA 2KG7B 4JZ2A 1EBOA 3E2EA 4PI0A 1RPOA 4JI1O 3JSNA 1ZLZA 3E22A 4UVBA 4O4LB 3ASOC 1WA8B 4LR3A 4O2AB 4HNAA 2WLKA 5BMVA 1IBKB 2OYQA 4X64B 1FXKA 4OPAA 4FLUA 4YY3O 4TV9B 1K5QA 2XNDG 1R3KC 3E22B 4B3RB 4OGQB 2HEPA 1Y66A 3S3WA 4H13B 1EN4A 5KAFZ 3UCSC 2KG7A 1G4YB 1W0KG 3E8HA 2P67A 1YDXA 5EZYB 1XDCA 2UU9B 4GLXA 3U0ZA 2YSUB 1SRYA 4DV1B 4G2KA 5C93A 4E2LA 2AHZA 4BIUA 1GKFA 3A0HZ 3ZS8C 1SZTA 5B5EZ 1MZEA 2EINB 2QR4A 1ZAUA 2K1EA 4HBNA 1SZXA 4JYCA 3ABMB 2LFSA 2EIJC 3CCEV 3P3NA 4DW0A 2L35A 1FD9A 4F6EA 2VWKA 4CH6A 3SYQA 4FLTA 1L0LH 5JH7B 4UB6Z 1DK1A 1IX9A 3HKCA 3ASNB 4EB6A 3P32A 5LBQA 4I0XB 4UCVA 4U3FH 2WLLA 1MG1A 2QM8A 2N04A 3OMAB 3J7AU 1M57C 5EZYA 2A7WA 4WFHA 5IYDO 4QNHB 4WFEA 4FMTA 1COWG 1IBKO 4J41A 1KMIZ 4G27B 3QO8A 1EFRG 1F4NA 5ITZA 1YI2V 4DR7B 2C2AA 4U7NA 3BA9A 3JCUZ 1QQCA 5BMVB 2Y0PA 4UCTA 4HNAB 5J2TA 5EYPA 1RPRA 4TQFA 3DSQA 2RDCA 3TGUH 4PD4F 2Q67A 3CP1A 2QWNB 1AI6A 1QLEB 2VRZA 4B3TB 3E8BA 1QLEC 5EIBC 2Q7HA 1Y67A 2ZE6A 4JGSA 2ZE8A 5IT9N 5D5PA 1KC8W 1XNRO 4X20B 3D36C 5IJ9B 4FLZA 1FYJA 5JCOA 5LHHA 1YCIA 1Q43A 1YTFB 4K3AA 1YEWA 2GSMB 2UXDB 1M56C 4DR2O 1JA8A 3I55V 4U7OA 3E89A 2CGOA 4K0KB 3PN1A 1Q5OA 3JAKB 4B08A 1RM1C 2WA3A 3CCSV 1OCRC 4YIOA 5D5QA 2EULA 4IHJA 4O4IA 1R3IC 5H5NA 4GKJB 4B7KA 4BR6A 1V55C 5H6QA 1JPXA 4YIPA 2QTOA 4H44B 3C90A 1IDSA 5KA6A 2PUSA 1NQTA 2ZXWB 4FZ1A 1IZ3A 1Y74A 5LXTA 1JQ0A 3RYIB 3I56V 3HB3B 3CRRA 3AG2C 5LYJA 1XMOB 1JMKC 3ZIAG 4JV5O 5DECA 4PELA 1Q6HA 1UJWB 2Q0AA 2X7RB 4UVAA 4DUYO 2E74B 2YEVB 5GONA 1BMFG 5K1PA 4DUZB 5FPRA 5L3DA 2F93B 3H1HH 1F7YA 3JASA 3ABKC 3RN4A 2HP8A 2CH7B 2IH1C 2FKXA 4FFBB 4DR1B 2ZT9B 1W59A 1SC5B 3QTCA 3CS5A 2Q6AA 2JIZG 2ZE7A 1QHTA 2NLJC 2ZCEA 4LF4B 2WLJA 2OCCC 3EFFK 4IHJB 2B5UA 4J7ZA 1OCOB 4QE7A 4DK1A 2P90A 1IBMB 4X8AA 4B7EA 1S76D 4H0LB 4P2ZA 5L3EA 1IVSA 1I94B 4ZI7B 3CJHB 3DC6A 3CCLV 2A79B 3F7VC 4I4TA 5CA0B 1Q81W 2EIMB 2UXBB 2HR3A 5CMUA 1FFXA 2ARHA 3ZHVA 4DRXA 5TISZ 1FS0G 4YHHB 1IXBA 3B09A 1QU7A 3OMNB 1AI4A 2Z0AA 3ZX6A 5KMGA 2UXNA 1VQ6V 3RYFB 3SPGA 2EJRA 2YIBD 4PDMA 2RMKB 4N21A 4JI4O 1S72V 5J2UB 4O4JA 3FYIB 3T4DA 1B3QA 2EZOA 5CBHA 4U3JB 2H8PC 3G4SV 3SYPA 3JATA 3VQWA 5J2TB 1YTFD 2QEXV 5CA1B 2NR5A 4P9PA 5C8YB 1S0VA 2O57A 2B1IA 3BVOA 3OMIB 4L8JA 4B3RO 4J7KA 2IH3C 1PNLA 1MMMA 1Q3EA 1OV9A 3BA8A 1XMQO 4Z1MG 1KUQA 4DV6B 4X89A 2CE4A 2DQ0A 3CB2A 2VQFO 4F6RB 2YXYA 1M93A 1T5EA 4ABMA 5HFMA 1TUBA 2Y48A 3OM3B 1MABG 1US6A 4NXNB 1HW7A 1WB8A 1R73A 3ML0A 1M5IA 1K34A 3ZHUA 4CS3A 4I0XA 1DF4A 1QR9A 1EN6A 1BS3A 1ROPA 4JI5O 2QWPB 3FX7A 2CTRA 3ZRXA 1VF6A 1V54C 4J11A 1AILA 2HLDG 3AK3A 2ITCC 4DR1O 1FFTB 3IC9A 2GTSA 1E1QG 2GDSA 4MTGA 4GKKB 3AG4B 3ABTA 1AJNA 4MTOA 2E75B 1GH6A 1PD3A 4MW3A 5B3SC 1BHAA 4PA4A 5HFLA 2YIAA 3OE7G 2IJIA 1N33B 3JAWA 5L3CA 3K04A 2YIBA 1A32A 4JI6O 3B8NA 2ODMA 1GN2A 4RO2A 2Q73A 1VQ8V 4FLVA 4OX9B 3S3XA 1NR1A 1V9PA 2WA4A 3J80N 1K9MW 4DK0A 1PPJH 3KCYA 2WLMA 4LWSB 4TV9A 1TAEA 3H1IH 4FIPC 2CTPA 1FXKB 5IY5B 1U97A 1HNZB 3WG7B 1PP9H 4DV3B 4DV2B 4LF5B 4QGPA 5JVDA 4DXWA 4B3SO 1AI5A 2WLHA 1ZSPA 3KKYA 1JX9A 3T1CA 4PDVA 1J5EO 4FM2A 5IDJA 3FFQA 4GX1A 4NVPA 5JCOC 2PYLA 3APQA 4NTYA 3OR7C 3RYHA 3D36A 3ABLC 2QSAA 4N23A 1XOUA 1MZFA 1JVMA 4TV8A 2DOSA 2H94A 2R72A 2P7TC 4CS2A 1AVMA 1ZL8A 3RT3C 1H2MA 3UT5A 2EZPA 4J9YB 4J9ZB 1BQ0A 2JDIG 2BTOA 4YJ3A 4LFCB 3LDDA 3O65A 1NVPB 5B1NA 1H2NA 3T1YB 4JI7B 3K9SA 2OT5A 3IJ4A 3P3PA 2WWWA 5GW7A 2KKWA 3X2QC 4H33A 1WP7A 1KBHA 2EIJB 2IJKA 3WG7C 4AILC 1THZA 4WFBV 3MAQA 3FD9A 3E83A 4GKJO 4X65O 5IYZA 1VP7A 4UV8A 1GM7A 2F95B 3T1YO 2EILB 2JEUA 3AG3B 3OEEG 2V7QG 1B04A 2YICA 4LH7A 3RVYA 5LHIA 1MA1A 1E1RG 2JEXA 1GTOA 3SDLA 3WU2Z 3ZRWA 2QM4A 4DR3B 1TGOA 4X9QA 2RN9A 3LDCA 2BCCH 4MVQA 1NBMG 3ZBHA 3VQXA 5IJ0B 3RYIA 4O4HB 4XDJA 4MT8A 4WCEV 1D5AA 1M4UA 3ZRWB 4HYOA 3WB1A 4TSFG 3VOUA 4YXWG 4I9QA 2DYRB 4UFZA 4JI2B 4JI8O 1URFA 4YJ2A 1WJZA 1XBLA 2OCCB 3K0DA 4IL6Z 2DMXA 3DTUB 3SPIA 1DGSA 1UFIA 3GVMA 4HAMA 5B1BB 2KB1A 3FKSG 3CCUV 2DJVA 1I7FA 2D2CB 4OX9O 3P30A 1M57B 4LF5O 3ZN1A 4X1IB 2GUZB 3LUTB 1N36B 4IYHA 3FB6C 1NH2B 2PZSA 3CC2V 3T2MA 1N34B 4FM1A 1IBLO 3ETGA 4PDRA 2ZM6B 3X2QB 1QVGU 1IBLB 4TQDA 3ABLB 3L70H 1WPXA 4LF8O 4O2AA 2BOCC 2QWOB 5KA5A 4DR4B 3K9AA 3RYHB 2LO1A 1BQZA 3CCMV 1B6QA 4DUZO 4OXSA 1E79G 1S3JA 1Z2GA 3UO2A 2YS8A 2LGWA 3SJBC 5DM6V 1JFFA 5FLXN 3LSUA 4X62B 3CCQV 3ETEA 2ZQMA 3OTFA 3SR2C 5LMUB 4JI2O 2UUCO 2AXTZ 2CTWA 2XHBA 3BAAA 4MVSA 4BWAA 1RM1B 3N27A 4PA6A 2P6JA 1KP3A 3ZMUA 3BHPA 3FYEB 4O2BB 1PNKA 1HR0B 4I5SA 2WLIA 4FK5C 2LGQA 1XMQB 1Q8IA 5KUKA 2CTQA 3C3TA 2UXXA 3FAVA 2CAZC 4R6ZA 4BW5A 4DR6B 5CBGA 4X64O 5EBMC 3OR6C 1VARA 2QM7A 4DR4O 1AR5A 3CE2A 4X88A 1VMGA 1WNSA 5B1BC 1R6TA 1K4DC 4TUYB 1SESA 4I7ZB 3W7TA 3M99B 4X65B 3ZMVA 2EJ7A 4XDLA 3AG3C 1YHQV 1S5JA 1RSOA 4HZ3A 3NR7A 1Q90D 2L6LA 2DYRC 3FAVB 3W7XA 1YJ9V 2E76B 1AR1B 1OCZC 2WLIB 1PV0A 5IJ0A 2UUAB 3K57A 2W0FC 2LJ2A 4QE9A 1AP5A 2Q7GA 5DEDA 4X62O 1VQPV 4FLYA 2GHYA 3N2GA 4JF3A 5LGUA 4IT5A 1XNQB 4JAVA 1XREA 3U11A 2ZINA 2FL4A 4I50A 1NR7A 4J80A 1TUBB 2YI8A 3IC7A 1N4CA 4R50A 3A2FA 2JK5C 4Q6GA 1ZUQA 2JS5A 2Y69C 3A8TA 3LNNA 3K5NA 3N2KB 1GK9A 3M8AA 4I55A 1YIJV 4WFFA 5L3BA 2DYSC 5JVDB 2QGNA 1VQ7V 4DV5O 1TVKB 4MVZA 3T1HB 1L0NH 4DR3O 3L74H 1JCHA 5IYBO 3VQVA 1NI8A 2DWEC 3CMAV 3HKBA 5LP6C 2ZNIA 1QVFU 1XEQA 3STZC 3H1KH 5LGTA 1W0JG 3UT5B 5CB4B 3CRAA 5IY5C 4X1IA 5GTHZ 1BZKA 1G1XB 5KX5B 3CYOA 2B9ZA 2QKAA 4FPPA 5L3FA 1CP9A 1KU9A 1N8RW 1LR1A 2XTAA 2EX3A 1FFXB 3H1LH 1W2BU 2RCVA 5LMUO 4D6TH 2UUCB 1AB3A 1EZVH 3RWRD 1RP3B 4W4LA 2OCHA 4RQFA 3ZEDA 1XL6A 4CZZA 4UCRA 4I9WA 3ASOB 1Q7YW 4O4HA 3W7SA 2QTSA 1VEWA 2BSKB 4JASA 1VQLV 1GO3F 4TOIA 3QG5A 4LF8B 4MSWC 5EK0A 4CH5A 2V1DA 3G80A 1SQBH 1GMGA 1I5XA 5CBFA 2UXCO 3WB0A 3HKBB 4TUYA 3ZHTA 1Y76A 5JQGB 1F4MA 4J42A 1GN3A 1HDJA 1XNRB 3TJTA 2P4VA 4BIOA 1VF5B 2UXDO 1GN6A 3JALA 4K35A 1FAFA 3FB5C 4J10A 1BCCH 4CC5A 1MSDA 1ORQC 2NN4A 3JAMN 1HNXB 1NTZH 2WSSG 3JD1A 1JR9A 1XHZA 2IU3A 2Y69B 4A5UB 3IAYA 1Y6XA 1R1BA 1ZTEA 2QDOA 4ZIBA 4FM0A 2Y4TA 1TUEB 3K5MA 2JGDB 1NU1H 4JAUA 3ZRVA 3ETDA 3HKEA 3OD4A 2XAGA 1OCRB 2M6YA 1H8EG 1ZWIC 1YSCA 5FNVA 1YVWA 1XILA 4ZKIA 3C3SA 3DXRB 1K73W 2F4VB 2A3QA 2LFRA 2Q0OC 3CWBH 4PDLA 4CC6A 4UV9A 3HKDB 2ATKC 2XAHA 4LNUB 2XT9A 4PI2A 5KHKA 1N34O 2GV9A 3BPZA 1KD1W 4ZI7A 4LF4O 5JJNB 2A06H 3ZHQA 3OAAG 4PA9A 3SPCA 4FJCC 4IGGA 2VQEB 3G6BA 3OTOO 2JJ1G 2W6JG 4Q20A 2YC0A 4PV1B 4JYAO 1VQ5V 4EEQA 4LF9B 1BHBA 3H01A 4AHCA 2ITDC 3JARA 2GUZA 3K03A 3B40A 5LHGA 2E5LB 5B1AC 3TCUA 3AG7A 1K3EA 3K59A 2F23A 1F23A 1YXBA 1SQPH 3BRCA 5KHIA 4UCUA 1B06A 3L9DA 3RBZA 3RGBA 4F4LA 3GWKC 1NZ6A 1VQOV 1EN5A 4JI0B 1H8HG 3HKDA 1I08A 1QCEA 1KQSU 3RW0A 2UU9O 5LGNA 5JJJB 2HVJC 4DV7O 3WFVA 1NT2B 3CD6V 2OTJV 3ZCCA 2FTKA 3PJSK 2YXLA 3TETA 2HJDA 4ZOLA 1I0HA 1NKDA 1JOYA 4NXMO 1WB7A 4X66O 3SJQC 4D7TA 2AW9A 3ZJZA 1DTOA 2AGAA 1SQVH 1N0NA 3OEHG 3B4SA 1MNGA 3AK2A 4MS2A 5EBWC 1WP8A 2LW1A 4KP4A 1NTMH 3E8GA 4DR7O 4GCZA 2HJFC 4LF9O 2ZD9A 5IYZB 1V54B 3A0BZ 3KZIZ 4JYAB 3CC7V 2UXCB 1IXMA 3K06A 1BGYH 5FPOA 5H2FZ 4Z1VA 2DE0X 3APOA 3LSSA 2Z5UA 5JQGA 1S5LZ 3LSQA 4DR2B 1JJOA 3H1JH 4O4JB 1SA0B 1CEZA 4KL1A 3B2EE 3JCZA 3AG1B 2Q4PA 4JPRA 4RQEA 4GT1A 1NVPD 3OGIB 5BR8B 4PA3A 4DR5O 5BR8O 2ZKOA 1HR0O 2BSKA 1AROP 3SPJA 5CA3A 2AZ2A 2CGNA 1SQQH 4K8ZA 1KYOF 4DV3O 4P9OA 3Q4HA 1AI7A 4DRXB 4JTAB 2ZNJA 3JALB 3AK1A 1H2LA 1N36O 1R6NA 2F1MA 3CMEV 3M7MX 1X59A 1EZJA 3CSXA 4L87A 4LC1A 4XDKA 2GBOA 2ZE5A 1KKDA 1R3LC 4JI3B 1AJQA 2QWRB 3I5DA 1OCCC 1ZX3A 1HP8A 2EILC 2HG5C 3QNEA 3R66A 3IGAC 1N0JA 3HR0A 3L73H 4QPKA 3CCRV 3J81N 1XL4A 3JARB 3JD0A 5LMNO 4LBEC 1H2KA 3SYOA 4DUYB 1WLEA 3EHBB 4R8CA 1LNQA 5DN6G 1HNWO 2DQ3A 4FLWA 3LDEA 3MHHC 5J9PC 5B1AB 1RFYA 1M9NA 4AQYO 2WLLB 2AZ0A 4PHZA 3AG2B 4JI8B 4UUJC 4FFKA 1F51A 1PM9A 4JTCB 4CH4A 4YJ2B 4KUMA 4MW8A 5K1XA 2X6AA 5EYPB 3E86A 2ADPA 1YITV 2XASA 4TT3G 1GN4A 1I5YA 2KQXA 3Q4HB 2XUMA 5FNVB 3VBBA 4UCOA 4JI0O 4IIJA 1P49A 4TWKA 2YUAA 1YZBA 1XMOO 4JTDB 4LFBO 3OUSA 1BSMA 2HVKC 2Z3YA 2B1GA 1Q6UA 1GM8A 2VQFB 3HKEB 4CS4A 4X1YB 5FL7G 1O9HA 4D7SA 4DV0B 4UVCA 5KUMA 4BIZA 1LUWA 3G67A 5B1OA 3QVNA 4BAYA 4DYLA 1M1KW 4G28B 1P7GA 2PYJA 4EFEA 2H3OA 3QO7A 1VQMV 2K9PA 4KHPB 2M7WA 5JH7A 3JAKA 3RVZA 1MOFA 3BY6A 5EBLC 4RAIA 2YDEA 3N2KA 2PI5A 1NJIW 2E3CA 1K4CC 2CH7A 3HPLC 1VQ4V 4AI8A 3K08A 4I50B 2BE3A 4O4LA 1SQFA 1NS1A 3F5WC 4JI6B 5GONB 1Q6IA 3CCVV 4ICGA 2X6BA 1FPOA 2ZR3A 2DWDC 4NB5A 2OTLV 4TV8B 3K5OA 1OHHG 4LFAB 4O2BA 5IWAO 2ILMA 2EIMC 3CXHF 1VQKV 2RQ6A 3A0RA 4WFAV 4P30A 2JS3A 2UUAO 1SF9A 4I4TB 3TXSA 4ASUG 1JFFB 1GRJA 1BT8A 1NTKH 2IJJA 1AR4A 4GZRB 1VF6C 3L75H 2P22C 1K33A 5B66Z 4O4IB 2NNUA 1J5EB 5F2VO 1K8AW 1H2SB 2CUGA 2P06A 3CEIA 2P5OA 1PKXA 4NTWA 1H2GA 4JAAA 4GKKO 5CA1A 1G8MA 5CB4A 4UB8Z 2BOBC 3SYAA 3UO3A 2WLNA 3E8FA 1SS3A 2PY5A 2OWOA 1R6KA 3JAWB 5JWPA 2XAQA 2IU0A 3SJCC 1TVKA 5LA6A 1CXZB 1Q86W 1MSWD 4I55B 2YEVA 4MTFA 1VQ9V 3DGEA 4RWUA 2X6CA 3F5TA 1YJWV 5IYCO 3K0GA 4LFCO 4JI5B 3MDSA 1L8DA 3CX5F 4JV5B 4J7JA 2N74A 2MW2B 5JJEB 3G6EV 3ZRSA 3CJHA 3CRCA 1P7BA 3AEIA 5BY1A 1SQXH 2DN9A 2UXBO 4GYCB 4QPJA 1D2DA 4R7CA 2DW4A 4F6RA 2ZR2A 2E5LO 1OCOC 3SJAC 3W7UA 1K5SA 2HKOA 1QR8A 3QO5A 1HNXO 1BE3H 4JI3O 4ZHQA 1SERA 3ETQA 1TA8A 2VQEO 1WPBA 3OTOB 3JD3A 3K58A 1S77D 3EVKA 3ZMTA 2Q68A 1O9GA 3JATB 2PTMA 3KCXA 4GX0A 1N33O 4JYYA 3W7WA 4U3JA 4JI7O 3ICXA 2YIDA 4LF6B 4CH3A 1Q82W 2UUBB 4PJ0Z 2QA4V 2ADQB 4JI4B 3OGCC 4LP8A 3U10A 2WAMA 1VF7A 3CRQA 1G6UA 4B3SB 3O9OA 1NH2D 2PF4E 2QWQB 2Q8VA 3IFXA 5KMGB 4ZOLB 4YJ3B 5LYJB 2ZM6O 3L72H 1J95A 2VWJA 1FJGB 1FJGO 2Y0IA 4DR5B 3CRMA 2UUBO 1HNZO 4WBNA 2JGUA 5E1AC 4DO2A 4DW1A 3F7YC 1XI1A 3GWOA 3CC4V 1ENVA 2W0XA 5CA0A 2R9RB 2N05A 1FXVA 3JD2A 3NXSA 2PGGA 5AG2A 3T1HO 3TXQA 4EKWA 2FB5A 1K97A 2EIKC 3ZMZA 1PL0A 4PA7A 1BL8A 2F43G 3EXAA 2D3OW 5A2QN 4JYBA 3SPHA 5KHGA 2YI9A 4GX2A 5EIBD 5KHJA 3STLC 4B3MB 3OUFA 1R3JC 1WA8A 4X1KA 2JJ2G 4NXMB 1WN7A 4LWSA 1KECA 1KP2A 3B8MA 1QNMA 2LW7A 1QLNA 1D5NA 5IJ9A 5L3GA 4QIWF 4E4EA 2XAJA 2IJHA 4EB6B 1ZL8B 4DV4O 4OPHA 4DV7B 3K79A 2JRIA 2QKSA 2BTQB 3MHSC 4LFBB 2F66C 1XNQO 2F4VO 2QE7G 3DXRA 3SYCA 1JJ2U 1Z5VA 1FXHA 3THOA 1VQNV 5B3SB 1M56B 3CPWU 2EINC 2VS0A 5H6RA 2ZIOA 3OFNG 2R70A 1QBZA 3N2GB 1FXKC 1AP6A 2JGDA 4B3TO 4NTXA 2Y4UA 1YJNV 2BTQA 4MVMA 3WB2A 1K92A 4BW9A 5BXZA 1PNMA 2XAFA 1I94O 4DV2O 4UXNA 5LMNB 1IURA 4GUNA 1VIBA 2Q5ZA 2RNBA 2HFEC 3D3IA 4AQYB
chains in the Genus database with same CATH topology
2Q5ZA 2Q73A 1Y6XA 2Q4PA 3CRCA 2OIEA 5IE9A 2GTAA 2P06A 2YXHA 2A3QA 4QGPA 2Q9LA 3C90A 2A7WA 3CRAA 1YXBA 1VMGA 1YVWA 2OIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5Z A;  2Q73 A;  1Y6X A;  2Q4P A;  3CRC A;  2OIE A;  5IE9 A;  2GTA A;  2P06 A;  2YXH A;  2A3Q A;  4QGP A;  2Q9L A;  3C90 A;  2A7W A;  3CRA A;  1YXB A;  1VMG A;  1YVW A;  2OIG A; 
#chains in the Genus database with same CATH topology
 2X0L A;  4LH6 A;  4B3M O;  3OW2 U;  4JI1 B;  4K8X A;  4X1Y A;  1GM9 A;  2A9H A;  1OCC B;  1Y76 B;  2ZXW C;  1S5H C;  3T4Z A;  1N32 B;  4MVO A;  4UCS A;  4K0K O;  4IIJ B;  2WPD G;  3UM7 A;  5C8Y A;  2IW5 A;  3ABU A;  2YXH A;  2XOK G;  3AG1 C;  3ZHS A;  1P4R A;  1Z5W A;  2PI4 A;  3ABK B;  2Q9L A;  2EIK B;  4C7U A;  4X66 B;  4WBN B;  4WF9 V;  3CHX A;  1OJH A;  1HNW B;  3L71 H;  3RFR A;  1XUQ A;  4FVM A;  2DYS B;  2KSD A;  4MTX A;  4RUF A;  3BAB A;  4IYI A;  3CXC U;  2A0L A;  4RUE A;  1XQ8 A;  2G38 A;  5EC2 C;  2CDY A;  4NXN O;  4W4K A;  2P4K A;  5LL6 Y;  4LF6 O;  2Q7E A;  5IE9 A;  1HWY A;  1Y4M A;  3BFR A;  3K5L A;  3R65 A;  5LOV B;  2IBZ H;  4DV4 B;  3TK1 A;  4CBC A;  3KG2 A;  4GX5 A;  3ZN0 A;  3D3Q A;  1YF2 A;  2FYU H;  2Q69 A;  1EM1 A;  2ZDI A;  1KKC A;  1DLB A;  4LNU A;  3FB7 C;  1K7D A;  3JSL A;  3AG4 C;  4YY3 B;  3CCJ V;  4KFM A;  2JVD A;  5LP6 A;  3DC5 A;  3JYC A;  4X20 A;  5KLV H;  4WFG A;  4DV1 O;  3BCC H;  3E35 A;  4FLX A;  4FFB A;  2QJ1 A;  3ZHR A;  5H9C A;  4Z2W A;  4KXR A;  3FB8 C;  1SA0 A;  1SKV A;  2ZIM A;  4NYK A;  1U96 A;  3D8C A;  3JAS B;  3QF7 A;  2IM9 A;  5A9G A;  3K3W A;  5IWA B;  4LCU C;  4YHH O;  3BEH A;  2ZDI C;  2AHY A;  5BZB A;  2ETN A;  4DV6 O;  3ZMS A;  3GB7 C;  2RJZ A;  3ASN C;  4ZHQ B;  1SQG A;  2HHH B;  5LA6 B;  2LP7 A;  4KHP O;  1WAZ A;  5ITZ B;  5GTI Z;  5LXT B;  2CK3 G;  1CPY A;  4ZBM A;  5LP6 B;  1OZ0 A;  1FKA O;  2OIG A;  1N32 O;  1X4T A;  1L1F A;  4LFA O;  1LUV A;  4H37 A;  4NR1 A;  1RSO B;  4LF7 O;  1V55 B;  4X1K B;  4LF7 B;  1P84 F;  2QKC A;  4XBF A;  1IBM O;  1GAX A;  2FML A;  3MD0 A;  5LOV A;  1H38 A;  1SET A;  2V4D A;  3HKC B;  4QJF B;  4MVU A;  4NKG B;  5CN0 A;  3B77 A;  3LNM B;  4MVR A;  1AJP A;  1PL4 A;  1KB9 F;  4DV5 B;  3ABM C;  2LQT A;  4JZG A;  4EFB A;  2GTA A;  4FZ0 A;  2HHH O;  2MK3 A;  4DV0 O;  1OCZ B;  1UPG A;  3JD4 A;  2R9I A;  2R9A A;  1DF5 A;  3SGI A;  2EBO A;  3RYC B;  5EC1 C;  4DR6 O;  5J2U A;  1Y74 B;  3UKM A;  5KAI Z;  3UQ8 A;  3G71 V;  3RYC A;  2W6I G;  1XHX A;  5KHH A;  5E79 Z;  1M90 W;  3H9V A;  3VQY A;  2OIE A;  3OT7 A;  5KX5 A;  3RYF A;  2KG7 B;  4JZ2 A;  1EBO A;  3E2E A;  4PI0 A;  1RPO A;  4JI1 O;  3JSN A;  1ZLZ A;  3E22 A;  4UVB A;  4O4L B;  3ASO C;  1WA8 B;  4LR3 A;  4O2A B;  4HNA A;  2WLK A;  5BMV A;  1IBK B;  2OYQ A;  4X64 B;  1FXK A;  4OPA A;  4FLU A;  4YY3 O;  4TV9 B;  1K5Q A;  2XND G;  1R3K C;  3E22 B;  4B3R B;  4OGQ B;  2HEP A;  1Y66 A;  3S3W A;  4H13 B;  1EN4 A;  5KAF Z;  3UCS C;  2KG7 A;  1G4Y B;  1W0K G;  3E8H A;  2P67 A;  1YDX A;  5EZY B;  1XDC A;  2UU9 B;  4GLX A;  3U0Z A;  2YSU B;  1SRY A;  4DV1 B;  4G2K A;  5C93 A;  4E2L A;  2AHZ A;  4BIU A;  1GKF A;  3A0H Z;  3ZS8 C;  1SZT A;  5B5E Z;  1MZE A;  2EIN B;  2QR4 A;  1ZAU A;  2K1E A;  4HBN A;  1SZX A;  4JYC A;  3ABM B;  2LFS A;  2EIJ C;  3CCE V;  3P3N A;  4DW0 A;  2L35 A;  1FD9 A;  4F6E A;  2VWK A;  4CH6 A;  3SYQ A;  4FLT A;  1L0L H;  5JH7 B;  4UB6 Z;  1DK1 A;  1IX9 A;  3HKC A;  3ASN B;  4EB6 A;  3P32 A;  5LBQ A;  4I0X B;  4UCV A;  4U3F H;  2WLL A;  1MG1 A;  2QM8 A;  2N04 A;  3OMA B;  3J7A U;  1M57 C;  5EZY A;  2A7W A;  4WFH A;  5IYD O;  4QNH B;  4WFE A;  4FMT A;  1COW G;  1IBK O;  4J41 A;  1KMI Z;  4G27 B;  3QO8 A;  1EFR G;  1F4N A;  5ITZ A;  1YI2 V;  4DR7 B;  2C2A A;  4U7N A;  3BA9 A;  3JCU Z;  1QQC A;  5BMV B;  2Y0P A;  4UCT A;  4HNA B;  5J2T A;  5EYP A;  1RPR A;  4TQF A;  3DSQ A;  2RDC A;  3TGU H;  4PD4 F;  2Q67 A;  3CP1 A;  2QWN B;  1AI6 A;  1QLE B;  2VRZ A;  4B3T B;  3E8B A;  1QLE C;  5EIB C;  2Q7H A;  1Y67 A;  2ZE6 A;  4JGS A;  2ZE8 A;  5IT9 N;  5D5P A;  1KC8 W;  1XNR O;  4X20 B;  3D36 C;  5IJ9 B;  4FLZ A;  1FYJ A;  5JCO A;  5LHH A;  1YCI A;  1Q43 A;  1YTF B;  4K3A A;  1YEW A;  2GSM B;  2UXD B;  1M56 C;  4DR2 O;  1JA8 A;  3I55 V;  4U7O A;  3E89 A;  2CGO A;  4K0K B;  3PN1 A;  1Q5O A;  3JAK B;  4B08 A;  1RM1 C;  2WA3 A;  3CCS V;  1OCR C;  4YIO A;  5D5Q A;  2EUL A;  4IHJ A;  4O4I A;  1R3I C;  5H5N A;  4GKJ B;  4B7K A;  4BR6 A;  1V55 C;  5H6Q A;  1JPX A;  4YIP A;  2QTO A;  4H44 B;  3C90 A;  1IDS A;  5KA6 A;  2PUS A;  1NQT A;  2ZXW B;  4FZ1 A;  1IZ3 A;  1Y74 A;  5LXT A;  1JQ0 A;  3RYI B;  3I56 V;  3HB3 B;  3CRR A;  3AG2 C;  5LYJ A;  1XMO B;  1JMK C;  3ZIA G;  4JV5 O;  5DEC A;  4PEL A;  1Q6H A;  1UJW B;  2Q0A A;  2X7R B;  4UVA A;  4DUY O;  2E74 B;  2YEV B;  5GON A;  1BMF G;  5K1P A;  4DUZ B;  5FPR A;  5L3D A;  2F93 B;  3H1H H;  1F7Y A;  3JAS A;  3ABK C;  3RN4 A;  2HP8 A;  2CH7 B;  2IH1 C;  2FKX A;  4FFB B;  4DR1 B;  2ZT9 B;  1W59 A;  1SC5 B;  3QTC A;  3CS5 A;  2Q6A A;  2JIZ G;  2ZE7 A;  1QHT A;  2NLJ C;  2ZCE A;  4LF4 B;  2WLJ A;  2OCC C;  3EFF K;  4IHJ B;  2B5U A;  4J7Z A;  1OCO B;  4QE7 A;  4DK1 A;  2P90 A;  1IBM B;  4X8A A;  4B7E A;  1S76 D;  4H0L B;  4P2Z A;  5L3E A;  1IVS A;  1I94 B;  4ZI7 B;  3CJH B;  3DC6 A;  3CCL V;  2A79 B;  3F7V C;  4I4T A;  5CA0 B;  1Q81 W;  2EIM B;  2UXB B;  2HR3 A;  5CMU A;  1FFX A;  2ARH A;  3ZHV A;  4DRX A;  5TIS Z;  1FS0 G;  4YHH B;  1IXB A;  3B09 A;  1QU7 A;  3OMN B;  1AI4 A;  2Z0A A;  3ZX6 A;  5KMG A;  2UXN A;  1VQ6 V;  3RYF B;  3SPG A;  2EJR A;  2YIB D;  4PDM A;  2RMK B;  4N21 A;  4JI4 O;  1S72 V;  5J2U B;  4O4J A;  3FYI B;  3T4D A;  1B3Q A;  2EZO A;  5CBH A;  4U3J B;  2H8P C;  3G4S V;  3SYP A;  3JAT A;  3VQW A;  5J2T B;  1YTF D;  2QEX V;  5CA1 B;  2NR5 A;  4P9P A;  5C8Y B;  1S0V A;  2O57 A;  2B1I A;  3BVO A;  3OMI B;  4L8J A;  4B3R O;  4J7K A;  2IH3 C;  1PNL A;  1MMM A;  1Q3E A;  1OV9 A;  3BA8 A;  1XMQ O;  4Z1M G;  1KUQ A;  4DV6 B;  4X89 A;  2CE4 A;  2DQ0 A;  3CB2 A;  2VQF O;  4F6R B;  2YXY A;  1M93 A;  1T5E A;  4ABM A;  5HFM A;  1TUB A;  2Y48 A;  3OM3 B;  1MAB G;  1US6 A;  4NXN B;  1HW7 A;  1WB8 A;  1R73 A;  3ML0 A;  1M5I A;  1K34 A;  3ZHU A;  4CS3 A;  4I0X A;  1DF4 A;  1QR9 A;  1EN6 A;  1BS3 A;  1ROP A;  4JI5 O;  2QWP B;  3FX7 A;  2CTR A;  3ZRX A;  1VF6 A;  1V54 C;  4J11 A;  1AIL A;  2HLD G;  3AK3 A;  2ITC C;  4DR1 O;  1FFT B;  3IC9 A;  2GTS A;  1E1Q G;  2GDS A;  4MTG A;  4GKK B;  3AG4 B;  3ABT A;  1AJN A;  4MTO A;  2E75 B;  1GH6 A;  1PD3 A;  4MW3 A;  5B3S C;  1BHA A;  4PA4 A;  5HFL A;  2YIA A;  3OE7 G;  2IJI A;  1N33 B;  3JAW A;  5L3C A;  3K04 A;  2YIB A;  1A32 A;  4JI6 O;  3B8N A;  2ODM A;  1GN2 A;  4RO2 A;  2Q73 A;  1VQ8 V;  4FLV A;  4OX9 B;  3S3X A;  1NR1 A;  1V9P A;  2WA4 A;  3J80 N;  1K9M W;  4DK0 A;  1PPJ H;  3KCY A;  2WLM A;  4LWS B;  4TV9 A;  1TAE A;  3H1I H;  4FIP C;  2CTP A;  1FXK B;  5IY5 B;  1U97 A;  1HNZ B;  3WG7 B;  1PP9 H;  4DV3 B;  4DV2 B;  4LF5 B;  4QGP A;  5JVD A;  4DXW A;  4B3S O;  1AI5 A;  2WLH A;  1ZSP A;  3KKY A;  1JX9 A;  3T1C A;  4PDV A;  1J5E O;  4FM2 A;  5IDJ A;  3FFQ A;  4GX1 A;  4NVP A;  5JCO C;  2PYL A;  3APQ A;  4NTY A;  3OR7 C;  3RYH A;  3D36 A;  3ABL C;  2QSA A;  4N23 A;  1XOU A;  1MZF A;  1JVM A;  4TV8 A;  2DOS A;  2H94 A;  2R72 A;  2P7T C;  4CS2 A;  1AVM A;  1ZL8 A;  3RT3 C;  1H2M A;  3UT5 A;  2EZP A;  4J9Y B;  4J9Z B;  1BQ0 A;  2JDI G;  2BTO A;  4YJ3 A;  4LFC B;  3LDD A;  3O65 A;  1NVP B;  5B1N A;  1H2N A;  3T1Y B;  4JI7 B;  3K9S A;  2OT5 A;  3IJ4 A;  3P3P A;  2WWW A;  5GW7 A;  2KKW A;  3X2Q C;  4H33 A;  1WP7 A;  1KBH A;  2EIJ B;  2IJK A;  3WG7 C;  4AIL C;  1THZ A;  4WFB V;  3MAQ A;  3FD9 A;  3E83 A;  4GKJ O;  4X65 O;  5IYZ A;  1VP7 A;  4UV8 A;  1GM7 A;  2F95 B;  3T1Y O;  2EIL B;  2JEU A;  3AG3 B;  3OEE G;  2V7Q G;  1B04 A;  2YIC A;  4LH7 A;  3RVY A;  5LHI A;  1MA1 A;  1E1R G;  2JEX A;  1GTO A;  3SDL A;  3WU2 Z;  3ZRW A;  2QM4 A;  4DR3 B;  1TGO A;  4X9Q A;  2RN9 A;  3LDC A;  2BCC H;  4MVQ A;  1NBM G;  3ZBH A;  3VQX A;  5IJ0 B;  3RYI A;  4O4H B;  4XDJ A;  4MT8 A;  4WCE V;  1D5A A;  1M4U A;  3ZRW B;  4HYO A;  3WB1 A;  4TSF G;  3VOU A;  4YXW G;  4I9Q A;  2DYR B;  4UFZ A;  4JI2 B;  4JI8 O;  1URF A;  4YJ2 A;  1WJZ A;  1XBL A;  2OCC B;  3K0D A;  4IL6 Z;  2DMX A;  3DTU B;  3SPI A;  1DGS A;  1UFI A;  3GVM A;  4HAM A;  5B1B B;  2KB1 A;  3FKS G;  3CCU V;  2DJV A;  1I7F A;  2D2C B;  4OX9 O;  3P30 A;  1M57 B;  4LF5 O;  3ZN1 A;  4X1I B;  2GUZ B;  3LUT B;  1N36 B;  4IYH A;  3FB6 C;  1NH2 B;  2PZS A;  3CC2 V;  3T2M A;  1N34 B;  4FM1 A;  1IBL O;  3ETG A;  4PDR A;  2ZM6 B;  3X2Q B;  1QVG U;  1IBL B;  4TQD A;  3ABL B;  3L70 H;  1WPX A;  4LF8 O;  4O2A A;  2BOC C;  2QWO B;  5KA5 A;  4DR4 B;  3K9A A;  3RYH B;  2LO1 A;  1BQZ A;  3CCM V;  1B6Q A;  4DUZ O;  4OXS A;  1E79 G;  1S3J A;  1Z2G A;  3UO2 A;  2YS8 A;  2LGW A;  3SJB C;  5DM6 V;  1JFF A;  5FLX N;  3LSU A;  4X62 B;  3CCQ V;  3ETE A;  2ZQM A;  3OTF A;  3SR2 C;  5LMU B;  4JI2 O;  2UUC O;  2AXT Z;  2CTW A;  2XHB A;  3BAA A;  4MVS A;  4BWA A;  1RM1 B;  3N27 A;  4PA6 A;  2P6J A;  1KP3 A;  3ZMU A;  3BHP A;  3FYE B;  4O2B B;  1PNK A;  1HR0 B;  4I5S A;  2WLI A;  4FK5 C;  2LGQ A;  1XMQ B;  1Q8I A;  5KUK A;  2CTQ A;  3C3T A;  2UXX A;  3FAV A;  2CAZ C;  4R6Z A;  4BW5 A;  4DR6 B;  5CBG A;  4X64 O;  5EBM C;  3OR6 C;  1VAR A;  2QM7 A;  4DR4 O;  1AR5 A;  3CE2 A;  4X88 A;  1VMG A;  1WNS A;  5B1B C;  1R6T A;  1K4D C;  4TUY B;  1SES A;  4I7Z B;  3W7T A;  3M99 B;  4X65 B;  3ZMV A;  2EJ7 A;  4XDL A;  3AG3 C;  1YHQ V;  1S5J A;  1RSO A;  4HZ3 A;  3NR7 A;  1Q90 D;  2L6L A;  2DYR C;  3FAV B;  3W7X A;  1YJ9 V;  2E76 B;  1AR1 B;  1OCZ C;  2WLI B;  1PV0 A;  5IJ0 A;  2UUA B;  3K57 A;  2W0F C;  2LJ2 A;  4QE9 A;  1AP5 A;  2Q7G A;  5DED A;  4X62 O;  1VQP V;  4FLY A;  2GHY A;  3N2G A;  4JF3 A;  5LGU A;  4IT5 A;  1XNQ B;  4JAV A;  1XRE A;  3U11 A;  2ZIN A;  2FL4 A;  4I50 A;  1NR7 A;  4J80 A;  1TUB B;  2YI8 A;  3IC7 A;  1N4C A;  4R50 A;  3A2F A;  2JK5 C;  4Q6G A;  1ZUQ A;  2JS5 A;  2Y69 C;  3A8T A;  3LNN A;  3K5N A;  3N2K B;  1GK9 A;  3M8A A;  4I55 A;  1YIJ V;  4WFF A;  5L3B A;  2DYS C;  5JVD B;  2QGN A;  1VQ7 V;  4DV5 O;  1TVK B;  4MVZ A;  3T1H B;  1L0N H;  4DR3 O;  3L74 H;  1JCH A;  5IYB O;  3VQV A;  1NI8 A;  2DWE C;  3CMA V;  3HKB A;  5LP6 C;  2ZNI A;  1QVF U;  1XEQ A;  3STZ C;  3H1K H;  5LGT A;  1W0J G;  3UT5 B;  5CB4 B;  3CRA A;  5IY5 C;  4X1I A;  5GTH Z;  1BZK A;  1G1X B;  5KX5 B;  3CYO A;  2B9Z A;  2QKA A;  4FPP A;  5L3F A;  1CP9 A;  1KU9 A;  1N8R W;  1LR1 A;  2XTA A;  2EX3 A;  1FFX B;  3H1L H;  1W2B U;  2RCV A;  5LMU O;  4D6T H;  2UUC B;  1AB3 A;  1EZV H;  3RWR D;  1RP3 B;  4W4L A;  2OCH A;  4RQF A;  3ZED A;  1XL6 A;  4CZZ A;  4UCR A;  4I9W A;  3ASO B;  1Q7Y W;  4O4H A;  3W7S A;  2QTS A;  1VEW A;  2BSK B;  4JAS A;  1VQL V;  1GO3 F;  4TOI A;  3QG5 A;  4LF8 B;  4MSW C;  5EK0 A;  4CH5 A;  2V1D A;  3G80 A;  1SQB H;  1GMG A;  1I5X A;  5CBF A;  2UXC O;  3WB0 A;  3HKB B;  4TUY A;  3ZHT A;  1Y76 A;  5JQG B;  1F4M A;  4J42 A;  1GN3 A;  1HDJ A;  1XNR B;  3TJT A;  2P4V A;  4BIO A;  1VF5 B;  2UXD O;  1GN6 A;  3JAL A;  4K35 A;  1FAF A;  3FB5 C;  4J10 A;  1BCC H;  4CC5 A;  1MSD A;  1ORQ C;  2NN4 A;  3JAM N;  1HNX B;  1NTZ H;  2WSS G;  3JD1 A;  1JR9 A;  1XHZ A;  2IU3 A;  2Y69 B;  4A5U B;  3IAY A;  1Y6X A;  1R1B A;  1ZTE A;  2QDO A;  4ZIB A;  4FM0 A;  2Y4T A;  1TUE B;  3K5M A;  2JGD B;  1NU1 H;  4JAU A;  3ZRV A;  3ETD A;  3HKE A;  3OD4 A;  2XAG A;  1OCR B;  2M6Y A;  1H8E G;  1ZWI C;  1YSC A;  5FNV A;  1YVW A;  1XIL A;  4ZKI A;  3C3S A;  3DXR B;  1K73 W;  2F4V B;  2A3Q A;  2LFR A;  2Q0O C;  3CWB H;  4PDL A;  4CC6 A;  4UV9 A;  3HKD B;  2ATK C;  2XAH A;  4LNU B;  2XT9 A;  4PI2 A;  5KHK A;  1N34 O;  2GV9 A;  3BPZ A;  1KD1 W;  4ZI7 A;  4LF4 O;  5JJN B;  2A06 H;  3ZHQ A;  3OAA G;  4PA9 A;  3SPC A;  4FJC C;  4IGG A;  2VQE B;  3G6B A;  3OTO O;  2JJ1 G;  2W6J G;  4Q20 A;  2YC0 A;  4PV1 B;  4JYA O;  1VQ5 V;  4EEQ A;  4LF9 B;  1BHB A;  3H01 A;  4AHC A;  2ITD C;  3JAR A;  2GUZ A;  3K03 A;  3B40 A;  5LHG A;  2E5L B;  5B1A C;  3TCU A;  3AG7 A;  1K3E A;  3K59 A;  2F23 A;  1F23 A;  1YXB A;  1SQP H;  3BRC A;  5KHI A;  4UCU A;  1B06 A;  3L9D A;  3RBZ A;  3RGB A;  4F4L A;  3GWK C;  1NZ6 A;  1VQO V;  1EN5 A;  4JI0 B;  1H8H G;  3HKD A;  1I08 A;  1QCE A;  1KQS U;  3RW0 A;  2UU9 O;  5LGN A;  5JJJ B;  2HVJ C;  4DV7 O;  3WFV A;  1NT2 B;  3CD6 V;  2OTJ V;  3ZCC A;  2FTK A;  3PJS K;  2YXL A;  3TET A;  2HJD A;  4ZOL A;  1I0H A;  1NKD A;  1JOY A;  4NXM O;  1WB7 A;  4X66 O;  3SJQ C;  4D7T A;  2AW9 A;  3ZJZ A;  1DTO A;  2AGA A;  1SQV H;  1N0N A;  3OEH G;  3B4S A;  1MNG A;  3AK2 A;  4MS2 A;  5EBW C;  1WP8 A;  2LW1 A;  4KP4 A;  1NTM H;  3E8G A;  4DR7 O;  4GCZ A;  2HJF C;  4LF9 O;  2ZD9 A;  5IYZ B;  1V54 B;  3A0B Z;  3KZI Z;  4JYA B;  3CC7 V;  2UXC B;  1IXM A;  3K06 A;  1BGY H;  5FPO A;  5H2F Z;  4Z1V A;  2DE0 X;  3APO A;  3LSS A;  2Z5U A;  5JQG A;  1S5L Z;  3LSQ A;  4DR2 B;  1JJO A;  3H1J H;  4O4J B;  1SA0 B;  1CEZ A;  4KL1 A;  3B2E E;  3JCZ A;  3AG1 B;  2Q4P A;  4JPR A;  4RQE A;  4GT1 A;  1NVP D;  3OGI B;  5BR8 B;  4PA3 A;  4DR5 O;  5BR8 O;  2ZKO A;  1HR0 O;  2BSK A;  1ARO P;  3SPJ A;  5CA3 A;  2AZ2 A;  2CGN A;  1SQQ H;  4K8Z A;  1KYO F;  4DV3 O;  4P9O A;  3Q4H A;  1AI7 A;  4DRX B;  4JTA B;  2ZNJ A;  3JAL B;  3AK1 A;  1H2L A;  1N36 O;  1R6N A;  2F1M A;  3CME V;  3M7M X;  1X59 A;  1EZJ A;  3CSX A;  4L87 A;  4LC1 A;  4XDK A;  2GBO A;  2ZE5 A;  1KKD A;  1R3L C;  4JI3 B;  1AJQ A;  2QWR B;  3I5D A;  1OCC C;  1ZX3 A;  1HP8 A;  2EIL C;  2HG5 C;  3QNE A;  3R66 A;  3IGA C;  1N0J A;  3HR0 A;  3L73 H;  4QPK A;  3CCR V;  3J81 N;  1XL4 A;  3JAR B;  3JD0 A;  5LMN O;  4LBE C;  1H2K A;  3SYO A;  4DUY B;  1WLE A;  3EHB B;  4R8C A;  1LNQ A;  5DN6 G;  1HNW O;  2DQ3 A;  4FLW A;  3LDE A;  3MHH C;  5J9P C;  5B1A B;  1RFY A;  1M9N A;  4AQY O;  2WLL B;  2AZ0 A;  4PHZ A;  3AG2 B;  4JI8 B;  4UUJ C;  4FFK A;  1F51 A;  1PM9 A;  4JTC B;  4CH4 A;  4YJ2 B;  4KUM A;  4MW8 A;  5K1X A;  2X6A A;  5EYP B;  3E86 A;  2ADP A;  1YIT V;  2XAS A;  4TT3 G;  1GN4 A;  1I5Y A;  2KQX A;  3Q4H B;  2XUM A;  5FNV B;  3VBB A;  4UCO A;  4JI0 O;  4IIJ A;  1P49 A;  4TWK A;  2YUA A;  1YZB A;  1XMO O;  4JTD B;  4LFB O;  3OUS A;  1BSM A;  2HVK C;  2Z3Y A;  2B1G A;  1Q6U A;  1GM8 A;  2VQF B;  3HKE B;  4CS4 A;  4X1Y B;  5FL7 G;  1O9H A;  4D7S A;  4DV0 B;  4UVC A;  5KUM A;  4BIZ A;  1LUW A;  3G67 A;  5B1O A;  3QVN A;  4BAY A;  4DYL A;  1M1K W;  4G28 B;  1P7G A;  2PYJ A;  4EFE A;  2H3O A;  3QO7 A;  1VQM V;  2K9P A;  4KHP B;  2M7W A;  5JH7 A;  3JAK A;  3RVZ A;  1MOF A;  3BY6 A;  5EBL C;  4RAI A;  2YDE A;  3N2K A;  2PI5 A;  1NJI W;  2E3C A;  1K4C C;  2CH7 A;  3HPL C;  1VQ4 V;  4AI8 A;  3K08 A;  4I50 B;  2BE3 A;  4O4L A;  1SQF A;  1NS1 A;  3F5W C;  4JI6 B;  5GON B;  1Q6I A;  3CCV V;  4ICG A;  2X6B A;  1FPO A;  2ZR3 A;  2DWD C;  4NB5 A;  2OTL V;  4TV8 B;  3K5O A;  1OHH G;  4LFA B;  4O2B A;  5IWA O;  2ILM A;  2EIM C;  3CXH F;  1VQK V;  2RQ6 A;  3A0R A;  4WFA V;  4P30 A;  2JS3 A;  2UUA O;  1SF9 A;  4I4T B;  3TXS A;  4ASU G;  1JFF B;  1GRJ A;  1BT8 A;  1NTK H;  2IJJ A;  1AR4 A;  4GZR B;  1VF6 C;  3L75 H;  2P22 C;  1K33 A;  5B66 Z;  4O4I B;  2NNU A;  1J5E B;  5F2V O;  1K8A W;  1H2S B;  2CUG A;  2P06 A;  3CEI A;  2P5O A;  1PKX A;  4NTW A;  1H2G A;  4JAA A;  4GKK O;  5CA1 A;  1G8M A;  5CB4 A;  4UB8 Z;  2BOB C;  3SYA A;  3UO3 A;  2WLN A;  3E8F A;  1SS3 A;  2PY5 A;  2OWO A;  1R6K A;  3JAW B;  5JWP A;  2XAQ A;  2IU0 A;  3SJC C;  1TVK A;  5LA6 A;  1CXZ B;  1Q86 W;  1MSW D;  4I55 B;  2YEV A;  4MTF A;  1VQ9 V;  3DGE A;  4RWU A;  2X6C A;  3F5T A;  1YJW V;  5IYC O;  3K0G A;  4LFC O;  4JI5 B;  3MDS A;  1L8D A;  3CX5 F;  4JV5 B;  4J7J A;  2N74 A;  2MW2 B;  5JJE B;  3G6E V;  3ZRS A;  3CJH A;  3CRC A;  1P7B A;  3AEI A;  5BY1 A;  1SQX H;  2DN9 A;  2UXB O;  4GYC B;  4QPJ A;  1D2D A;  4R7C A;  2DW4 A;  4F6R A;  2ZR2 A;  2E5L O;  1OCO C;  3SJA C;  3W7U A;  1K5S A;  2HKO A;  1QR8 A;  3QO5 A;  1HNX O;  1BE3 H;  4JI3 O;  4ZHQ A;  1SER A;  3ETQ A;  1TA8 A;  2VQE O;  1WPB A;  3OTO B;  3JD3 A;  3K58 A;  1S77 D;  3EVK A;  3ZMT A;  2Q68 A;  1O9G A;  3JAT B;  2PTM A;  3KCX A;  4GX0 A;  1N33 O;  4JYY A;  3W7W A;  4U3J A;  4JI7 O;  3ICX A;  2YID A;  4LF6 B;  4CH3 A;  1Q82 W;  2UUB B;  4PJ0 Z;  2QA4 V;  2ADQ B;  4JI4 B;  3OGC C;  4LP8 A;  3U10 A;  2WAM A;  1VF7 A;  3CRQ A;  1G6U A;  4B3S B;  3O9O A;  1NH2 D;  2PF4 E;  2QWQ B;  2Q8V A;  3IFX A;  5KMG B;  4ZOL B;  4YJ3 B;  5LYJ B;  2ZM6 O;  3L72 H;  1J95 A;  2VWJ A;  1FJG B;  1FJG O;  2Y0I A;  4DR5 B;  3CRM A;  2UUB O;  1HNZ O;  4WBN A;  2JGU A;  5E1A C;  4DO2 A;  4DW1 A;  3F7Y C;  1XI1 A;  3GWO A;  3CC4 V;  1ENV A;  2W0X A;  5CA0 A;  2R9R B;  2N05 A;  1FXV A;  3JD2 A;  3NXS A;  2PGG A;  5AG2 A;  3T1H O;  3TXQ A;  4EKW A;  2FB5 A;  1K97 A;  2EIK C;  3ZMZ A;  1PL0 A;  4PA7 A;  1BL8 A;  2F43 G;  3EXA A;  2D3O W;  5A2Q N;  4JYB A;  3SPH A;  5KHG A;  2YI9 A;  4GX2 A;  5EIB D;  5KHJ A;  3STL C;  4B3M B;  3OUF A;  1R3J C;  1WA8 A;  4X1K A;  2JJ2 G;  4NXM B;  1WN7 A;  4LWS A;  1KEC A;  1KP2 A;  3B8M A;  1QNM A;  2LW7 A;  1QLN A;  1D5N A;  5IJ9 A;  5L3G A;  4QIW F;  4E4E A;  2XAJ A;  2IJH A;  4EB6 B;  1ZL8 B;  4DV4 O;  4OPH A;  4DV7 B;  3K79 A;  2JRI A;  2QKS A;  2BTQ B;  3MHS C;  4LFB B;  2F66 C;  1XNQ O;  2F4V O;  2QE7 G;  3DXR A;  3SYC A;  1JJ2 U;  1Z5V A;  1FXH A;  3THO A;  1VQN V;  5B3S B;  1M56 B;  3CPW U;  2EIN C;  2VS0 A;  5H6R A;  2ZIO A;  3OFN G;  2R70 A;  1QBZ A;  3N2G B;  1FXK C;  1AP6 A;  2JGD A;  4B3T O;  4NTX A;  2Y4U A;  1YJN V;  2BTQ A;  4MVM A;  3WB2 A;  1K92 A;  4BW9 A;  5BXZ A;  1PNM A;  2XAF A;  1I94 O;  4DV2 O;  4UXN A;  5LMN B;  1IUR A;  4GUN A;  1VIB A;  2Q5Z A;  2RNB A;  2HFE C;  3D3I A;  4AQY B; 
#chains in the Genus database with same CATH homology
 2Q5Z A;  2Q73 A;  1Y6X A;  2Q4P A;  3CRC A;  2OIE A;  5IE9 A;  2GTA A;  2P06 A;  2YXH A;  2A3Q A;  4QGP A;  2Q9L A;  3C90 A;  2A7W A;  3CRA A;  1YXB A;  1VMG A;  1YVW A;  2OIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...