2Q5ZA

Crystal structure of imazg from vibrio dat 722: ntag-imazg (p43212)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
HMKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEKTRELKEVLNKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title A putative house-cleaning enzyme encoded within an integron array: 1.8 A crystal structure defines a new MazG subtype.
pubmed doi rcsb
source organism Vibrio sp. dat722
molecule tags Hydrolase
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature ec 3.6.1.19: Transferred entry: 3.6.1.9.
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2q5zA00
3C90A 3CRCA 2Q73A 2A7WA 2Q5ZA 1YVWA 2A3QA 2OIEA 2YXHA 4QGPA 2Q4PA 5IE9A 2OIGA 2Q9LA 1VMGA 2P06A 2GTAA 1YXBA 3CRAA 1Y6XA
chains in the Genus database with same CATH superfamily
2D3OW 1HDJA 1LUVA 5IWAB 5LGNA 2BE3A 1TUBA 3CWBH 4NVPA 1N34O 1G8MA 1KC8W 2R9AA 2JJ2G 2VQFO 1MNGA 2IJIA 2YIBA 3ETDA 2XT9A 4B3RO 2HHHB 3FYEB 2BSKB 2WLMA 2F1MA 4PA3A 4UCUA 5BY1A 1D5NA 1KUQA 4IHJA 3E89A 3KCXA 1YXBA 4CS4A 5KHIA 2PZSA 3UO3A 3ASNC 3G67A 4E2LA 2YUAA 3M99B 1QLNA 1R73A 3H1IH 1OCZC 4UB8Z 1GKFA 2VQEO 2P4KA 4X89A 4LF6B 3EXAA 3EFFK 2QWPB 1BS3A 1XDCA 4ASUG 1Q6UA 1NTMH 3ZMVA 2WLLB 2QA4V 2A79B 2F4VB 1KKCA 3MHHC 3CRQA 2X6AA 2X0LA 3WG7C 3IC7A 3OW2U 5F2VO 2DWDC 1HNZB 1YJNV 4J7JA 4FM0A 5LMNB 1XNQO 2F95B 4JPRA 5KX5A 4LWSB 5CN0A 3SR2C 2OTJV 5B3SB 3OTOB 3SPJA 5JH7B 4GYCB 1WB8A 4DR2O 1J5EB 1VQ8V 5JJJB 5JQGA 1YITV 2GSMB 1K5QA 3VQXA 1CPYA 5EBMC 4EB6A 3R65A 5KLVH 2V4DA 4B08A 3RVYA 1KQSU 2OWOA 3CMAV 4K8ZA 2Q67A 2ZNJA 1BCCH 3WG7B 4U3JA 1QLEB 4FIPC 4B3MO 2C2AA 1AI7A 2PTMA 3ZJZA 1AROP 1NZ6A 5H2FZ 2KQXA 5BMVA 1IZ3A 4DV5O 3C3TA 1NJIW 1SA0A 4NTYA 2VS0A 5A2QN 3I5DA 2OCHA 3WB0A 3CC7V 3J81N 2VRZA 2N74A 1BMFG 3JARA 1P4RA 4HAMA 1FYJA 3ZIAG 1W2BU 3CEIA 4I55B 2A0LA 1KKDA 2CGNA 1ZSPA 1MABG 3B77A 1CXZB 1NH2B 4JI0B 1Q82W 1BGYH 4DV1O 2E76B 1PNKA 2YDEA 4IYIA 1FFXA 3JAWB 3WU2Z 4UCRA 5EC2C 5LGUA 4O4IB 1M1KW 4R6ZA 2H8PC 2ZQMA 1LNQA 4WFEA 5CA0A 2PI5A 5J2TB 3CMEV 3CCUV 1YJWV 1SQFA 3CJHA 3UKMA 3U11A 1AI6A 3HPLC 4NTXA 5LXTB 3TK1A 4GKJO 5CB4B 3UT5B 2PI4A 2HG5C 2XAHA 2P5OA 5BZBA 1YTFB 3J7AU 1COWG 3J80N 3OT7A 2YIBD 4X8AA 3ETGA 4JASA 2IU3A 4MVMA 1M4UA 1S3JA 4WFGA 2O57A 1FKAO 1VQ4V 4X1IB 2GUZB 2MK3A 1GN4A 2JIZG 3ASOC 3JATB 4QPKA 4UVAA 2UU9O 3K79A 1G6UA 3HKBB 3QO5A 2Q5ZA 3F5WC 1P7GA 5KA6A 1Q6IA 1M56B 1RSOB 3UM7A 2IH1C 4MTOA 3B4SA 4FMTA 3K06A 2RNBA 3HKCA 4JYCA 5JVDB 1FJGO 1HNXB 2UUCO 2ZCEA 5CBGA 4N21A 1IX9A 1NR1A 5LBQA 4B7EA 4JI2O 4BW5A 3EHBB 4MVRA 4WF9V 3SJCC 3ZRWA 4ZKIA 3VQVA 4DR7B 3BCCH 2HHHO 4ICGA 3F7VC 3Q4HB 1B04A 1KP2A 2JGDA 5C8YA 3W7WA 3OMIB 1YHQV 4CS2A 1ZL8B 2AGAA 1ZTEA 3FKSG 5DEDA 2ITDC 1EFRG 2Q8VA 2Z3YA 4JAUA 1H2KA 4CBCA 4FM1A 3LNNA 1Z5VA 3FD9A 1OCOC 3N2KA 3DXRA 1Q81W 4X1YB 1Z2GA 4HNAB 3WB2A 2E5LB 1FD9A 2YI8A 4JI5B 2DE0X 1S77D 4LF6O 2IBZH 4JYAB 3E8BA 4MS2A 3K5OA 4F4LA 3AG3B 1YSCA 2VQEB 4IT5A 5AG2A 5KAIZ 1VQKV 2ZD9A 1NBMG 5B1NA 3I55V 1JFFA 4TUYA 4EEQA 4UCTA 2F4VO 3OEHG 2YICA 4JGSA 4FLUA 2OCCC 3TCUA 4AILC 1HNZO 2H3OA 1RP3B 3CC2V 1XHZA 3KKYA 3OM3B 5H6QA 4MVUA 2XAFA 2DW4A 3D8CA 2P4VA 1PM9A 2WSSG 4J7KA 3OTOO 3BA9A 3KZIZ 4NB5A 4DV0B 4P2ZA 3N2GA 1J5EO 3P32A 4W4LA 1OHHG 4KUMA 1EN6A 4BIZA 3PN1A 3H01A 3DSQA 3QO8A 3RYFB 1B06A 3BVOA 1MG1A 4LF7B 3DC5A 1CP9A 3X2QB 3P30A 5GONA 4C7UA 4NXNB 4IHJB 3L72H 1K5SA 2EINB 1K8AW 1AI5A 1ZLZA 1H2SB 4TV8A 1KBHA 4F6RB 2CTWA 2ZM6B 4FLTA 1FXHA 4O2AA 2UUAB 1OCCB 2EILC 2WLHA 1HW7A 1SERA 1F4NA 3SJBC 4DR6O 2K1EA 4LF9B 4EFEA 2L6LA 2ZE8A 3W7XA 2F93B 2EIMB 2Q68A 5CBFA 3HKDB 4JI0O 4J9YB 2RJZA 4I4TA 3F7YC 4O4LA 3RYIB 4X66O 3JALB 3ZS8C 3ICXA 2BTQB 2A7WA 4YJ3A 1I08A 2ZR3A 4K0KO 4GX0A 5FL7G 1L1FA 3W7SA 3OGCC 1I94B 3ZMTA 2E74B 1EBOA 2WLNA 1DGSA 2EIKB 1F7YA 2OIGA 5JQGB 3L75H 1XOUA 2GDSA 3OE7G 3MDSA 4TV9B 1VF6A 5LYJB 1XHXA 5KHGA 4WFFA 2HFEC 5GTHZ 4IGGA 3LSUA 3ZMUA 4DXWA 1US6A 5IT9N 3OEEG 1V54C 4DK0A 4B3SB 2LW7A 5LP6A 1SZXA 1VQPV 4RQEA 1HWYA 2GTSA 3ETEA 2EZOA 3E35A 5BMVB 4FM2A 1EZVH 2KSDA 4CS3A 3OMNB 3BY6A 3ZMSA 3JD3A 3EVKA 3R66A 3ABLC 4JAVA 3IJ4A 1M90W 3AG4B 5DM6V 4JI4B 3U10A 1D5AA 3CCEV 2JEXA 3KG2A 4R8CA 2IU0A 2CH7B 1E79G 3CE2A 4JI8B 3IC9A 3CYOA 4FLZA 2B9ZA 4UXNA 5IYZA 3ZHVA 5GTIZ 4O4HB 1FJGB 5IJ0A 5LMUO 1V54B 2UUCB 2UXCB 4DUYB 2RCVA 4DV6B 3TXSA 5IYBO 2Y69C 1PPJH 2FB5A 1K9MW 2QWRB 2CTPA 2Y4UA 4X1KA 4JI1B 3ABUA 3CS5A 4DR7O 1JOYA 1KU9A 4JI2B 1SZTA 1K33A 4ZHQA 1GRJA 3CJHB 3CC4V 3TXQA 1H2LA 3JASB 5IYDO 1GN2A 4GX1A 2BOBC 4FZ1A 1GMGA 2YS8A 1SQQH 5EYPB 1XQ8A 4AI8A 2IJHA 4Z2WA 1BQZA 1YDXA 1VIBA 1OCRB 2QKSA 1IXBA 1Q7YW 4X64B 4PV1B 2E5LO 2YXYA 4JI5O 5DN6G 1DF5A 1FXVA 3VQYA 4JYAO 2A06H 3OR7C 1MZFA 3H1HH 4JTDB 1AJQA 2WPDG 4I7ZB 5D5QA 1WA8B 4CH3A 3C90A 3A0HZ 3SYAA 1S76D 5LGTA 2XNDG 5IY5C 5FLXN 3A2FA 5B1AC 4ZI7B 2ARHA 2NR5A 1JQ0A 4X65B 1B6QA 1VARA 3BHPA 1M57C 4GLXA 4LF4O 2P67A 5CA1B 1PL4A 4PA9A 1NVPD 3BAAA 4PI2A 1LUWA 1SRYA 1GM9A 4D7TA 4DV4B 3ASNB 3FB6C 4FLYA 1MSDA 2B1IA 2FMLA 2L35A 4DYLA 2CAZC 3ZHUA 2P6JA 4DV0O 1KECA 4WFHA 3E8FA 3QNEA 2Z5UA 4CC6A 1DF4A 4LP8A 4O4JA 4JI3O 3FB7C 1OCZB 4LH6A 1TA8A 1BL8A 2AZ0A 4FFBA 3E8GA 3CCQV 4LF7O 2F43G 2X6CA 2DJVA 4BIUA 2JEUA 1MZEA 1H2NA 4UCOA 1N33B 5FNVA 4NXNO 4R7CA 5ITZA 2PF4E 3APQA 3AG2C 2QKAA 2CK3G 3RYCA 2Y48A 2ZM6O 1XMOB 4MSWC 2KG7A 1N8RW 3LDEA 2UUAO 1G4YB 1K73W 3NR7A 3T4DA 4LC1A 4LF9O 1TGOA 2N05A 1BHBA 1R6NA 1FXKA 1ROPA 3W7TA 4DR6B 3K5LA 5B1BC 4WBNB 3S3XA 4TUYB 3HKEA 2N04A 3IFXA 5KMGA 3D3IA 1L8DA 2H94A 3ABTA 4FPPA 3O9OA 1NTKH 5LHGA 4X66B 4FFKA 4H13B 3RVZA 2M7WA 1R3IC 1WP7A 3T1CA 1UFIA 3OFNG 1XL4A 1U96A 3JYCA 4PD4F 4PDRA 2ITCC 5EBWC 1Y74A 1I94O 3IAYA 4IL6Z 4K0KB 2ZIMA 1R3KC 3CX5F 2QE7G 3N2GB 3DTUB 1K92A 2LGQA 2YEVB 5J2UA 4LR3A 4K3AA 1TUEB 3H1KH 5EZYA 2YIDA 4DRXB 4UVCA 1I7FA 2DYRC 2Q7EA 1E1QG 4JTCB 3K04A 1VQNV 2Y0IA 2KB1A 5JJNB 4P9PA 3JD1A 4CC5A 4UFZA 1GTOA 1IBMB 3RYHB 4B3SO 1LR1A 3D36A 5KAFZ 2HJFC 1NI8A 4TV8B 1D2DA 2BSKA 4RO2A 1MOFA 3ABKC 1Y76B 3FYIB 4LNUB 4PA6A 3ZCCA 4MVQA 2BCCH 5JJEB 1DK1A 3K5NA 1ZX3A 1HR0B 4ZOLB 4GZRB 3L74H 2EIJC 1RPOA 3NXSA 4B7KA 2AW9A 3DGEA 2P7TC 4YJ2B 5IJ9A 4JI4O 1I5YA 3RFRA 4YIPA 4CH4A 1VF6C 3RN4A 4JI8O 2LJ2A 3ZRXA 4I4TB 2RDCA 3K58A 3APOA 1YCIA 4NKGB 4FJCC 2UXNA 2UXCO 4H37A 3RBZA 2LGWA 4N23A 4DUYO 3CCJV 1W0JG 4DV6O 3T1HB 2WLLA 4GUNA 5LP6C 1MA1A 3SPCA 4I5SA 3ABKB 5LMUB 1N4CA 2HR3A 4JI1O 4Z1MG 2R70A 4I9QA 1RFYA 4D7SA 1G1XB 1NKDA 2Q6AA 1AP5A 3ASOB 1QHTA 3FAVB 2QDOA 2WLIB 1IBLB 4LWSA 1JPXA 2IJKA 1NTZH 4JF3A 4JAAA 5JCOA 2Q7HA 2IH3C 1L0LH 5JH7A 3OTFA 5L3EA 3W7UA 4PI0A 1IBKB 4DK1A 2UXXA 4X64O 4I50B 2RMKB 3CHXA 1Q8IA 1Z5WA 3G4SV 4FLXA 4XDJA 2EULA 1GM7A 1KMIZ 1QCEA 4RUFA 1YZBA 1XILA 1FFTB 1EZJA 1GH6A 2HVJC 3K9AA 1NR7A 2A3QA 2QWNB 4O2BA 3ZEDA 3HR0A 2ATKC 2AXTZ 1VQ7V 3VOUA 2DMXA 1N0NA 1M5IA 4QGPA 1WAZA 3LDCA 2DQ3A 1SF9A 4HYOA 4X65O 5LA6B 4QPJA 2W0XA 5EIBD 3ZN0A 3L9DA 5E1AC 4FZ0A 1N32B 2LO1A 1VQ6V 1BQ0A 4LF4B 4UV8A 4LFCB 4XBFA 4DV4O 2CUGA 1H2MA 1AI4A 1DTOA 4P30A 2GBOA 1SQGA 3SYQA 1OCOB 4H33A 1W0KG 5EK0A 4I55A 1S0VA 4XDLA 4PJ0Z 5HFMA 3E22B 5CBHA 3VBBA 1L0NH 1YIJV 4NR1A 5IDJA 3SJQC 1X4TA 2F23A 1QU7A 1TUBB 4JI3B 1S72V 3JSNA 3MD0A 2YXHA 1H8EG 2KKWA 2RN9A 1N33O 3E8HA 2FYUH 3P3NA 1O9GA 2Q4PA 4O4IA 2R72A 3JAKA 2JVDA 1Y66A 2ZKOA 4Q20A 2OCCB 4J9ZB 5J2TA 3CCSV 2QM7A 5L3DA 3SYOA 1QR8A 3IGAC 2ZE7A 1VQ9V 3K0GA 2HEPA 3AEIA 2V7QG 4JZGA 2DQ0A 4PDLA 1RM1C 4R50A 4LFBB 1XMOO 4Q6GA 3ABMC 2QJ1A 2XTAA 1XL6A 5LXTA 1IVSA 1AJNA 5CB4A 3UT5A 2HKOA 1GO3F 2WLJA 1V55C 3ML0A 2V1DA 2JRIA 1GK9A 4JI7B 4AHCA 4I9WA 1NU1H 2PUSA 2QM4A 1SS3A 3TJTA 2BOCC 4DUZB 4OX9O 2B5UA 4KHPB 1GM8A 5L3BA 2YC0A 4RAIA 4X1IA 4UVBA 3AG7A 5L3CA 4LF8B 4TOIA 2GUZA 1KB9F 3UQ8A 2X6BA 3TGUH 4PDVA 4JI6B 5KHJA 5BXZA 1K7DA 3HKBA 2CDYA 1Q3EA 3OGIB 1RSOA 1XBLA 3MHSC 1XMQB 1H2GA 4U3FH 1RM1B 3B40A 5KX5B 3WB1A 5LHIA 2EJRA 3A0BZ 1UJWB 2JJ1G 2P90A 4X62O 5EIBC 2XAJA 2DYSC 1PP9H 5A9GA 3K03A 1QVFU 2EILB 1Q5OA 2OYQA 4BWAA 1FXKC 3JCZA 4DV2O 1CEZA 4GKKB 3CRRA 3CRCA 1VQOV 2PYLA 1S5LZ 2NNUA 4EB6B 1TVKA 1PV0A 4F6EA 4FLVA 2Q0OC 3L70H 5FNVB 2HVKC 4X20A 3SDLA 4OGQB 3VQWA 4H0LB 2LQTA 5ITZB 1SQPH 1IBMO 4U3JB 3Q4HA 4E4EA 3RYCB 1KP3A 1NS1A 1JJ2U 3SGIA 4UB6Z 3LSQA 3LSSA 1HR0O 3ZRVA 4LCUC 1ZL8A 2PYJA 1SC5B 4DR4B 4EKWA 4FK5C 2ODMA 1WB7A 4TQFA 2QWQB 1SA0B 1MMMA 4JZ2A 1VQMV 3QVNA 3D3QA 3B2EE 3THOA 5C93A 1X59A 4JV5O 4UCVA 2EZPA 2G38A 3JARB 1WLEA 2YXLA 1AVMA 3H1LH 3CCLV 2Z0AA 4IYHA 1PNMA 2ZDIA 2LFSA 3SJAC 2LFRA 3GWKC 4BAYA 3T1HO 1FAFA 3D36C 1W59A 1FFXB 3LUTB 4J42A 3K5MA 4QNHB 5KUKA 3P3PA 4LBEC 2Q73A 1BE3H 4KXRA 2ZIOA 2CGOA 5CA0B 3BPZA 3ABLB 4DV7B 1XI1A 1IBLO 2QKCA 3F5TA 1NQTA 3GB7C 2UXBB 2HLDG 4QE7A 1NH2D 1IBKO 1OJHA 3QTCA 3K59A 2UXDB 4LF5B 3RT3C 1ORQC 2Q0AA 4NXMO 1AR5A 3RYFA 1VEWA 2MW2B 2ZNIA 3CCRV 4TWKA 4W4KA 3G6EV 2ZT9B 1Q6HA 4KFMA 2DN9A 4IIJA 1EN4A 4YY3B 2Y69B 4WFBV 1VMGA 3OD4A 1F51A 3RW0A 4G27B 1BZKA 4DW0A 5IJ9B 4MTXA 4F6RA 2QSAA 1XUQA 4X88A 3JD0A 3ZBHA 4OPAA 5B3SC 1N32O 2R9IA 1JVMA 1XEQA 2FL4A 5JCOC 1KYOF 3LDDA 3GWOA 1YTFD 4LFCO 1WPXA 3HKCB 1H38A 2P06A 1IXMA 3G6BA 1XNRB 1VQLV 2JDIG 2XUMA 3HKDA 3RYIA 5H9CA 1R6KA 3JALA 2RQ6A 5FPRA 4DR1B 1F4MA 1QLEC 1R6TA 4TQDA 2OT5A 4MVZA 2GTAA 3ZRWB 1EN5A 2BTQA 3E2EA 3CPWU 5IY5B 1F23A 4CH6A 1MSWD 5B1AB 1HNWO 4AQYB 3OMAB 2JGDB 2ADPA 4OPHA 3SYPA 5C8YB 1JX9A 4J10A 1M57B 4I0XA 1UPGA 5K1PA 4HBNA 2JK5C 3BA8A 2QEXV 4G28B 5GW7A 3T2MA 4LFBO 1URFA 1WPBA 3QO7A 4RWUA 4TV9A 5LYJA 3N2KB 2LW1A 3DXRB 1P84F 4JI7O 3ZMZA 3ZHRA 1OV9A 4MTFA 3FB5C 4O2BB 1YF2A 5B5EZ 1ZWIC 4DUZO 2WAMA 4KHPO 3LNMB 2JGUA 3GVMA 3BEHA 4LF8O 1JFFB 4OX9B 3B8MA 3N27A 3K08A 3JAMN 2XASA 3ZRSA 4JI6O 2GV9A 1K4CC 2YIAA 1ENVA 2NN4A 5LOVA 4JYYA 4LFAO 4XDKA 3AG2B 3U0ZA 3ZX6A 3K0DA 4BIOA 1XMQO 3SPGA 1BHAA 1HP8A 2W6JG 3M8AA 3B8NA 1YI2V 2CH7A 4X62B 2WA4A 1AR4A 1M93A 1XREA 2XAQA 5BR8O 1AB3A 1E1RG 4KP4A 3ETQA 4MW8A 2E75B 4GKKO 4DV3B 4K8XA 4O4HA 1GAXA 1SETA 5B1BB 4DV2B 3BRCA 5CMUA 1GN6A 1AR1B 2JS3A 3FB8C 2W0FC 5GONB 2HP8A 2WLKA 3CD6V 2DOSA 3CP1A 3S3WA 1BSMA 3JAKB 4DR3B 3QG5A 2PGGA 1WJZA 4DR5B 1QVGU 1DLBA 2M6YA 4BW9A 2UUBB 2QTOA 3RGBA 1M56C 4YHHB 5LHHA 1PKXA 4PDMA 1JMKC 3JASA 4QE9A 4DR4O 2XHBA 2D2CB 5EYPA 2YSUB 5K1XA 3OUSA 4HZ3A 1JCHA 4O2AB 3JD4A 2ZR2A 2IW5A 2XAGA 1I0HA 3A0RA 1NVPB 3K57A 3C3SA 2BTOA 2A9HA 4ZIBA 4RUEA 4JV5B 1QR9A 3AK2A 4PA7A 2OTLV 4NYKA 4JTAB 4J80A 2QWOB 2DYRB 4O4LB 5IE9A 1Y4MA 3FX7A 2CTQA 1WA8A 1KD1W 1S5HC 3CRMA 1S5JA 2IJJA 1Y6XA 2FTKA 1QBZA 3AK1A 4JYBA 4ZI7A 5TISZ 3WFVA 1JA8A 2ZE5A 2CE4A 1N36B 4YJ3B 4RQFA 2WA3A 4J7ZA 3K9SA 3H9VA 2GHYA 1SKVA 5CA1A 3T1YB 2AHYA 3OUFA 3SPIA 2F66C 3OAAG 4DV7O 1QNMA 2EIJB 5EC1C 2UXBO 4B3TO 2AHZA 1WP8A 2ZXWC 1PL0A 2WWWA 5EBLC 1A32A 1TVKB 4LF5O 1ZAUA 2UXDO 5B1OA 3T4ZA 5IWAO 1VQ5V 4X20B 2ZDIC 3AG3C 1PD3A 1GN3A 4UCSA 3AG1C 5B66Z 2P22C 4WFAV 1N34B 4NXMB 1VP7A 3CRAA 2VQFB 1ZUQA 1Y67A 4ZBMA 4B3RB 4YY3O 5LP6B 3JSLA 3TETA 4DO2A 3G80A 1JJOA 4L8JA 3JD2A 4L87A 5FPOA 5CA3A 5IYCO 3O65A 1R3LC 4QIWF 3STLC 2ZXWB 3OR6C 5H5NA 3E86A 4WCEV 1SESA 3CCVV 3PJSK 4U7NA 5E79Z 1XNRO 3AG1B 2LP7A 3SYCA 4WBNA 1YJ9V 3X2QC 1J95A 4OXSA 4K35A 1M9NA 5IYZB 4GX5A 4Z1VA 5IJ0B 1VF7A 1AILA 1O9HA 5L3FA 3RWRD 3SPHA 4KL1A 4DR1O 3AK3A 4X1KB 2EINC 4J41A 2QM8A 3G71V 2K9PA 4LH7A 5LMNO 4UV9A 4ZHQB 3JAWA 4PA4A 1B3QA 4AQYO 2QGNA 3L73H 1XNQB 2EBOA 2EJ7A 5L3GA 3FFQA 1HNWB 1OCCC 4YXWG 2YEVA 2QTSA 4DR2B 5H6RA 4MVOA 4GX2A 1WNSA 4PHZA 2OIEA 4G2KA 1K34A 3BFRA 4DRXA 3CXCU 3L71H 1OZ0A 1QQCA 2EIMC 4DW1A 4CZZA 1Q86W 4IIJB 1SQVH 2ZE6A 3DC6A 1IDSA 2Q9LA 4P9OA 2X7RB 4BR6A 4J11A 3RYHA 1P7BA 1IURA 4QJFB 3B09A 1YVWA 4CH5A 2VWJA 4MVSA 4B3MB 1Y76A 4LNUA 1Q90D 4ZOLA 1WN7A 1THZA 3CCMV 4A5UB 1FPOA 4DV5B 2B1GA 3CXHF 1AJPA 2EIKC 3JATA 4YJ2A 1VF5B 1T5EA 4LFAB 4EFBA 1I5XA 3I56V 3STZC 1JR9A 4GCZA 4GT1A 3ABMB 5HFLA 2JS5A 3ZHSA 5JVDA 1V55B 2YI9A 1K3EA 4FLWA 4O4JB 4DV3O 3KCYA 5BR8B 1K97A 1V9PA 4ABMA 3H1JH 4FFBB 4DV1B 3MAQA 4MW3A 1NT2B 2AZ2A 3ZHTA 1AP6A 5J9PC 2IM9A 3E83A 2Q7GA 4DR3O 2QR4A 4PELA 4D6TH 2DWEC 4DR5O 1R3JC 5KHKA 4I0XB 4MTGA 2UUBO 3HB3B 3ZN1A 5LL6Y 1PNLA 2E3CA 3AG4C 4YHHO 3FAVA 4FVMA 2XOKG 2WLIA 1EM1A 2Q69A 1BT8A 1Q43A 2NLJC 3QF7A 2KG7B 4GKJB 2Y4TA 4I50A 2DYSB 2Y0PA 1TAEA 3CSXA 1FXKB 3JCUZ 2FKXA 2W6IG 1SQXH 4X1YA 5KA5A 4HNAA 3UCSC 1H8HG 1N0JA 2CTRA 3HKEB 2ETNA 5D5PA 2R9RB 5KMGB 1SQBH 1YEWA 3UO2A 4H44B 1K4DC 5LOVB 1R1BA 3CB2A 1N36O 5LA6A 5JWPA 3A8TA 2UU9B 2HJDA 4UUJC 4MT8A 3T1YO 2VWKA 4NTWA 1Y74B 3BABA 2ZINA 1RPRA 4YIOA 1OCRC 2EX3A 3K3WA 4TSFG 1U97A 1HNXO 3M7MX 5J2UB 4TT3G 4U7OA 5EZYB 5KUMA 4X9QA 3ZHQA 5DECA 1P49A 4B3TB 2ILMA 1FS0G 5KHHA 3E22A 2ADQB 2PY5A
chains in the Genus database with same CATH topology
3C90A 3CRCA 2Q73A 2A7WA 2Q5ZA 1YVWA 2A3QA 2OIEA 2YXHA 4QGPA 2Q4PA 5IE9A 2OIGA 2Q9LA 1VMGA 2P06A 2GTAA 1YXBA 3CRAA 1Y6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C90 A;  3CRC A;  2Q73 A;  2A7W A;  2Q5Z A;  1YVW A;  2A3Q A;  2OIE A;  2YXH A;  4QGP A;  2Q4P A;  5IE9 A;  2OIG A;  2Q9L A;  1VMG A;  2P06 A;  2GTA A;  1YXB A;  3CRA A;  1Y6X A; 
#chains in the Genus database with same CATH topology
 2D3O W;  1HDJ A;  1LUV A;  5IWA B;  5LGN A;  2BE3 A;  1TUB A;  3CWB H;  4NVP A;  1N34 O;  1G8M A;  1KC8 W;  2R9A A;  2JJ2 G;  2VQF O;  1MNG A;  2IJI A;  2YIB A;  3ETD A;  2XT9 A;  4B3R O;  2HHH B;  3FYE B;  2BSK B;  2WLM A;  2F1M A;  4PA3 A;  4UCU A;  5BY1 A;  1D5N A;  1KUQ A;  4IHJ A;  3E89 A;  3KCX A;  1YXB A;  4CS4 A;  5KHI A;  2PZS A;  3UO3 A;  3ASN C;  3G67 A;  4E2L A;  2YUA A;  3M99 B;  1QLN A;  1R73 A;  3H1I H;  1OCZ C;  4UB8 Z;  1GKF A;  2VQE O;  2P4K A;  4X89 A;  4LF6 B;  3EXA A;  3EFF K;  2QWP B;  1BS3 A;  1XDC A;  4ASU G;  1Q6U A;  1NTM H;  3ZMV A;  2WLL B;  2QA4 V;  2A79 B;  2F4V B;  1KKC A;  3MHH C;  3CRQ A;  2X6A A;  2X0L A;  3WG7 C;  3IC7 A;  3OW2 U;  5F2V O;  2DWD C;  1HNZ B;  1YJN V;  4J7J A;  4FM0 A;  5LMN B;  1XNQ O;  2F95 B;  4JPR A;  5KX5 A;  4LWS B;  5CN0 A;  3SR2 C;  2OTJ V;  5B3S B;  3OTO B;  3SPJ A;  5JH7 B;  4GYC B;  1WB8 A;  4DR2 O;  1J5E B;  1VQ8 V;  5JJJ B;  5JQG A;  1YIT V;  2GSM B;  1K5Q A;  3VQX A;  1CPY A;  5EBM C;  4EB6 A;  3R65 A;  5KLV H;  2V4D A;  4B08 A;  3RVY A;  1KQS U;  2OWO A;  3CMA V;  4K8Z A;  2Q67 A;  2ZNJ A;  1BCC H;  3WG7 B;  4U3J A;  1QLE B;  4FIP C;  4B3M O;  2C2A A;  1AI7 A;  2PTM A;  3ZJZ A;  1ARO P;  1NZ6 A;  5H2F Z;  2KQX A;  5BMV A;  1IZ3 A;  4DV5 O;  3C3T A;  1NJI W;  1SA0 A;  4NTY A;  2VS0 A;  5A2Q N;  3I5D A;  2OCH A;  3WB0 A;  3CC7 V;  3J81 N;  2VRZ A;  2N74 A;  1BMF G;  3JAR A;  1P4R A;  4HAM A;  1FYJ A;  3ZIA G;  1W2B U;  3CEI A;  4I55 B;  2A0L A;  1KKD A;  2CGN A;  1ZSP A;  1MAB G;  3B77 A;  1CXZ B;  1NH2 B;  4JI0 B;  1Q82 W;  1BGY H;  4DV1 O;  2E76 B;  1PNK A;  2YDE A;  4IYI A;  1FFX A;  3JAW B;  3WU2 Z;  4UCR A;  5EC2 C;  5LGU A;  4O4I B;  1M1K W;  4R6Z A;  2H8P C;  2ZQM A;  1LNQ A;  4WFE A;  5CA0 A;  2PI5 A;  5J2T B;  3CME V;  3CCU V;  1YJW V;  1SQF A;  3CJH A;  3UKM A;  3U11 A;  1AI6 A;  3HPL C;  4NTX A;  5LXT B;  3TK1 A;  4GKJ O;  5CB4 B;  3UT5 B;  2PI4 A;  2HG5 C;  2XAH A;  2P5O A;  5BZB A;  1YTF B;  3J7A U;  1COW G;  3J80 N;  3OT7 A;  2YIB D;  4X8A A;  3ETG A;  4JAS A;  2IU3 A;  4MVM A;  1M4U A;  1S3J A;  4WFG A;  2O57 A;  1FKA O;  1VQ4 V;  4X1I B;  2GUZ B;  2MK3 A;  1GN4 A;  2JIZ G;  3ASO C;  3JAT B;  4QPK A;  4UVA A;  2UU9 O;  3K79 A;  1G6U A;  3HKB B;  3QO5 A;  2Q5Z A;  3F5W C;  1P7G A;  5KA6 A;  1Q6I A;  1M56 B;  1RSO B;  3UM7 A;  2IH1 C;  4MTO A;  3B4S A;  4FMT A;  3K06 A;  2RNB A;  3HKC A;  4JYC A;  5JVD B;  1FJG O;  1HNX B;  2UUC O;  2ZCE A;  5CBG A;  4N21 A;  1IX9 A;  1NR1 A;  5LBQ A;  4B7E A;  4JI2 O;  4BW5 A;  3EHB B;  4MVR A;  4WF9 V;  3SJC C;  3ZRW A;  4ZKI A;  3VQV A;  4DR7 B;  3BCC H;  2HHH O;  4ICG A;  3F7V C;  3Q4H B;  1B04 A;  1KP2 A;  2JGD A;  5C8Y A;  3W7W A;  3OMI B;  1YHQ V;  4CS2 A;  1ZL8 B;  2AGA A;  1ZTE A;  3FKS G;  5DED A;  2ITD C;  1EFR G;  2Q8V A;  2Z3Y A;  4JAU A;  1H2K A;  4CBC A;  4FM1 A;  3LNN A;  1Z5V A;  3FD9 A;  1OCO C;  3N2K A;  3DXR A;  1Q81 W;  4X1Y B;  1Z2G A;  4HNA B;  3WB2 A;  2E5L B;  1FD9 A;  2YI8 A;  4JI5 B;  2DE0 X;  1S77 D;  4LF6 O;  2IBZ H;  4JYA B;  3E8B A;  4MS2 A;  3K5O A;  4F4L A;  3AG3 B;  1YSC A;  2VQE B;  4IT5 A;  5AG2 A;  5KAI Z;  1VQK V;  2ZD9 A;  1NBM G;  5B1N A;  3I55 V;  1JFF A;  4TUY A;  4EEQ A;  4UCT A;  2F4V O;  3OEH G;  2YIC A;  4JGS A;  4FLU A;  2OCC C;  3TCU A;  4AIL C;  1HNZ O;  2H3O A;  1RP3 B;  3CC2 V;  1XHZ A;  3KKY A;  3OM3 B;  5H6Q A;  4MVU A;  2XAF A;  2DW4 A;  3D8C A;  2P4V A;  1PM9 A;  2WSS G;  4J7K A;  3OTO O;  3BA9 A;  3KZI Z;  4NB5 A;  4DV0 B;  4P2Z A;  3N2G A;  1J5E O;  3P32 A;  4W4L A;  1OHH G;  4KUM A;  1EN6 A;  4BIZ A;  3PN1 A;  3H01 A;  3DSQ A;  3QO8 A;  3RYF B;  1B06 A;  3BVO A;  1MG1 A;  4LF7 B;  3DC5 A;  1CP9 A;  3X2Q B;  3P30 A;  5GON A;  4C7U A;  4NXN B;  4IHJ B;  3L72 H;  1K5S A;  2EIN B;  1K8A W;  1AI5 A;  1ZLZ A;  1H2S B;  4TV8 A;  1KBH A;  4F6R B;  2CTW A;  2ZM6 B;  4FLT A;  1FXH A;  4O2A A;  2UUA B;  1OCC B;  2EIL C;  2WLH A;  1HW7 A;  1SER A;  1F4N A;  3SJB C;  4DR6 O;  2K1E A;  4LF9 B;  4EFE A;  2L6L A;  2ZE8 A;  3W7X A;  2F93 B;  2EIM B;  2Q68 A;  5CBF A;  3HKD B;  4JI0 O;  4J9Y B;  2RJZ A;  4I4T A;  3F7Y C;  4O4L A;  3RYI B;  4X66 O;  3JAL B;  3ZS8 C;  3ICX A;  2BTQ B;  2A7W A;  4YJ3 A;  1I08 A;  2ZR3 A;  4K0K O;  4GX0 A;  5FL7 G;  1L1F A;  3W7S A;  3OGC C;  1I94 B;  3ZMT A;  2E74 B;  1EBO A;  2WLN A;  1DGS A;  2EIK B;  1F7Y A;  2OIG A;  5JQG B;  3L75 H;  1XOU A;  2GDS A;  3OE7 G;  3MDS A;  4TV9 B;  1VF6 A;  5LYJ B;  1XHX A;  5KHG A;  4WFF A;  2HFE C;  5GTH Z;  4IGG A;  3LSU A;  3ZMU A;  4DXW A;  1US6 A;  5IT9 N;  3OEE G;  1V54 C;  4DK0 A;  4B3S B;  2LW7 A;  5LP6 A;  1SZX A;  1VQP V;  4RQE A;  1HWY A;  2GTS A;  3ETE A;  2EZO A;  3E35 A;  5BMV B;  4FM2 A;  1EZV H;  2KSD A;  4CS3 A;  3OMN B;  3BY6 A;  3ZMS A;  3JD3 A;  3EVK A;  3R66 A;  3ABL C;  4JAV A;  3IJ4 A;  1M90 W;  3AG4 B;  5DM6 V;  4JI4 B;  3U10 A;  1D5A A;  3CCE V;  2JEX A;  3KG2 A;  4R8C A;  2IU0 A;  2CH7 B;  1E79 G;  3CE2 A;  4JI8 B;  3IC9 A;  3CYO A;  4FLZ A;  2B9Z A;  4UXN A;  5IYZ A;  3ZHV A;  5GTI Z;  4O4H B;  1FJG B;  5IJ0 A;  5LMU O;  1V54 B;  2UUC B;  2UXC B;  4DUY B;  2RCV A;  4DV6 B;  3TXS A;  5IYB O;  2Y69 C;  1PPJ H;  2FB5 A;  1K9M W;  2QWR B;  2CTP A;  2Y4U A;  4X1K A;  4JI1 B;  3ABU A;  3CS5 A;  4DR7 O;  1JOY A;  1KU9 A;  4JI2 B;  1SZT A;  1K33 A;  4ZHQ A;  1GRJ A;  3CJH B;  3CC4 V;  3TXQ A;  1H2L A;  3JAS B;  5IYD O;  1GN2 A;  4GX1 A;  2BOB C;  4FZ1 A;  1GMG A;  2YS8 A;  1SQQ H;  5EYP B;  1XQ8 A;  4AI8 A;  2IJH A;  4Z2W A;  1BQZ A;  1YDX A;  1VIB A;  1OCR B;  2QKS A;  1IXB A;  1Q7Y W;  4X64 B;  4PV1 B;  2E5L O;  2YXY A;  4JI5 O;  5DN6 G;  1DF5 A;  1FXV A;  3VQY A;  4JYA O;  2A06 H;  3OR7 C;  1MZF A;  3H1H H;  4JTD B;  1AJQ A;  2WPD G;  4I7Z B;  5D5Q A;  1WA8 B;  4CH3 A;  3C90 A;  3A0H Z;  3SYA A;  1S76 D;  5LGT A;  2XND G;  5IY5 C;  5FLX N;  3A2F A;  5B1A C;  4ZI7 B;  2ARH A;  2NR5 A;  1JQ0 A;  4X65 B;  1B6Q A;  1VAR A;  3BHP A;  1M57 C;  4GLX A;  4LF4 O;  2P67 A;  5CA1 B;  1PL4 A;  4PA9 A;  1NVP D;  3BAA A;  4PI2 A;  1LUW A;  1SRY A;  1GM9 A;  4D7T A;  4DV4 B;  3ASN B;  3FB6 C;  4FLY A;  1MSD A;  2B1I A;  2FML A;  2L35 A;  4DYL A;  2CAZ C;  3ZHU A;  2P6J A;  4DV0 O;  1KEC A;  4WFH A;  3E8F A;  3QNE A;  2Z5U A;  4CC6 A;  1DF4 A;  4LP8 A;  4O4J A;  4JI3 O;  3FB7 C;  1OCZ B;  4LH6 A;  1TA8 A;  1BL8 A;  2AZ0 A;  4FFB A;  3E8G A;  3CCQ V;  4LF7 O;  2F43 G;  2X6C A;  2DJV A;  4BIU A;  2JEU A;  1MZE A;  1H2N A;  4UCO A;  1N33 B;  5FNV A;  4NXN O;  4R7C A;  5ITZ A;  2PF4 E;  3APQ A;  3AG2 C;  2QKA A;  2CK3 G;  3RYC A;  2Y48 A;  2ZM6 O;  1XMO B;  4MSW C;  2KG7 A;  1N8R W;  3LDE A;  2UUA O;  1G4Y B;  1K73 W;  3NR7 A;  3T4D A;  4LC1 A;  4LF9 O;  1TGO A;  2N05 A;  1BHB A;  1R6N A;  1FXK A;  1ROP A;  3W7T A;  4DR6 B;  3K5L A;  5B1B C;  4WBN B;  3S3X A;  4TUY B;  3HKE A;  2N04 A;  3IFX A;  5KMG A;  3D3I A;  1L8D A;  2H94 A;  3ABT A;  4FPP A;  3O9O A;  1NTK H;  5LHG A;  4X66 B;  4FFK A;  4H13 B;  3RVZ A;  2M7W A;  1R3I C;  1WP7 A;  3T1C A;  1UFI A;  3OFN G;  1XL4 A;  1U96 A;  3JYC A;  4PD4 F;  4PDR A;  2ITC C;  5EBW C;  1Y74 A;  1I94 O;  3IAY A;  4IL6 Z;  4K0K B;  2ZIM A;  1R3K C;  3CX5 F;  2QE7 G;  3N2G B;  3DTU B;  1K92 A;  2LGQ A;  2YEV B;  5J2U A;  4LR3 A;  4K3A A;  1TUE B;  3H1K H;  5EZY A;  2YID A;  4DRX B;  4UVC A;  1I7F A;  2DYR C;  2Q7E A;  1E1Q G;  4JTC B;  3K04 A;  1VQN V;  2Y0I A;  2KB1 A;  5JJN B;  4P9P A;  3JD1 A;  4CC5 A;  4UFZ A;  1GTO A;  1IBM B;  3RYH B;  4B3S O;  1LR1 A;  3D36 A;  5KAF Z;  2HJF C;  1NI8 A;  4TV8 B;  1D2D A;  2BSK A;  4RO2 A;  1MOF A;  3ABK C;  1Y76 B;  3FYI B;  4LNU B;  4PA6 A;  3ZCC A;  4MVQ A;  2BCC H;  5JJE B;  1DK1 A;  3K5N A;  1ZX3 A;  1HR0 B;  4ZOL B;  4GZR B;  3L74 H;  2EIJ C;  1RPO A;  3NXS A;  4B7K A;  2AW9 A;  3DGE A;  2P7T C;  4YJ2 B;  5IJ9 A;  4JI4 O;  1I5Y A;  3RFR A;  4YIP A;  4CH4 A;  1VF6 C;  3RN4 A;  4JI8 O;  2LJ2 A;  3ZRX A;  4I4T B;  2RDC A;  3K58 A;  3APO A;  1YCI A;  4NKG B;  4FJC C;  2UXN A;  2UXC O;  4H37 A;  3RBZ A;  2LGW A;  4N23 A;  4DUY O;  3CCJ V;  1W0J G;  4DV6 O;  3T1H B;  2WLL A;  4GUN A;  5LP6 C;  1MA1 A;  3SPC A;  4I5S A;  3ABK B;  5LMU B;  1N4C A;  2HR3 A;  4JI1 O;  4Z1M G;  2R70 A;  4I9Q A;  1RFY A;  4D7S A;  1G1X B;  1NKD A;  2Q6A A;  1AP5 A;  3ASO B;  1QHT A;  3FAV B;  2QDO A;  2WLI B;  1IBL B;  4LWS A;  1JPX A;  2IJK A;  1NTZ H;  4JF3 A;  4JAA A;  5JCO A;  2Q7H A;  2IH3 C;  1L0L H;  5JH7 A;  3OTF A;  5L3E A;  3W7U A;  4PI0 A;  1IBK B;  4DK1 A;  2UXX A;  4X64 O;  4I50 B;  2RMK B;  3CHX A;  1Q8I A;  1Z5W A;  3G4S V;  4FLX A;  4XDJ A;  2EUL A;  1GM7 A;  1KMI Z;  1QCE A;  4RUF A;  1YZB A;  1XIL A;  1FFT B;  1EZJ A;  1GH6 A;  2HVJ C;  3K9A A;  1NR7 A;  2A3Q A;  2QWN B;  4O2B A;  3ZED A;  3HR0 A;  2ATK C;  2AXT Z;  1VQ7 V;  3VOU A;  2DMX A;  1N0N A;  1M5I A;  4QGP A;  1WAZ A;  3LDC A;  2DQ3 A;  1SF9 A;  4HYO A;  4X65 O;  5LA6 B;  4QPJ A;  2W0X A;  5EIB D;  3ZN0 A;  3L9D A;  5E1A C;  4FZ0 A;  1N32 B;  2LO1 A;  1VQ6 V;  1BQ0 A;  4LF4 B;  4UV8 A;  4LFC B;  4XBF A;  4DV4 O;  2CUG A;  1H2M A;  1AI4 A;  1DTO A;  4P30 A;  2GBO A;  1SQG A;  3SYQ A;  1OCO B;  4H33 A;  1W0K G;  5EK0 A;  4I55 A;  1S0V A;  4XDL A;  4PJ0 Z;  5HFM A;  3E22 B;  5CBH A;  3VBB A;  1L0N H;  1YIJ V;  4NR1 A;  5IDJ A;  3SJQ C;  1X4T A;  2F23 A;  1QU7 A;  1TUB B;  4JI3 B;  1S72 V;  3JSN A;  3MD0 A;  2YXH A;  1H8E G;  2KKW A;  2RN9 A;  1N33 O;  3E8H A;  2FYU H;  3P3N A;  1O9G A;  2Q4P A;  4O4I A;  2R72 A;  3JAK A;  2JVD A;  1Y66 A;  2ZKO A;  4Q20 A;  2OCC B;  4J9Z B;  5J2T A;  3CCS V;  2QM7 A;  5L3D A;  3SYO A;  1QR8 A;  3IGA C;  2ZE7 A;  1VQ9 V;  3K0G A;  2HEP A;  3AEI A;  2V7Q G;  4JZG A;  2DQ0 A;  4PDL A;  1RM1 C;  4R50 A;  4LFB B;  1XMO O;  4Q6G A;  3ABM C;  2QJ1 A;  2XTA A;  1XL6 A;  5LXT A;  1IVS A;  1AJN A;  5CB4 A;  3UT5 A;  2HKO A;  1GO3 F;  2WLJ A;  1V55 C;  3ML0 A;  2V1D A;  2JRI A;  1GK9 A;  4JI7 B;  4AHC A;  4I9W A;  1NU1 H;  2PUS A;  2QM4 A;  1SS3 A;  3TJT A;  2BOC C;  4DUZ B;  4OX9 O;  2B5U A;  4KHP B;  1GM8 A;  5L3B A;  2YC0 A;  4RAI A;  4X1I A;  4UVB A;  3AG7 A;  5L3C A;  4LF8 B;  4TOI A;  2GUZ A;  1KB9 F;  3UQ8 A;  2X6B A;  3TGU H;  4PDV A;  4JI6 B;  5KHJ A;  5BXZ A;  1K7D A;  3HKB A;  2CDY A;  1Q3E A;  3OGI B;  1RSO A;  1XBL A;  3MHS C;  1XMQ B;  1H2G A;  4U3F H;  1RM1 B;  3B40 A;  5KX5 B;  3WB1 A;  5LHI A;  2EJR A;  3A0B Z;  1UJW B;  2JJ1 G;  2P90 A;  4X62 O;  5EIB C;  2XAJ A;  2DYS C;  1PP9 H;  5A9G A;  3K03 A;  1QVF U;  2EIL B;  1Q5O A;  2OYQ A;  4BWA A;  1FXK C;  3JCZ A;  4DV2 O;  1CEZ A;  4GKK B;  3CRR A;  3CRC A;  1VQO V;  2PYL A;  1S5L Z;  2NNU A;  4EB6 B;  1TVK A;  1PV0 A;  4F6E A;  4FLV A;  2Q0O C;  3L70 H;  5FNV B;  2HVK C;  4X20 A;  3SDL A;  4OGQ B;  3VQW A;  4H0L B;  2LQT A;  5ITZ B;  1SQP H;  1IBM O;  4U3J B;  3Q4H A;  4E4E A;  3RYC B;  1KP3 A;  1NS1 A;  1JJ2 U;  3SGI A;  4UB6 Z;  3LSQ A;  3LSS A;  1HR0 O;  3ZRV A;  4LCU C;  1ZL8 A;  2PYJ A;  1SC5 B;  4DR4 B;  4EKW A;  4FK5 C;  2ODM A;  1WB7 A;  4TQF A;  2QWQ B;  1SA0 B;  1MMM A;  4JZ2 A;  1VQM V;  3QVN A;  3D3Q A;  3B2E E;  3THO A;  5C93 A;  1X59 A;  4JV5 O;  4UCV A;  2EZP A;  2G38 A;  3JAR B;  1WLE A;  2YXL A;  1AVM A;  3H1L H;  3CCL V;  2Z0A A;  4IYH A;  1PNM A;  2ZDI A;  2LFS A;  3SJA C;  2LFR A;  3GWK C;  4BAY A;  3T1H O;  1FAF A;  3D36 C;  1W59 A;  1FFX B;  3LUT B;  4J42 A;  3K5M A;  4QNH B;  5KUK A;  3P3P A;  4LBE C;  2Q73 A;  1BE3 H;  4KXR A;  2ZIO A;  2CGO A;  5CA0 B;  3BPZ A;  3ABL B;  4DV7 B;  1XI1 A;  1IBL O;  2QKC A;  3F5T A;  1NQT A;  3GB7 C;  2UXB B;  2HLD G;  4QE7 A;  1NH2 D;  1IBK O;  1OJH A;  3QTC A;  3K59 A;  2UXD B;  4LF5 B;  3RT3 C;  1ORQ C;  2Q0A A;  4NXM O;  1AR5 A;  3RYF A;  1VEW A;  2MW2 B;  2ZNI A;  3CCR V;  4TWK A;  4W4K A;  3G6E V;  2ZT9 B;  1Q6H A;  4KFM A;  2DN9 A;  4IIJ A;  1EN4 A;  4YY3 B;  2Y69 B;  4WFB V;  1VMG A;  3OD4 A;  1F51 A;  3RW0 A;  4G27 B;  1BZK A;  4DW0 A;  5IJ9 B;  4MTX A;  4F6R A;  2QSA A;  1XUQ A;  4X88 A;  3JD0 A;  3ZBH A;  4OPA A;  5B3S C;  1N32 O;  2R9I A;  1JVM A;  1XEQ A;  2FL4 A;  5JCO C;  1KYO F;  3LDD A;  3GWO A;  1YTF D;  4LFC O;  1WPX A;  3HKC B;  1H38 A;  2P06 A;  1IXM A;  3G6B A;  1XNR B;  1VQL V;  2JDI G;  2XUM A;  3HKD A;  3RYI A;  5H9C A;  1R6K A;  3JAL A;  2RQ6 A;  5FPR A;  4DR1 B;  1F4M A;  1QLE C;  1R6T A;  4TQD A;  2OT5 A;  4MVZ A;  2GTA A;  3ZRW B;  1EN5 A;  2BTQ A;  3E2E A;  3CPW U;  5IY5 B;  1F23 A;  4CH6 A;  1MSW D;  5B1A B;  1HNW O;  4AQY B;  3OMA B;  2JGD B;  2ADP A;  4OPH A;  3SYP A;  5C8Y B;  1JX9 A;  4J10 A;  1M57 B;  4I0X A;  1UPG A;  5K1P A;  4HBN A;  2JK5 C;  3BA8 A;  2QEX V;  4G28 B;  5GW7 A;  3T2M A;  4LFB O;  1URF A;  1WPB A;  3QO7 A;  4RWU A;  4TV9 A;  5LYJ A;  3N2K B;  2LW1 A;  3DXR B;  1P84 F;  4JI7 O;  3ZMZ A;  3ZHR A;  1OV9 A;  4MTF A;  3FB5 C;  4O2B B;  1YF2 A;  5B5E Z;  1ZWI C;  4DUZ O;  2WAM A;  4KHP O;  3LNM B;  2JGU A;  3GVM A;  3BEH A;  4LF8 O;  1JFF B;  4OX9 B;  3B8M A;  3N27 A;  3K08 A;  3JAM N;  2XAS A;  3ZRS A;  4JI6 O;  2GV9 A;  1K4C C;  2YIA A;  1ENV A;  2NN4 A;  5LOV A;  4JYY A;  4LFA O;  4XDK A;  3AG2 B;  3U0Z A;  3ZX6 A;  3K0D A;  4BIO A;  1XMQ O;  3SPG A;  1BHA A;  1HP8 A;  2W6J G;  3M8A A;  3B8N A;  1YI2 V;  2CH7 A;  4X62 B;  2WA4 A;  1AR4 A;  1M93 A;  1XRE A;  2XAQ A;  5BR8 O;  1AB3 A;  1E1R G;  4KP4 A;  3ETQ A;  4MW8 A;  2E75 B;  4GKK O;  4DV3 B;  4K8X A;  4O4H A;  1GAX A;  1SET A;  5B1B B;  4DV2 B;  3BRC A;  5CMU A;  1GN6 A;  1AR1 B;  2JS3 A;  3FB8 C;  2W0F C;  5GON B;  2HP8 A;  2WLK A;  3CD6 V;  2DOS A;  3CP1 A;  3S3W A;  1BSM A;  3JAK B;  4DR3 B;  3QG5 A;  2PGG A;  1WJZ A;  4DR5 B;  1QVG U;  1DLB A;  2M6Y A;  4BW9 A;  2UUB B;  2QTO A;  3RGB A;  1M56 C;  4YHH B;  5LHH A;  1PKX A;  4PDM A;  1JMK C;  3JAS A;  4QE9 A;  4DR4 O;  2XHB A;  2D2C B;  5EYP A;  2YSU B;  5K1X A;  3OUS A;  4HZ3 A;  1JCH A;  4O2A B;  3JD4 A;  2ZR2 A;  2IW5 A;  2XAG A;  1I0H A;  3A0R A;  1NVP B;  3K57 A;  3C3S A;  2BTO A;  2A9H A;  4ZIB A;  4RUE A;  4JV5 B;  1QR9 A;  3AK2 A;  4PA7 A;  2OTL V;  4NYK A;  4JTA B;  4J80 A;  2QWO B;  2DYR B;  4O4L B;  5IE9 A;  1Y4M A;  3FX7 A;  2CTQ A;  1WA8 A;  1KD1 W;  1S5H C;  3CRM A;  1S5J A;  2IJJ A;  1Y6X A;  2FTK A;  1QBZ A;  3AK1 A;  4JYB A;  4ZI7 A;  5TIS Z;  3WFV A;  1JA8 A;  2ZE5 A;  2CE4 A;  1N36 B;  4YJ3 B;  4RQF A;  2WA3 A;  4J7Z A;  3K9S A;  3H9V A;  2GHY A;  1SKV A;  5CA1 A;  3T1Y B;  2AHY A;  3OUF A;  3SPI A;  2F66 C;  3OAA G;  4DV7 O;  1QNM A;  2EIJ B;  5EC1 C;  2UXB O;  4B3T O;  2AHZ A;  1WP8 A;  2ZXW C;  1PL0 A;  2WWW A;  5EBL C;  1A32 A;  1TVK B;  4LF5 O;  1ZAU A;  2UXD O;  5B1O A;  3T4Z A;  5IWA O;  1VQ5 V;  4X20 B;  2ZDI C;  3AG3 C;  1PD3 A;  1GN3 A;  4UCS A;  3AG1 C;  5B66 Z;  2P22 C;  4WFA V;  1N34 B;  4NXM B;  1VP7 A;  3CRA A;  2VQF B;  1ZUQ A;  1Y67 A;  4ZBM A;  4B3R B;  4YY3 O;  5LP6 B;  3JSL A;  3TET A;  4DO2 A;  3G80 A;  1JJO A;  4L8J A;  3JD2 A;  4L87 A;  5FPO A;  5CA3 A;  5IYC O;  3O65 A;  1R3L C;  4QIW F;  3STL C;  2ZXW B;  3OR6 C;  5H5N A;  3E86 A;  4WCE V;  1SES A;  3CCV V;  3PJS K;  4U7N A;  5E79 Z;  1XNR O;  3AG1 B;  2LP7 A;  3SYC A;  4WBN A;  1YJ9 V;  3X2Q C;  1J95 A;  4OXS A;  4K35 A;  1M9N A;  5IYZ B;  4GX5 A;  4Z1V A;  5IJ0 B;  1VF7 A;  1AIL A;  1O9H A;  5L3F A;  3RWR D;  3SPH A;  4KL1 A;  4DR1 O;  3AK3 A;  4X1K B;  2EIN C;  4J41 A;  2QM8 A;  3G71 V;  2K9P A;  4LH7 A;  5LMN O;  4UV9 A;  4ZHQ B;  3JAW A;  4PA4 A;  1B3Q A;  4AQY O;  2QGN A;  3L73 H;  1XNQ B;  2EBO A;  2EJ7 A;  5L3G A;  3FFQ A;  1HNW B;  1OCC C;  4YXW G;  2YEV A;  2QTS A;  4DR2 B;  5H6R A;  4MVO A;  4GX2 A;  1WNS A;  4PHZ A;  2OIE A;  4G2K A;  1K34 A;  3BFR A;  4DRX A;  3CXC U;  3L71 H;  1OZ0 A;  1QQC A;  2EIM C;  4DW1 A;  4CZZ A;  1Q86 W;  4IIJ B;  1SQV H;  2ZE6 A;  3DC6 A;  1IDS A;  2Q9L A;  4P9O A;  2X7R B;  4BR6 A;  4J11 A;  3RYH A;  1P7B A;  1IUR A;  4QJF B;  3B09 A;  1YVW A;  4CH5 A;  2VWJ A;  4MVS A;  4B3M B;  1Y76 A;  4LNU A;  1Q90 D;  4ZOL A;  1WN7 A;  1THZ A;  3CCM V;  4A5U B;  1FPO A;  4DV5 B;  2B1G A;  3CXH F;  1AJP A;  2EIK C;  3JAT A;  4YJ2 A;  1VF5 B;  1T5E A;  4LFA B;  4EFB A;  1I5X A;  3I56 V;  3STZ C;  1JR9 A;  4GCZ A;  4GT1 A;  3ABM B;  5HFL A;  2JS5 A;  3ZHS A;  5JVD A;  1V55 B;  2YI9 A;  1K3E A;  4FLW A;  4O4J B;  4DV3 O;  3KCY A;  5BR8 B;  1K97 A;  1V9P A;  4ABM A;  3H1J H;  4FFB B;  4DV1 B;  3MAQ A;  4MW3 A;  1NT2 B;  2AZ2 A;  3ZHT A;  1AP6 A;  5J9P C;  2IM9 A;  3E83 A;  2Q7G A;  4DR3 O;  2QR4 A;  4PEL A;  4D6T H;  2DWE C;  4DR5 O;  1R3J C;  5KHK A;  4I0X B;  4MTG A;  2UUB O;  3HB3 B;  3ZN1 A;  5LL6 Y;  1PNL A;  2E3C A;  3AG4 C;  4YHH O;  3FAV A;  4FVM A;  2XOK G;  2WLI A;  1EM1 A;  2Q69 A;  1BT8 A;  1Q43 A;  2NLJ C;  3QF7 A;  2KG7 B;  4GKJ B;  2Y4T A;  4I50 A;  2DYS B;  2Y0P A;  1TAE A;  3CSX A;  1FXK B;  3JCU Z;  2FKX A;  2W6I G;  1SQX H;  4X1Y A;  5KA5 A;  4HNA A;  3UCS C;  1H8H G;  1N0J A;  2CTR A;  3HKE B;  2ETN A;  5D5P A;  2R9R B;  5KMG B;  1SQB H;  1YEW A;  3UO2 A;  4H44 B;  1K4D C;  5LOV B;  1R1B A;  3CB2 A;  1N36 O;  5LA6 A;  5JWP A;  3A8T A;  2UU9 B;  2HJD A;  4UUJ C;  4MT8 A;  3T1Y O;  2VWK A;  4NTW A;  1Y74 B;  3BAB A;  2ZIN A;  1RPR A;  4YIO A;  1OCR C;  2EX3 A;  3K3W A;  4TSF G;  1U97 A;  1HNX O;  3M7M X;  5J2U B;  4TT3 G;  4U7O A;  5EZY B;  5KUM A;  4X9Q A;  3ZHQ A;  5DEC A;  1P49 A;  4B3T B;  2ILM A;  1FS0 G;  5KHH A;  3E22 A;  2ADQ B;  2PY5 A; 
#chains in the Genus database with same CATH homology
 3C90 A;  3CRC A;  2Q73 A;  2A7W A;  2Q5Z A;  1YVW A;  2A3Q A;  2OIE A;  2YXH A;  4QGP A;  2Q4P A;  5IE9 A;  2OIG A;  2Q9L A;  1VMG A;  2P06 A;  2GTA A;  1YXB A;  3CRA A;  1Y6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...