2Q6AA

Crystal structure of nak channel d66e mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGEGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
molecule keywords Potassium channel protein
molecule tags Metal transport, membrane protein
source organism Bacillus cereus
total genus 42
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q6aA00
4JTCB 2DYRC 4WFEA 5EBLC 3X2QC 3ABMC 3HPLC 5KUKA 4MW8A 4PDLA 1ORQC 1R3JC 4G27B 4PA9A 3FB7C 4WFFA 3K0GA 3E8FA 3AG3C 4QE7A 3SPGA 5CBFA 4RAIA 5EK0A 3IFXA 4WFHA 2A0LA 4GX0A 1M57C 2WLJA 2R9RB 5B1BC 1J95A 2ATKC 5J9PC 3FB8C 4P2ZA 4PDVA 2K1EA 3OGCC 4J9YB 2OCCC 1OCRC 4MTOA 3OR6C 2X6CA 4UUJC 3T1CA 2JK5C 4LP8A 2Q68A 4MVRA 2AHZA 4GX5A 2EIMC 4KFMA 4QE9A 2HFEC 4RUFA 3LNMB 4X8AA 3T4DA 4RUEA 1V54C 3K04A 2HVKC 3STZC 2WLIB 4PDMA 2W0FC 5E1AC 4TWKA 2DWEC 3K06A 1LNQA 3E8GA 1S5HC 2A9HA 5BZBA 3K08A 3LDEA 3FB5C 4PA3A 3JYCA 1R3IC 2QTOA 3SJQC 3LDDA 3E89A 2WLIA 4MVUA 3E8HA 4XDJA 3SPIA 3OR7C 3SYQA 2EIJC 2A79B 3AG4C 4MVSA 4MVZA 5B1AC 3EFFK 4MVMA 3E86A 1G4YB 3F5WC 1XL6A 4X88A 4XDKA 3ASOC 4MVOA 3ZJZA 3ABLC 2KB1A 4J9ZB 4PA7A 3IGAC 1OCOC 1R3KC 4MSWC 2Q69A 3T4ZA 3SPJA 3ZRSA 4JTDB 3RBZA 3UKMA 4H37A 4PA4A 2P7TC 4ZBMA 3T2MA 2EILC 3E83A 3LUTB 4JTAB 2ZXWC 3K03A 3UM7A 4QNHB 1ZWIC 2WLLB 3STLC 4I9WA 3F7VC 5EC1C 5CBHA 4MVQA 2ITDC 2BOBC 3SYOA 4OXSA 3ABKC 2WLHA 4MTFA 2YEVA 4R50A 2X6AA 1K4DC 1OCCC 3LDCA 4DXWA 3PJSK 4GX1A 4MTGA 2IH1C 4BW5A 2BOCC 3SPHA 3RW0A 5B3SC 2WLLA 1V55C 3AG1C 4MS2A 2Y69C 5EC2C 3VOUA 1M56C 3SYAA 2ITCC 2DYSC 2Q67A 3RVZA 4LBEC 1OCZC 4CBCA 3AG2C 4LCUC 3R65A 4H33A 2WLMA 1BL8A 5IY5C 4F4LA 1XL4A 4MW3A 4R7CA 1QLEC 2HVJC 3BEHA 3GB7C 2QKSA 3KG2A 1K4CC 4HZ3A 5KUMA 5CBGA 4P9OA 3FB6C 3SYPA 4WFGA 2HJFC 1KKDA 2WLNA 4X89A 3E8BA 3WG7C 4XDLA 4PA6A 3F7YC 2WLKA 4HYOA 2HG5C 4PDRA 5EBMC 2Q6AA 4R6ZA 5EBWC 3RVYA 3OUSA 3SPCA 2H8PC 2X6BA 3SYCA 3OUFA 2IH3C 2DWDC 3ASNC 4P9PA 4GX2A 4EKWA 4RO2A 1JVMA 2EINC 4P30A 4G28B 3K0DA 1P7BA 4R8CA 3TETA 3TCUA 2EIKC 2AHYA 2ZD9A 1R3LC 2NLJC
chains in the Genus database with same CATH superfamily
1NZ6A 3ASNB 3CCUV 3E8FA 4EFBA 1LR1A 2NN4A 5JQGA 2ZINA 4IL6Z 4QJFB 1K34A 5B3SB 2VQEB 1J95A 4TSFG 4WFAV 4EB6B 1COWG 3CCEV 1MSDA 4DV3B 4JV5B 4X8AA 3B4SA 5K1XA 4DO2A 3K04A 4LF9O 4DV2O 1VQLV 1P49A 1L0NH 2PUSA 1KC8W 2XAGA 4UCOA 2PI5A 3M8AA 5IJ0B 4UV8A 2QTSA 5JCOC 3C3TA 1QR8A 2AZ0A 5GTHZ 1EN5A 1N34O 1MZFA 1OCRB 3ZX6A 2WA3A 3T2MA 4DV5O 1HWYA 2ZR3A 1SQVH 4B7KA 1TA8A 2NNUA 3UO3A 4J80A 2PGGA 5IJ9A 1F51A 1QCEA 2HHHB 2ITCC 1Y74B 1TVKA 3OMNB 3IC7A 2ZQMA 3FFQA 5GONB 4Z2WA 1Q6IA 3VQVA 3H1KH 1RM1B 1YJWV 4R7CA 3BEHA 3ZS8C 3JAMN 3P3PA 1HNWB 3CCRV 1JX9A 2BE3A 4PA6A 2QE7G 3M7MX 4NYKA 2ZT9B 4P9PA 4LF8O 1KUQA 1Q8IA 5A2QN 2ZR2A 1M5IA 1FXVA 4R8CA 2GHYA 1YVWA 3E2EA 4PJ0Z 2K9PA 3FB7C 3I5DA 5L3EA 1M56B 3AG3C 4DV4O 4LF6O 3APOA 2ATKC 1XILA 2ZE5A 4MTOA 1HR0O 5CA3A 3ZEDA 1AVMA 4MVRA 1JFFB 1BS3A 3K59A 5D5PA 3LNMB 1KB9F 2WLIB 4JI5B 1HNXB 2UXBB 3E8GA 1MABG 4FK5C 3FB5C 3HKDA 3QO7A 3ZMUA 4LF7O 1YDXA 1XMQB 4MVSA 4UB6Z 4X1KA 1WP7A 4MVMA 4XDKA 2CTQA 1FXKC 3K3WA 1H2GA 3K9SA 4NTWA 3OAAG 4JI0O 2Q0AA 2Y0PA 1RPRA 3CRRA 2A3QA 2HP8A 2P7TC 4U3JB 1XHZA 5FLXN 3QO8A 1JFFA 4UCTA 3ZRVA 3U11A 4MTFA 1GN2A 5C8YA 5D5QA 1AJQA 1RFYA 4I9QA 4UXNA 1B6QA 5F2VO 2VQEO 5BR8B 1BE3H 2O57A 4U3FH 2G38A 4B3TB 3BFRA 4DV3O 3B40A 1D2DA 4ABMA 2CGNA 1SF9A 3QTCA 2UXDO 2V1DA 2WLKA 3P30A 1HNZO 1BHBA 1I5XA 4IHJB 3ZBHA 3H1IH 2RDCA 1CP9A 2Z5UA 1XBLA 5KHIA 1FXHA 2QSAA 2ZE8A 1SESA 2Q73A 4DUYO 2GUZB 4QE7A 4Q6GA 3BY6A 4YIOA 5EK0A 3ETDA 2IJJA 3CWBH 1PP9H 5KX5B 2QM4A 1OCRC 3OR6C 2F66C 5CMUA 2F4VB 1NR7A 4DV0O 1CXZB 4IHJA 5FPOA 3K58A 3HB3B 4PA3A 2EIMB 4JZ2A 4YY3B 3J81N 2EIKB 4K35A 1S0VA 1AR1B 5JVDA 3DSQA 3GVMA 1AI4A 2JS5A 3CC4V 2QWPB 4JI6B 3EVKA 1WA8B 2KB1A 1R3KC 3JAKB 4W4LA 3RYIA 5KX5A 2E5LB 2XT9A 1SRYA 2XAQA 5DECA 2UUBO 2XAHA 2L6LA 3K5NA 2Z3YA 3F7VC 3N2KB 2BSKA 4JI2B 2WLHA 3LDCA 5LOVB 5KAIZ 1SA0B 3CS5A 3J7AU 1M56C 1FFXA 3K5OA 4FJCC 4TOIA 5IYCO 3ABKB 4H13B 5J2UA 1UPGA 2DOSA 3A0BZ 2X0LA 3RVZA 4LBEC 2GTAA 1OCZC 3FYEB 4O2AA 4JI1O 3RYHA 2WLMA 5LMUB 5IY5C 4HNAA 1XL4A 4E2LA 1OHHG 1P84F 2CH7B 4HZ3A 1VQNV 4LNUA 1EN4A 1HNXO 1OCOB 1VQKV 4O4LA 2JEUA 3L70H 4DR1O 2IBZH 1Q43A 1QLEB 4LFCO 2ZM6B 3CE2A 2DWDC 5KMGA 4FLXA 1TAEA 3RYFB 1T5EA 5IYZB 2WSSG 3TCUA 2AHYA 1PNMA 5ITZA 1G8MA 4MW8A 1NH2D 1N33O 1I0HA 2ZNJA 3RN4A 4IYIA 4LF4B 2D2CB 2YC0A 3EHBB 4FZ0A 4RAIA 1GTOA 2DN9A 1SZTA 2QEXV 3JASB 3JATA 3TXQA 3OGCC 2LP7A 1NQTA 1NS1A 1VARA 2M6YA 2CH7A 5LGTA 4QE9A 1BQ0A 4DR6O 4MT8A 4O4HB 2W0FC 5BR8O 2OCCB 4K8XA 2AGAA 4ZOLB 3RFRA 3HKBB 3SJAC 3ABTA 4NXNB 3OFNG 1N0JA 1I94B 3OMIB 1MNGA 4DR4O 2Q8VA 1EBOA 3E86A 3FKSG 1AI6A 2C2AA 1H2SB 4L8JA 3C3SA 1XNRO 2EIJB 3JASA 5LGNA 5TISZ 3J80N 1KP3A 4NTYA 2EILC 3DTUB 4I9WA 3OW2U 1R6NA 2XNDG 2BOBC 4TUYA 3DGEA 3ZHRA 1AI5A 1DTOA 4ZOLA 4K8ZA 1PV0A 2EJ7A 1SQXH 3CCJV 3ZMZA 4N23A 3CB2A 3CJHB 4WFGA 5LMNO 2OCHA 2WLNA 2XHBA 5LGUA 4B08A 5EBWC 1ZSPA 3TXSA 3SPCA 2HLDG 1YI2V 1SQQH 1VQ7V 1FJGO 4KL1A 4LF9B 4DV2B 2EIKC 5FNVA 5KLVH 1ORQC 3IC9A 1IBLO 3SPGA 2FB5A 2E5LO 2ARHA 5B1BC 3HKEB 2IU0A 4DYLA 3WB2A 3VQXA 1XMOO 2QA4V 5L3FA 2X6CA 1V9PA 1WP8A 3UT5A 1N34B 2YEVB 4DV5B 1DGSA 2YI8A 1WPXA 2A9HA 1L8DA 2GSMB 1D5NA 5BZBA 1GH6A 4J10A 2Q4PA 1GRJA 1H2LA 3CMEV 1WB8A 3SPIA 3SJBC 1S72V 2EZOA 4JYAO 1NKDA 2JGDA 1AR5A 1HP8A 4MVZA 3D8CA 4UCUA 5LL6Y 1XL6A 3ZN1A 1NVPD 2KG7A 4J9ZB 1M57B 1OCOC 3HKEA 5EIBD 3AG4B 2Q69A 1SC5B 3H1LH 1BMFG 2YIDA 3D36A 4UVAA 2QWNB 2XUMA 1SQGA 3KZIZ 2YEVA 3AG7A 1EZVH 3RT3C 3PJSK 1NTKH 3SPHA 3RW0A 3JALB 1V55C 3ZHTA 2Y69C 4DV6O 2NR5A 2YICA 3TK1A 3BRCA 1AJPA 1H8HG 3QVNA 1I08A 1OCCB 1EFRG 5AG2A 2P06A 4I0XA 3FAVB 4CBCA 4LCUC 4TT3G 4DV4B 4LF6B 5L3BA 3U10A 4F4LA 3GB7C 4FLUA 5CBGA 2JJ2G 1YJNV 4JGSA 1KKDA 1K97A 1HR0B 1X4TA 4PDRA 4JAUA 4ICGA 2Q6AA 4R6ZA 1VF5B 2BTQA 3CEIA 1YITV 3M99B 5JQGB 2NLJC 2QWRB 2IJHA 3HPLC 3JALA 2KQXA 5JJNB 3A0RA 4WFFA 4Z1VA 4LF7B 2YIBD 4K0KO 1JQ0A 3G80A 2V7QG 3DXRA 1H2NA 3K9AA 3H9VA 1S5LZ 4JI0B 3ETGA 2OIEA 4BIOA 3WG7B 2HFEC 3T4DA 4F6RB 4RUEA 4DK0A 3ABUA 1KP2A 5LP6A 4GKKO 3CMAV 2QTOA 2DMXA 2W0XA 1PNLA 3WB0A 3ZMVA 3S3WA 1GN3A 3T1YB 1KECA 1H38A 1W0JG 3A8TA 3SPJA 4NKGB 4PA4A 2UXDB 2MW2B 5IJ9B 2LW1A 4DR3O 3O9OA 1H2KA 2CE4A 5H5NA 4F6RA 1HNZB 2PYJA 1TVKB 4KXRA 1Z5VA 1XHXA 4B7EA 2IM9A 5KAFZ 4MS2A 1VEWA 4QPKA 2ETNA 1B04A 1AJNA 5IT9N 4DUYB 3JSLA 4OPAA 1WJZA 1D5AA 4LH6A 1DLBA 4YJ2B 2M7WA 1XUQA 4I55B 4GKJB 3O65A 4DV0B 1QNMA 4LWSA 4UV9A 1JJOA 2FL4A 3I55V 5JH7A 3OTFA 3JD4A 4Z1MG 3BAAA 1M57C 4NVPA 5KHHA 5H6QA 1SKVA 1WB7A 3WU2Z 2ZNIA 4UUJC 4O4JA 3OEHG 3HKDB 1S77D 4IT5A 2UUBB 5CA0A 1NR1A 4QGPA 1MZEA 4JYBA 4YJ2A 1N4CA 4PDMA 4I55A 2EX3A 3LDEA 3TJTA 4X1KB 3JYCA 2ZDIA 3CC7V 5GTIZ 3W7XA 2X7RB 1QR9A 1DF4A 2V4DA 3F5WC 2IJKA 4JI1B 2BTOA 3IGAC 4ZHQA 4F6EA 3OTOO 5EZYA 3RBZA 5C8YB 1GM9A 3K03A 3UM7A 2Q0OC 3SDLA 2Q5ZA 3SYOA 2YI9A 3N27A 1LUWA 4DR1B 4LFCB 4R50A 1FKAO 1K4DC 4WF9V 4BAYA 2A7WA 3B8NA 2CTWA 3AG1C 2CAZC 4FFBB 1N33B 2Q67A 3U0ZA 3ZRWA 4FPPA 3R65A 3F5TA 2HVJC 5KUMA 4P9OA 4YHHO 3SYPA 3WG7C 3AG2B 3F7YC 5EBMC 5CB4A 2YDEA 1AILA 4FVMA 2ZIMA 3ZMSA 1PL0A 3ASNC 1VQOV 1M93A 1MA1A 4OPHA 3VBBA 4DR6B 1R6TA 4GZRB 3TETA 4IYHA 2ZD9A 5B3SC 1ZLZA 5K1PA 3T1YO 3T1HO 1NI8A 4PA9A 3K0GA 2PZSA 5L3CA 5CBFA 4J7ZA 4DR4B 4FFBA 1KQSU 5L3DA 3IAYA 1G6UA 3OT7A 4UFZA 1XNRB 3ML0A 2VWJA 3T1CA 2JK5C 2AZ2A 1FYJA 2RQ6A 2UUAO 3OGIB 3ZHUA 3OD4A 5JVDB 4TQFA 1S5HC 1FPOA 2P5OA 1EN6A 1X59A 1Y76A 4YJ3A 4X9QA 5JJEB 4DUZO 2LFSA 3X2QB 4Q20A 4X1YA 3RYIB 4AI8A 4I7ZB 4UCRA 4DK1A 5HFMA 4X88A 4MSWC 4GKJO 2BSKB 4RQEA 5B1AB 4L87A 4MTXA 5LMNB 4JTAB 1Y4MA 2DJVA 2B9ZA 1FFXB 2X6AA 3K79A 2H94A 5J2UB 1FJGB 4X65O 2BOCC 4QIWF 1MG1A 2P6JA 1IBKB 4O2AB 3CYOA 5IYBO 3RYHB 5IYDO 1RM1C 4HNAB 4FM2A 4XBFA 1IBLB 4LNUB 3JAWA 5KHGA 4O4LB 2OIGA 5KHJA 5KMGB 1VQ5V 4X89A 1JCHA 1XMOB 1URFA 1BQZA 2Y0IA 3OUSA 4JAVA 2IJIA 5E79Z 1E1RG 4YXWG 2IH3C 5ITZB 3B8MA 1HW7A 1JVMA 3FD9A 4DV1O 3RYCA 2E76B 3CCSV 2VRZA 2Y4UA 3JATB 1GMGA 4O4IA 5GW7A 4JYAB 4LFAO 3IFXA 1Q90D 3L73H 5H9CA 1IZ3A 4FZ1A 3C90A 4X20A 4IGGA 3WB1A 1UFIA 2ZE6A 2B1IA 2EJRA 1SS3A 3STZC 1J5EO 2UXCB 2CGOA 3K06A 3W7UA 1LNQA 1N0NA 1WAZA 1CPYA 4JI7O 2HJDA 4J7JA 4DV6B 1XNQB 2ADQB 4DW1A 5IE9A 2E3CA 1GKFA 2JEXA 1NU1H 4D6TH 4AQYO 1VQ4V 4PA7A 4TUYB 1KD1W 4FFKA 5LHIA 1B06A 3G67A 3A2FA 4ZBMA 3ASOB 2HR3A 4PD4F 1Q6UA 1V54B 3ZRXA 2WWWA 2JVDA 4LFBO 1Y6XA 3Q4HB 5BMVA 2Y48A 1MOFA 2W6IG 2QJ1A 3LSSA 1M4UA 1K5QA 1RP3B 1AB3A 4K0KB 3W7WA 3MDSA 2QR4A 3CC2V 3RVYA 2H8PC 5FNVB 3SYCA 1Q82W 1SZXA 3AK2A 4P30A 4G28B 1ZUQA 1GM7A 2H3OA 5CA1A 4EFEA 5EBLC 3X2QC 1S76D 1Q7YW 4GKKB 4OX9O 1JA8A 3SR2C 4H44B 3Q4HA 4TV8A 4I4TA 4WFHA 1I5YA 5IDJA 4GX0A 2MK3A 2WAMA 3D3IA 3UT5B 1ZTEA 2YIBA 1TGOA 1VQ6V 4I5SA 2Q68A 1KU9A 2EIMC 2P4VA 1IBKO 3HKCA 2ZIOA 2BCCH 5C93A 2ZCEA 2UU9O 4JI4O 4DR3B 4BIZA 2JGDB 1W2BU 1R1BA 2QWQB 4IIJB 1BZKA 1XDCA 3E8HA 3CP1A 3OR7C 2B5UA 2KG7B 2ODMA 1NBMG 1SQBH 1UJWB 4CH5A 4DV7O 4BWAA 3G6EV 3GWOA 4NXMO 3W7TA 1AI7A 2R72A 2QWOB 1JJ2U 2Q7GA 3T4ZA 4KP4A 1N36O 4J42A 2W6JG 4BW9A 3UKMA 2QKAA 4B3MO 3STLC 1VF6C 1EZJA 2E74B 4MVQA 4X64O 3K5LA 2OTJV 3ABKC 3P3NA 3L74H 1E1QG 2YXLA 4X62O 4DRXA 1Q6HA 4I0XB 4X1IA 5EYPB 1L1FA 3VOUA 4G2KA 1KMIZ 4IIJA 4CC5A 3ZMTA 4JI3O 4DW0A 2JIZG 3BCCH 2JJ1G 1KBHA 3NXSA 1IXMA 4H33A 5KHKA 1BL8A 1PPJH 1QLEC 3KG2A 2CK3G 1IBMO 2BTQB 1SQFA 4DR2O 2UXCO 1GN6A 5JCOA 4HYOA 2HG5C 3JD2A 3BHPA 2CDYA 3JSNA 1Y67A 1XNQO 2DWEC 3BPZA 4DR7B 5EYPA 5LYJA 3DXRB 1BT8A 4CC6A 4PDLA 1R3JC 3W7SA 2JRIA 5J2TA 3E22A 2A0LA 2EZPA 3E35A 4FLYA 2PY5A 2R9IA 3D3QA 1IXBA 4PI2A 2OCCC 1KKCA 3PN1A 3AG3B 2YUAA 4OGQB 5LP6B 4U7OA 4FIPC 3OTOB 3RWRD 4GX5A 4KFMA 3CRQA 1BCCH 1V54C 1G1XB 3UQ8A 2Z0AA 4X66O 2RNBA 3SJQC 2F95B 3MHSC 4XDJA 3SYQA 2EIJC 1JOYA 3ABMB 5JWPA 1TUBA 4GCZA 2OTLV 2E75B 4UVBA 5H2FZ 1NTMH 4W4KA 4KUMA 2LGQA 3OMAB 1F7YA 3ZRSA 4AILC 4YHHB 4J7KA 1FXKB 2FTKA 4JYYA 4RQFA 4JF3A 2ITDC 4A5UB 3ZIAG 4C7UA 1Z2GA 5B1OA 1K8AW 4GX1A 4BW5A 3JARB 2WLLA 2VWKA 2ZKOA 1VF7A 2RJZA 2YSUB 3T1HB 4LR3A 1H2MA 1NT2B 3EXAA 4WFBV 3BA9A 3NR7A 2HEPA 1BSMA 2JGUA 3R66A 5L3GA 2D3OW 3TGUH 2VQFO 4XDLA 1N32O 4LWSB 3CXHF 1EM1A 2WPDG 4EEQA 2Q9LA 4FLTA 1HDJA 1FXKA 2UUAB 2F43G 5JH7B 3ZHSA 3ETQA 2UUCB 2KKWA 1S3JA 4QPJA 1I7FA 1R3LC 5FPRA 4WFEA 3JARA 5KA6A 3KCXA 3UCSC 4DR5O 1M1KW 4DUZB 2KSDA 3D36C 3CXCU 5LA6A 3CHXA 2DYSB 2JDIG 1VQMV 4JI8O 4O4JB 3CCMV 5J9PC 5CA0B 2EULA 2P4KA 4J9YB 3B2EE 1PM9A 2P67A 5BXZA 4B3RO 1IURA 4EB6A 2HVKC 3GWKC 4UB8Z 1N8RW 3K08A 2QDOA 1R3IC 4X65B 2XTAA 3L72H 2DQ3A 2A79B 4ZHQB 3AG4C 1AROP 3B09A 4PHZA 5DN6G 5EZYB 3ZN0A 4CH4A 4MVOA 5IJ0A 1Q86W 4DR7O 4GLXA 2PYLA 1ZAUA 1A32A 1OCCC 3L71H 4MTGA 2IH1C 3DC5A 3ZHQA 3ZRWB 1YIJV 2F93B 1U96A 4DV1B 5DEDA 3AK1A 4E4EA 3JCUZ 1B3QA 1XREA 1ZX3A 4LFAB 5CB4B 1GO3F 1Y74A 5LP6C 4BIUA 1SETA 2P90A 1OCZB 5DM6V 5GONA 2DE0X 2GDSA 2UXNA 5IY5B 1WLEA 3CX5F 3OUFA 2OT5A 2Q7HA 1R73A 2LFRA 1J5EB 1O9GA 2IW5A 3ICXA 1NH2B 4JASA 4JTCB 3ABMC 3LSQA 4JI7B 1JMKC 4KHPB 4UCVA 2R9RB 3MHHC 4ZIBA 2LW7A 3FB8C 4PDVA 5B1NA 4B3SO 2K1EA 1YTFD 4AQYB 1GAXA 4LP8A 4BR6A 4H0LB 4CH6A 4LF5O 1Y76B 4YJ3B 1FD9A 5CN0A 1US6A 4TWKA 4X1YB 2EINB 4ZKIA 2WLIA 4MVUA 3A0HZ 1VQPV 4LFBB 1K73W 4U7NA 3L9DA 3ZHVA 3CD6V 2CUGA 2AW9A 1L0LH 3QO5A 4JV5O 3OE7G 4TV9B 2UUCO 3E83A 1YSCA 3FYIB 2YXHA 4QNHB 5CBHA 1O9HA 1AR4A 4ASUG 1XQ8A 1VQ9V 4U3JA 3JAWB 1H8EG 2EILB 3UO2A 1W0KG 4CS3A 1P4RA 5EC2C 1JR9A 2DYSC 4OX9B 2YXYA 4N21A 1Y66A 3G6BA 2DW4A 1YZBA 1K33A 3ABLB 3L75H 4GT1A 1OV9A 2P22C 3OM3B 1SQPH 1QLNA 1YEWA 2ZDIC 4TQDA 1PD3A 2B1GA 3RYCB 1VIBA 3QG5A 1KYOF 4TV9A 1GK9A 4GX2A 2VS0A 4EKWA 2HKOA 4O4IB 3K0DA 3KKYA 2UU9B 4JI4B 2HHHO 3CRMA 1TUEB 1F23A 1Q3EA 5KUKA 5LBQA 3QNEA 1WNSA 1LUVA 2N74A 4WCEV 3AK3A 4X20B 1FS0G 4DV7B 2PI4A 3FX7A 1Q5OA 1XI1A 4UVCA 4FM0A 4NXMB 1HNWO 2GUZA 3ZCCA 2ZE7A 3HR0A 4WBNB 1N36B 2AHZA 5B1BB 5JJJB 2L35A 4B3MB 2XAJA 5E1AC 1VP7A 4X64B 3CCVV 1U97A 4X62B 3BABA 3THOA 3CCQV 2DYRB 3CRAA 3MD0A 1RPOA 1NVPB 4JI3B 4NB5A 1AP5A 3EFFK 3JD3A 2ILMA 2JS3A 4PELA 5A9GA 1YF2A 1GN4A 2FKXA 1IBMB 4DR2B 4H37A 1WA8A 3VQYA 1ZWIC 4WBNA 4JI5O 5EC1C 2UXBO 4K3AA 3JAKA 3N2GB 4I50B 2F23A 5BMVB 2F1MA 1S5JA 4KHPO 2PF4E 2CTRA 4YIPA 3N2KA 3AEIA 1XMQO 1K5SA 4JAAA 3RGBA 1QU7A 2OYQA 5LOVA 3AG2C 1SA0A 1K92A 1V55B 1VF6A 3H1JH 3CRCA 2Y69B 1M90W 2QKSA 3SJCC 1K4CC 3DC6A 3JCZA 4CS4A 1ROPA 4O2BB 1ZL8B 5CA1B 3H1HH 4HBNA 3QF7A 2ZXWB 4FLZA 1GM8A 4RO2A 3N2GA 2EINC 1FFTB 1DF5A 1P7BA 4I50A 4TV8B 4I4TB 4X66B 1AP6A 2QGNA 1OJHA 2IU3A 4G27B 3I56V 4B3TO 5LHHA 2A06H 3RYFA 5IYZA 3MAQA 2R70A 3IJ4A 2LGWA 3G4SV 4P2ZA 3HKCB 1MMMA 2LJ2A 3ETEA 1BGYH 1IVSA 2GV9A 1SERA 4O2BA 4PV1B 1ZL8A 2FMLA 4J11A 4FLWA 3S3XA 3APQA 5KA5A 2GBOA 4AHCA 1K3EA 4LC1A 3LDDA 4O4HA 1JPXA 2YIAA 3HKBA 1R6KA 1BHAA 5B1AC 5IWAB 1G4YB 4CH3A 3ZJZA 3ABLC 4RWUA 3P32A 5LXTB 4PI0A 4DRXB 2F4VO 4JPRA 5HFLA 2VQFB 4X1IB 1N32B 4GUNA 1E79G 3K57A 1M9NA 4YY3O 1IDSA 4GYCB 1F4NA 2QKCA 4CS2A 4LH7A 3SYAA 1QVGU 1XOUA 3BA8A 1P7GA 3LSUA 4JI6O 2RN9A 3BVOA 4DR5B 2UXXA 5BY1A 3LNNA 5LHGA 3G71V 4JI8B 3SGIA 1QVFU 1Z5WA 5LXTA 4UCSA 4JI2O 4B3RB 2DQ0A 1F4MA 3CJHA 5LYJB 1THZA 4FMTA 1WPBA 1MSWD 5IWAO 1YXBA 5J2TB 1RSOB 3E22B 3JD1A 4NR1A 2DYRC 1VMGA 2EBOA 2XOKG 5LMUO 5EIBC 4FLVA 2WA4A 1K9MW 1DK1A 2WLJA 2XASA 1FAFA 1IX9A 3CCLV 2XAFA 2ZM6O 4RUFA 1YCIA 3B77A 4J41A 1QQCA 1TUBB 4LF4O 3E89A 1RSOA 1K7DA 4ZI7B 4LF8B 1QBZA 2N05A 2QM7A 1NTZH 2QM8A 1CEZA 2LQTA 2LO1A 3ASOC 1W59A 4CZZA 4D7SA 4JTDB 1WN7A 1PNKA 2N04A 3K5MA 1Q81W 3OEEG 3LUTB 2ZXWC 2WLLB 1OZ0A 4OXSA 1XEQA 4HAMA 2AXTZ 4DXWA 4NXNO 2FYUH 2RCVA 3VQWA 1I94O 3CPWU 1YJ9V 3CSXA 2GTSA 1VQ8V 1PL4A 5H6RA 1ENVA 2Y4TA 4ZI7A 2OWOA 5B5EZ 2RMKB 1PKXA 3AG1B 4JYCA 5FL7G 4MW3A 5B66Z 3KCYA 2Q7EA 3FB6C 2HJFC 4B3SB 2R9AA 1QHTA 3FAVA 1YHQV 1YTFB 3E8BA 3JD0A 2ADPA 2X6BA 3H01A 4LF5B 4D7TA 4JZGA 4FM1A 2YS8A 2CTPA 1NJIW 3WFVA 2PTMA 4NTXA 5LA6B
chains in the Genus database with same CATH topology
4JASA 4JTCB 3ABMC 3CCSV 1ORQC 3ASNB 3CCUV 1GMGA 3E8FA 3LSQA 5GW7A 3SPGA 3IFXA 4QJFB 1K34A 5B3SB 2R9RB 5B1BC 1J95A 3MHHC 4TSFG 4WFAV 5H9CA 3FB8C 4PDVA 5B1NA 2K1EA 2IU0A 1YTFD 1COWG 3CCEV 5L3FA 2X6CA 2QA4V 4LP8A 2B1IA 2EJRA 4X8AA 2YEVB 4DO2A 3K04A 3STZC 5CN0A 4TWKA 1WPXA 3K06A 3W7UA 1LNQA 2A9HA 5BZBA 2GSMB 2EINB 1VQLV 1KC8W 4ZKIA 3CMEV 2XAGA 2PI5A 1CPYA 2WLIA 4MVUA 3SPIA 1S72V 2EZOA 1NKDA 1VQPV 4UV8A 1K73W 4MVZA 4U7NA 1GKFA 2JEXA 1QR8A 1XL6A 3ZN1A 1NVPD 1VQ4V 4PA7A 4J9ZB 3CD6V 1M57B 1OCOC 3QO5A 3AG4B 2Q69A 1KD1W 5LHIA 3OE7G 1OCRB 1BMFG 4ZBMA 3E83A 3T2MA 1YSCA 3FYIB 3D36A 4UVAA 4QNHB 3ASOB 1HWYA 5CBHA 2HR3A 2ZR3A 2YEVA 2NNUA 4ASUG 3PJSK 1V54B 3ZRXA 1VQ9V 3SPHA 1H8EG 2EILB 3RW0A 2WWWA 1F51A 1V55C 1W0KG 2Y69C 1P4RA 5EC2C 1QCEA 3TK1A 1AJPA 2ITCC 1H8HG 2Y48A 1OCCB 1EFRG 2DYSC 3OMNB 1MOFA 2W6IG 1Y66A 3IC7A 3LSSA 4N21A 2DW4A 4CBCA 2ZQMA 4LCUC 4TT3G 5L3BA 1K5QA 1YJWV 1RM1B 4F4LA 4R7CA 3BEHA 3GB7C 1K33A 5CBGA 2JJ2G 3W7WA 3ABLB 3CCRV 4GT1A 1JX9A 1YJNV 4JGSA 1KKDA 3OM3B 1K97A 1QLNA 4PA6A 2ZDIC 2QE7G 3CC2V 1PD3A 4PDRA 4JAUA 2Q6AA 2B1GA 4R6ZA 3RVYA 2H8PC 3SYCA 1GK9A 4P9PA 1Q82W 4GX2A 4EKWA 1YITV 2HKOA 3M99B 4G28B 4P30A 2ZR2A 3K0DA 1FXVA 1GM7A 4R8CA 2NLJC 2GHYA 1TUEB 5EBLC 3X2QC 1S76D 1F23A 2IJHA 3HPLC 5KUKA 5LBQA 1Q7YW 3E2EA 3QNEA 3A0RA 4WFFA 3FB7C 5L3EA 1M56B 3AG3C 4WCEV 4WFHA 1I5YA 5IDJA 1JQ0A 1FS0G 2V7QG 4GX0A 2PI4A 2MK3A 4UVCA 2WAMA 3D3IA 2ATKC 3K9AA 4MTOA 5CA3A 1VQ6V 3ZCCA 4I5SA 3ETGA 2Q68A 4MVRA 2AHZA 5B1BB 2EIMC 3WG7B 2HFEC 3T4DA 3LNMB 2XAJA 5C93A 4RUEA 2WLIB 5E1AC 3ABUA 1KP2A 3E8GA 4BIZA 3CCVV 1MABG 4FK5C 1W2BU 3FB5C 3CMAV 2QTOA 3E8HA 3CP1A 3OR7C 2B5UA 3QO7A 3CCQV 2DYRB 3ZMUA 1NBMG 1UJWB 3MD0A 4MVSA 1PNLA 1RPOA 3G6EV 1NVPB 3ZMVA 3GWOA 3EFFK 4MVMA 3W7TA 4XDKA 3JD3A 1KECA 1AI7A 1FXKC 3K3WA 1W0JG 4PELA 1H38A 1H2GA 3OAAG 1JJ2U 3T4ZA 3SPJA 4KP4A 2W6JG 1RPRA 3UKMA 4H37A 4PA4A 2P7TC 1ZWIC 3STLC 3QO8A 5EC1C 1EZJA 3ZRVA 4MVQA 2OTJV 3ABKC 4MTFA 1E1QG 1AJQA 4MS2A 4UXNA 1B6QA 3AEIA 1L1FA 3VOUA 4G2KA 1K5SA 4QPKA 3ZMTA 1AJNA 2JIZG 2JJ1G 3NXSA 3AG2C 1K92A 1IXMA 1V55B 4H33A 2Y69B 1BL8A 1M90W 1QLEC 3KG2A 2CK3G 2QKSA 1K4CC 2V1DA 3JCZA 2WLKA 1ROPA 2HG5C 4HYOA 1DLBA 2M7WA 3JD2A 3P30A 1BHBA 1I5XA 2ZXWB 1GM8A 4RO2A 2EINC 1CP9A 1FFTB 2Z5UA 1DF5A 1P7BA 1FXHA 2DWEC 4UV9A 2IU3A 4PDLA 1R3JC 4G27B 3W7SA 3I55V 1SESA 3I56V 4QE7A 5LHHA 3BY6A 5EK0A 3ETDA 3JD4A 2A0LA 2IJJA 4Z1MG 1M57C 2EZPA 3E35A 2R9IA 3G4SV 4P2ZA 5H6QA 3ETEA 2OCCC 1OCRC 3OR6C 3AG3B 4UUJC 5CMUA 4U7OA 4FIPC 1SERA 3OEHG 4GX5A 4KFMA 1S77D 1NR1A 4JYBA 1V54C 4PDMA 1NR7A 3LDEA 3HB3B 4PA3A 5KA5A 2EIMB 3JYCA 1K3EA 2ZDIA 3SJQC 4LC1A 3LDDA 3MHSC 2EIKB 3CC7V 4XDJA 3W7XA 1S0VA 3SYQA 1AR1B 1JPXA 2X7RB 2EIJC 1JOYA 3ABMB 1QR9A 1AI4A 4GCZA 1R6KA 1BHAA 5B1AC 3CC4V 2OTLV 4UVBA 1DF4A 3F5WC 1G4YB 2IJKA 3ZJZA 3ABLC 2KB1A 3IGAC 4KUMA 3P32A 1R3KC 3OMAB 3ZRSA 1SRYA 2XAQA 3RBZA 2XAHA 1GM9A 2Z3YA 3K03A 4JPRA 5HFLA 3UM7A 1FXKB 2FTKA 3F7VC 4RQFA 4JF3A 1E79G 2ITDC 3SYOA 2WLHA 3ZIAG 4R50A 1M9NA 5B1OA 1K4DC 3LDCA 1K8AW 4GX1A 4BAYA 4WF9V 4BW5A 3B8NA 2WLLA 1F4NA 3AG1C 1M56C 4FJCC 5IYCO 3SYAA 3ABKB 2YSUB 1QVGU 2X0LA 2Q67A 3RVZA 4LBEC 3ZRWA 1OCZC 3FYEB 4FPPA 3R65A 4WFBV 2UXXA 2WLMA 5LHGA 5IY5C 3G71V 1XL4A 4E2LA 2HVJC 1OHHG 1QVFU 5KUMA 4HZ3A 4P9OA 1VQNV 3SYPA 5L3GA 1OCOB 1VQKV 2D3OW 3WG7C 4XDLA 3AG2B 3F7YC 5EBMC 2JEUA 2WPDG 2DQ0A 1QLEB 3ZMSA 1F4MA 1PL0A 2DWDC 3ASNC 1FXKA 1VQOV 1THZA 3VBBA 2F43G 4FMTA 1MSWD 1S3JA 3TETA 2WSSG 4QPJA 3TCUA 2AHYA 2ZD9A 5B3SC 1R3LC 3JD1A 2DYRC 4WFEA 1PNMA 1NH2D 1G8MA 4MW8A 2EBOA 5KA6A 4PA9A 3K0GA 2XOKG 5L3CA 3EHBB 1M1KW 5CBFA 4RAIA 1GTOA 3CXCU 1K9MW 1SZTA 1VQMV 2DYSB 2JDIG 2WLJA 1KQSU 2QEXV 5L3DA 2XASA 3CCMV 5J9PC 3OGCC 2LP7A 1NQTA 4J9YB 3ML0A 3T1CA 2JK5C 3CCLV 2P67A 2XAFA 5LGTA 4QE9A 4RUFA 3B77A 2HVKC 4MT8A 2W0FC 2OCCB 1S5HC 1N8RW 3K08A 3ABTA 3OFNG 1R3IC 3OMIB 3E89A 1K7DA 2LFSA 3X2QB 2DQ3A 2A79B 3AG4C 4Q20A 1AROP 1QBZA 5DN6G 1EBOA 2QM7A 2QM8A 3E86A 3FKSG 3ZN0A 5HFMA 1AI6A 4X88A 1CEZA 3ASOC 2C2AA 4MVOA 4CZZA 1Q86W 2EIJB 4MSWC 4RQEA 5LGNA 4JTDB 5B1AB 1PNKA 1KP3A 1Q81W 4L87A 3OEEG 4MTXA 2EILC 3DTUB 3LUTB 4JTAB 2ZXWC 1Y4MA 2WLLB 1OZ0A 4I9WA 3OW2U 1R6NA 2XNDG 2BOBC 4OXSA 3DGEA 4HAMA 2X6AA 1AI5A 1OCCC 2H94A 3K79A 1DTOA 4DXWA 4MTGA 2IH1C 2BOCC 3ZRWB 3CPWU 1YJ9V 1YIJV 1MG1A 2P6JA 4QIWF 1VQ8V 3CYOA 5IYBO 5IYDO 1RM1C 5H6RA 1ENVA 4XBFA 3CCJV 3ZMZA 3AG1B 1PKXA 4JYCA 5FL7G 4MW3A 4N23A 1GO3F 3FB6C 4WFGA 2HJFC 4BIUA 1SETA 1VQ5V 1YHQV 2P90A 1OCZB 2WLNA 3E8BA 4X89A 1JCHA 5LGUA 1YTFB 3JD0A 5DM6V 5EBWC 5IY5B 2UXNA 3OUSA 2IJIA 2HLDG 1WLEA 2X6BA 3H01A 4JAVA 1E1RG 3SPCA 1YI2V 1VQ7V 3OUFA 2IH3C 2OT5A 4YXWG 3B8MA 1JVMA 1R73A 2LFRA 2IW5A 1NJIW 3WFVA 2EIKC 1NH2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTC B;  2DYR C;  4WFE A;  5EBL C;  3X2Q C;  3ABM C;  3HPL C;  5KUK A;  4MW8 A;  4PDL A;  1ORQ C;  1R3J C;  4G27 B;  4PA9 A;  3FB7 C;  4WFF A;  3K0G A;  3E8F A;  3AG3 C;  4QE7 A;  3SPG A;  5CBF A;  4RAI A;  5EK0 A;  3IFX A;  4WFH A;  2A0L A;  4GX0 A;  1M57 C;  2WLJ A;  2R9R B;  5B1B C;  1J95 A;  2ATK C;  5J9P C;  3FB8 C;  4P2Z A;  4PDV A;  2K1E A;  3OGC C;  4J9Y B;  2OCC C;  1OCR C;  4MTO A;  3OR6 C;  2X6C A;  4UUJ C;  3T1C A;  2JK5 C;  4LP8 A;  2Q68 A;  4MVR A;  2AHZ A;  4GX5 A;  2EIM C;  4KFM A;  4QE9 A;  2HFE C;  4RUF A;  3LNM B;  4X8A A;  3T4D A;  4RUE A;  1V54 C;  3K04 A;  2HVK C;  3STZ C;  2WLI B;  4PDM A;  2W0F C;  5E1A C;  4TWK A;  2DWE C;  3K06 A;  1LNQ A;  3E8G A;  1S5H C;  2A9H A;  5BZB A;  3K08 A;  3LDE A;  3FB5 C;  4PA3 A;  3JYC A;  1R3I C;  2QTO A;  3SJQ C;  3LDD A;  3E89 A;  2WLI A;  4MVU A;  3E8H A;  4XDJ A;  3SPI A;  3OR7 C;  3SYQ A;  2EIJ C;  2A79 B;  3AG4 C;  4MVS A;  4MVZ A;  5B1A C;  3EFF K;  4MVM A;  3E86 A;  1G4Y B;  3F5W C;  1XL6 A;  4X88 A;  4XDK A;  3ASO C;  4MVO A;  3ZJZ A;  3ABL C;  2KB1 A;  4J9Z B;  4PA7 A;  3IGA C;  1OCO C;  1R3K C;  4MSW C;  2Q69 A;  3T4Z A;  3SPJ A;  3ZRS A;  4JTD B;  3RBZ A;  3UKM A;  4H37 A;  4PA4 A;  2P7T C;  4ZBM A;  3T2M A;  2EIL C;  3E83 A;  3LUT B;  4JTA B;  2ZXW C;  3K03 A;  3UM7 A;  4QNH B;  1ZWI C;  2WLL B;  3STL C;  4I9W A;  3F7V C;  5EC1 C;  5CBH A;  4MVQ A;  2ITD C;  2BOB C;  3SYO A;  4OXS A;  3ABK C;  2WLH A;  4MTF A;  2YEV A;  4R50 A;  2X6A A;  1K4D C;  1OCC C;  3LDC A;  4DXW A;  3PJS K;  4GX1 A;  4MTG A;  2IH1 C;  4BW5 A;  2BOC C;  3SPH A;  3RW0 A;  5B3S C;  2WLL A;  1V55 C;  3AG1 C;  4MS2 A;  2Y69 C;  5EC2 C;  3VOU A;  1M56 C;  3SYA A;  2ITC C;  2DYS C;  2Q67 A;  3RVZ A;  4LBE C;  1OCZ C;  4CBC A;  3AG2 C;  4LCU C;  3R65 A;  4H33 A;  2WLM A;  1BL8 A;  5IY5 C;  4F4L A;  1XL4 A;  4MW3 A;  4R7C A;  1QLE C;  2HVJ C;  3BEH A;  3GB7 C;  2QKS A;  3KG2 A;  1K4C C;  4HZ3 A;  5KUM A;  5CBG A;  4P9O A;  3FB6 C;  3SYP A;  4WFG A;  2HJF C;  1KKD A;  2WLN A;  4X89 A;  3E8B A;  3WG7 C;  4XDL A;  4PA6 A;  3F7Y C;  2WLK A;  4HYO A;  2HG5 C;  4PDR A;  5EBM C;  2Q6A A;  4R6Z A;  5EBW C;  3RVY A;  3OUS A;  3SPC A;  2H8P C;  2X6B A;  3SYC A;  3OUF A;  2IH3 C;  2DWD C;  3ASN C;  4P9P A;  4GX2 A;  4EKW A;  4RO2 A;  1JVM A;  2EIN C;  4P30 A;  4G28 B;  3K0D A;  1P7B A;  4R8C A;  3TET A;  3TCU A;  2EIK C;  2AHY A;  2ZD9 A;  1R3L C;  2NLJ C; 
#chains in the Genus database with same CATH topology
 1NZ6 A;  3ASN B;  3CCU V;  3E8F A;  4EFB A;  1LR1 A;  2NN4 A;  5JQG A;  2ZIN A;  4IL6 Z;  4QJF B;  1K34 A;  5B3S B;  2VQE B;  1J95 A;  4TSF G;  4WFA V;  4EB6 B;  1COW G;  3CCE V;  1MSD A;  4DV3 B;  4JV5 B;  4X8A A;  3B4S A;  5K1X A;  4DO2 A;  3K04 A;  4LF9 O;  4DV2 O;  1VQL V;  1P49 A;  1L0N H;  2PUS A;  1KC8 W;  2XAG A;  4UCO A;  2PI5 A;  3M8A A;  5IJ0 B;  4UV8 A;  2QTS A;  5JCO C;  3C3T A;  1QR8 A;  2AZ0 A;  5GTH Z;  1EN5 A;  1N34 O;  1MZF A;  1OCR B;  3ZX6 A;  2WA3 A;  3T2M A;  4DV5 O;  1HWY A;  2ZR3 A;  1SQV H;  4B7K A;  1TA8 A;  2NNU A;  3UO3 A;  4J80 A;  2PGG A;  5IJ9 A;  1F51 A;  1QCE A;  2HHH B;  2ITC C;  1Y74 B;  1TVK A;  3OMN B;  3IC7 A;  2ZQM A;  3FFQ A;  5GON B;  4Z2W A;  1Q6I A;  3VQV A;  3H1K H;  1RM1 B;  1YJW V;  4R7C A;  3BEH A;  3ZS8 C;  3JAM N;  3P3P A;  1HNW B;  3CCR V;  1JX9 A;  2BE3 A;  4PA6 A;  2QE7 G;  3M7M X;  4NYK A;  2ZT9 B;  4P9P A;  4LF8 O;  1KUQ A;  1Q8I A;  5A2Q N;  2ZR2 A;  1M5I A;  1FXV A;  4R8C A;  2GHY A;  1YVW A;  3E2E A;  4PJ0 Z;  2K9P A;  3FB7 C;  3I5D A;  5L3E A;  1M56 B;  3AG3 C;  4DV4 O;  4LF6 O;  3APO A;  2ATK C;  1XIL A;  2ZE5 A;  4MTO A;  1HR0 O;  5CA3 A;  3ZED A;  1AVM A;  4MVR A;  1JFF B;  1BS3 A;  3K59 A;  5D5P A;  3LNM B;  1KB9 F;  2WLI B;  4JI5 B;  1HNX B;  2UXB B;  3E8G A;  1MAB G;  4FK5 C;  3FB5 C;  3HKD A;  3QO7 A;  3ZMU A;  4LF7 O;  1YDX A;  1XMQ B;  4MVS A;  4UB6 Z;  4X1K A;  1WP7 A;  4MVM A;  4XDK A;  2CTQ A;  1FXK C;  3K3W A;  1H2G A;  3K9S A;  4NTW A;  3OAA G;  4JI0 O;  2Q0A A;  2Y0P A;  1RPR A;  3CRR A;  2A3Q A;  2HP8 A;  2P7T C;  4U3J B;  1XHZ A;  5FLX N;  3QO8 A;  1JFF A;  4UCT A;  3ZRV A;  3U11 A;  4MTF A;  1GN2 A;  5C8Y A;  5D5Q A;  1AJQ A;  1RFY A;  4I9Q A;  4UXN A;  1B6Q A;  5F2V O;  2VQE O;  5BR8 B;  1BE3 H;  2O57 A;  4U3F H;  2G38 A;  4B3T B;  3BFR A;  4DV3 O;  3B40 A;  1D2D A;  4ABM A;  2CGN A;  1SF9 A;  3QTC A;  2UXD O;  2V1D A;  2WLK A;  3P30 A;  1HNZ O;  1BHB A;  1I5X A;  4IHJ B;  3ZBH A;  3H1I H;  2RDC A;  1CP9 A;  2Z5U A;  1XBL A;  5KHI A;  1FXH A;  2QSA A;  2ZE8 A;  1SES A;  2Q73 A;  4DUY O;  2GUZ B;  4QE7 A;  4Q6G A;  3BY6 A;  4YIO A;  5EK0 A;  3ETD A;  2IJJ A;  3CWB H;  1PP9 H;  5KX5 B;  2QM4 A;  1OCR C;  3OR6 C;  2F66 C;  5CMU A;  2F4V B;  1NR7 A;  4DV0 O;  1CXZ B;  4IHJ A;  5FPO A;  3K58 A;  3HB3 B;  4PA3 A;  2EIM B;  4JZ2 A;  4YY3 B;  3J81 N;  2EIK B;  4K35 A;  1S0V A;  1AR1 B;  5JVD A;  3DSQ A;  3GVM A;  1AI4 A;  2JS5 A;  3CC4 V;  2QWP B;  4JI6 B;  3EVK A;  1WA8 B;  2KB1 A;  1R3K C;  3JAK B;  4W4L A;  3RYI A;  5KX5 A;  2E5L B;  2XT9 A;  1SRY A;  2XAQ A;  5DEC A;  2UUB O;  2XAH A;  2L6L A;  3K5N A;  2Z3Y A;  3F7V C;  3N2K B;  2BSK A;  4JI2 B;  2WLH A;  3LDC A;  5LOV B;  5KAI Z;  1SA0 B;  3CS5 A;  3J7A U;  1M56 C;  1FFX A;  3K5O A;  4FJC C;  4TOI A;  5IYC O;  3ABK B;  4H13 B;  5J2U A;  1UPG A;  2DOS A;  3A0B Z;  2X0L A;  3RVZ A;  4LBE C;  2GTA A;  1OCZ C;  3FYE B;  4O2A A;  4JI1 O;  3RYH A;  2WLM A;  5LMU B;  5IY5 C;  4HNA A;  1XL4 A;  4E2L A;  1OHH G;  1P84 F;  2CH7 B;  4HZ3 A;  1VQN V;  4LNU A;  1EN4 A;  1HNX O;  1OCO B;  1VQK V;  4O4L A;  2JEU A;  3L70 H;  4DR1 O;  2IBZ H;  1Q43 A;  1QLE B;  4LFC O;  2ZM6 B;  3CE2 A;  2DWD C;  5KMG A;  4FLX A;  1TAE A;  3RYF B;  1T5E A;  5IYZ B;  2WSS G;  3TCU A;  2AHY A;  1PNM A;  5ITZ A;  1G8M A;  4MW8 A;  1NH2 D;  1N33 O;  1I0H A;  2ZNJ A;  3RN4 A;  4IYI A;  4LF4 B;  2D2C B;  2YC0 A;  3EHB B;  4FZ0 A;  4RAI A;  1GTO A;  2DN9 A;  1SZT A;  2QEX V;  3JAS B;  3JAT A;  3TXQ A;  3OGC C;  2LP7 A;  1NQT A;  1NS1 A;  1VAR A;  2M6Y A;  2CH7 A;  5LGT A;  4QE9 A;  1BQ0 A;  4DR6 O;  4MT8 A;  4O4H B;  2W0F C;  5BR8 O;  2OCC B;  4K8X A;  2AGA A;  4ZOL B;  3RFR A;  3HKB B;  3SJA C;  3ABT A;  4NXN B;  3OFN G;  1N0J A;  1I94 B;  3OMI B;  1MNG A;  4DR4 O;  2Q8V A;  1EBO A;  3E86 A;  3FKS G;  1AI6 A;  2C2A A;  1H2S B;  4L8J A;  3C3S A;  1XNR O;  2EIJ B;  3JAS A;  5LGN A;  5TIS Z;  3J80 N;  1KP3 A;  4NTY A;  2EIL C;  3DTU B;  4I9W A;  3OW2 U;  1R6N A;  2XND G;  2BOB C;  4TUY A;  3DGE A;  3ZHR A;  1AI5 A;  1DTO A;  4ZOL A;  4K8Z A;  1PV0 A;  2EJ7 A;  1SQX H;  3CCJ V;  3ZMZ A;  4N23 A;  3CB2 A;  3CJH B;  4WFG A;  5LMN O;  2OCH A;  2WLN A;  2XHB A;  5LGU A;  4B08 A;  5EBW C;  1ZSP A;  3TXS A;  3SPC A;  2HLD G;  1YI2 V;  1SQQ H;  1VQ7 V;  1FJG O;  4KL1 A;  4LF9 B;  4DV2 B;  2EIK C;  5FNV A;  5KLV H;  1ORQ C;  3IC9 A;  1IBL O;  3SPG A;  2FB5 A;  2E5L O;  2ARH A;  5B1B C;  3HKE B;  2IU0 A;  4DYL A;  3WB2 A;  3VQX A;  1XMO O;  2QA4 V;  5L3F A;  2X6C A;  1V9P A;  1WP8 A;  3UT5 A;  1N34 B;  2YEV B;  4DV5 B;  1DGS A;  2YI8 A;  1WPX A;  2A9H A;  1L8D A;  2GSM B;  1D5N A;  5BZB A;  1GH6 A;  4J10 A;  2Q4P A;  1GRJ A;  1H2L A;  3CME V;  1WB8 A;  3SPI A;  3SJB C;  1S72 V;  2EZO A;  4JYA O;  1NKD A;  2JGD A;  1AR5 A;  1HP8 A;  4MVZ A;  3D8C A;  4UCU A;  5LL6 Y;  1XL6 A;  3ZN1 A;  1NVP D;  2KG7 A;  4J9Z B;  1M57 B;  1OCO C;  3HKE A;  5EIB D;  3AG4 B;  2Q69 A;  1SC5 B;  3H1L H;  1BMF G;  2YID A;  3D36 A;  4UVA A;  2QWN B;  2XUM A;  1SQG A;  3KZI Z;  2YEV A;  3AG7 A;  1EZV H;  3RT3 C;  3PJS K;  1NTK H;  3SPH A;  3RW0 A;  3JAL B;  1V55 C;  3ZHT A;  2Y69 C;  4DV6 O;  2NR5 A;  2YIC A;  3TK1 A;  3BRC A;  1AJP A;  1H8H G;  3QVN A;  1I08 A;  1OCC B;  1EFR G;  5AG2 A;  2P06 A;  4I0X A;  3FAV B;  4CBC A;  4LCU C;  4TT3 G;  4DV4 B;  4LF6 B;  5L3B A;  3U10 A;  4F4L A;  3GB7 C;  4FLU A;  5CBG A;  2JJ2 G;  1YJN V;  4JGS A;  1KKD A;  1K97 A;  1HR0 B;  1X4T A;  4PDR A;  4JAU A;  4ICG A;  2Q6A A;  4R6Z A;  1VF5 B;  2BTQ A;  3CEI A;  1YIT V;  3M99 B;  5JQG B;  2NLJ C;  2QWR B;  2IJH A;  3HPL C;  3JAL A;  2KQX A;  5JJN B;  3A0R A;  4WFF A;  4Z1V A;  4LF7 B;  2YIB D;  4K0K O;  1JQ0 A;  3G80 A;  2V7Q G;  3DXR A;  1H2N A;  3K9A A;  3H9V A;  1S5L Z;  4JI0 B;  3ETG A;  2OIE A;  4BIO A;  3WG7 B;  2HFE C;  3T4D A;  4F6R B;  4RUE A;  4DK0 A;  3ABU A;  1KP2 A;  5LP6 A;  4GKK O;  3CMA V;  2QTO A;  2DMX A;  2W0X A;  1PNL A;  3WB0 A;  3ZMV A;  3S3W A;  1GN3 A;  3T1Y B;  1KEC A;  1H38 A;  1W0J G;  3A8T A;  3SPJ A;  4NKG B;  4PA4 A;  2UXD B;  2MW2 B;  5IJ9 B;  2LW1 A;  4DR3 O;  3O9O A;  1H2K A;  2CE4 A;  5H5N A;  4F6R A;  1HNZ B;  2PYJ A;  1TVK B;  4KXR A;  1Z5V A;  1XHX A;  4B7E A;  2IM9 A;  5KAF Z;  4MS2 A;  1VEW A;  4QPK A;  2ETN A;  1B04 A;  1AJN A;  5IT9 N;  4DUY B;  3JSL A;  4OPA A;  1WJZ A;  1D5A A;  4LH6 A;  1DLB A;  4YJ2 B;  2M7W A;  1XUQ A;  4I55 B;  4GKJ B;  3O65 A;  4DV0 B;  1QNM A;  4LWS A;  4UV9 A;  1JJO A;  2FL4 A;  3I55 V;  5JH7 A;  3OTF A;  3JD4 A;  4Z1M G;  3BAA A;  1M57 C;  4NVP A;  5KHH A;  5H6Q A;  1SKV A;  1WB7 A;  3WU2 Z;  2ZNI A;  4UUJ C;  4O4J A;  3OEH G;  3HKD B;  1S77 D;  4IT5 A;  2UUB B;  5CA0 A;  1NR1 A;  4QGP A;  1MZE A;  4JYB A;  4YJ2 A;  1N4C A;  4PDM A;  4I55 A;  2EX3 A;  3LDE A;  3TJT A;  4X1K B;  3JYC A;  2ZDI A;  3CC7 V;  5GTI Z;  3W7X A;  2X7R B;  1QR9 A;  1DF4 A;  2V4D A;  3F5W C;  2IJK A;  4JI1 B;  2BTO A;  3IGA C;  4ZHQ A;  4F6E A;  3OTO O;  5EZY A;  3RBZ A;  5C8Y B;  1GM9 A;  3K03 A;  3UM7 A;  2Q0O C;  3SDL A;  2Q5Z A;  3SYO A;  2YI9 A;  3N27 A;  1LUW A;  4DR1 B;  4LFC B;  4R50 A;  1FKA O;  1K4D C;  4WF9 V;  4BAY A;  2A7W A;  3B8N A;  2CTW A;  3AG1 C;  2CAZ C;  4FFB B;  1N33 B;  2Q67 A;  3U0Z A;  3ZRW A;  4FPP A;  3R65 A;  3F5T A;  2HVJ C;  5KUM A;  4P9O A;  4YHH O;  3SYP A;  3WG7 C;  3AG2 B;  3F7Y C;  5EBM C;  5CB4 A;  2YDE A;  1AIL A;  4FVM A;  2ZIM A;  3ZMS A;  1PL0 A;  3ASN C;  1VQO V;  1M93 A;  1MA1 A;  4OPH A;  3VBB A;  4DR6 B;  1R6T A;  4GZR B;  3TET A;  4IYH A;  2ZD9 A;  5B3S C;  1ZLZ A;  5K1P A;  3T1Y O;  3T1H O;  1NI8 A;  4PA9 A;  3K0G A;  2PZS A;  5L3C A;  5CBF A;  4J7Z A;  4DR4 B;  4FFB A;  1KQS U;  5L3D A;  3IAY A;  1G6U A;  3OT7 A;  4UFZ A;  1XNR B;  3ML0 A;  2VWJ A;  3T1C A;  2JK5 C;  2AZ2 A;  1FYJ A;  2RQ6 A;  2UUA O;  3OGI B;  3ZHU A;  3OD4 A;  5JVD B;  4TQF A;  1S5H C;  1FPO A;  2P5O A;  1EN6 A;  1X59 A;  1Y76 A;  4YJ3 A;  4X9Q A;  5JJE B;  4DUZ O;  2LFS A;  3X2Q B;  4Q20 A;  4X1Y A;  3RYI B;  4AI8 A;  4I7Z B;  4UCR A;  4DK1 A;  5HFM A;  4X88 A;  4MSW C;  4GKJ O;  2BSK B;  4RQE A;  5B1A B;  4L87 A;  4MTX A;  5LMN B;  4JTA B;  1Y4M A;  2DJV A;  2B9Z A;  1FFX B;  2X6A A;  3K79 A;  2H94 A;  5J2U B;  1FJG B;  4X65 O;  2BOC C;  4QIW F;  1MG1 A;  2P6J A;  1IBK B;  4O2A B;  3CYO A;  5IYB O;  3RYH B;  5IYD O;  1RM1 C;  4HNA B;  4FM2 A;  4XBF A;  1IBL B;  4LNU B;  3JAW A;  5KHG A;  4O4L B;  2OIG A;  5KHJ A;  5KMG B;  1VQ5 V;  4X89 A;  1JCH A;  1XMO B;  1URF A;  1BQZ A;  2Y0I A;  3OUS A;  4JAV A;  2IJI A;  5E79 Z;  1E1R G;  4YXW G;  2IH3 C;  5ITZ B;  3B8M A;  1HW7 A;  1JVM A;  3FD9 A;  4DV1 O;  3RYC A;  2E76 B;  3CCS V;  2VRZ A;  2Y4U A;  3JAT B;  1GMG A;  4O4I A;  5GW7 A;  4JYA B;  4LFA O;  3IFX A;  1Q90 D;  3L73 H;  5H9C A;  1IZ3 A;  4FZ1 A;  3C90 A;  4X20 A;  4IGG A;  3WB1 A;  1UFI A;  2ZE6 A;  2B1I A;  2EJR A;  1SS3 A;  3STZ C;  1J5E O;  2UXC B;  2CGO A;  3K06 A;  3W7U A;  1LNQ A;  1N0N A;  1WAZ A;  1CPY A;  4JI7 O;  2HJD A;  4J7J A;  4DV6 B;  1XNQ B;  2ADQ B;  4DW1 A;  5IE9 A;  2E3C A;  1GKF A;  2JEX A;  1NU1 H;  4D6T H;  4AQY O;  1VQ4 V;  4PA7 A;  4TUY B;  1KD1 W;  4FFK A;  5LHI A;  1B06 A;  3G67 A;  3A2F A;  4ZBM A;  3ASO B;  2HR3 A;  4PD4 F;  1Q6U A;  1V54 B;  3ZRX A;  2WWW A;  2JVD A;  4LFB O;  1Y6X A;  3Q4H B;  5BMV A;  2Y48 A;  1MOF A;  2W6I G;  2QJ1 A;  3LSS A;  1M4U A;  1K5Q A;  1RP3 B;  1AB3 A;  4K0K B;  3W7W A;  3MDS A;  2QR4 A;  3CC2 V;  3RVY A;  2H8P C;  5FNV B;  3SYC A;  1Q82 W;  1SZX A;  3AK2 A;  4P30 A;  4G28 B;  1ZUQ A;  1GM7 A;  2H3O A;  5CA1 A;  4EFE A;  5EBL C;  3X2Q C;  1S76 D;  1Q7Y W;  4GKK B;  4OX9 O;  1JA8 A;  3SR2 C;  4H44 B;  3Q4H A;  4TV8 A;  4I4T A;  4WFH A;  1I5Y A;  5IDJ A;  4GX0 A;  2MK3 A;  2WAM A;  3D3I A;  3UT5 B;  1ZTE A;  2YIB A;  1TGO A;  1VQ6 V;  4I5S A;  2Q68 A;  1KU9 A;  2EIM C;  2P4V A;  1IBK O;  3HKC A;  2ZIO A;  2BCC H;  5C93 A;  2ZCE A;  2UU9 O;  4JI4 O;  4DR3 B;  4BIZ A;  2JGD B;  1W2B U;  1R1B A;  2QWQ B;  4IIJ B;  1BZK A;  1XDC A;  3E8H A;  3CP1 A;  3OR7 C;  2B5U A;  2KG7 B;  2ODM A;  1NBM G;  1SQB H;  1UJW B;  4CH5 A;  4DV7 O;  4BWA A;  3G6E V;  3GWO A;  4NXM O;  3W7T A;  1AI7 A;  2R72 A;  2QWO B;  1JJ2 U;  2Q7G A;  3T4Z A;  4KP4 A;  1N36 O;  4J42 A;  2W6J G;  4BW9 A;  3UKM A;  2QKA A;  4B3M O;  3STL C;  1VF6 C;  1EZJ A;  2E74 B;  4MVQ A;  4X64 O;  3K5L A;  2OTJ V;  3ABK C;  3P3N A;  3L74 H;  1E1Q G;  2YXL A;  4X62 O;  4DRX A;  1Q6H A;  4I0X B;  4X1I A;  5EYP B;  1L1F A;  3VOU A;  4G2K A;  1KMI Z;  4IIJ A;  4CC5 A;  3ZMT A;  4JI3 O;  4DW0 A;  2JIZ G;  3BCC H;  2JJ1 G;  1KBH A;  3NXS A;  1IXM A;  4H33 A;  5KHK A;  1BL8 A;  1PPJ H;  1QLE C;  3KG2 A;  2CK3 G;  1IBM O;  2BTQ B;  1SQF A;  4DR2 O;  2UXC O;  1GN6 A;  5JCO A;  4HYO A;  2HG5 C;  3JD2 A;  3BHP A;  2CDY A;  3JSN A;  1Y67 A;  1XNQ O;  2DWE C;  3BPZ A;  4DR7 B;  5EYP A;  5LYJ A;  3DXR B;  1BT8 A;  4CC6 A;  4PDL A;  1R3J C;  3W7S A;  2JRI A;  5J2T A;  3E22 A;  2A0L A;  2EZP A;  3E35 A;  4FLY A;  2PY5 A;  2R9I A;  3D3Q A;  1IXB A;  4PI2 A;  2OCC C;  1KKC A;  3PN1 A;  3AG3 B;  2YUA A;  4OGQ B;  5LP6 B;  4U7O A;  4FIP C;  3OTO B;  3RWR D;  4GX5 A;  4KFM A;  3CRQ A;  1BCC H;  1V54 C;  1G1X B;  3UQ8 A;  2Z0A A;  4X66 O;  2RNB A;  3SJQ C;  2F95 B;  3MHS C;  4XDJ A;  3SYQ A;  2EIJ C;  1JOY A;  3ABM B;  5JWP A;  1TUB A;  4GCZ A;  2OTL V;  2E75 B;  4UVB A;  5H2F Z;  1NTM H;  4W4K A;  4KUM A;  2LGQ A;  3OMA B;  1F7Y A;  3ZRS A;  4AIL C;  4YHH B;  4J7K A;  1FXK B;  2FTK A;  4JYY A;  4RQF A;  4JF3 A;  2ITD C;  4A5U B;  3ZIA G;  4C7U A;  1Z2G A;  5B1O A;  1K8A W;  4GX1 A;  4BW5 A;  3JAR B;  2WLL A;  2VWK A;  2ZKO A;  1VF7 A;  2RJZ A;  2YSU B;  3T1H B;  4LR3 A;  1H2M A;  1NT2 B;  3EXA A;  4WFB V;  3BA9 A;  3NR7 A;  2HEP A;  1BSM A;  2JGU A;  3R66 A;  5L3G A;  2D3O W;  3TGU H;  2VQF O;  4XDL A;  1N32 O;  4LWS B;  3CXH F;  1EM1 A;  2WPD G;  4EEQ A;  2Q9L A;  4FLT A;  1HDJ A;  1FXK A;  2UUA B;  2F43 G;  5JH7 B;  3ZHS A;  3ETQ A;  2UUC B;  2KKW A;  1S3J A;  4QPJ A;  1I7F A;  1R3L C;  5FPR A;  4WFE A;  3JAR A;  5KA6 A;  3KCX A;  3UCS C;  4DR5 O;  1M1K W;  4DUZ B;  2KSD A;  3D36 C;  3CXC U;  5LA6 A;  3CHX A;  2DYS B;  2JDI G;  1VQM V;  4JI8 O;  4O4J B;  3CCM V;  5J9P C;  5CA0 B;  2EUL A;  2P4K A;  4J9Y B;  3B2E E;  1PM9 A;  2P67 A;  5BXZ A;  4B3R O;  1IUR A;  4EB6 A;  2HVK C;  3GWK C;  4UB8 Z;  1N8R W;  3K08 A;  2QDO A;  1R3I C;  4X65 B;  2XTA A;  3L72 H;  2DQ3 A;  2A79 B;  4ZHQ B;  3AG4 C;  1ARO P;  3B09 A;  4PHZ A;  5DN6 G;  5EZY B;  3ZN0 A;  4CH4 A;  4MVO A;  5IJ0 A;  1Q86 W;  4DR7 O;  4GLX A;  2PYL A;  1ZAU A;  1A32 A;  1OCC C;  3L71 H;  4MTG A;  2IH1 C;  3DC5 A;  3ZHQ A;  3ZRW B;  1YIJ V;  2F93 B;  1U96 A;  4DV1 B;  5DED A;  3AK1 A;  4E4E A;  3JCU Z;  1B3Q A;  1XRE A;  1ZX3 A;  4LFA B;  5CB4 B;  1GO3 F;  1Y74 A;  5LP6 C;  4BIU A;  1SET A;  2P90 A;  1OCZ B;  5DM6 V;  5GON A;  2DE0 X;  2GDS A;  2UXN A;  5IY5 B;  1WLE A;  3CX5 F;  3OUF A;  2OT5 A;  2Q7H A;  1R73 A;  2LFR A;  1J5E B;  1O9G A;  2IW5 A;  3ICX A;  1NH2 B;  4JAS A;  4JTC B;  3ABM C;  3LSQ A;  4JI7 B;  1JMK C;  4KHP B;  4UCV A;  2R9R B;  3MHH C;  4ZIB A;  2LW7 A;  3FB8 C;  4PDV A;  5B1N A;  4B3S O;  2K1E A;  1YTF D;  4AQY B;  1GAX A;  4LP8 A;  4BR6 A;  4H0L B;  4CH6 A;  4LF5 O;  1Y76 B;  4YJ3 B;  1FD9 A;  5CN0 A;  1US6 A;  4TWK A;  4X1Y B;  2EIN B;  4ZKI A;  2WLI A;  4MVU A;  3A0H Z;  1VQP V;  4LFB B;  1K73 W;  4U7N A;  3L9D A;  3ZHV A;  3CD6 V;  2CUG A;  2AW9 A;  1L0L H;  3QO5 A;  4JV5 O;  3OE7 G;  4TV9 B;  2UUC O;  3E83 A;  1YSC A;  3FYI B;  2YXH A;  4QNH B;  5CBH A;  1O9H A;  1AR4 A;  4ASU G;  1XQ8 A;  1VQ9 V;  4U3J A;  3JAW B;  1H8E G;  2EIL B;  3UO2 A;  1W0K G;  4CS3 A;  1P4R A;  5EC2 C;  1JR9 A;  2DYS C;  4OX9 B;  2YXY A;  4N21 A;  1Y66 A;  3G6B A;  2DW4 A;  1YZB A;  1K33 A;  3ABL B;  3L75 H;  4GT1 A;  1OV9 A;  2P22 C;  3OM3 B;  1SQP H;  1QLN A;  1YEW A;  2ZDI C;  4TQD A;  1PD3 A;  2B1G A;  3RYC B;  1VIB A;  3QG5 A;  1KYO F;  4TV9 A;  1GK9 A;  4GX2 A;  2VS0 A;  4EKW A;  2HKO A;  4O4I B;  3K0D A;  3KKY A;  2UU9 B;  4JI4 B;  2HHH O;  3CRM A;  1TUE B;  1F23 A;  1Q3E A;  5KUK A;  5LBQ A;  3QNE A;  1WNS A;  1LUV A;  2N74 A;  4WCE V;  3AK3 A;  4X20 B;  1FS0 G;  4DV7 B;  2PI4 A;  3FX7 A;  1Q5O A;  1XI1 A;  4UVC A;  4FM0 A;  4NXM B;  1HNW O;  2GUZ A;  3ZCC A;  2ZE7 A;  3HR0 A;  4WBN B;  1N36 B;  2AHZ A;  5B1B B;  5JJJ B;  2L35 A;  4B3M B;  2XAJ A;  5E1A C;  1VP7 A;  4X64 B;  3CCV V;  1U97 A;  4X62 B;  3BAB A;  3THO A;  3CCQ V;  2DYR B;  3CRA A;  3MD0 A;  1RPO A;  1NVP B;  4JI3 B;  4NB5 A;  1AP5 A;  3EFF K;  3JD3 A;  2ILM A;  2JS3 A;  4PEL A;  5A9G A;  1YF2 A;  1GN4 A;  2FKX A;  1IBM B;  4DR2 B;  4H37 A;  1WA8 A;  3VQY A;  1ZWI C;  4WBN A;  4JI5 O;  5EC1 C;  2UXB O;  4K3A A;  3JAK A;  3N2G B;  4I50 B;  2F23 A;  5BMV B;  2F1M A;  1S5J A;  4KHP O;  2PF4 E;  2CTR A;  4YIP A;  3N2K A;  3AEI A;  1XMQ O;  1K5S A;  4JAA A;  3RGB A;  1QU7 A;  2OYQ A;  5LOV A;  3AG2 C;  1SA0 A;  1K92 A;  1V55 B;  1VF6 A;  3H1J H;  3CRC A;  2Y69 B;  1M90 W;  2QKS A;  3SJC C;  1K4C C;  3DC6 A;  3JCZ A;  4CS4 A;  1ROP A;  4O2B B;  1ZL8 B;  5CA1 B;  3H1H H;  4HBN A;  3QF7 A;  2ZXW B;  4FLZ A;  1GM8 A;  4RO2 A;  3N2G A;  2EIN C;  1FFT B;  1DF5 A;  1P7B A;  4I50 A;  4TV8 B;  4I4T B;  4X66 B;  1AP6 A;  2QGN A;  1OJH A;  2IU3 A;  4G27 B;  3I56 V;  4B3T O;  5LHH A;  2A06 H;  3RYF A;  5IYZ A;  3MAQ A;  2R70 A;  3IJ4 A;  2LGW A;  3G4S V;  4P2Z A;  3HKC B;  1MMM A;  2LJ2 A;  3ETE A;  1BGY H;  1IVS A;  2GV9 A;  1SER A;  4O2B A;  4PV1 B;  1ZL8 A;  2FML A;  4J11 A;  4FLW A;  3S3X A;  3APQ A;  5KA5 A;  2GBO A;  4AHC A;  1K3E A;  4LC1 A;  3LDD A;  4O4H A;  1JPX A;  2YIA A;  3HKB A;  1R6K A;  1BHA A;  5B1A C;  5IWA B;  1G4Y B;  4CH3 A;  3ZJZ A;  3ABL C;  4RWU A;  3P32 A;  5LXT B;  4PI0 A;  4DRX B;  2F4V O;  4JPR A;  5HFL A;  2VQF B;  4X1I B;  1N32 B;  4GUN A;  1E79 G;  3K57 A;  1M9N A;  4YY3 O;  1IDS A;  4GYC B;  1F4N A;  2QKC A;  4CS2 A;  4LH7 A;  3SYA A;  1QVG U;  1XOU A;  3BA8 A;  1P7G A;  3LSU A;  4JI6 O;  2RN9 A;  3BVO A;  4DR5 B;  2UXX A;  5BY1 A;  3LNN A;  5LHG A;  3G71 V;  4JI8 B;  3SGI A;  1QVF U;  1Z5W A;  5LXT A;  4UCS A;  4JI2 O;  4B3R B;  2DQ0 A;  1F4M A;  3CJH A;  5LYJ B;  1THZ A;  4FMT A;  1WPB A;  1MSW D;  5IWA O;  1YXB A;  5J2T B;  1RSO B;  3E22 B;  3JD1 A;  4NR1 A;  2DYR C;  1VMG A;  2EBO A;  2XOK G;  5LMU O;  5EIB C;  4FLV A;  2WA4 A;  1K9M W;  1DK1 A;  2WLJ A;  2XAS A;  1FAF A;  1IX9 A;  3CCL V;  2XAF A;  2ZM6 O;  4RUF A;  1YCI A;  3B77 A;  4J41 A;  1QQC A;  1TUB B;  4LF4 O;  3E89 A;  1RSO A;  1K7D A;  4ZI7 B;  4LF8 B;  1QBZ A;  2N05 A;  2QM7 A;  1NTZ H;  2QM8 A;  1CEZ A;  2LQT A;  2LO1 A;  3ASO C;  1W59 A;  4CZZ A;  4D7S A;  4JTD B;  1WN7 A;  1PNK A;  2N04 A;  3K5M A;  1Q81 W;  3OEE G;  3LUT B;  2ZXW C;  2WLL B;  1OZ0 A;  4OXS A;  1XEQ A;  4HAM A;  2AXT Z;  4DXW A;  4NXN O;  2FYU H;  2RCV A;  3VQW A;  1I94 O;  3CPW U;  1YJ9 V;  3CSX A;  2GTS A;  1VQ8 V;  1PL4 A;  5H6R A;  1ENV A;  2Y4T A;  4ZI7 A;  2OWO A;  5B5E Z;  2RMK B;  1PKX A;  3AG1 B;  4JYC A;  5FL7 G;  4MW3 A;  5B66 Z;  3KCY A;  2Q7E A;  3FB6 C;  2HJF C;  4B3S B;  2R9A A;  1QHT A;  3FAV A;  1YHQ V;  1YTF B;  3E8B A;  3JD0 A;  2ADP A;  2X6B A;  3H01 A;  4LF5 B;  4D7T A;  4JZG A;  4FM1 A;  2YS8 A;  2CTP A;  1NJI W;  3WFV A;  2PTM A;  4NTX A;  5LA6 B; 
#chains in the Genus database with same CATH homology
 4JAS A;  4JTC B;  3ABM C;  3CCS V;  1ORQ C;  3ASN B;  3CCU V;  1GMG A;  3E8F A;  3LSQ A;  5GW7 A;  3SPG A;  3IFX A;  4QJF B;  1K34 A;  5B3S B;  2R9R B;  5B1B C;  1J95 A;  3MHH C;  4TSF G;  4WFA V;  5H9C A;  3FB8 C;  4PDV A;  5B1N A;  2K1E A;  2IU0 A;  1YTF D;  1COW G;  3CCE V;  5L3F A;  2X6C A;  2QA4 V;  4LP8 A;  2B1I A;  2EJR A;  4X8A A;  2YEV B;  4DO2 A;  3K04 A;  3STZ C;  5CN0 A;  4TWK A;  1WPX A;  3K06 A;  3W7U A;  1LNQ A;  2A9H A;  5BZB A;  2GSM B;  2EIN B;  1VQL V;  1KC8 W;  4ZKI A;  3CME V;  2XAG A;  2PI5 A;  1CPY A;  2WLI A;  4MVU A;  3SPI A;  1S72 V;  2EZO A;  1NKD A;  1VQP V;  4UV8 A;  1K73 W;  4MVZ A;  4U7N A;  1GKF A;  2JEX A;  1QR8 A;  1XL6 A;  3ZN1 A;  1NVP D;  1VQ4 V;  4PA7 A;  4J9Z B;  3CD6 V;  1M57 B;  1OCO C;  3QO5 A;  3AG4 B;  2Q69 A;  1KD1 W;  5LHI A;  3OE7 G;  1OCR B;  1BMF G;  4ZBM A;  3E83 A;  3T2M A;  1YSC A;  3FYI B;  3D36 A;  4UVA A;  4QNH B;  3ASO B;  1HWY A;  5CBH A;  2HR3 A;  2ZR3 A;  2YEV A;  2NNU A;  4ASU G;  3PJS K;  1V54 B;  3ZRX A;  1VQ9 V;  3SPH A;  1H8E G;  2EIL B;  3RW0 A;  2WWW A;  1F51 A;  1V55 C;  1W0K G;  2Y69 C;  1P4R A;  5EC2 C;  1QCE A;  3TK1 A;  1AJP A;  2ITC C;  1H8H G;  2Y48 A;  1OCC B;  1EFR G;  2DYS C;  3OMN B;  1MOF A;  2W6I G;  1Y66 A;  3IC7 A;  3LSS A;  4N21 A;  2DW4 A;  4CBC A;  2ZQM A;  4LCU C;  4TT3 G;  5L3B A;  1K5Q A;  1YJW V;  1RM1 B;  4F4L A;  4R7C A;  3BEH A;  3GB7 C;  1K33 A;  5CBG A;  2JJ2 G;  3W7W A;  3ABL B;  3CCR V;  4GT1 A;  1JX9 A;  1YJN V;  4JGS A;  1KKD A;  3OM3 B;  1K97 A;  1QLN A;  4PA6 A;  2ZDI C;  2QE7 G;  3CC2 V;  1PD3 A;  4PDR A;  4JAU A;  2Q6A A;  2B1G A;  4R6Z A;  3RVY A;  2H8P C;  3SYC A;  1GK9 A;  4P9P A;  1Q82 W;  4GX2 A;  4EKW A;  1YIT V;  2HKO A;  3M99 B;  4G28 B;  4P30 A;  2ZR2 A;  3K0D A;  1FXV A;  1GM7 A;  4R8C A;  2NLJ C;  2GHY A;  1TUE B;  5EBL C;  3X2Q C;  1S76 D;  1F23 A;  2IJH A;  3HPL C;  5KUK A;  5LBQ A;  1Q7Y W;  3E2E A;  3QNE A;  3A0R A;  4WFF A;  3FB7 C;  5L3E A;  1M56 B;  3AG3 C;  4WCE V;  4WFH A;  1I5Y A;  5IDJ A;  1JQ0 A;  1FS0 G;  2V7Q G;  4GX0 A;  2PI4 A;  2MK3 A;  4UVC A;  2WAM A;  3D3I A;  2ATK C;  3K9A A;  4MTO A;  5CA3 A;  1VQ6 V;  3ZCC A;  4I5S A;  3ETG A;  2Q68 A;  4MVR A;  2AHZ A;  5B1B B;  2EIM C;  3WG7 B;  2HFE C;  3T4D A;  3LNM B;  2XAJ A;  5C93 A;  4RUE A;  2WLI B;  5E1A C;  3ABU A;  1KP2 A;  3E8G A;  4BIZ A;  3CCV V;  1MAB G;  4FK5 C;  1W2B U;  3FB5 C;  3CMA V;  2QTO A;  3E8H A;  3CP1 A;  3OR7 C;  2B5U A;  3QO7 A;  3CCQ V;  2DYR B;  3ZMU A;  1NBM G;  1UJW B;  3MD0 A;  4MVS A;  1PNL A;  1RPO A;  3G6E V;  1NVP B;  3ZMV A;  3GWO A;  3EFF K;  4MVM A;  3W7T A;  4XDK A;  3JD3 A;  1KEC A;  1AI7 A;  1FXK C;  3K3W A;  1W0J G;  4PEL A;  1H38 A;  1H2G A;  3OAA G;  1JJ2 U;  3T4Z A;  3SPJ A;  4KP4 A;  2W6J G;  1RPR A;  3UKM A;  4H37 A;  4PA4 A;  2P7T C;  1ZWI C;  3STL C;  3QO8 A;  5EC1 C;  1EZJ A;  3ZRV A;  4MVQ A;  2OTJ V;  3ABK C;  4MTF A;  1E1Q G;  1AJQ A;  4MS2 A;  4UXN A;  1B6Q A;  3AEI A;  1L1F A;  3VOU A;  4G2K A;  1K5S A;  4QPK A;  3ZMT A;  1AJN A;  2JIZ G;  2JJ1 G;  3NXS A;  3AG2 C;  1K92 A;  1IXM A;  1V55 B;  4H33 A;  2Y69 B;  1BL8 A;  1M90 W;  1QLE C;  3KG2 A;  2CK3 G;  2QKS A;  1K4C C;  2V1D A;  3JCZ A;  2WLK A;  1ROP A;  2HG5 C;  4HYO A;  1DLB A;  2M7W A;  3JD2 A;  3P30 A;  1BHB A;  1I5X A;  2ZXW B;  1GM8 A;  4RO2 A;  2EIN C;  1CP9 A;  1FFT B;  2Z5U A;  1DF5 A;  1P7B A;  1FXH A;  2DWE C;  4UV9 A;  2IU3 A;  4PDL A;  1R3J C;  4G27 B;  3W7S A;  3I55 V;  1SES A;  3I56 V;  4QE7 A;  5LHH A;  3BY6 A;  5EK0 A;  3ETD A;  3JD4 A;  2A0L A;  2IJJ A;  4Z1M G;  1M57 C;  2EZP A;  3E35 A;  2R9I A;  3G4S V;  4P2Z A;  5H6Q A;  3ETE A;  2OCC C;  1OCR C;  3OR6 C;  3AG3 B;  4UUJ C;  5CMU A;  4U7O A;  4FIP C;  1SER A;  3OEH G;  4GX5 A;  4KFM A;  1S77 D;  1NR1 A;  4JYB A;  1V54 C;  4PDM A;  1NR7 A;  3LDE A;  3HB3 B;  4PA3 A;  5KA5 A;  2EIM B;  3JYC A;  1K3E A;  2ZDI A;  3SJQ C;  4LC1 A;  3LDD A;  3MHS C;  2EIK B;  3CC7 V;  4XDJ A;  3W7X A;  1S0V A;  3SYQ A;  1AR1 B;  1JPX A;  2X7R B;  2EIJ C;  1JOY A;  3ABM B;  1QR9 A;  1AI4 A;  4GCZ A;  1R6K A;  1BHA A;  5B1A C;  3CC4 V;  2OTL V;  4UVB A;  1DF4 A;  3F5W C;  1G4Y B;  2IJK A;  3ZJZ A;  3ABL C;  2KB1 A;  3IGA C;  4KUM A;  3P32 A;  1R3K C;  3OMA B;  3ZRS A;  1SRY A;  2XAQ A;  3RBZ A;  2XAH A;  1GM9 A;  2Z3Y A;  3K03 A;  4JPR A;  5HFL A;  3UM7 A;  1FXK B;  2FTK A;  3F7V C;  4RQF A;  4JF3 A;  1E79 G;  2ITD C;  3SYO A;  2WLH A;  3ZIA G;  4R50 A;  1M9N A;  5B1O A;  1K4D C;  3LDC A;  1K8A W;  4GX1 A;  4BAY A;  4WF9 V;  4BW5 A;  3B8N A;  2WLL A;  1F4N A;  3AG1 C;  1M56 C;  4FJC C;  5IYC O;  3SYA A;  3ABK B;  2YSU B;  1QVG U;  2X0L A;  2Q67 A;  3RVZ A;  4LBE C;  3ZRW A;  1OCZ C;  3FYE B;  4FPP A;  3R65 A;  4WFB V;  2UXX A;  2WLM A;  5LHG A;  5IY5 C;  3G71 V;  1XL4 A;  4E2L A;  2HVJ C;  1OHH G;  1QVF U;  5KUM A;  4HZ3 A;  4P9O A;  1VQN V;  3SYP A;  5L3G A;  1OCO B;  1VQK V;  2D3O W;  3WG7 C;  4XDL A;  3AG2 B;  3F7Y C;  5EBM C;  2JEU A;  2WPD G;  2DQ0 A;  1QLE B;  3ZMS A;  1F4M A;  1PL0 A;  2DWD C;  3ASN C;  1FXK A;  1VQO V;  1THZ A;  3VBB A;  2F43 G;  4FMT A;  1MSW D;  1S3J A;  3TET A;  2WSS G;  4QPJ A;  3TCU A;  2AHY A;  2ZD9 A;  5B3S C;  1R3L C;  3JD1 A;  2DYR C;  4WFE A;  1PNM A;  1NH2 D;  1G8M A;  4MW8 A;  2EBO A;  5KA6 A;  4PA9 A;  3K0G A;  2XOK G;  5L3C A;  3EHB B;  1M1K W;  5CBF A;  4RAI A;  1GTO A;  3CXC U;  1K9M W;  1SZT A;  1VQM V;  2DYS B;  2JDI G;  2WLJ A;  1KQS U;  2QEX V;  5L3D A;  2XAS A;  3CCM V;  5J9P C;  3OGC C;  2LP7 A;  1NQT A;  4J9Y B;  3ML0 A;  3T1C A;  2JK5 C;  3CCL V;  2P67 A;  2XAF A;  5LGT A;  4QE9 A;  4RUF A;  3B77 A;  2HVK C;  4MT8 A;  2W0F C;  2OCC B;  1S5H C;  1N8R W;  3K08 A;  3ABT A;  3OFN G;  1R3I C;  3OMI B;  3E89 A;  1K7D A;  2LFS A;  3X2Q B;  2DQ3 A;  2A79 B;  3AG4 C;  4Q20 A;  1ARO P;  1QBZ A;  5DN6 G;  1EBO A;  2QM7 A;  2QM8 A;  3E86 A;  3FKS G;  3ZN0 A;  5HFM A;  1AI6 A;  4X88 A;  1CEZ A;  3ASO C;  2C2A A;  4MVO A;  4CZZ A;  1Q86 W;  2EIJ B;  4MSW C;  4RQE A;  5LGN A;  4JTD B;  5B1A B;  1PNK A;  1KP3 A;  1Q81 W;  4L87 A;  3OEE G;  4MTX A;  2EIL C;  3DTU B;  3LUT B;  4JTA B;  2ZXW C;  1Y4M A;  2WLL B;  1OZ0 A;  4I9W A;  3OW2 U;  1R6N A;  2XND G;  2BOB C;  4OXS A;  3DGE A;  4HAM A;  2X6A A;  1AI5 A;  1OCC C;  2H94 A;  3K79 A;  1DTO A;  4DXW A;  4MTG A;  2IH1 C;  2BOC C;  3ZRW B;  3CPW U;  1YJ9 V;  1YIJ V;  1MG1 A;  2P6J A;  4QIW F;  1VQ8 V;  3CYO A;  5IYB O;  5IYD O;  1RM1 C;  5H6R A;  1ENV A;  4XBF A;  3CCJ V;  3ZMZ A;  3AG1 B;  1PKX A;  4JYC A;  5FL7 G;  4MW3 A;  4N23 A;  1GO3 F;  3FB6 C;  4WFG A;  2HJF C;  4BIU A;  1SET A;  1VQ5 V;  1YHQ V;  2P90 A;  1OCZ B;  2WLN A;  3E8B A;  4X89 A;  1JCH A;  5LGU A;  1YTF B;  3JD0 A;  5DM6 V;  5EBW C;  5IY5 B;  2UXN A;  3OUS A;  2IJI A;  2HLD G;  1WLE A;  2X6B A;  3H01 A;  4JAV A;  1E1R G;  3SPC A;  1YI2 V;  1VQ7 V;  3OUF A;  2IH3 C;  2OT5 A;  4YXW G;  3B8M A;  1JVM A;  1R73 A;  2LFR A;  2IW5 A;  1NJI W;  3WFV A;  2EIK C;  1NH2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...