2Q5ZA

Crystal structure of imazg from vibrio dat 722: ntag-imazg (p43212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'HMKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTRELKEVLNKVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q5zA00
3CRCA 4QGPA 2Q4PA 1YVWA 2OIGA 2YXHA 1Y6XA 2P06A 1YXBA 1VMGA 3C90A 5IE9A 2A3QA 2Q73A 2Q9LA 2GTAA 3CRAA 2Q5ZA 2OIEA 2A7WA
chains in the Genus database with same CATH superfamily
4FPPA 4KP4A 2Q69A 1LUVA 1WPBA 4D7SA 2IU3A 3HKDA 3E2EA 4LF8O 5IWAB 3SJQC 1SQGA 1B04A 4PHZA 1H2GA 2JK5C 4F6RB 4JI4B 1XNQO 3HKEA 5BY1A 2EIKC 4UUJC 4ICGA 2CGOA 1Y74A 2JGDA 1LR1A 2ZIOA 4QGPA 5B1AC 2AZ0A 3ZEDA 1AB3A 3K5MA 4NXMB 3P3NA 2JDIG 2UXBB 1SA0A 3JAWA 3B4SA 5IYZB 1YHQV 3OE7G 1Y66A 4KL1A 5IJ9B 2C2AA 1Z2GA 1YITV 3CC2V 1Q7YW 1GN2A 2WLNA 2LGWA 3OMAB 1YDXA 3CRCA 3E22A 4DUZB 1VF6C 3X2QC 3U0ZA 3Q4HA 4CH3A 4YIOA 5B1OA 5KX5A 1TVKA 2A3QA 4AHCA 4JGSA 2FB5A 1SQQH 3L74H 5B66Z 1NH2D 1MOFA 4DR6B 2P4VA 4YY3B 4EFBA 1ZL8B 1RM1C 2PTMA 3P3PA 2P6JA 3RBZA 5BZBA 1GH6A 3U10A 4WFBV 3FB7C 1NTKH 4UVAA 4TQDA 4GX0A 2WLIA 1BL8A 1AI7A 1XHXA 3A0RA 1F4MA 1WP7A 3W7UA 3CS5A 4B7KA 1T5EA 3WG7B 1GK9A 3J80N 4H44B 2VS0A 3EFFK 1Q90D 4JI0B 4JYAO 3RGBA 4WFEA 4B3TO 1E79G 5DN6G 3JCUZ 1YJNV 4K8ZA 4UCUA 2A79B 2DQ0A 4JI2B 5L3BA 2BOBC 4DR1B 2ZE5A 4JTCB 5KUKA 3MAQA 4L87A 4ASUG 5HFMA 3R66A 4KHPB 3IC9A 1RFYA 3ZX6A 2RMKB 2PF4E 3LNMB 1XNRB 1JX9A 4LF7B 4FLXA 2ILMA 2QWNB 1EN5A 1Y4MA 5GONB 2WAMA 4PDLA 2EIMC 5GTHZ 4ZI7B 2WSSG 2ZCEA 3PN1A 1L1FA 2N74A 4X20B 3JARB 1KKCA 2UUAO 3K08A 2ATKC 4PDRA 5L3CA 4KUMA 5B5EZ 2M7WA 4E2LA 4N21A 5JJEB 3CPWU 4W4LA 4X1IA 4X1KA 2WLMA 1BHAA 1S0VA 1QR9A 3TJTA 3FYEB 4BW5A 1R3KC 4JI8B 2Y48A 2UXCB 1QLEB 2AGAA 4BIUA 1Y76A 2V4DA 1NU1H 4DR5B 3WB2A 4LH6A 1WA8A 2M6YA 5JQGA 3E8GA 3ZRXA 3K06A 4DK1A 1NR7A 1R3JC 5IE9A 1R6TA 3G67A 3QO8A 4DR4B 2IJHA 1MZFA 1NR1A 5L3FA 5ITZB 4DR2O 1HNZB 1OV9A 1JQ0A 2UUBB 3SGIA 2QJ1A 1BSMA 3CRRA 2UXXA 1K5QA 4P30A 3M7MX 1SQPH 3DXRB 1NTMH 4J7KA 5BR8O 2HR3A 1CXZB 1KP2A 4X88A 5CA3A 2OCCB 2DYRC 1H8HG 1MSWD 1ENVA 3GWOA 4QPKA 5IJ0A 1FS0G 4X66B 2OYQA 4I9QA 1FYJA 1IXBA 4X62O 4R6ZA 5LMUB 1JJ2U 1TUEB 3G80A 1UPGA 5TISZ 2XT9A 3RYHA 5L3EA 1N33O 3CMEV 1ROPA 4TOIA 1SF9A 1I94O 2QSAA 4CZZA 1LNQA 2LW7A 4UCRA 5CMUA 1PL4A 2V1DA 4I0XA 3RVYA 2HJDA 3N27A 1OCZB 4I50A 4JI5O 2B1GA 2YSUB 4WBNB 4EEQA 2NN4A 3W7XA 2VQEO 2BE3A 1SQFA 1R6KA 3ETQA 1NQTA 2WWWA 4GYCB 2O57A 3H1JH 2JGUA 2Q7EA 4MVUA 5LP6B 3A0BZ 1NKDA 3OTOO 5KHKA 3H1IH 1AJQA 4P9PA 1Q81W 1RSOA 4WFHA 4DR3O 2OT5A 3BA9A 3UM7A 1GMGA 1FPOA 2UXNA 4LFCB 1V55C 1UFIA 4MTOA 3CCVV 4O4IB 3CB2A 2LJ2A 1HNWO 2WLLA 2BSKB 3BHPA 1VQKV 2HP8A 5EZYA 4ABMA 4BR6A 3JASA 5C8YB 1WLEA 4RQFA 4DV0B 3F5WC 1M56B 4DV4B 2YXHA 3KZIZ 3K04A 3ZIAG 1XNQB 4IIJB 1WN7A 3CMAV 2D2CB 1WPXA 3OEEG 1H2SB 3LDCA 1H2KA 5KMGA 1SESA 4PDVA 4P2ZA 3TXSA 4QE9A 3WG7C 2JRIA 1GM7A 5H9CA 2F66C 5FPOA 2RNBA 2Q4PA 2A0LA 4LF9B 1Q6HA 4B3MO 2JEXA 3B8NA 1JFFA 2HJFC 1KYOF 1ZUQA 4I55B 3CX5F 4TV8A 1N36B 4O4JA 5JH7B 1XHZA 1NT2B 2GSMB 1H2LA 5GW7A 3AG1C 3DSQA 4Q20A 1YJ9V 3OT7A 4MTGA 2P7TC 3ABLB 1TUBA 4JI1O 2MK3A 4O2BA 5LA6B 4MW8A 4IYHA 4B3RO 1M57B 4XBFA 5F2VO 2LFRA 1K33A 3F5TA 4JI3B 2QM7A 4U7OA 5CB4B 3IGAC 3FD9A 2K1EA 4U7NA 1P7BA 1IBKB 2ADQB 4MVOA 2KG7A 1QVGU 4GX2A 2Q7HA 1JJOA 2DYSB 2P06A 4Q6GA 2ARHA 2Y0IA 2P22C 2ZE8A 1W0KG 2W6IG 1IXMA 3SYAA 1GAXA 1NBMG 2GUZB 1QLEC 4AI8A 3JATB 2YEVA 1N0JA 2ZR2A 3H9VA 4LWSB 5IY5C 2Y0PA 3T1YO 3JD4A 4QE7A 3JALB 3FAVB 5DECA 2WLHA 2WA4A 2VQFO 3K79A 4TUYA 1X4TA 2HVKC 3HB3B 4JZGA 3IFXA 3HKBA 5KHJA 5EYPB 2E5LO 3IJ4A 1AILA 4MVRA 4P9OA 1VIBA 1EFRG 4K8XA 5BMVB 3LDEA 3M99B 4DW0A 1JOYA 1Q6IA 3QF7A 5EBMC 3QO5A 2GV9A 1COWG 3H1KH 1IBMB 2H3OA 4RO2A 1FAFA 3B09A 2QDOA 3AK1A 4LH7A 3E83A 3E8BA 4JF3A 1Q5OA 1D2DA 1GN6A 5CA0B 1N34O 2ZIMA 2OCCC 1Q6UA 2CTRA 1N8RW 1NTZH 3CRQA 1FFXA 4K0KO 4MS2A 1R3LC 5L3DA 1H38A 3S3WA 1MG1A 2YS8A 4C7UA 2ZR3A 3F7VC 1TAEA 1OZ0A 4B3SO 1W0JG 4GKJB 2CTWA 4OGQB 2Y69B 4DRXA 2XAJA 1YI2V 4DV7O 2IJJA 3K0GA 4DV1O 1K3EA 1OCZC 2YIBD 4YHHB 2EIJB 5CA1B 4PA4A 4FZ1A 4XDJA 3FB8C 3AG3B 3N2KB 3K59A 5DEDA 2NLJC 4LNUB 1KC8W 5LP6C 4G2KA 3J7AU 3WU2Z 1B3QA 1K5SA 4CH5A 3IC7A 4EB6B 4E4EA 2BTQA 2UXDO 4IHJA 4GCZA 1AR4A 3HKCB 2CTQA 3HPLC 1W59A 5L3GA 4KXRA 1XBLA 2EJRA 4PJ0Z 2YXYA 1RPOA 3JAKB 1YTFB 3CSXA 4UCSA 1FFTB 4X62B 1SQBH 4J80A 2QA4V 2Q0OC 4K35A 4RQEA 1M93A 5LHIA 1M56C 3CJHB 3OFNG 3GVMA 5IYZA 1DK1A 1S5JA 5BXZA 4NVPA 2YI8A 3RN4A 4ZOLB 3K03A 1F23A 2UUCB 4GLXA 1WAZA 3NXSA 2R70A 2W0FC 2EJ7A 3ZHTA 2AW9A 1FJGO 3PJSK 5KAIZ 3K3WA 4G27B 1VF7A 3OTOB 5J2TB 2IU0A 5H2FZ 2Z3YA 3I55V 1BS3A 4FLVA 1HP8A 3WB0A 4D6TH 3ICXA 5B1BB 3L70H 3CCLV 5J9PC 4NXNB 2L35A 3HKDB 1XUQA 1Q82W 5EIBD 3CXHF 1OHHG 3DC6A 5LXTA 3E89A 3ABLC 3OR6C 3CP1A 2Q73A 3K5NA 3HKEB 4B7EA 1PPJH 2KKWA 4I4TA 5LGNA 1HNXO 1M57C 2EINB 2JEUA 4XDLA 1G4YB 3H1HH 1Y74B 2JGDB 1M5IA 1LUWA 5J2UA 3VQWA 4FK5C 1ZSPA 1VQ4V 3UT5A 2RQ6A 1SA0B 1FXKA 1B6QA 1XMOB 2P4KA 3JAWB 4OX9O 2DYSC 5EIBC 5GTIZ 1BQ0A 4DV3O 4JZ2A 3BVOA 3S3XA 1HWYA 1Z5VA 4DUYB 2GBOA 2ZM6O 1ZAUA 3E22B 3HR0A 4GKKO 1GRJA 1YCIA 1QU7A 1J5EO 3OR7C 1AJPA 3B8MA 3Q4HB 4D7TA 3RW0A 2DE0X 2XNDG 1Y67A 3A2FA 4JPRA 5KX5B 1TVKB 4HNAB 1K92A 3VBBA 1KD1W 4JI7O 2VWKA 4I5SA 4H13B 1FKAO 3ABMB 2PYLA 1MABG 2ZDIC 1BZKA 2E76B 2ZNIA 2CH7A 1YEWA 4DV5O 4MSWC 1ORQC 1EN4A 1QNMA 1QR8A 2YC0A 2FTKA 4B3RB 2WLIB 1IURA 3ZHQA 1R6NA 2LP7A 5K1XA 1KU9A 1I7FA 2ZD9A 4J7JA 2QWPB 1OCRB 4EFEA 1VF5B 4EKWA 5LOVA 4FLTA 2BCCH 1VQ8V 3AG4B 2ZXWB 4DR7B 4DYLA 3M8AA 5A9GA 4TV9A 2ZKOA 2A06H 1MZEA 3KKYA 2F4VO 2IH3C 4BAYA 3JSNA 1YIJV 3AG2B 3STZC 4U3JA 4GZRB 1XI1A 1BE3H 1RP3B 5LMNO 3T1HB 4CS4A 1Q8IA 2HHHO 2UU9O 1HDJA 3L75H 2LFSA 4GX1A 4FLWA 1XL4A 1YSCA 3QVNA 3ZHSA 3OUSA 4MW3A 3RYFA 3CCQV 3NR7A 5LYJA 1ZLZA 3OM3B 1N32B 2VQFB 1XMQO 1EN6A 3A0HZ 1YF2A 4AQYO 2Y69C 1JVMA 1V54B 5KHGA 3C90A 4HYOA 3BFRA 1OCOC 2JS3A 2JS5A 4IL6Z 5H6QA 2EIJC 4LFAO 4PA9A 1EM1A 2ETNA 3CRAA 1YTFD 1PNMA 1PV0A 4X1YA 1DF5A 1GN3A 3ZHUA 3AG3C 4UVCA 1OCCB 2EILB 2H8PC 4LF5O 4X1IB 4X1KB 1QBZA 4NTYA 1YXBA 5FNVA 2ZE6A 2QKSA 4X9QA 2F93B 3ZMSA 4O4HA 3EXAA 4X64O 1YJWV 5EC2C 1FXVA 1JMKC 4Z1MG 2EZOA 1UJWB 1Y76B 4RUFA 4ZHQA 5JCOA 4RAIA 2FYUH 2YIAA 3K0DA 3D8CA 1G6UA 4BIOA 1WA8B 5JQGB 4FFKA 1IBLB 3OMNB 2VRZA 3AK3A 2PI5A 4X65B 3ML0A 2X6AA 3JD2A 3SPJA 2FL4A 3UO3A 4O2AA 3ABUA 1K34A 2QGNA 2ADPA 3MHSC 3SYCA 3JCZA 1FXHA 4FMTA 3O65A 1Q86W 1KECA 1K73W 1VQ5V 3ZHRA 4DV2B 5IWAO 3CRMA 3GB7C 5FLXN 1U97A 1PNLA 1WB7A 4JI6B 2UXDB 1EBOA 4X89A 2EULA 1I5YA 5B1BC 3RYHB 2KSDA 4NTXA 1I5XA 1WB8A 4QJFB 2QM4A 3BPZA 3OUFA 3RFRA 4NXMO 4LF6B 3LUTB 2UXBO 4OPHA 5EK0A 3ZCCA 3RYCA 1H8EG 3DC5A 3BAAA 4I0XB 2R72A 1QLNA 2EINC 4NKGB 2RCVA 2PI4A 4LF8B 2KQXA 3VQVA 2ZE7A 2HVJC 4DUZO 2ITDC 3ZRWA 5KHIA 4HZ3A 3TETA 2R9AA 3ZMUA 4YJ3A 2XTAA 1MMMA 3C3TA 4JAAA 1QHTA 1FJGB 2HFEC 4DR6O 3KG2A 1VF6A 4YY3O 3TK1A 5JVDA 3ZMZA 1KP3A 5LGTA 3SYQA 2EIKB 4JYCA 1BT8A 3D3IA 4FVMA 4WFAV 2Q9LA 2WLLB 4RUEA 4MVQA 3JAMN 5CB4A 5EZYB 5KAFZ 1CEZA 1U96A 3JASB 2RJZA 1G1XB 2F23A 2OIGA 4JI0O 3WFVA 3OW2U 2X6BA 4UV8A 2ZQMA 2F1MA 1S5LZ 3RWRD 1XOUA 4JYBA 4JI2O 5KMGB 4DR1O 2AHYA 1D5NA 1OCRC 2QWQB 4KHPO 3SPHA 4H0LB 3ZMVA 4UCOA 5LHGA 1O9HA 1VQNV 1XNRO 3QG5A 4LF7O 3AG4C 3CCEV 2ZXWC 3L9DA 1E1QG 3ZRVA 2X0LA 3FB5C 4LP8A 5A2QN 1JFFB 3AG2C 2ZDIA 4JYYA 1MA1A 3IAYA 4TV8B 1I0HA 4JYAB 4B3TB 1SZXA 4O4JB 3K58A 1SS3A 1L8DA 1M9NA 3FX7A 2GHYA 3N2GA 1MNGA 1TUBB 3OAAG 2Q7GA 3CHXA 2CTPA 3I56V 5LGUA 4R8CA 3MHHC 2OWOA 1VQ9V 5D5PA 1V54C 3W7WA 4DV5B 4JI8O 3OGIB 1AP6A 5CA0A 3RYIA 2ITCC 4YJ2A 2UXCO 2YI9A 1Q3EA 3SPIA 2P67A 4DR5O 4IT5A 2KG7B 2EILC 2HEPA 2UUAB 1G8MA 4UB8Z 1WJZA 4MT8A 4PV1B 2OCHA 2XASA 3T4ZA 2GTAA 4UXNA 4FFBA 3K9SA 2PGGA 4UB6Z 4DR4O 5LBQA 2L6LA 2YEVB 3K57A 1HNZO 1XL6A 4KFMA 2UUBO 2IH1C 1JR9A 3ASNB 2QWOB 3L71H 2GTSA 5KA5A 4TUYB 3OGCC 1URFA 3HKBB 3CCJV 2XOKG 4PI0A 1XMQB 2JJ2G 4K3AA 2BTOA 2LGQA 2N05A 1JA8A 4X66O 4O4LA 2WPDG 1NVPB 1IZ3A 5LMUO 3LDDA 5EBWC 4DR2B 3KCYA 4J11A 4MVMA 1AI5A 1S3JA 1M90W 2OTJV 1HR0O 3K9AA 4LF5B 2CAZC 1Z5WA 4JAUA 1NZ6A 3JD1A 1XQ8A 1YVWA 5BR8B 3CCUV 1FFXB 5EBLC 2AXTZ 4JV5O 1FD9A 4JAVA 2W6JG 4J42A 4F6RA 2HKOA 2R9IA 2QE7G 4ZOLA 2CK3G 2JJ1G 2YIDA 1QQCA 3VOUA 2R9RB 3GWKC 3CD6V 3STLC 4U3FH 1CP9A 3CC4V 1N33B 4MVZA 4DRXB 4H37A 1I94B 3AG7A 4LFCO 1SERA 3H01A 1BCCH 5IJ9A 1HW7A 4FM2A 1V9PA 1M1KW 3APOA 1F4NA 2DOSA 1KKDA 1SETA 2DWEC 5KLVH 3G6BA 4JI5B 3T2MA 4LF4O 2VQEB 4TWKA 2BTQB 4DV0O 4IHJB 2Q67A 1VQ6V 3CYOA 4DV4O 4LR3A 4PA7A 2MW2B 3K5OA 2Y4UA 2HG5C 3G6EV 4R50A 4DR3B 2DQ3A 1ZL8A 2DN9A 3F7YC 4NTWA 5FPRA 3OD4A 1AP5A 1NJIW 4DK0A 2AHZA 1QCEA 1VQOV 3QNEA 1L0LH 1EZJA 5B1NA 5JJJB 1HNWB 1L0NH 4LF9O 1SC5B 1K4DC 3ZS8C 3W7SA 2QKCA 1WNSA 2FMLA 3DGEA 3L73H 3E8FA 3UCSC 1N36O 1V55B 3ZBHA 1VQLV 1K97A 1SQXH 4JTDB 4ZBMA 4J7ZA 2LQTA 2P90A 1VMGA 1ZTEA 4HNAA 4JASA 1GO3F 5JJNB 3CCSV 1H2MA 2Q8VA 5B3SB 1VQPV 4PD4F 3MD0A 2LW1A 5GONA 4JI3O 3BEHA 3FYIB 4ZI7A 4B3MB 3ABKB 2NR5A 3C3SA 2OTLV 3OMIB 4X20A 3SJAC 3JARA 1GM9A 5LXTB 1DF4A 2Z0AA 1IBKO 3JYCA 1KUQA 4I4TB 5CN0A 4J41A 1OJHA 3DTUB 2A9HA 3ZRSA 1P7GA 1JCHA 2B9ZA 5HFLA 3E8HA 5J2UB 1K9MW 3ZN0A 4JI1B 1VQ7V 2Q0AA 2XHBA 3EVKA 1Y6XA 3UT5B 1FXKB 5LHHA 4YXWG 3P32A 4PELA 3D36C 2YUAA 3AG1B 2PY5A 1P84F 2QWRB 4UV9A 4DO2A 3I5DA 5K1PA 4I7ZB 3MDSA 3U11A 4WF9V 1VQMV 1SKVA 2IJIA 3L72H 1NVPD 2EZPA 3ASNC 2WLJA 4CS3A 3ZHVA 3B77A 1IBMO 5JWPA 2YDEA 5ITZA 4DW1A 5KHHA 3T1YB 2CH7B 1N4CA 2IJKA 4CC6A 3B40A 1NI8A 1S77D 1DTOA 3SDLA 3JD0A 1J95A 1SZTA 1GM8A 4MTFA 3DXRA 1P49A 5LOVB 2E5LB 3FKSG 5IY5B 2XAGA 1PKXA 2JIZG 4DV6O 5CBGA 4TV9B 1P4RA 2ZT9B 5D5QA 2F43G 4LBEC 5E1AC 4GKJO 2QTSA 4U3JB 3UQ8A 4XDKA 4TSFG 3ZN1A 3SJBC 1N34B 4YHHO 4LFBO 2WA3A 3H1LH 4UFZA 3RYFB 5LYJB 1YZBA 3SPGA 3JSLA 3ABTA 4K0KB 4FJCC 1IX9A 3CCRV 3T4DA 2HLDG 2H94A 3AK2A 3G4SV 2QR4A 4OXSA 5IT9N 4WBNA 3LSSA 1AJNA 3AEIA 4ZKIA 1KBHA 4HBNA 4PA6A 1RPRA 2P5OA 4B3SB 3J81N 4FLYA 2YICA 4X1YB 2ODMA 1PD3A 5LP6A 3ETGA 1XDCA 2B1IA 4PI2A 2Z5UA 3ETEA 4DV7B 4MVSA 4DV1B 1JPXA 5IYCO 2EX3A 1NS1A 3BA8A 2GDSA 4NB5A 5FNVB 1HR0B 2YIBA 1GN4A 3B2EE 2CDYA 4Z2WA 1QVFU 4O4HB 1IVSA 4O4IA 2XAHA 3OTFA 1S5HC 1XILA 4FIPC 1K4CC 2BSKA 4ZHQB 1W2BU 4J9YB 4J10A 3ASOB 4IGGA 1A32A 5IJ0B 4JI4O 4MTXA 2CGNA 2E74B 5C8YA 4JV5B 4AILC 2UUCO 4J9ZB 3KCXA 1XREA 1S72V 3E35A 4IIJA 2PUSA 5H6RA 1AROP 2X6CA 2PYJA 4O2AB 4UVBA 2Q5ZA 1R1BA 4ZIBA 3D3QA 4BWAA 3BCCH 3O9OA 2QTOA 1D5AA 1S76D 2BOCC 3FB6C 4I50B 4OPAA 3VQYA 2QEXV 1BHBA 2XUMA 4NXNO 2JVDA 1F51A 4R7CA 2E3CA 1IDSA 4I55A 3P30A 2EBOA 5KA6A 3LSUA 5JH7A 4LF4B 1VEWA 1RSOB 3W7TA 5B3SC 1R73A 4CS2A 3K5LA 2DW4A 3T1CA 2LO1A 1K8AW 3JD3A 1AI6A 3ABKC 1TA8A 3BY6A 5LA6A 5AG2A 1KQSU 4WCEV 2QM8A 2YXLA 3SPCA 1XEQA 3RYCB 4IYIA 1XMOO 4A5UB 2E75B 3APQA 5B1AB 3LSQA 1PNKA 3A8TA 3ABMC 4DUYO 4GX5A 4WFGA 5H5NA 1H2NA 4BW9A 1TGOA 3ZRWB 2CE4A 2WLKA 4NYKA 1HNXB 1O9GA 2Q68A 4PDMA 1FXKC 2VWJA 4YJ3B 3CXCU 4F6EA 1VP7A 4TT3G 3FFQA 1R3IC 1AR5A 4DXWA 2GUZA 3JATA 4QNHB 3X2QB 4LWSA 5E79Z 1AI4A 1KMIZ 1Q43A 4I9WA 5JVDB 2D3OW 2DMXA 4OX9B 5DM6V 3JALA 3FAVA 4DV3B 1E1RG 1VARA 1ZX3A 4TQFA 2ZM6B 1RM1B 3BABA 4CH6A 1BMFG 4GKKB 3CEIA 5IDJA 1KB9F 5EYPA 1J5EB 2FKXA 4DR7O 5BMVA 2X7RB 4G28B 4NR1A 1ZWIC 3D36A 1CPYA 3TGUH 4JI7B 1AVMA 4O2BB 2IW5A 3TCUA 4UCVA 4YIPA 4GT1A 1NH2B 2B5UA 1B06A 4X8AA 3T1HO 2CUGA 3ZJZA 3SYOA 1PL0A 4WFFA 1GKFA 2A7WA 3TXQA 5CBFA 3CWBH 1SRYA 5LL6Y 3RVZA 4GUNA 4B08A 1OCCC 2G38A 4CH4A 1N32O 2N04A 2NNUA 1K7DA 4H33A 1F7YA 4JTAB 1DLBA 3UKMA 2EIMB 1THZA 1BQZA 1X59A 2F4VB 1I08A 3THOA 3SJCC 4W4KA 4LCUC 4FM1A 3N2GB 2RDCA 4RWUA 2RN9A 1SQVH 5LMNB 2F95B 4L8JA 3OEHG 2Y4TA 2HHHB 2UU9B 2QKAA 4QIWF 2W0XA 2AZ2A 5CA1A 4QPJA 2XAQA 4N23A 3CCMV 1M4UA 3N2KA 5IYDO 4YJ2B 3RYIB 4LNUA 4AQYB 3EHBB 2IM9A 3CE2A 4EB6A 2Q6AA 4FM0A 2K9PA 4LFAB 3HKCA 3BRCA 3G71V 1IBLO 3QTCA 4DV6B 4FFBB 5KUMA 1MSDA 3JAKA 4X65O 4FZ0A 3R65A 1US6A 3SYPA 5JCOC 3ASOC 2XAFA 4HAMA 1EZVH 3E86A 3RT3C 5IYBO 1OCOB 3CC7V 2DJVA 5C93A 3WB1A 1BGYH 4X64B 2PZSA 4LFBB 3CJHA 1GTOA 3ETDA 3LNNA 4UCTA 4CC5A 2V7QG 4DV2O 4Z1VA 4F4LA 5CBHA 2DWDC 5EC1C 4FLZA 3VQXA 1WP8A 1N0NA 3UO2A 2IBZH 4O4LB 4JI6O 4BIZA 5FL7G 4CBCA 2KB1A 4FLUA 2DYRB 1DGSA 4LC1A 5J2TA 2ZINA 2ZNJA 3ZMTA 1PM9A 1AR1B 3SR2C 3QO7A 4LF6O 4PA3A 2OIEA 1PP9H
chains in the Genus database with same CATH topology
3CRCA 4QGPA 2Q4PA 1YVWA 2OIGA 2YXHA 1Y6XA 2P06A 1YXBA 1VMGA 3C90A 5IE9A 2A3QA 2Q73A 2Q9LA 2GTAA 3CRAA 2Q5ZA 2OIEA 2A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRC A;  4QGP A;  2Q4P A;  1YVW A;  2OIG A;  2YXH A;  1Y6X A;  2P06 A;  1YXB A;  1VMG A;  3C90 A;  5IE9 A;  2A3Q A;  2Q73 A;  2Q9L A;  2GTA A;  3CRA A;  2Q5Z A;  2OIE A;  2A7W A; 
#chains in the Genus database with same CATH topology
 4FPP A;  4KP4 A;  2Q69 A;  1LUV A;  1WPB A;  4D7S A;  2IU3 A;  3HKD A;  3E2E A;  4LF8 O;  5IWA B;  3SJQ C;  1SQG A;  1B04 A;  4PHZ A;  1H2G A;  2JK5 C;  4F6R B;  4JI4 B;  1XNQ O;  3HKE A;  5BY1 A;  2EIK C;  4UUJ C;  4ICG A;  2CGO A;  1Y74 A;  2JGD A;  1LR1 A;  2ZIO A;  4QGP A;  5B1A C;  2AZ0 A;  3ZED A;  1AB3 A;  3K5M A;  4NXM B;  3P3N A;  2JDI G;  2UXB B;  1SA0 A;  3JAW A;  3B4S A;  5IYZ B;  1YHQ V;  3OE7 G;  1Y66 A;  4KL1 A;  5IJ9 B;  2C2A A;  1Z2G A;  1YIT V;  3CC2 V;  1Q7Y W;  1GN2 A;  2WLN A;  2LGW A;  3OMA B;  1YDX A;  3CRC A;  3E22 A;  4DUZ B;  1VF6 C;  3X2Q C;  3U0Z A;  3Q4H A;  4CH3 A;  4YIO A;  5B1O A;  5KX5 A;  1TVK A;  2A3Q A;  4AHC A;  4JGS A;  2FB5 A;  1SQQ H;  3L74 H;  5B66 Z;  1NH2 D;  1MOF A;  4DR6 B;  2P4V A;  4YY3 B;  4EFB A;  1ZL8 B;  1RM1 C;  2PTM A;  3P3P A;  2P6J A;  3RBZ A;  5BZB A;  1GH6 A;  3U10 A;  4WFB V;  3FB7 C;  1NTK H;  4UVA A;  4TQD A;  4GX0 A;  2WLI A;  1BL8 A;  1AI7 A;  1XHX A;  3A0R A;  1F4M A;  1WP7 A;  3W7U A;  3CS5 A;  4B7K A;  1T5E A;  3WG7 B;  1GK9 A;  3J80 N;  4H44 B;  2VS0 A;  3EFF K;  1Q90 D;  4JI0 B;  4JYA O;  3RGB A;  4WFE A;  4B3T O;  1E79 G;  5DN6 G;  3JCU Z;  1YJN V;  4K8Z A;  4UCU A;  2A79 B;  2DQ0 A;  4JI2 B;  5L3B A;  2BOB C;  4DR1 B;  2ZE5 A;  4JTC B;  5KUK A;  3MAQ A;  4L87 A;  4ASU G;  5HFM A;  3R66 A;  4KHP B;  3IC9 A;  1RFY A;  3ZX6 A;  2RMK B;  2PF4 E;  3LNM B;  1XNR B;  1JX9 A;  4LF7 B;  4FLX A;  2ILM A;  2QWN B;  1EN5 A;  1Y4M A;  5GON B;  2WAM A;  4PDL A;  2EIM C;  5GTH Z;  4ZI7 B;  2WSS G;  2ZCE A;  3PN1 A;  1L1F A;  2N74 A;  4X20 B;  3JAR B;  1KKC A;  2UUA O;  3K08 A;  2ATK C;  4PDR A;  5L3C A;  4KUM A;  5B5E Z;  2M7W A;  4E2L A;  4N21 A;  5JJE B;  3CPW U;  4W4L A;  4X1I A;  4X1K A;  2WLM A;  1BHA A;  1S0V A;  1QR9 A;  3TJT A;  3FYE B;  4BW5 A;  1R3K C;  4JI8 B;  2Y48 A;  2UXC B;  1QLE B;  2AGA A;  4BIU A;  1Y76 A;  2V4D A;  1NU1 H;  4DR5 B;  3WB2 A;  4LH6 A;  1WA8 A;  2M6Y A;  5JQG A;  3E8G A;  3ZRX A;  3K06 A;  4DK1 A;  1NR7 A;  1R3J C;  5IE9 A;  1R6T A;  3G67 A;  3QO8 A;  4DR4 B;  2IJH A;  1MZF A;  1NR1 A;  5L3F A;  5ITZ B;  4DR2 O;  1HNZ B;  1OV9 A;  1JQ0 A;  2UUB B;  3SGI A;  2QJ1 A;  1BSM A;  3CRR A;  2UXX A;  1K5Q A;  4P30 A;  3M7M X;  1SQP H;  3DXR B;  1NTM H;  4J7K A;  5BR8 O;  2HR3 A;  1CXZ B;  1KP2 A;  4X88 A;  5CA3 A;  2OCC B;  2DYR C;  1H8H G;  1MSW D;  1ENV A;  3GWO A;  4QPK A;  5IJ0 A;  1FS0 G;  4X66 B;  2OYQ A;  4I9Q A;  1FYJ A;  1IXB A;  4X62 O;  4R6Z A;  5LMU B;  1JJ2 U;  1TUE B;  3G80 A;  1UPG A;  5TIS Z;  2XT9 A;  3RYH A;  5L3E A;  1N33 O;  3CME V;  1ROP A;  4TOI A;  1SF9 A;  1I94 O;  2QSA A;  4CZZ A;  1LNQ A;  2LW7 A;  4UCR A;  5CMU A;  1PL4 A;  2V1D A;  4I0X A;  3RVY A;  2HJD A;  3N27 A;  1OCZ B;  4I50 A;  4JI5 O;  2B1G A;  2YSU B;  4WBN B;  4EEQ A;  2NN4 A;  3W7X A;  2VQE O;  2BE3 A;  1SQF A;  1R6K A;  3ETQ A;  1NQT A;  2WWW A;  4GYC B;  2O57 A;  3H1J H;  2JGU A;  2Q7E A;  4MVU A;  5LP6 B;  3A0B Z;  1NKD A;  3OTO O;  5KHK A;  3H1I H;  1AJQ A;  4P9P A;  1Q81 W;  1RSO A;  4WFH A;  4DR3 O;  2OT5 A;  3BA9 A;  3UM7 A;  1GMG A;  1FPO A;  2UXN A;  4LFC B;  1V55 C;  1UFI A;  4MTO A;  3CCV V;  4O4I B;  3CB2 A;  2LJ2 A;  1HNW O;  2WLL A;  2BSK B;  3BHP A;  1VQK V;  2HP8 A;  5EZY A;  4ABM A;  4BR6 A;  3JAS A;  5C8Y B;  1WLE A;  4RQF A;  4DV0 B;  3F5W C;  1M56 B;  4DV4 B;  2YXH A;  3KZI Z;  3K04 A;  3ZIA G;  1XNQ B;  4IIJ B;  1WN7 A;  3CMA V;  2D2C B;  1WPX A;  3OEE G;  1H2S B;  3LDC A;  1H2K A;  5KMG A;  1SES A;  4PDV A;  4P2Z A;  3TXS A;  4QE9 A;  3WG7 C;  2JRI A;  1GM7 A;  5H9C A;  2F66 C;  5FPO A;  2RNB A;  2Q4P A;  2A0L A;  4LF9 B;  1Q6H A;  4B3M O;  2JEX A;  3B8N A;  1JFF A;  2HJF C;  1KYO F;  1ZUQ A;  4I55 B;  3CX5 F;  4TV8 A;  1N36 B;  4O4J A;  5JH7 B;  1XHZ A;  1NT2 B;  2GSM B;  1H2L A;  5GW7 A;  3AG1 C;  3DSQ A;  4Q20 A;  1YJ9 V;  3OT7 A;  4MTG A;  2P7T C;  3ABL B;  1TUB A;  4JI1 O;  2MK3 A;  4O2B A;  5LA6 B;  4MW8 A;  4IYH A;  4B3R O;  1M57 B;  4XBF A;  5F2V O;  2LFR A;  1K33 A;  3F5T A;  4JI3 B;  2QM7 A;  4U7O A;  5CB4 B;  3IGA C;  3FD9 A;  2K1E A;  4U7N A;  1P7B A;  1IBK B;  2ADQ B;  4MVO A;  2KG7 A;  1QVG U;  4GX2 A;  2Q7H A;  1JJO A;  2DYS B;  2P06 A;  4Q6G A;  2ARH A;  2Y0I A;  2P22 C;  2ZE8 A;  1W0K G;  2W6I G;  1IXM A;  3SYA A;  1GAX A;  1NBM G;  2GUZ B;  1QLE C;  4AI8 A;  3JAT B;  2YEV A;  1N0J A;  2ZR2 A;  3H9V A;  4LWS B;  5IY5 C;  2Y0P A;  3T1Y O;  3JD4 A;  4QE7 A;  3JAL B;  3FAV B;  5DEC A;  2WLH A;  2WA4 A;  2VQF O;  3K79 A;  4TUY A;  1X4T A;  2HVK C;  3HB3 B;  4JZG A;  3IFX A;  3HKB A;  5KHJ A;  5EYP B;  2E5L O;  3IJ4 A;  1AIL A;  4MVR A;  4P9O A;  1VIB A;  1EFR G;  4K8X A;  5BMV B;  3LDE A;  3M99 B;  4DW0 A;  1JOY A;  1Q6I A;  3QF7 A;  5EBM C;  3QO5 A;  2GV9 A;  1COW G;  3H1K H;  1IBM B;  2H3O A;  4RO2 A;  1FAF A;  3B09 A;  2QDO A;  3AK1 A;  4LH7 A;  3E83 A;  3E8B A;  4JF3 A;  1Q5O A;  1D2D A;  1GN6 A;  5CA0 B;  1N34 O;  2ZIM A;  2OCC C;  1Q6U A;  2CTR A;  1N8R W;  1NTZ H;  3CRQ A;  1FFX A;  4K0K O;  4MS2 A;  1R3L C;  5L3D A;  1H38 A;  3S3W A;  1MG1 A;  2YS8 A;  4C7U A;  2ZR3 A;  3F7V C;  1TAE A;  1OZ0 A;  4B3S O;  1W0J G;  4GKJ B;  2CTW A;  4OGQ B;  2Y69 B;  4DRX A;  2XAJ A;  1YI2 V;  4DV7 O;  2IJJ A;  3K0G A;  4DV1 O;  1K3E A;  1OCZ C;  2YIB D;  4YHH B;  2EIJ B;  5CA1 B;  4PA4 A;  4FZ1 A;  4XDJ A;  3FB8 C;  3AG3 B;  3N2K B;  3K59 A;  5DED A;  2NLJ C;  4LNU B;  1KC8 W;  5LP6 C;  4G2K A;  3J7A U;  3WU2 Z;  1B3Q A;  1K5S A;  4CH5 A;  3IC7 A;  4EB6 B;  4E4E A;  2BTQ A;  2UXD O;  4IHJ A;  4GCZ A;  1AR4 A;  3HKC B;  2CTQ A;  3HPL C;  1W59 A;  5L3G A;  4KXR A;  1XBL A;  2EJR A;  4PJ0 Z;  2YXY A;  1RPO A;  3JAK B;  1YTF B;  3CSX A;  4UCS A;  1FFT B;  4X62 B;  1SQB H;  4J80 A;  2QA4 V;  2Q0O C;  4K35 A;  4RQE A;  1M93 A;  5LHI A;  1M56 C;  3CJH B;  3OFN G;  3GVM A;  5IYZ A;  1DK1 A;  1S5J A;  5BXZ A;  4NVP A;  2YI8 A;  3RN4 A;  4ZOL B;  3K03 A;  1F23 A;  2UUC B;  4GLX A;  1WAZ A;  3NXS A;  2R70 A;  2W0F C;  2EJ7 A;  3ZHT A;  2AW9 A;  1FJG O;  3PJS K;  5KAI Z;  3K3W A;  4G27 B;  1VF7 A;  3OTO B;  5J2T B;  2IU0 A;  5H2F Z;  2Z3Y A;  3I55 V;  1BS3 A;  4FLV A;  1HP8 A;  3WB0 A;  4D6T H;  3ICX A;  5B1B B;  3L70 H;  3CCL V;  5J9P C;  4NXN B;  2L35 A;  3HKD B;  1XUQ A;  1Q82 W;  5EIB D;  3CXH F;  1OHH G;  3DC6 A;  5LXT A;  3E89 A;  3ABL C;  3OR6 C;  3CP1 A;  2Q73 A;  3K5N A;  3HKE B;  4B7E A;  1PPJ H;  2KKW A;  4I4T A;  5LGN A;  1HNX O;  1M57 C;  2EIN B;  2JEU A;  4XDL A;  1G4Y B;  3H1H H;  1Y74 B;  2JGD B;  1M5I A;  1LUW A;  5J2U A;  3VQW A;  4FK5 C;  1ZSP A;  1VQ4 V;  3UT5 A;  2RQ6 A;  1SA0 B;  1FXK A;  1B6Q A;  1XMO B;  2P4K A;  3JAW B;  4OX9 O;  2DYS C;  5EIB C;  5GTI Z;  1BQ0 A;  4DV3 O;  4JZ2 A;  3BVO A;  3S3X A;  1HWY A;  1Z5V A;  4DUY B;  2GBO A;  2ZM6 O;  1ZAU A;  3E22 B;  3HR0 A;  4GKK O;  1GRJ A;  1YCI A;  1QU7 A;  1J5E O;  3OR7 C;  1AJP A;  3B8M A;  3Q4H B;  4D7T A;  3RW0 A;  2DE0 X;  2XND G;  1Y67 A;  3A2F A;  4JPR A;  5KX5 B;  1TVK B;  4HNA B;  1K92 A;  3VBB A;  1KD1 W;  4JI7 O;  2VWK A;  4I5S A;  4H13 B;  1FKA O;  3ABM B;  2PYL A;  1MAB G;  2ZDI C;  1BZK A;  2E76 B;  2ZNI A;  2CH7 A;  1YEW A;  4DV5 O;  4MSW C;  1ORQ C;  1EN4 A;  1QNM A;  1QR8 A;  2YC0 A;  2FTK A;  4B3R B;  2WLI B;  1IUR A;  3ZHQ A;  1R6N A;  2LP7 A;  5K1X A;  1KU9 A;  1I7F A;  2ZD9 A;  4J7J A;  2QWP B;  1OCR B;  4EFE A;  1VF5 B;  4EKW A;  5LOV A;  4FLT A;  2BCC H;  1VQ8 V;  3AG4 B;  2ZXW B;  4DR7 B;  4DYL A;  3M8A A;  5A9G A;  4TV9 A;  2ZKO A;  2A06 H;  1MZE A;  3KKY A;  2F4V O;  2IH3 C;  4BAY A;  3JSN A;  1YIJ V;  3AG2 B;  3STZ C;  4U3J A;  4GZR B;  1XI1 A;  1BE3 H;  1RP3 B;  5LMN O;  3T1H B;  4CS4 A;  1Q8I A;  2HHH O;  2UU9 O;  1HDJ A;  3L75 H;  2LFS A;  4GX1 A;  4FLW A;  1XL4 A;  1YSC A;  3QVN A;  3ZHS A;  3OUS A;  4MW3 A;  3RYF A;  3CCQ V;  3NR7 A;  5LYJ A;  1ZLZ A;  3OM3 B;  1N32 B;  2VQF B;  1XMQ O;  1EN6 A;  3A0H Z;  1YF2 A;  4AQY O;  2Y69 C;  1JVM A;  1V54 B;  5KHG A;  3C90 A;  4HYO A;  3BFR A;  1OCO C;  2JS3 A;  2JS5 A;  4IL6 Z;  5H6Q A;  2EIJ C;  4LFA O;  4PA9 A;  1EM1 A;  2ETN A;  3CRA A;  1YTF D;  1PNM A;  1PV0 A;  4X1Y A;  1DF5 A;  1GN3 A;  3ZHU A;  3AG3 C;  4UVC A;  1OCC B;  2EIL B;  2H8P C;  4LF5 O;  4X1I B;  4X1K B;  1QBZ A;  4NTY A;  1YXB A;  5FNV A;  2ZE6 A;  2QKS A;  4X9Q A;  2F93 B;  3ZMS A;  4O4H A;  3EXA A;  4X64 O;  1YJW V;  5EC2 C;  1FXV A;  1JMK C;  4Z1M G;  2EZO A;  1UJW B;  1Y76 B;  4RUF A;  4ZHQ A;  5JCO A;  4RAI A;  2FYU H;  2YIA A;  3K0D A;  3D8C A;  1G6U A;  4BIO A;  1WA8 B;  5JQG B;  4FFK A;  1IBL B;  3OMN B;  2VRZ A;  3AK3 A;  2PI5 A;  4X65 B;  3ML0 A;  2X6A A;  3JD2 A;  3SPJ A;  2FL4 A;  3UO3 A;  4O2A A;  3ABU A;  1K34 A;  2QGN A;  2ADP A;  3MHS C;  3SYC A;  3JCZ A;  1FXH A;  4FMT A;  3O65 A;  1Q86 W;  1KEC A;  1K73 W;  1VQ5 V;  3ZHR A;  4DV2 B;  5IWA O;  3CRM A;  3GB7 C;  5FLX N;  1U97 A;  1PNL A;  1WB7 A;  4JI6 B;  2UXD B;  1EBO A;  4X89 A;  2EUL A;  1I5Y A;  5B1B C;  3RYH B;  2KSD A;  4NTX A;  1I5X A;  1WB8 A;  4QJF B;  2QM4 A;  3BPZ A;  3OUF A;  3RFR A;  4NXM O;  4LF6 B;  3LUT B;  2UXB O;  4OPH A;  5EK0 A;  3ZCC A;  3RYC A;  1H8E G;  3DC5 A;  3BAA A;  4I0X B;  2R72 A;  1QLN A;  2EIN C;  4NKG B;  2RCV A;  2PI4 A;  4LF8 B;  2KQX A;  3VQV A;  2ZE7 A;  2HVJ C;  4DUZ O;  2ITD C;  3ZRW A;  5KHI A;  4HZ3 A;  3TET A;  2R9A A;  3ZMU A;  4YJ3 A;  2XTA A;  1MMM A;  3C3T A;  4JAA A;  1QHT A;  1FJG B;  2HFE C;  4DR6 O;  3KG2 A;  1VF6 A;  4YY3 O;  3TK1 A;  5JVD A;  3ZMZ A;  1KP3 A;  5LGT A;  3SYQ A;  2EIK B;  4JYC A;  1BT8 A;  3D3I A;  4FVM A;  4WFA V;  2Q9L A;  2WLL B;  4RUE A;  4MVQ A;  3JAM N;  5CB4 A;  5EZY B;  5KAF Z;  1CEZ A;  1U96 A;  3JAS B;  2RJZ A;  1G1X B;  2F23 A;  2OIG A;  4JI0 O;  3WFV A;  3OW2 U;  2X6B A;  4UV8 A;  2ZQM A;  2F1M A;  1S5L Z;  3RWR D;  1XOU A;  4JYB A;  4JI2 O;  5KMG B;  4DR1 O;  2AHY A;  1D5N A;  1OCR C;  2QWQ B;  4KHP O;  3SPH A;  4H0L B;  3ZMV A;  4UCO A;  5LHG A;  1O9H A;  1VQN V;  1XNR O;  3QG5 A;  4LF7 O;  3AG4 C;  3CCE V;  2ZXW C;  3L9D A;  1E1Q G;  3ZRV A;  2X0L A;  3FB5 C;  4LP8 A;  5A2Q N;  1JFF B;  3AG2 C;  2ZDI A;  4JYY A;  1MA1 A;  3IAY A;  4TV8 B;  1I0H A;  4JYA B;  4B3T B;  1SZX A;  4O4J B;  3K58 A;  1SS3 A;  1L8D A;  1M9N A;  3FX7 A;  2GHY A;  3N2G A;  1MNG A;  1TUB B;  3OAA G;  2Q7G A;  3CHX A;  2CTP A;  3I56 V;  5LGU A;  4R8C A;  3MHH C;  2OWO A;  1VQ9 V;  5D5P A;  1V54 C;  3W7W A;  4DV5 B;  4JI8 O;  3OGI B;  1AP6 A;  5CA0 A;  3RYI A;  2ITC C;  4YJ2 A;  2UXC O;  2YI9 A;  1Q3E A;  3SPI A;  2P67 A;  4DR5 O;  4IT5 A;  2KG7 B;  2EIL C;  2HEP A;  2UUA B;  1G8M A;  4UB8 Z;  1WJZ A;  4MT8 A;  4PV1 B;  2OCH A;  2XAS A;  3T4Z A;  2GTA A;  4UXN A;  4FFB A;  3K9S A;  2PGG A;  4UB6 Z;  4DR4 O;  5LBQ A;  2L6L A;  2YEV B;  3K57 A;  1HNZ O;  1XL6 A;  4KFM A;  2UUB O;  2IH1 C;  1JR9 A;  3ASN B;  2QWO B;  3L71 H;  2GTS A;  5KA5 A;  4TUY B;  3OGC C;  1URF A;  3HKB B;  3CCJ V;  2XOK G;  4PI0 A;  1XMQ B;  2JJ2 G;  4K3A A;  2BTO A;  2LGQ A;  2N05 A;  1JA8 A;  4X66 O;  4O4L A;  2WPD G;  1NVP B;  1IZ3 A;  5LMU O;  3LDD A;  5EBW C;  4DR2 B;  3KCY A;  4J11 A;  4MVM A;  1AI5 A;  1S3J A;  1M90 W;  2OTJ V;  1HR0 O;  3K9A A;  4LF5 B;  2CAZ C;  1Z5W A;  4JAU A;  1NZ6 A;  3JD1 A;  1XQ8 A;  1YVW A;  5BR8 B;  3CCU V;  1FFX B;  5EBL C;  2AXT Z;  4JV5 O;  1FD9 A;  4JAV A;  2W6J G;  4J42 A;  4F6R A;  2HKO A;  2R9I A;  2QE7 G;  4ZOL A;  2CK3 G;  2JJ1 G;  2YID A;  1QQC A;  3VOU A;  2R9R B;  3GWK C;  3CD6 V;  3STL C;  4U3F H;  1CP9 A;  3CC4 V;  1N33 B;  4MVZ A;  4DRX B;  4H37 A;  1I94 B;  3AG7 A;  4LFC O;  1SER A;  3H01 A;  1BCC H;  5IJ9 A;  1HW7 A;  4FM2 A;  1V9P A;  1M1K W;  3APO A;  1F4N A;  2DOS A;  1KKD A;  1SET A;  2DWE C;  5KLV H;  3G6B A;  4JI5 B;  3T2M A;  4LF4 O;  2VQE B;  4TWK A;  2BTQ B;  4DV0 O;  4IHJ B;  2Q67 A;  1VQ6 V;  3CYO A;  4DV4 O;  4LR3 A;  4PA7 A;  2MW2 B;  3K5O A;  2Y4U A;  2HG5 C;  3G6E V;  4R50 A;  4DR3 B;  2DQ3 A;  1ZL8 A;  2DN9 A;  3F7Y C;  4NTW A;  5FPR A;  3OD4 A;  1AP5 A;  1NJI W;  4DK0 A;  2AHZ A;  1QCE A;  1VQO V;  3QNE A;  1L0L H;  1EZJ A;  5B1N A;  5JJJ B;  1HNW B;  1L0N H;  4LF9 O;  1SC5 B;  1K4D C;  3ZS8 C;  3W7S A;  2QKC A;  1WNS A;  2FML A;  3DGE A;  3L73 H;  3E8F A;  3UCS C;  1N36 O;  1V55 B;  3ZBH A;  1VQL V;  1K97 A;  1SQX H;  4JTD B;  4ZBM A;  4J7Z A;  2LQT A;  2P90 A;  1VMG A;  1ZTE A;  4HNA A;  4JAS A;  1GO3 F;  5JJN B;  3CCS V;  1H2M A;  2Q8V A;  5B3S B;  1VQP V;  4PD4 F;  3MD0 A;  2LW1 A;  5GON A;  4JI3 O;  3BEH A;  3FYI B;  4ZI7 A;  4B3M B;  3ABK B;  2NR5 A;  3C3S A;  2OTL V;  3OMI B;  4X20 A;  3SJA C;  3JAR A;  1GM9 A;  5LXT B;  1DF4 A;  2Z0A A;  1IBK O;  3JYC A;  1KUQ A;  4I4T B;  5CN0 A;  4J41 A;  1OJH A;  3DTU B;  2A9H A;  3ZRS A;  1P7G A;  1JCH A;  2B9Z A;  5HFL A;  3E8H A;  5J2U B;  1K9M W;  3ZN0 A;  4JI1 B;  1VQ7 V;  2Q0A A;  2XHB A;  3EVK A;  1Y6X A;  3UT5 B;  1FXK B;  5LHH A;  4YXW G;  3P32 A;  4PEL A;  3D36 C;  2YUA A;  3AG1 B;  2PY5 A;  1P84 F;  2QWR B;  4UV9 A;  4DO2 A;  3I5D A;  5K1P A;  4I7Z B;  3MDS A;  3U11 A;  4WF9 V;  1VQM V;  1SKV A;  2IJI A;  3L72 H;  1NVP D;  2EZP A;  3ASN C;  2WLJ A;  4CS3 A;  3ZHV A;  3B77 A;  1IBM O;  5JWP A;  2YDE A;  5ITZ A;  4DW1 A;  5KHH A;  3T1Y B;  2CH7 B;  1N4C A;  2IJK A;  4CC6 A;  3B40 A;  1NI8 A;  1S77 D;  1DTO A;  3SDL A;  3JD0 A;  1J95 A;  1SZT A;  1GM8 A;  4MTF A;  3DXR A;  1P49 A;  5LOV B;  2E5L B;  3FKS G;  5IY5 B;  2XAG A;  1PKX A;  2JIZ G;  4DV6 O;  5CBG A;  4TV9 B;  1P4R A;  2ZT9 B;  5D5Q A;  2F43 G;  4LBE C;  5E1A C;  4GKJ O;  2QTS A;  4U3J B;  3UQ8 A;  4XDK A;  4TSF G;  3ZN1 A;  3SJB C;  1N34 B;  4YHH O;  4LFB O;  2WA3 A;  3H1L H;  4UFZ A;  3RYF B;  5LYJ B;  1YZB A;  3SPG A;  3JSL A;  3ABT A;  4K0K B;  4FJC C;  1IX9 A;  3CCR V;  3T4D A;  2HLD G;  2H94 A;  3AK2 A;  3G4S V;  2QR4 A;  4OXS A;  5IT9 N;  4WBN A;  3LSS A;  1AJN A;  3AEI A;  4ZKI A;  1KBH A;  4HBN A;  4PA6 A;  1RPR A;  2P5O A;  4B3S B;  3J81 N;  4FLY A;  2YIC A;  4X1Y B;  2ODM A;  1PD3 A;  5LP6 A;  3ETG A;  1XDC A;  2B1I A;  4PI2 A;  2Z5U A;  3ETE A;  4DV7 B;  4MVS A;  4DV1 B;  1JPX A;  5IYC O;  2EX3 A;  1NS1 A;  3BA8 A;  2GDS A;  4NB5 A;  5FNV B;  1HR0 B;  2YIB A;  1GN4 A;  3B2E E;  2CDY A;  4Z2W A;  1QVF U;  4O4H B;  1IVS A;  4O4I A;  2XAH A;  3OTF A;  1S5H C;  1XIL A;  4FIP C;  1K4C C;  2BSK A;  4ZHQ B;  1W2B U;  4J9Y B;  4J10 A;  3ASO B;  4IGG A;  1A32 A;  5IJ0 B;  4JI4 O;  4MTX A;  2CGN A;  2E74 B;  5C8Y A;  4JV5 B;  4AIL C;  2UUC O;  4J9Z B;  3KCX A;  1XRE A;  1S72 V;  3E35 A;  4IIJ A;  2PUS A;  5H6R A;  1ARO P;  2X6C A;  2PYJ A;  4O2A B;  4UVB A;  2Q5Z A;  1R1B A;  4ZIB A;  3D3Q A;  4BWA A;  3BCC H;  3O9O A;  2QTO A;  1D5A A;  1S76 D;  2BOC C;  3FB6 C;  4I50 B;  4OPA A;  3VQY A;  2QEX V;  1BHB A;  2XUM A;  4NXN O;  2JVD A;  1F51 A;  4R7C A;  2E3C A;  1IDS A;  4I55 A;  3P30 A;  2EBO A;  5KA6 A;  3LSU A;  5JH7 A;  4LF4 B;  1VEW A;  1RSO B;  3W7T A;  5B3S C;  1R73 A;  4CS2 A;  3K5L A;  2DW4 A;  3T1C A;  2LO1 A;  1K8A W;  3JD3 A;  1AI6 A;  3ABK C;  1TA8 A;  3BY6 A;  5LA6 A;  5AG2 A;  1KQS U;  4WCE V;  2QM8 A;  2YXL A;  3SPC A;  1XEQ A;  3RYC B;  4IYI A;  1XMO O;  4A5U B;  2E75 B;  3APQ A;  5B1A B;  3LSQ A;  1PNK A;  3A8T A;  3ABM C;  4DUY O;  4GX5 A;  4WFG A;  5H5N A;  1H2N A;  4BW9 A;  1TGO A;  3ZRW B;  2CE4 A;  2WLK A;  4NYK A;  1HNX B;  1O9G A;  2Q68 A;  4PDM A;  1FXK C;  2VWJ A;  4YJ3 B;  3CXC U;  4F6E A;  1VP7 A;  4TT3 G;  3FFQ A;  1R3I C;  1AR5 A;  4DXW A;  2GUZ A;  3JAT A;  4QNH B;  3X2Q B;  4LWS A;  5E79 Z;  1AI4 A;  1KMI Z;  1Q43 A;  4I9W A;  5JVD B;  2D3O W;  2DMX A;  4OX9 B;  5DM6 V;  3JAL A;  3FAV A;  4DV3 B;  1E1R G;  1VAR A;  1ZX3 A;  4TQF A;  2ZM6 B;  1RM1 B;  3BAB A;  4CH6 A;  1BMF G;  4GKK B;  3CEI A;  5IDJ A;  1KB9 F;  5EYP A;  1J5E B;  2FKX A;  4DR7 O;  5BMV A;  2X7R B;  4G28 B;  4NR1 A;  1ZWI C;  3D36 A;  1CPY A;  3TGU H;  4JI7 B;  1AVM A;  4O2B B;  2IW5 A;  3TCU A;  4UCV A;  4YIP A;  4GT1 A;  1NH2 B;  2B5U A;  1B06 A;  4X8A A;  3T1H O;  2CUG A;  3ZJZ A;  3SYO A;  1PL0 A;  4WFF A;  1GKF A;  2A7W A;  3TXQ A;  5CBF A;  3CWB H;  1SRY A;  5LL6 Y;  3RVZ A;  4GUN A;  4B08 A;  1OCC C;  2G38 A;  4CH4 A;  1N32 O;  2N04 A;  2NNU A;  1K7D A;  4H33 A;  1F7Y A;  4JTA B;  1DLB A;  3UKM A;  2EIM B;  1THZ A;  1BQZ A;  1X59 A;  2F4V B;  1I08 A;  3THO A;  3SJC C;  4W4K A;  4LCU C;  4FM1 A;  3N2G B;  2RDC A;  4RWU A;  2RN9 A;  1SQV H;  5LMN B;  2F95 B;  4L8J A;  3OEH G;  2Y4T A;  2HHH B;  2UU9 B;  2QKA A;  4QIW F;  2W0X A;  2AZ2 A;  5CA1 A;  4QPJ A;  2XAQ A;  4N23 A;  3CCM V;  1M4U A;  3N2K A;  5IYD O;  4YJ2 B;  3RYI B;  4LNU A;  4AQY B;  3EHB B;  2IM9 A;  3CE2 A;  4EB6 A;  2Q6A A;  4FM0 A;  2K9P A;  4LFA B;  3HKC A;  3BRC A;  3G71 V;  1IBL O;  3QTC A;  4DV6 B;  4FFB B;  5KUM A;  1MSD A;  3JAK A;  4X65 O;  4FZ0 A;  3R65 A;  1US6 A;  3SYP A;  5JCO C;  3ASO C;  2XAF A;  4HAM A;  1EZV H;  3E86 A;  3RT3 C;  5IYB O;  1OCO B;  3CC7 V;  2DJV A;  5C93 A;  3WB1 A;  1BGY H;  4X64 B;  2PZS A;  4LFB B;  3CJH A;  1GTO A;  3ETD A;  3LNN A;  4UCT A;  4CC5 A;  2V7Q G;  4DV2 O;  4Z1V A;  4F4L A;  5CBH A;  2DWD C;  5EC1 C;  4FLZ A;  3VQX A;  1WP8 A;  1N0N A;  3UO2 A;  2IBZ H;  4O4L B;  4JI6 O;  4BIZ A;  5FL7 G;  4CBC A;  2KB1 A;  4FLU A;  2DYR B;  1DGS A;  4LC1 A;  5J2T A;  2ZIN A;  2ZNJ A;  3ZMT A;  1PM9 A;  1AR1 B;  3SR2 C;  3QO7 A;  4LF6 O;  4PA3 A;  2OIE A;  1PP9 H; 
#chains in the Genus database with same CATH homology
 3CRC A;  4QGP A;  2Q4P A;  1YVW A;  2OIG A;  2YXH A;  1Y6X A;  2P06 A;  1YXB A;  1VMG A;  3C90 A;  5IE9 A;  2A3Q A;  2Q73 A;  2Q9L A;  2GTA A;  3CRA A;  2Q5Z A;  2OIE A;  2A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...