2Q6AA

Crystal structure of nak channel d66e mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGEGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 42
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q6aA00
4R7CA 3IGAC 4MW8A 2P7TC 2EIMC 4MW3A 5EC1C 3ABLC 4LCUC 3STZC 2DYRC 5CBHA 3HPLC 1V55C 4PDMA 1BL8A 1OCRC 5EK0A 4MVSA 3SPHA 3OR7C 4X88A 1KKDA 2EIKC 3PJSK 4HYOA 4KFMA 3AG3C 4PDRA 2H8PC 2Q69A 3LUTB 3ZRSA 5BZBA 2AHYA 2DYSC 3LDDA 3SPCA 3ASNC 3T4DA 2EILC 2X6CA 4H33A 4X89A 3LDCA 2YEVA 3SPIA 1XL4A 5EBMC 2A0LA 4MVMA 4LBEC 4MTFA 4JTDB 5B3SC 2NLJC 4RAIA 3SYPA 4DXWA 3K06A 4PA3A 2ITCC 4XDLA 2WLJA 2HFEC 3SYQA 3FB6C 1JVMA 5EC2C 3SYAA 4GX0A 3VOUA 5KUKA 1OCOC 3FB7C 2WLNA 2KB1A 3ZJZA 4P30A 2DWDC 3AG2C 3F7YC 3LDEA 3E86A 4MVRA 4QE9A 2WLLB 5EBLC 4PA9A 4XDJA 4PA6A 4MTOA 4RO2A 3X2QC 3E8BA 4WFEA 2QKSA 3IFXA 4J9YB 2W0FC 4PDVA 1OCZC 1V54C 4PA4A 2IH1C 3UKMA 1M56C 4QE7A 1ORQC 1XL6A 3BEHA 3WG7C 4CBCA 3OR6C 3KG2A 2WLMA 4G27B 3T2MA 4EKWA 4F4LA 3RVYA 3SPJA 4BW5A 1K4DC 4MVUA 3ABMC 4RUFA 3K0GA 2Q67A 2WLIB 2HG5C 3E89A 4P9PA 5B1BC 1LNQA 3RW0A 2A79B 4ZBMA 1K4CC 4OXSA 2BOCC 2A9HA 4WFHA 3OUFA 4MSWC 3TETA 2ITDC 3ASOC 4JTCB 3R65A 3E8GA 3AG4C 3FB5C 3K03A 3OUSA 4P2ZA 1G4YB 4R6ZA 2Q68A 3STLC 4HZ3A 3F5WC 4GX1A 3OGCC 1R3LC 1R3IC 3TCUA 5CBFA 3T1CA 3K0DA 4MS2A 4XDKA 5IY5C 5J9PC 4PDLA 3RVZA 5CBGA 1J95A 2AHZA 2R9RB 3F7VC 1R3KC 2ZXWC 2ATKC 3K04A 4RUEA 2WLLA 5KUMA 1OCCC 2ZD9A 3SJQC 3SPGA 1ZWIC 4P9OA 2K1EA 4WFGA 2IH3C 4H37A 2QTOA 2WLKA 3FB8C 4I9WA 4X8AA 1R3JC 3GB7C 4R50A 5B1AC 3SYCA 1P7BA 4J9ZB 4MVQA 3ABKC 3LNMB 4R8CA 4UUJC 3T4ZA 4QNHB 2BOBC 4GX5A 3K08A 2WLHA 1QLEC 2X6BA 3AG1C 3SYOA 5EBWC 3E8HA 4GX2A 4MVZA 2WLIA 3E8FA 2HVKC 4PA7A 2Y69C 1S5HC 3UM7A 4LP8A 4TWKA 4G28B 2EINC 2HVJC 5E1AC 2Q6AA 3EFFK 4MVOA 2JK5C 2OCCC 2X6AA 3JYCA 3E83A 2HJFC 4MTGA 3RBZA 2DWEC 1M57C 4JTAB 2EIJC 4WFFA
chains in the Genus database with same CATH superfamily
4R7CA 1HNWB 1M1KW 5C93A 2ODMA 5EIBD 2ZXWB 1AJQA 1I94B 1BL8A 4MVSA 2EBOA 4HYOA 4KFMA 4IIJB 1LUWA 1H2GA 4ZHQB 4MTXA 3VQXA 2BTQB 4F6EA 1BHBA 3ETQA 2KQXA 2X7RB 5KX5A 1L1FA 4J42A 5CA3A 2R72A 1S72V 4JI3O 3U0ZA 2RQ6A 3RYHB 5FPOA 1HR0O 5L3EA 3ZMVA 2UXXA 3F7YC 4DV0O 3U10A 1L0LH 4I4TB 1O9HA 1EZJA 5AG2A 4E4EA 4O4HA 3GVMA 3OGIB 3QO8A 4O2BB 1Q6HA 5CMUA 3G80A 1EN6A 5B1BC 4DW0A 4I50A 4FJCC 4DW1A 1XMOO 2JDIG 2DQ0A 3FB5C 5GONA 1EN4A 5KHKA 1NZ6A 3OGCC 4B3MB 1SETA 5CBFA 3K0DA 2ADQB 3CCUV 5KHJA 1W59A 4J7ZA 4JI1O 5GTHZ 3CRAA 4AILC 2AW9A 3ABTA 3RYIB 2K1EA 2LP7A 2GHYA 5B1AC 2OCHA 4FM1A 3IC7A 3G71V 3AK1A 1K9MW 1BS3A 4NXNO 2HLDG 1YSCA 2JS5A 5E1AC 3JARA 4FFKA 5J2UA 4TQDA 4U7OA 4F6RB 2Q9LA 3OMAB 3ZN0A 2RJZA 4ZI7B 3KCYA 4WBNA 5B66Z 3SDLA 3K58A 4CZZA 4TV9B 2JEUA 4X20A 3T4DA 2KKWA 5IJ9A 2ZM6O 3R66A 4PD4F 1JJ2U 2LFRA 5C8YA 4JTDB 1YHQV 4X65B 1AJPA 1WP7A 2UU9B 4CH6A 1NVPB 1MOFA 1K97A 1XOUA 4FLXA 2IW5A 1D5NA 2VS0A 1IX9A 2WPDG 1SRYA 3ML0A 4PA9A 5JH7B 3G6EV 3X2QC 1PL0A 4DRXA 1HNZO 2H94A 4KL1A 3ZMZA 1YDXA 2XOKG 4DV7B 1MZFA 2FYUH 4JI2O 4X1YB 1CPYA 3ZRVA 1FXKA 2P4KA 2N05A 2EILB 4DV2B 4LF4B 3DXRB 3CPWU 1TA8A 1KYOF 5KHIA 3CJHA 1JFFB 2P06A 2AZ2A 1AILA 5LHHA 2QA4V 5JQGB 3RFRA 3ABLB 4NB5A 3F5TA 1YITV 4DR5B 1OCCC 2Q7EA 4CH3A 1OCZB 1BGYH 3JATA 1GTOA 1M56B 3HKCB 5JWPA 4UCUA 3T4ZA 3HR0A 1TUBB 2ZNIA 2WLHA 3CCJV 2OWOA 2WLIA 4O4IB 1MA1A 2Q6AA 3J80N 1QHTA 2WA4A 2QM4A 1Q81W 2ZNJA 2R9AA 4DR3O 2LW7A 4J80A 4QGPA 3CB2A 4EB6A 3O9OA 3L70H 1VQ4V 1X59A 2YXYA 4FFBA 2WSSG 2LJ2A 4BIUA 2O57A 5IE9A 3RYCB 4CS2A 2YEVA 1FFXA 3J81N 4YJ3A 4JI7O 3BA9A 1VQ5V 1K7DA 4JI3B 1XHXA 3AK3A 4PA3A 2HFEC 4FZ0A 4X66O 1K34A 3PN1A 3UO2A 1NH2B 1CEZA 3I5DA 3ZJZA 2CTWA 4JF3A 2P6JA 4PA6A 1XQ8A 5H9CA 3IFXA 1S5JA 2W0XA 3MAQA 3H1JH 1N33O 1V55B 4CBCA 1BZKA 2CUGA 2VRZA 3ZHTA 1XNRO 3QVNA 1AP5A 4UCRA 2HG5C 2GBOA 3JAWB 4OXSA 4HBNA 4HNAB 5EYPA 3OUFA 5KX5B 4Q6GA 1NJIW 5KHGA 2YICA 1K73W 3OM3B 5HFLA 4HZ3A 3CRCA 2IJJA 2VQFO 2Y0PA 1YVWA 1I08A 1SA0B 4IYHA 5E79Z 3H9VA 3CC7V 4DUYO 1TVKB 3CCQV 3L72H 3A2FA 3IAYA 1YTFB 2WLLA 1HDJA 2DJVA 2IH3C 1GM9A 5LHGA 5IYZB 5FNVA 1HP8A 1UFIA 4IHJA 5EBWC 3UM7A 2YXLA 2QSAA 4NXNB 2EINC 4I55A 4K0KB 4JYYA 1WA8A 1E1RG 2UXBO 3ABLC 2Q0OC 1PP9H 3L74H 1P7GA 4DR2O 2FTKA 2Q0AA 3N27A 5IT9N 4UVBA 1XMQO 2ZM6B 4PJ0Z 2CTRA 2E74B 2OTLV 1Z5VA 5EBMC 4TV8A 2P5OA 3S3WA 2ZT9B 4J7JA 4QIWF 3UCSC 3UO3A 1WP8A 1SS3A 4XDLA 1FS0G 5LGUA 2ILMA 5J2UB 4L87A 2KB1A 1M90W 2F43G 3CCMV 1PNLA 5FL7G 4MTOA 1M57B 4PV1B 5IYDO 1DF5A 1G1XB 4JYAB 1EZVH 1FYJA 1M9NA 2F1MA 5JVDA 4U3JA 1XL6A 3SPJA 4FLWA 4B3RB 4K35A 1KP3A 1VQ9V 4B7EA 5LOVB 2QWQB 1F23A 3B4SA 5C8YB 4QPKA 2KG7A 3K5LA 3STLC 3UT5A 2MW2B 4RQEA 4LF9B 1K5SA 3N2KA 1R3LC 5B5EZ 3T1CA 2YIAA 4J11A 4K8ZA 2M7WA 1ZX3A 2ATKC 3K04A 4LH7A 4UFZA 3S3XA 2CGOA 3K5OA 2VWJA 1PKXA 3FB8C 3WG7B 3T1HB 4X62O 3HKBA 1QR9A 5H2FZ 1RP3B 1FXKB 5K1XA 4H44B 3CHXA 2FMLA 4NXMO 2XUMA 1AR4A 5DEDA 1PD3A 2OT5A 3HB3B 3MHSC 4NTWA 1FFTB 3CJHB 4D6TH 4PI2A 1NTMH 4ZOLB 1L0NH 4UB8Z 2BTOA 3P32A 3JCZA 1JX9A 4DR3B 1WAZA 1YJ9V 2EIMC 3BA8A 2EJ7A 3JAKB 5JJNB 4GKJO 2RNBA 4CS3A 1KKDA 1PNMA 3JATB 2F4VO 4LWSB 2ZE5A 3SPCA 4KHPB 3APOA 3JD4A 4MVMA 2XNDG 3ZRXA 4LNUA 2QM8A 2ZINA 3ZIAG 3ZMSA 5KUKA 3APQA 1JCHA 3BABA 1YZBA 1KMIZ 2YUAA 1BSMA 1W0KG 4LC1A 1V54C 2RN9A 2Y4TA 5H6QA 1N33B 4UXNA 1AI6A 4FFBB 2W6IG 3U11A 4MVUA 1KBHA 1K33A 4P9PA 1Y74B 3BY6A 4X65O 2YEVB 2UU9O 3ASNB 3TETA 2JRIA 3ASOC 2EJRA 1GMGA 3ZRWB 2EIJB 1T5EA 4DK1A 5HFMA 5LHIA 4J7KA 5J9PC 2R9RB 3F7VC 5B1OA 1OCRB 3P3NA 3BFRA 1KU9A 4JV5O 2CDYA 2UUAB 4P9OA 1IXMA 5GTIZ 1AP6A 3DTUB 3TXSA 1SQGA 1TAEA 4JAUA 1V9PA 4DV2O 1P7BA 4FVMA 3GWOA 2B1IA 2FL4A 4J41A 2R70A 4O4LB 1Y67A 3OMNB 1IXBA 3AG2B 3D3IA 1H2LA 4DR5O 4NYKA 1Q6UA 1EFRG 1YI2V 2GUZA 1K3EA 4AQYO 2UXCB 4LCUC 2UXBB 1XHZA 1IZ3A 3E22A 5CBHA 3HPLC 3HKDA 3IJ4A 3SPHA 4LR3A 3TJTA 4UVAA 1IDSA 4FPPA 1EBOA 3N2GB 4JI8O 2X6CA 2ZCEA 2D3OW 3AG1B 1VIBA 2A7WA 2LGWA 2PTMA 3FAVB 4N23A 2QJ1A 3HKEB 2PUSA 1JVMA 4JAVA 1YXBA 2JS3A 5CB4A 1FPOA 1M93A 5LP6B 3VQYA 1RSOB 2W0FC 3Q4HA 1NBMG 2JJ1G 3BEHA 3J7AU 2GTAA 4EKWA 3BRCA 4GCZA 3O65A 2VQEO 2A79B 3ZHUA 1JQ0A 4Z1MG 5IYCO 1GM7A 4TV8B 4O4JB 2P4VA 3A8TA 3K9AA 3JALA 3K03A 1PPJH 3FFQA 3L71H 3F5WC 3CRQA 4FZ1A 3W7SA 5JCOC 2PYJA 1US6A 4MS2A 3JASA 2AHZA 3ZBHA 3QTCA 1DLBA 2C2AA 5KHHA 1S3JA 4U3JB 2PF4E 1P49A 3SGIA 4X1KB 4BIOA 2WLKA 3QO7A 4X62B 1GN2A 5KLVH 2OTJV 4NXMB 1D5AA 2GTSA 1SQFA 3UT5B 3GWKC 1Y66A 2DQ3A 2EIJC 2Q73A 1M5IA 1GO3F 4KUMA 3OE7G 3BPZA 4GKJB 4B08A 1OCRC 4X88A 2EIKC 3PJSK 1SQPH 2HHHO 2LQTA 2V7QG 2GSMB 2F4VB 1B06A 5LGNA 2ZDIC 1XL4A 4K0KO 5BXZA 1N8RW 1F4NA 1IVSA 5D5PA 4BIZA 1Y76A 1OCOC 4P30A 2OCCB 3AG2C 3E86A 5DM6V 2VWKA 1I0HA 5LYJA 4DYLA 4MT8A 1J5EB 5BMVA 1IBKO 4BW5A 1VEWA 2Q67A 2IJKA 3AG3B 1QR8A 1AB3A 1WB7A 1ZL8B 1XI1A 4AI8A 3LSSA 4QJFB 1UPGA 2HP8A 2CTQA 1G4YB 3T1YO 1THZA 3IC9A 4GX1A 1BHAA 5B3SB 2XAJA 4JYAO 2E75B 4XDKA 4PHZA 3CCEV 2P67A 2ZXWC 2G38A 4JAAA 3CRRA 5EZYB 4B3RO 1NR7A 3D36C 1FXHA 3ZMUA 4JV5B 2XTAA 4L8JA 2DOSA 2P90A 2QTSA 4H37A 2JIZG 4I9WA 1QVGU 4J9ZB 2UXNA 4UUJC 3CWBH 1NU1H 1KUQA 1ZTEA 1D2DA 5IWAB 3JCUZ 4LF9O 1EN5A 5CA0A 2Z3YA 2JK5C 4NR1A 4TT3G 1AROP 1Z2GA 1WNSA 5CA1B 2BSKA 3OTFA 1L8DA 1A32A 3RYFA 4AQYB 3E35A 3T1HO 5ITZB 4FK5C 4PDMA 5EK0A 2RCVA 1URFA 2BE3A 1COWG 4GUNA 2ZE7A 4TSFG 1ZUQA 4JI8B 1VQOV 5K1PA 2Z0AA 1N4CA 4B3TB 2AZ0A 2JGDA 4GX0A 4CC6A 2WLNA 3RWRD 3EXAA 1G8MA 2YC0A 3G67A 4WFEA 3ZCCA 5JCOA 2XAGA 5LBQA 1FJGO 2DYRB 3OEEG 1YJNV 4KHPO 5LA6A 1F7YA 2KSDA 1WJZA 3H1KH 1O9GA 1XEQA 5J2TB 2VQEB 3ZX6A 1N0JA 2BOCC 2Y69B 4ICGA 5JJJB 4DV6O 3EVKA 1BQZA 1AI4A 4CH4A 4LFBO 5KAFZ 4QPJA 1K5QA 1X4TA 4LF8O 2CH7A 3K5MA 4FLTA 2ARHA 3UQ8A 1AR1B 5DN6G 5LMNO 2YI9A 4FLZA 1EM1A 3CRMA 1MMMA 1SKVA 2ZR2A 4JZ2A 2YI8A 2BOBC 4B3SO 2Q8VA 1KB9F 4JGSA 2R9IA 3AG7A 2HVJC 1Z5WA 2ZDIA 5LMUB 1WPBA 2WWWA 3H1HH 1JPXA 2X6AA 1VMGA 4DUZO 2ZKOA 4O4HB 3JASB 4WFFA 5B3SC 1LR1A 2YIBD 2UUAO 2QWPB 4MW8A 5LXTA 2P7TC 2HEPA 4DO2A 1N36B 1HWYA 3OW2U 1QNMA 4I50B 4LH6A 1SESA 5TISZ 2HHHB 3ZRSA 2HR3A 2AHYA 4Q20A 2EILC 1OV9A 3LDCA 5GONB 3W7TA 2UUCB 2M6YA 2A0LA 2DE0X 4RAIA 3K06A 4YJ2A 2F23A 3CE2A 3SYAA 2UXCO 1IBLO 3SR2C 2X0LA 3LDEA 5EBLC 4MVRA 1NVPD 1MZEA 3OTOB 2WAMA 1TGOA 1JOYA 1OCZC 4I0XA 5L3DA 1M56C 1PNKA 3KG2A 1IBKB 3W7UA 1DF4A 2E5LB 1LNQA 4FLUA 2DYSB 4IIJA 3BAAA 3JARB 3R65A 4BAYA 2BTQA 4KP4A 4LF7O 3OUSA 2Q68A 3T1YB 1RM1B 2FKXA 3JSNA 1NQTA 4WBNB 1DK1A 3RYHA 3WB0A 3SJQC 1PM9A 4I4TA 4X20B 5IJ9B 1S77D 2IBZH 2L35A 4R50A 4TOIA 3JD1A 4GZRB 3ABMB 4O2BA 1XDCA 3E8FA 1S5LZ 2Y69C 1FD9A 1AR5A 4JI4B 3H1LH 2F93B 3AG4B 5H6RA 3JYCA 4DRXB 4TUYA 4DV4B 4MTGA 3JD2A 4RUEA 4EFEA 1F51A 2OYQA 1VP7A 2UXDO 1NR1A 2MK3A 2PY5A 3CMEV 1V55C 1I5YA 2ADPA 3W7XA 4KXRA 2H8PC 1GN4A 4CH5A 3SJCC 3RYIA 1Q82W 1HW7A 4NTYA 4X1IA 3THOA 1VF6C 2Y0IA 1WLEA 3DGEA 1N0NA 5IJ0A 3P30A 1ENVA 1M4UA 4LF6O 1DTOA 1NH2D 3RYFB 5L3CA 2YIBA 5DECA 3L73H 3H1IH 4JZGA 4PDVA 1QQCA 4F6RA 1UJWB 5BY1A 1FJGB 2WA3A 1AVMA 1XILA 3OR6C 4JI6O 4DR7O 3RVYA 3EHBB 1K4DC 4JI5B 4ZI7A 1QLEB 2WLIB 1JA8A 3CCLV 1VQKV 3B40A 4TV9A 4DV6B 1GN6A 2A06H 4LFAO 1BQ0A 5KA6A 1AI7A 4LFBB 3TCUA 4EB6B 4LF8B 5L3BA 4JI0B 2IU0A 2ZIOA 1J5EO 3ZHVA 2B1GA 2ZD9A 5JH7A 5LMNB 3SPGA 5LA6B 1YTFD 1FFXB 1R3JC 3SYCA 4YJ3B 3LNMB 4GX5A 3K08A 1QVFU 4B3SB 5BR8O 1VF5B 3QF7A 5JJEB 3CXCU 4LP8A 4JYCA 4HAMA 3M8AA 4MVOA 2QM7A 5FLXN 3DXRA 4DUZB 1M57C 1VQLV 4JYBA 1JFFA 2ZQMA 4U3FH 5JQGA 2W6JG 5EYPB 5IWAO 3K57A 1N34B 4PDRA 3A0RA 5B1AB 1PV0A 3JSLA 3JD0A 4H33A 2PZSA 4ASUG 2PYLA 4MTFA 1TUBA 2IU3A 3SYQA 1H8HG 4IT5A 4O4IA 5A2QN 2YS8A 4E2LA 1IBLB 3LSUA 3NR7A 2WLLB 3ZHSA 4XDJA 1R6KA 5LXTB 3WU2Z 5FNVB 3CC4V 2XT9A 3WG7C 3AEIA 4IHJB 4RUFA 4UCVA 1FXKC 3I55V 3MHHC 3B8MA 4DK0A 4B3TO 1NT2B 1SZTA 1VQPV 2A9HA 3MD0A 1Q3EA 4JTCB 1Y6XA 4I55B 3RYCA 3FYIB 4LF7B 4P2ZA 4A5UB 1WA8B 1GKFA 3P3PA 1BT8A 5KAIZ 2GV9A 4FIPC 4GYCB 4BWAA 1YEWA 2XASA 4DR6O 2QWRB 1H2NA 2QTOA 3M99B 4UV9A 2UUBO 3KCXA 4I9QA 1QLEC 3G6BA 4U7NA 2RMKB 4MVZA 2Q7HA 1I7FA 3JAWA 2QWNB 2JVDA 4CS4A 4HNAA 4X64O 3L9DA 2QR4A 2HJFC 3B2EE 3RBZA 3C3SA 1U96A 1VF6A 4R8CA 1RFYA 3H01A 2IJHA 2IJIA 5JVDB 2UXDB 4MW3A 2B9ZA 1JJOA 2RDCA 1SA0A 4JASA 1E79G 3C90A 5KMGA 1OCCB 1TVKA 5BZBA 2KG7B 2JJ2G 3ASNC 1FXVA 1FAFA 5LMUO 2Q4PA 4LBEC 3N2KB 5IYZA 1KQSU 2LGQA 1HNXO 1QU7A 3CC2V 1VQNV 2WLJA 3FB6C 5IY5B 2E76B 1N36O 3ZN1A 4Z2WA 4TUYB 4LF6B 2DWDC 4BW9A 2OIEA 3ZHQA 1OJHA 3NXSA 3HKBB 2IH1C 3UKMA 4QE7A 1ORQC 4JI6B 4DR7B 2HJDA 2UUCO 1VQ7V 3D8CA 2YSUB 3RW0A 2AGAA 1K4CC 4X1IB 4MSWC 4WF9V 4LFAB 3DSQA 3OTOO 3ABKB 2EX3A 5IJ0B 3FYEB 3ABUA 3ETGA 3OEHG 1ZSPA 4O2AA 5CBGA 2ZE6A 3ICXA 2E5LO 4D7TA 2Y48A 1R73A 4OX9O 3CP1A 4LNUB 1LUVA 3AG1C 5BR8B 5IYBO 1KECA 5LOVA 1ZLZA 2H3OA 1H38A 1IURA 3K5NA 3CS5A 2LO1A 1AI5A 2EZPA 5GW7A 5LP6C 2DWEC 4K3AA 1JMKC 1BMFG 4JTAB 3JAMN 1IBMO 1H2MA 1SQQH 2Q5ZA 3FKSG 1GK9A 2XAFA 2DW4A 2IM9A 3QG5A 1ZAUA 3B77A 4WFBV 1OZ0A 3B09A 4WCEV 2NN4A 3A0HZ 3LDDA 4JI4O 1XREA 4G2KA 1XNQO 4Z1VA 2LFSA 4UCOA 4DV4O 1JR9A 2ZIMA 1Q6IA 2EINB 4NVPA 5EC2C 4DR4O 3QO5A 3FB7C 3CCSV 4QE9A 5A9GA 1W0JG 5KA5A 3BVOA 2NNUA 4GKKO 3C3TA 4ZOLA 2QE7G 2LW1A 1B04A 2QWOB 3W7WA 4PA4A 3SJBC 4ZIBA 4YY3O 4PELA 2WLMA 4DV1B 3JAKA 4YHHO 1MG1A 3E89A 2Z5UA 4ZBMA 4WFHA 1WB8A 2ITDC 4LWSA 4X9QA 2N74A 1OHHG 2GUZB 3RGBA 2CAZC 1R3IC 3E22B 1YF2A 3CCRV 3HKDB 5IY5C 4I7ZB 1J95A 2PI5A 4LF5B 2QGNA 5L3FA 2NR5A 4JI5O 4JPRA 1H2KA 4I5SA 4UVCA 5KUMA 1FKAO 1QCEA 4DR6B 2ZE8A 1XUQA 2GDSA 3WB1A 1BCCH 4QNHB 2UUBB 2X6BA 3E8HA 4K8XA 2E3CA 5CB4B 4TWKA 1Y74A 4G28B 2HKOA 4JI0O 4FM0A 4X64B 3WFVA 2OCCC 1MSDA 3OAAG 3ABKC 3Q4HB 3I56V 3G4SV 1I5XA 1S76D 3ZRWA 1HR0B 1SZXA 3VQVA 4CC5A 2FB5A 1MABG 4DV0B 5FPRA 4BR6A 4OPHA 3AG3C 5LL6Y 5H5NA 2QDOA 3JALB 3OMIB 4ABMA 2ETNA 4X89A 1NTKH 1HNXB 1E1QG 4NKGB 3B8NA 1XMOB 4O4LA 2QKCA 1SF9A 4J10A 4RO2A 4GLXA 4YIPA 1KC8W 4J9YB 3E2EA 1SC5B 1N34O 1VQ8V 2EIMB 4LFCO 4YIOA 4ZKIA 5KMGB 2PGGA 4AHCA 4JI1B 4F4LA 2XAHA 3K0GA 1F4MA 3DC5A 2EULA 4PI0A 3TGUH 1G6UA 1VQ6V 2YDEA 3BCCH 3ZMTA 3N2GA 3DC6A 1S0VA 1QLNA 4EEQA 3E8GA 4GT1A 3K3WA 2A3QA 4XBFA 1SQBH 3FAVA 4IGGA 3HKEA 1NI8A 4PDLA 1GH6A 3ZEDA 2JEXA 5LP6A 3D36A 4OX9B 4WFGA 1V54B 2DMXA 1YIJV 1RSOA 2D2CB 4DV5O 4IL6Z 4X8AA 3ZS8C 3RN4A 2XAQA 2CK3G 4UCTA 4MVQA 1TUEB 4ZHQA 4FM2A 1XBLA 4RQFA 1DGSA 5B1NA 3SYOA 2ZR3A 1VQMV 1Y76B 1S5HC 1RPRA 4DV3O 1R6NA 3ASOB 1GRJA 5CN0A 4DR1O 4UCSA 4NTXA 4O4JA 3E83A 1N32O 1YCIA 4O2AB 5LYJB 1HNWO 4IYIA 1IBMB 3IGAC 1U97A 3JD3A 3CYOA 5BMVB 2DYRC 1I94O 5D5QA 1KD1W 4UV8A 1HNZB 2QEXV 1Q7YW 3CSXA 2QKAA 4RWUA 4X1KA 1XNQB 2Y4UA 4W4LA 2EZOA 3SPIA 4JI2B 1VF7A 4N21A 3CX5F 3OFNG 3SYPA 4DXWA 2CE4A 4H13B 2V1DA 1Q86W 4DR4B 5F2VO 2XHBA 3K79A 4GKKB 3E8BA 2QKSA 5L3GA 4YY3B 3BHPA 4EFBA 4G27B 2F66C 1P4RA 4YHHB 3FD9A 4TQFA 3OD4A 4FLYA 3CEIA 3CMAV 5CA0B 3TXQA 1SQXH 1K92A 2BSKB 1P84F 2DN9A 3ZHRA 3M7MX 4B7KA 3TK1A 4B3MO 1KKCA 4UB6Z 2B5UA 1ZWIC 3FX7A 3CXHF 1MSWD 3RT3C 1VARA 3ETDA 2JGDB 3SJAC 2V4DA 4FLVA 4D7SA 4PA7A 2PI4A 1W2BU 1WPXA 2N04A 3D3QA 1ROPA 3EFFK 1ZL8A 1Q90D 1RPOA 4WFAV 5LGTA 4JI7B 1K8AW 2CTPA 1Y4MA 3MDSA 4OGQB 4X66B 1GN3A 3STZC 3L75H 1H2SB 3OR7C 5B1BB 5EZYA 1B6QA 2Q69A 1H8EG 3LUTB 4X1YA 2DYSC 1SERA 1XNRB 1NS1A 1GAXA 2NLJC 2JGUA 1RM1C 2ITCC 2CH7B 1CP9A 3AK2A 4W4KA 3VOUA 2L6LA 3QNEA 5EC1C 1NKDA 3OT7A 3VQWA 5IDJA 2YXHA 4FMTA 2VQFB 5CA1A 3CCVV 3A0BZ 3K9SA 4DV7O 2AXTZ 4LFCB 1Q5OA 3T2MA 4DUYB 3HKCA 2EIKB 5ITZA 3ABMC 1AJNA 1NTZH 3KZIZ 2BCCH 4C7UA 1Q43A 3LSQA 4LF4O 3VBBA 3AG4C 3CD6V 4R6ZA 4OPAA 2Q7GA 1R1BA 5EIBC 4H0LB 1YJWV 1OCOB 1QBZA 3RVZA 1GM8A 1R3KC 4DV1O 1KP2A 2K9PA 2OIGA 2P22C 1R6TA 1B3QA 3ETEA 1PL4A 1MNGA 1Q8IA 4DV5B 3GB7C 3KKYA 4DR2B 2F95B 3WB2A 4YJ2B 1BE3H 3K59A 4GX2A 4YXWG 2HVKC 5J2TA 1SQVH 2CGNA 4DV3B 1XMQB 3LNNA 4LF5O 4DR1B 3X2QB 2YIDA 1WN7A 1N32B 1CXZB 4I0XB
chains in the Genus database with same CATH topology
4R7CA 1YJ9V 1M1KW 4MW8A 5C93A 2P7TC 2EIMC 4DO2A 3FKSG 1GK9A 1HWYA 2XAFA 2ZXWB 3OW2U 2DW4A 1AJQA 1BL8A 4MVSA 3B77A 1KKDA 4WFBV 1OZ0A 1PNMA 1SESA 2EBOA 4HYOA 4KFMA 4WCEV 3ZRSA 1H2GA 2HR3A 2AHYA 4Q20A 4MTXA 3LDDA 3SPCA 4G2KA 1BHBA 2EILC 2LFSA 3LDCA 2X7RB 3W7TA 2A0LA 3JD4A 4MVMA 2XNDG 1L1FA 3ZRXA 5CA3A 1S72V 4RAIA 3K06A 2QM8A 3ZIAG 3ZMSA 2EINB 5EC2C 3SYAA 5L3EA 3QO5A 5KUKA 3FB7C 3CCSV 4QE9A 3ZMVA 2UXXA 3F7YC 2X0LA 1W0JG 3LDEA 1JCHA 4MVRA 5EBLC 5KA5A 2NNUA 1NVPD 2WAMA 2QE7G 1EZJA 1W0KG 4LC1A 3W7WA 1OCZC 1V54C 4PA4A 5L3DA 1JOYA 1M56C 4PELA 3QO8A 5H6QA 1PNKA 3KG2A 2WLMA 4UXNA 1AI6A 2W6IG 4MVUA 3W7UA 1K33A 1DF4A 5CMUA 1MG1A 3E89A 4P9PA 2Z5UA 5B1BC 1LNQA 4ZBMA 4FJCC 3BY6A 4WFHA 2YEVB 2DYSB 3ASNB 3TETA 2ITDC 2JDIG 3ASOC 3R65A 4BAYA 2DQ0A 4KP4A 2EJRA 3FB5C 3OUSA 1OHHG 2Q68A 1RM1B 1GMGA 3ZRWB 2EIJB 3OGCC 1R3IC 5HFMA 1SETA 5CBFA 5LHIA 3K0DA 3CCRV 1NQTA 5IY5C 5J9PC 3CCUV 2PI5A 1J95A 2R9RB 3F7VC 5L3FA 5B1OA 1OCRB 4JPRA 4I5SA 4UVCA 5KUMA 3SJQC 3ABTA 1IXMA 1QCEA 4P9OA 2K1EA 2LP7A 3DTUB 1S77D 2GHYA 4JAUA 5B1AC 4R50A 1P7BA 3JD1A 3ABMB 3IC7A 4QNHB 3G71V 2X6BA 3E8HA 3GWOA 1K9MW 2B1IA 3E8FA 2Y69C 4TWKA 4G28B 2HLDG 3OMNB 1YSCA 2HKOA 3AG4B 5E1AC 3AG2B 3WFVA 3D3IA 2OCCC 3JYCA 5H6RA 3OAAG 4U7OA 4MTGA 1EFRG 3ABKC 3JD2A 4RUEA 3I56V 1YI2V 3G4SV 1I5XA 1F51A 1S76D 3OMAB 3ZRWA 3ZN0A 1K3EA 1NR1A 2MK3A 4LCUC 5CBHA 3HPLC 1MABG 3CMEV 1V55C 3SPHA 1I5YA 4UVAA 4FPPA 4CZZA 1EBOA 3AG3C 3W7XA 2H8PC 2JEUA 1Q82W 3OMIB 3T4DA 2X6CA 4X89A 1JJ2U 2D3OW 2LFRA 3AG1B 4JTDB 1YHQV 1E1QG 1WLEA 3DGEA 4N23A 1AJPA 3B8NA 1NVPB 1JVMA 4JAVA 1MOFA 1K97A 3P30A 1ENVA 2IW5A 2WPDG 1DTOA 1SRYA 3ML0A 4PA9A 3G6EV 4RO2A 3X2QC 5L3CA 1NH2D 1PL0A 1KC8W 4J9YB 3E2EA 2H94A 1VQ8V 3ZMZA 2EIMB 2XOKG 2W0FC 4PDVA 1UJWB 1NBMG 4ZKIA 2JJ1G 3BEHA 3OR6C 4EKWA 4F4LA 3RVYA 3EHBB 1K4DC 2XAHA 3K0GA 1QLEB 2WLIB 4GCZA 1CPYA 1F4MA 2A79B 3CCLV 1JQ0A 1FXKA 3ZRVA 4Z1MG 5IYCO 1VQKV 1VQ6V 1GM7A 3ZMTA 1S0VA 2EILB 1QLNA 3K9AA 3E8GA 3CPWU 3K03A 4GT1A 5KA6A 3F5WC 3W7SA 1AI7A 3K3WA 5LHHA 3TCUA 2QA4V 4XBFA 4MS2A 3ABLB 4PDLA 5L3BA 2AHZA 2IU0A 1YITV 2B1GA 1DLBA 1OCCC 2ZD9A 2C2AA 2JEXA 3SPGA 1S3JA 3D36A 1OCZB 1V54B 4WFGA 1YTFD 1YIJV 1GTOA 1M56B 2WLKA 4X8AA 3QO7A 1R3JC 2XAQA 3SYCA 2CK3G 4MVQA 3LNMB 1TUEB 3T4ZA 4GX5A 3K08A 1QVFU 4RQFA 2WLHA 5B1NA 2OTJV 3SYOA 3CCJV 2ZR3A 2WLIA 1VQMV 1S5HC 3CXCU 1RPRA 4LP8A 1R6NA 3ASOB 4JYCA 5CN0A 2Q6AA 4HAMA 4MVOA 2QM7A 3E83A 1Q81W 1Y66A 2DQ3A 1M57C 1VQLV 4JYBA 2EIJC 3IGAC 3JD3A 2ZQMA 1GO3F 4KUMA 3OE7G 3CYOA 2DYRC 1VQ4V 1OCRC 4X88A 2W6JG 2EIKC 3PJSK 1KD1W 4UV8A 2QEXV 1Q7YW 2V7QG 4PDRA 2GSMB 3A0RA 2WSSG 4BIUA 5B1AB 5LGNA 2ZDIC 3JD0A 4H33A 2YEVA 3SPIA 2EZOA 1XL4A 4ASUG 4MTFA 1VQ5V 1K7DA 3OFNG 4N21A 3SYPA 4DXWA 4PA3A 2IU3A 2V1DA 2HFEC 1N8RW 3SYQA 1F4NA 1K34A 1Q86W 1H8HG 4BIZA 1BMFG 1NH2B 1OCOC 1CEZA 4E2LA 3ZJZA 4P30A 2OCCB 3AG2C 4JF3A 3E86A 2WLLB 4JTAB 4XDJA 2P6JA 3K79A 1R6KA 4PA6A 5H9CA 3E8BA 5DM6V 2QKSA 3IFXA 5L3GA 3CC4V 3WG7C 1V55B 4CBCA 4MT8A 4G27B 3AEIA 4BW5A 1P4RA 4RUFA 1FXKC 2Q67A 2IJKA 2HG5C 3AG3B 3I55V 3MHHC 3B8MA 1QR8A 4OXSA 1SZTA 3CMAV 1VQPV 2A9HA 3OUFA 3MD0A 1NJIW 4JTCB 3LSSA 4QJFB 1K92A 1K73W 3FYIB 3OM3B 4P2ZA 1G4YB 5HFLA 4HZ3A 1THZA 4GX1A 1BHAA 2IJJA 5B3SB 1GKFA 3TK1A 2XAJA 4XDKA 3CCEV 4FIPC 2P67A 2ZXWC 3CC7V 3CCQV 1YTFB 1NR7A 2WLLA 1FXHA 3ZMUA 2B5UA 2XASA 1ZWIC 2P90A 2IH3C 4H37A 1MSWD 1GM9A 2QTOA 2JIZG 4I9WA 1QVGU 5LHGA 3M99B 4J9ZB 2UXNA 3ETDA 4UV9A 4UUJC 1QLEC 5EBWC 4U7NA 4MVZA 4PA7A 3UM7A 2PI4A 1W2BU 1WPXA 2EINC 1ROPA 3EFFK 2Z3YA 2JK5C 1RPOA 4TT3G 4WFAV 1AROP 5LGTA 1K8AW 2HJFC 3RBZA 1Y4MA 4R8CA 3H01A 2IJHA 2IJIA 1E1RG 4MW3A 3ABLC 3E35A 3STZC 4FK5C 4PDMA 4JASA 5EK0A 1E79G 3OR7C 2FTKA 1OCCB 5B1BB 1COWG 1B6QA 4TSFG 2Q69A 1H8EG 3LUTB 5BZBA 2JJ2G 2DYSC 4UVBA 1SERA 3ASNC 1FXVA 1VQOV 2OTLV 5EBMC 4LBEC 1KQSU 3CC2V 2NLJC 1VQNV 4QIWF 1RM1C 2ITCC 4XDLA 2WLJA 1FS0G 5LGUA 1CP9A 3FB6C 5IY5B 4GX0A 3ZN1A 3VOUA 4L87A 3QNEA 2WLNA 2KB1A 5EC1C 2DWDC 1NKDA 1M90W 2F43G 3CCMV 1PNLA 1G8MA 4MTOA 5FL7G 1M57B 4WFEA 5IYDO 5IDJA 3ZCCA 4FMTA 3NXSA 3CCVV 1DF5A 2XAGA 5LBQA 1M9NA 2DYRB 2IH1C 3OEEG 3UKMA 4QE7A 1YJNV 1ORQC 1XL6A 3T2MA 3SPJA 2EIKB 3ABMC 1VQ7V 1KP3A 1VQ9V 3RW0A 2YSUB 1AJNA 1K4CC 1F23A 2BOCC 2Y69B 4MSWC 4WF9V 3LSQA 4QPKA 3VBBA 3AG4C 1AI4A 3CD6V 3STLC 4R6ZA 3ABKB 4RQEA 1K5SA 3FYEB 1R3LC 4QPJA 3ABUA 1K5QA 3ETGA 3OEHG 3T1CA 1YJWV 1OCOB 1QBZA 3RVZA 5CBGA 1GM8A 2M7WA 1R3KC 2ATKC 3K04A 1KP2A 1AR1B 5DN6G 2Y48A 1R73A 1PKXA 3ETEA 3FB8C 3WG7B 2ZR2A 3GB7C 3CP1A 1QR9A 1FXKB 2BOBC 3AG1C 4GX2A 5IYBO 4YXWG 2HVKC 1PD3A 1KECA 2OT5A 4JGSA 3HB3B 2R9IA 3MHSC 1H38A 2HVJC 1FFTB 2ZDIA 2WWWA 1JPXA 2X6AA 1AI5A 2EZPA 3X2QB 5GW7A 2DWEC 3P32A 3JCZA 1JX9A 5B3SC 4WFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7C A;  3IGA C;  4MW8 A;  2P7T C;  2EIM C;  4MW3 A;  5EC1 C;  3ABL C;  4LCU C;  3STZ C;  2DYR C;  5CBH A;  3HPL C;  1V55 C;  4PDM A;  1BL8 A;  1OCR C;  5EK0 A;  4MVS A;  3SPH A;  3OR7 C;  4X88 A;  1KKD A;  2EIK C;  3PJS K;  4HYO A;  4KFM A;  3AG3 C;  4PDR A;  2H8P C;  2Q69 A;  3LUT B;  3ZRS A;  5BZB A;  2AHY A;  2DYS C;  3LDD A;  3SPC A;  3ASN C;  3T4D A;  2EIL C;  2X6C A;  4H33 A;  4X89 A;  3LDC A;  2YEV A;  3SPI A;  1XL4 A;  5EBM C;  2A0L A;  4MVM A;  4LBE C;  4MTF A;  4JTD B;  5B3S C;  2NLJ C;  4RAI A;  3SYP A;  4DXW A;  3K06 A;  4PA3 A;  2ITC C;  4XDL A;  2WLJ A;  2HFE C;  3SYQ A;  3FB6 C;  1JVM A;  5EC2 C;  3SYA A;  4GX0 A;  3VOU A;  5KUK A;  1OCO C;  3FB7 C;  2WLN A;  2KB1 A;  3ZJZ A;  4P30 A;  2DWD C;  3AG2 C;  3F7Y C;  3LDE A;  3E86 A;  4MVR A;  4QE9 A;  2WLL B;  5EBL C;  4PA9 A;  4XDJ A;  4PA6 A;  4MTO A;  4RO2 A;  3X2Q C;  3E8B A;  4WFE A;  2QKS A;  3IFX A;  4J9Y B;  2W0F C;  4PDV A;  1OCZ C;  1V54 C;  4PA4 A;  2IH1 C;  3UKM A;  1M56 C;  4QE7 A;  1ORQ C;  1XL6 A;  3BEH A;  3WG7 C;  4CBC A;  3OR6 C;  3KG2 A;  2WLM A;  4G27 B;  3T2M A;  4EKW A;  4F4L A;  3RVY A;  3SPJ A;  4BW5 A;  1K4D C;  4MVU A;  3ABM C;  4RUF A;  3K0G A;  2Q67 A;  2WLI B;  2HG5 C;  3E89 A;  4P9P A;  5B1B C;  1LNQ A;  3RW0 A;  2A79 B;  4ZBM A;  1K4C C;  4OXS A;  2BOC C;  2A9H A;  4WFH A;  3OUF A;  4MSW C;  3TET A;  2ITD C;  3ASO C;  4JTC B;  3R65 A;  3E8G A;  3AG4 C;  3FB5 C;  3K03 A;  3OUS A;  4P2Z A;  1G4Y B;  4R6Z A;  2Q68 A;  3STL C;  4HZ3 A;  3F5W C;  4GX1 A;  3OGC C;  1R3L C;  1R3I C;  3TCU A;  5CBF A;  3T1C A;  3K0D A;  4MS2 A;  4XDK A;  5IY5 C;  5J9P C;  4PDL A;  3RVZ A;  5CBG A;  1J95 A;  2AHZ A;  2R9R B;  3F7V C;  1R3K C;  2ZXW C;  2ATK C;  3K04 A;  4RUE A;  2WLL A;  5KUM A;  1OCC C;  2ZD9 A;  3SJQ C;  3SPG A;  1ZWI C;  4P9O A;  2K1E A;  4WFG A;  2IH3 C;  4H37 A;  2QTO A;  2WLK A;  3FB8 C;  4I9W A;  4X8A A;  1R3J C;  3GB7 C;  4R50 A;  5B1A C;  3SYC A;  1P7B A;  4J9Z B;  4MVQ A;  3ABK C;  3LNM B;  4R8C A;  4UUJ C;  3T4Z A;  4QNH B;  2BOB C;  4GX5 A;  3K08 A;  2WLH A;  1QLE C;  2X6B A;  3AG1 C;  3SYO A;  5EBW C;  3E8H A;  4GX2 A;  4MVZ A;  2WLI A;  3E8F A;  2HVK C;  4PA7 A;  2Y69 C;  1S5H C;  3UM7 A;  4LP8 A;  4TWK A;  4G28 B;  2EIN C;  2HVJ C;  5E1A C;  2Q6A A;  3EFF K;  4MVO A;  2JK5 C;  2OCC C;  2X6A A;  3JYC A;  3E83 A;  2HJF C;  4MTG A;  3RBZ A;  2DWE C;  1M57 C;  4JTA B;  2EIJ C;  4WFF A; 
#chains in the Genus database with same CATH topology
 4R7C A;  1HNW B;  1M1K W;  5C93 A;  2ODM A;  5EIB D;  2ZXW B;  1AJQ A;  1I94 B;  1BL8 A;  4MVS A;  2EBO A;  4HYO A;  4KFM A;  4IIJ B;  1LUW A;  1H2G A;  4ZHQ B;  4MTX A;  3VQX A;  2BTQ B;  4F6E A;  1BHB A;  3ETQ A;  2KQX A;  2X7R B;  5KX5 A;  1L1F A;  4J42 A;  5CA3 A;  2R72 A;  1S72 V;  4JI3 O;  3U0Z A;  2RQ6 A;  3RYH B;  5FPO A;  1HR0 O;  5L3E A;  3ZMV A;  2UXX A;  3F7Y C;  4DV0 O;  3U10 A;  1L0L H;  4I4T B;  1O9H A;  1EZJ A;  5AG2 A;  4E4E A;  4O4H A;  3GVM A;  3OGI B;  3QO8 A;  4O2B B;  1Q6H A;  5CMU A;  3G80 A;  1EN6 A;  5B1B C;  4DW0 A;  4I50 A;  4FJC C;  4DW1 A;  1XMO O;  2JDI G;  2DQ0 A;  3FB5 C;  5GON A;  1EN4 A;  5KHK A;  1NZ6 A;  3OGC C;  4B3M B;  1SET A;  5CBF A;  3K0D A;  2ADQ B;  3CCU V;  5KHJ A;  1W59 A;  4J7Z A;  4JI1 O;  5GTH Z;  3CRA A;  4AIL C;  2AW9 A;  3ABT A;  3RYI B;  2K1E A;  2LP7 A;  2GHY A;  5B1A C;  2OCH A;  4FM1 A;  3IC7 A;  3G71 V;  3AK1 A;  1K9M W;  1BS3 A;  4NXN O;  2HLD G;  1YSC A;  2JS5 A;  5E1A C;  3JAR A;  4FFK A;  5J2U A;  4TQD A;  4U7O A;  4F6R B;  2Q9L A;  3OMA B;  3ZN0 A;  2RJZ A;  4ZI7 B;  3KCY A;  4WBN A;  5B66 Z;  3SDL A;  3K58 A;  4CZZ A;  4TV9 B;  2JEU A;  4X20 A;  3T4D A;  2KKW A;  5IJ9 A;  2ZM6 O;  3R66 A;  4PD4 F;  1JJ2 U;  2LFR A;  5C8Y A;  4JTD B;  1YHQ V;  4X65 B;  1AJP A;  1WP7 A;  2UU9 B;  4CH6 A;  1NVP B;  1MOF A;  1K97 A;  1XOU A;  4FLX A;  2IW5 A;  1D5N A;  2VS0 A;  1IX9 A;  2WPD G;  1SRY A;  3ML0 A;  4PA9 A;  5JH7 B;  3G6E V;  3X2Q C;  1PL0 A;  4DRX A;  1HNZ O;  2H94 A;  4KL1 A;  3ZMZ A;  1YDX A;  2XOK G;  4DV7 B;  1MZF A;  2FYU H;  4JI2 O;  4X1Y B;  1CPY A;  3ZRV A;  1FXK A;  2P4K A;  2N05 A;  2EIL B;  4DV2 B;  4LF4 B;  3DXR B;  3CPW U;  1TA8 A;  1KYO F;  5KHI A;  3CJH A;  1JFF B;  2P06 A;  2AZ2 A;  1AIL A;  5LHH A;  2QA4 V;  5JQG B;  3RFR A;  3ABL B;  4NB5 A;  3F5T A;  1YIT V;  4DR5 B;  1OCC C;  2Q7E A;  4CH3 A;  1OCZ B;  1BGY H;  3JAT A;  1GTO A;  1M56 B;  3HKC B;  5JWP A;  4UCU A;  3T4Z A;  3HR0 A;  1TUB B;  2ZNI A;  2WLH A;  3CCJ V;  2OWO A;  2WLI A;  4O4I B;  1MA1 A;  2Q6A A;  3J80 N;  1QHT A;  2WA4 A;  2QM4 A;  1Q81 W;  2ZNJ A;  2R9A A;  4DR3 O;  2LW7 A;  4J80 A;  4QGP A;  3CB2 A;  4EB6 A;  3O9O A;  3L70 H;  1VQ4 V;  1X59 A;  2YXY A;  4FFB A;  2WSS G;  2LJ2 A;  4BIU A;  2O57 A;  5IE9 A;  3RYC B;  4CS2 A;  2YEV A;  1FFX A;  3J81 N;  4YJ3 A;  4JI7 O;  3BA9 A;  1VQ5 V;  1K7D A;  4JI3 B;  1XHX A;  3AK3 A;  4PA3 A;  2HFE C;  4FZ0 A;  4X66 O;  1K34 A;  3PN1 A;  3UO2 A;  1NH2 B;  1CEZ A;  3I5D A;  3ZJZ A;  2CTW A;  4JF3 A;  2P6J A;  4PA6 A;  1XQ8 A;  5H9C A;  3IFX A;  1S5J A;  2W0X A;  3MAQ A;  3H1J H;  1N33 O;  1V55 B;  4CBC A;  1BZK A;  2CUG A;  2VRZ A;  3ZHT A;  1XNR O;  3QVN A;  1AP5 A;  4UCR A;  2HG5 C;  2GBO A;  3JAW B;  4OXS A;  4HBN A;  4HNA B;  5EYP A;  3OUF A;  5KX5 B;  4Q6G A;  1NJI W;  5KHG A;  2YIC A;  1K73 W;  3OM3 B;  5HFL A;  4HZ3 A;  3CRC A;  2IJJ A;  2VQF O;  2Y0P A;  1YVW A;  1I08 A;  1SA0 B;  4IYH A;  5E79 Z;  3H9V A;  3CC7 V;  4DUY O;  1TVK B;  3CCQ V;  3L72 H;  3A2F A;  3IAY A;  1YTF B;  2WLL A;  1HDJ A;  2DJV A;  2IH3 C;  1GM9 A;  5LHG A;  5IYZ B;  5FNV A;  1HP8 A;  1UFI A;  4IHJ A;  5EBW C;  3UM7 A;  2YXL A;  2QSA A;  4NXN B;  2EIN C;  4I55 A;  4K0K B;  4JYY A;  1WA8 A;  1E1R G;  2UXB O;  3ABL C;  2Q0O C;  1PP9 H;  3L74 H;  1P7G A;  4DR2 O;  2FTK A;  2Q0A A;  3N27 A;  5IT9 N;  4UVB A;  1XMQ O;  2ZM6 B;  4PJ0 Z;  2CTR A;  2E74 B;  2OTL V;  1Z5V A;  5EBM C;  4TV8 A;  2P5O A;  3S3W A;  2ZT9 B;  4J7J A;  4QIW F;  3UCS C;  3UO3 A;  1WP8 A;  1SS3 A;  4XDL A;  1FS0 G;  5LGU A;  2ILM A;  5J2U B;  4L87 A;  2KB1 A;  1M90 W;  2F43 G;  3CCM V;  1PNL A;  5FL7 G;  4MTO A;  1M57 B;  4PV1 B;  5IYD O;  1DF5 A;  1G1X B;  4JYA B;  1EZV H;  1FYJ A;  1M9N A;  2F1M A;  5JVD A;  4U3J A;  1XL6 A;  3SPJ A;  4FLW A;  4B3R B;  4K35 A;  1KP3 A;  1VQ9 V;  4B7E A;  5LOV B;  2QWQ B;  1F23 A;  3B4S A;  5C8Y B;  4QPK A;  2KG7 A;  3K5L A;  3STL C;  3UT5 A;  2MW2 B;  4RQE A;  4LF9 B;  1K5S A;  3N2K A;  1R3L C;  5B5E Z;  3T1C A;  2YIA A;  4J11 A;  4K8Z A;  2M7W A;  1ZX3 A;  2ATK C;  3K04 A;  4LH7 A;  4UFZ A;  3S3X A;  2CGO A;  3K5O A;  2VWJ A;  1PKX A;  3FB8 C;  3WG7 B;  3T1H B;  4X62 O;  3HKB A;  1QR9 A;  5H2F Z;  1RP3 B;  1FXK B;  5K1X A;  4H44 B;  3CHX A;  2FML A;  4NXM O;  2XUM A;  1AR4 A;  5DED A;  1PD3 A;  2OT5 A;  3HB3 B;  3MHS C;  4NTW A;  1FFT B;  3CJH B;  4D6T H;  4PI2 A;  1NTM H;  4ZOL B;  1L0N H;  4UB8 Z;  2BTO A;  3P32 A;  3JCZ A;  1JX9 A;  4DR3 B;  1WAZ A;  1YJ9 V;  2EIM C;  3BA8 A;  2EJ7 A;  3JAK B;  5JJN B;  4GKJ O;  2RNB A;  4CS3 A;  1KKD A;  1PNM A;  3JAT B;  2F4V O;  4LWS B;  2ZE5 A;  3SPC A;  4KHP B;  3APO A;  3JD4 A;  4MVM A;  2XND G;  3ZRX A;  4LNU A;  2QM8 A;  2ZIN A;  3ZIA G;  3ZMS A;  5KUK A;  3APQ A;  1JCH A;  3BAB A;  1YZB A;  1KMI Z;  2YUA A;  1BSM A;  1W0K G;  4LC1 A;  1V54 C;  2RN9 A;  2Y4T A;  5H6Q A;  1N33 B;  4UXN A;  1AI6 A;  4FFB B;  2W6I G;  3U11 A;  4MVU A;  1KBH A;  1K33 A;  4P9P A;  1Y74 B;  3BY6 A;  4X65 O;  2YEV B;  2UU9 O;  3ASN B;  3TET A;  2JRI A;  3ASO C;  2EJR A;  1GMG A;  3ZRW B;  2EIJ B;  1T5E A;  4DK1 A;  5HFM A;  5LHI A;  4J7K A;  5J9P C;  2R9R B;  3F7V C;  5B1O A;  1OCR B;  3P3N A;  3BFR A;  1KU9 A;  4JV5 O;  2CDY A;  2UUA B;  4P9O A;  1IXM A;  5GTI Z;  1AP6 A;  3DTU B;  3TXS A;  1SQG A;  1TAE A;  4JAU A;  1V9P A;  4DV2 O;  1P7B A;  4FVM A;  3GWO A;  2B1I A;  2FL4 A;  4J41 A;  2R70 A;  4O4L B;  1Y67 A;  3OMN B;  1IXB A;  3AG2 B;  3D3I A;  1H2L A;  4DR5 O;  4NYK A;  1Q6U A;  1EFR G;  1YI2 V;  2GUZ A;  1K3E A;  4AQY O;  2UXC B;  4LCU C;  2UXB B;  1XHZ A;  1IZ3 A;  3E22 A;  5CBH A;  3HPL C;  3HKD A;  3IJ4 A;  3SPH A;  4LR3 A;  3TJT A;  4UVA A;  1IDS A;  4FPP A;  1EBO A;  3N2G B;  4JI8 O;  2X6C A;  2ZCE A;  2D3O W;  3AG1 B;  1VIB A;  2A7W A;  2LGW A;  2PTM A;  3FAV B;  4N23 A;  2QJ1 A;  3HKE B;  2PUS A;  1JVM A;  4JAV A;  1YXB A;  2JS3 A;  5CB4 A;  1FPO A;  1M93 A;  5LP6 B;  3VQY A;  1RSO B;  2W0F C;  3Q4H A;  1NBM G;  2JJ1 G;  3BEH A;  3J7A U;  2GTA A;  4EKW A;  3BRC A;  4GCZ A;  3O65 A;  2VQE O;  2A79 B;  3ZHU A;  1JQ0 A;  4Z1M G;  5IYC O;  1GM7 A;  4TV8 B;  4O4J B;  2P4V A;  3A8T A;  3K9A A;  3JAL A;  3K03 A;  1PPJ H;  3FFQ A;  3L71 H;  3F5W C;  3CRQ A;  4FZ1 A;  3W7S A;  5JCO C;  2PYJ A;  1US6 A;  4MS2 A;  3JAS A;  2AHZ A;  3ZBH A;  3QTC A;  1DLB A;  2C2A A;  5KHH A;  1S3J A;  4U3J B;  2PF4 E;  1P49 A;  3SGI A;  4X1K B;  4BIO A;  2WLK A;  3QO7 A;  4X62 B;  1GN2 A;  5KLV H;  2OTJ V;  4NXM B;  1D5A A;  2GTS A;  1SQF A;  3UT5 B;  3GWK C;  1Y66 A;  2DQ3 A;  2EIJ C;  2Q73 A;  1M5I A;  1GO3 F;  4KUM A;  3OE7 G;  3BPZ A;  4GKJ B;  4B08 A;  1OCR C;  4X88 A;  2EIK C;  3PJS K;  1SQP H;  2HHH O;  2LQT A;  2V7Q G;  2GSM B;  2F4V B;  1B06 A;  5LGN A;  2ZDI C;  1XL4 A;  4K0K O;  5BXZ A;  1N8R W;  1F4N A;  1IVS A;  5D5P A;  4BIZ A;  1Y76 A;  1OCO C;  4P30 A;  2OCC B;  3AG2 C;  3E86 A;  5DM6 V;  2VWK A;  1I0H A;  5LYJ A;  4DYL A;  4MT8 A;  1J5E B;  5BMV A;  1IBK O;  4BW5 A;  1VEW A;  2Q67 A;  2IJK A;  3AG3 B;  1QR8 A;  1AB3 A;  1WB7 A;  1ZL8 B;  1XI1 A;  4AI8 A;  3LSS A;  4QJF B;  1UPG A;  2HP8 A;  2CTQ A;  1G4Y B;  3T1Y O;  1THZ A;  3IC9 A;  4GX1 A;  1BHA A;  5B3S B;  2XAJ A;  4JYA O;  2E75 B;  4XDK A;  4PHZ A;  3CCE V;  2P67 A;  2ZXW C;  2G38 A;  4JAA A;  3CRR A;  5EZY B;  4B3R O;  1NR7 A;  3D36 C;  1FXH A;  3ZMU A;  4JV5 B;  2XTA A;  4L8J A;  2DOS A;  2P90 A;  2QTS A;  4H37 A;  2JIZ G;  4I9W A;  1QVG U;  4J9Z B;  2UXN A;  4UUJ C;  3CWB H;  1NU1 H;  1KUQ A;  1ZTE A;  1D2D A;  5IWA B;  3JCU Z;  4LF9 O;  1EN5 A;  5CA0 A;  2Z3Y A;  2JK5 C;  4NR1 A;  4TT3 G;  1ARO P;  1Z2G A;  1WNS A;  5CA1 B;  2BSK A;  3OTF A;  1L8D A;  1A32 A;  3RYF A;  4AQY B;  3E35 A;  3T1H O;  5ITZ B;  4FK5 C;  4PDM A;  5EK0 A;  2RCV A;  1URF A;  2BE3 A;  1COW G;  4GUN A;  2ZE7 A;  4TSF G;  1ZUQ A;  4JI8 B;  1VQO V;  5K1P A;  2Z0A A;  1N4C A;  4B3T B;  2AZ0 A;  2JGD A;  4GX0 A;  4CC6 A;  2WLN A;  3RWR D;  3EXA A;  1G8M A;  2YC0 A;  3G67 A;  4WFE A;  3ZCC A;  5JCO A;  2XAG A;  5LBQ A;  1FJG O;  2DYR B;  3OEE G;  1YJN V;  4KHP O;  5LA6 A;  1F7Y A;  2KSD A;  1WJZ A;  3H1K H;  1O9G A;  1XEQ A;  5J2T B;  2VQE B;  3ZX6 A;  1N0J A;  2BOC C;  2Y69 B;  4ICG A;  5JJJ B;  4DV6 O;  3EVK A;  1BQZ A;  1AI4 A;  4CH4 A;  4LFB O;  5KAF Z;  4QPJ A;  1K5Q A;  1X4T A;  4LF8 O;  2CH7 A;  3K5M A;  4FLT A;  2ARH A;  3UQ8 A;  1AR1 B;  5DN6 G;  5LMN O;  2YI9 A;  4FLZ A;  1EM1 A;  3CRM A;  1MMM A;  1SKV A;  2ZR2 A;  4JZ2 A;  2YI8 A;  2BOB C;  4B3S O;  2Q8V A;  1KB9 F;  4JGS A;  2R9I A;  3AG7 A;  2HVJ C;  1Z5W A;  2ZDI A;  5LMU B;  1WPB A;  2WWW A;  3H1H H;  1JPX A;  2X6A A;  1VMG A;  4DUZ O;  2ZKO A;  4O4H B;  3JAS B;  4WFF A;  5B3S C;  1LR1 A;  2YIB D;  2UUA O;  2QWP B;  4MW8 A;  5LXT A;  2P7T C;  2HEP A;  4DO2 A;  1N36 B;  1HWY A;  3OW2 U;  1QNM A;  4I50 B;  4LH6 A;  1SES A;  5TIS Z;  2HHH B;  3ZRS A;  2HR3 A;  2AHY A;  4Q20 A;  2EIL C;  1OV9 A;  3LDC A;  5GON B;  3W7T A;  2UUC B;  2M6Y A;  2A0L A;  2DE0 X;  4RAI A;  3K06 A;  4YJ2 A;  2F23 A;  3CE2 A;  3SYA A;  2UXC O;  1IBL O;  3SR2 C;  2X0L A;  3LDE A;  5EBL C;  4MVR A;  1NVP D;  1MZE A;  3OTO B;  2WAM A;  1TGO A;  1JOY A;  1OCZ C;  4I0X A;  5L3D A;  1M56 C;  1PNK A;  3KG2 A;  1IBK B;  3W7U A;  1DF4 A;  2E5L B;  1LNQ A;  4FLU A;  2DYS B;  4IIJ A;  3BAA A;  3JAR B;  3R65 A;  4BAY A;  2BTQ A;  4KP4 A;  4LF7 O;  3OUS A;  2Q68 A;  3T1Y B;  1RM1 B;  2FKX A;  3JSN A;  1NQT A;  4WBN B;  1DK1 A;  3RYH A;  3WB0 A;  3SJQ C;  1PM9 A;  4I4T A;  4X20 B;  5IJ9 B;  1S77 D;  2IBZ H;  2L35 A;  4R50 A;  4TOI A;  3JD1 A;  4GZR B;  3ABM B;  4O2B A;  1XDC A;  3E8F A;  1S5L Z;  2Y69 C;  1FD9 A;  1AR5 A;  4JI4 B;  3H1L H;  2F93 B;  3AG4 B;  5H6R A;  3JYC A;  4DRX B;  4TUY A;  4DV4 B;  4MTG A;  3JD2 A;  4RUE A;  4EFE A;  1F51 A;  2OYQ A;  1VP7 A;  2UXD O;  1NR1 A;  2MK3 A;  2PY5 A;  3CME V;  1V55 C;  1I5Y A;  2ADP A;  3W7X A;  4KXR A;  2H8P C;  1GN4 A;  4CH5 A;  3SJC C;  3RYI A;  1Q82 W;  1HW7 A;  4NTY A;  4X1I A;  3THO A;  1VF6 C;  2Y0I A;  1WLE A;  3DGE A;  1N0N A;  5IJ0 A;  3P30 A;  1ENV A;  1M4U A;  4LF6 O;  1DTO A;  1NH2 D;  3RYF B;  5L3C A;  2YIB A;  5DEC A;  3L73 H;  3H1I H;  4JZG A;  4PDV A;  1QQC A;  4F6R A;  1UJW B;  5BY1 A;  1FJG B;  2WA3 A;  1AVM A;  1XIL A;  3OR6 C;  4JI6 O;  4DR7 O;  3RVY A;  3EHB B;  1K4D C;  4JI5 B;  4ZI7 A;  1QLE B;  2WLI B;  1JA8 A;  3CCL V;  1VQK V;  3B40 A;  4TV9 A;  4DV6 B;  1GN6 A;  2A06 H;  4LFA O;  1BQ0 A;  5KA6 A;  1AI7 A;  4LFB B;  3TCU A;  4EB6 B;  4LF8 B;  5L3B A;  4JI0 B;  2IU0 A;  2ZIO A;  1J5E O;  3ZHV A;  2B1G A;  2ZD9 A;  5JH7 A;  5LMN B;  3SPG A;  5LA6 B;  1YTF D;  1FFX B;  1R3J C;  3SYC A;  4YJ3 B;  3LNM B;  4GX5 A;  3K08 A;  1QVF U;  4B3S B;  5BR8 O;  1VF5 B;  3QF7 A;  5JJE B;  3CXC U;  4LP8 A;  4JYC A;  4HAM A;  3M8A A;  4MVO A;  2QM7 A;  5FLX N;  3DXR A;  4DUZ B;  1M57 C;  1VQL V;  4JYB A;  1JFF A;  2ZQM A;  4U3F H;  5JQG A;  2W6J G;  5EYP B;  5IWA O;  3K57 A;  1N34 B;  4PDR A;  3A0R A;  5B1A B;  1PV0 A;  3JSL A;  3JD0 A;  4H33 A;  2PZS A;  4ASU G;  2PYL A;  4MTF A;  1TUB A;  2IU3 A;  3SYQ A;  1H8H G;  4IT5 A;  4O4I A;  5A2Q N;  2YS8 A;  4E2L A;  1IBL B;  3LSU A;  3NR7 A;  2WLL B;  3ZHS A;  4XDJ A;  1R6K A;  5LXT B;  3WU2 Z;  5FNV B;  3CC4 V;  2XT9 A;  3WG7 C;  3AEI A;  4IHJ B;  4RUF A;  4UCV A;  1FXK C;  3I55 V;  3MHH C;  3B8M A;  4DK0 A;  4B3T O;  1NT2 B;  1SZT A;  1VQP V;  2A9H A;  3MD0 A;  1Q3E A;  4JTC B;  1Y6X A;  4I55 B;  3RYC A;  3FYI B;  4LF7 B;  4P2Z A;  4A5U B;  1WA8 B;  1GKF A;  3P3P A;  1BT8 A;  5KAI Z;  2GV9 A;  4FIP C;  4GYC B;  4BWA A;  1YEW A;  2XAS A;  4DR6 O;  2QWR B;  1H2N A;  2QTO A;  3M99 B;  4UV9 A;  2UUB O;  3KCX A;  4I9Q A;  1QLE C;  3G6B A;  4U7N A;  2RMK B;  4MVZ A;  2Q7H A;  1I7F A;  3JAW A;  2QWN B;  2JVD A;  4CS4 A;  4HNA A;  4X64 O;  3L9D A;  2QR4 A;  2HJF C;  3B2E E;  3RBZ A;  3C3S A;  1U96 A;  1VF6 A;  4R8C A;  1RFY A;  3H01 A;  2IJH A;  2IJI A;  5JVD B;  2UXD B;  4MW3 A;  2B9Z A;  1JJO A;  2RDC A;  1SA0 A;  4JAS A;  1E79 G;  3C90 A;  5KMG A;  1OCC B;  1TVK A;  5BZB A;  2KG7 B;  2JJ2 G;  3ASN C;  1FXV A;  1FAF A;  5LMU O;  2Q4P A;  4LBE C;  3N2K B;  5IYZ A;  1KQS U;  2LGQ A;  1HNX O;  1QU7 A;  3CC2 V;  1VQN V;  2WLJ A;  3FB6 C;  5IY5 B;  2E76 B;  1N36 O;  3ZN1 A;  4Z2W A;  4TUY B;  4LF6 B;  2DWD C;  4BW9 A;  2OIE A;  3ZHQ A;  1OJH A;  3NXS A;  3HKB B;  2IH1 C;  3UKM A;  4QE7 A;  1ORQ C;  4JI6 B;  4DR7 B;  2HJD A;  2UUC O;  1VQ7 V;  3D8C A;  2YSU B;  3RW0 A;  2AGA A;  1K4C C;  4X1I B;  4MSW C;  4WF9 V;  4LFA B;  3DSQ A;  3OTO O;  3ABK B;  2EX3 A;  5IJ0 B;  3FYE B;  3ABU A;  3ETG A;  3OEH G;  1ZSP A;  4O2A A;  5CBG A;  2ZE6 A;  3ICX A;  2E5L O;  4D7T A;  2Y48 A;  1R73 A;  4OX9 O;  3CP1 A;  4LNU B;  1LUV A;  3AG1 C;  5BR8 B;  5IYB O;  1KEC A;  5LOV A;  1ZLZ A;  2H3O A;  1H38 A;  1IUR A;  3K5N A;  3CS5 A;  2LO1 A;  1AI5 A;  2EZP A;  5GW7 A;  5LP6 C;  2DWE C;  4K3A A;  1JMK C;  1BMF G;  4JTA B;  3JAM N;  1IBM O;  1H2M A;  1SQQ H;  2Q5Z A;  3FKS G;  1GK9 A;  2XAF A;  2DW4 A;  2IM9 A;  3QG5 A;  1ZAU A;  3B77 A;  4WFB V;  1OZ0 A;  3B09 A;  4WCE V;  2NN4 A;  3A0H Z;  3LDD A;  4JI4 O;  1XRE A;  4G2K A;  1XNQ O;  4Z1V A;  2LFS A;  4UCO A;  4DV4 O;  1JR9 A;  2ZIM A;  1Q6I A;  2EIN B;  4NVP A;  5EC2 C;  4DR4 O;  3QO5 A;  3FB7 C;  3CCS V;  4QE9 A;  5A9G A;  1W0J G;  5KA5 A;  3BVO A;  2NNU A;  4GKK O;  3C3T A;  4ZOL A;  2QE7 G;  2LW1 A;  1B04 A;  2QWO B;  3W7W A;  4PA4 A;  3SJB C;  4ZIB A;  4YY3 O;  4PEL A;  2WLM A;  4DV1 B;  3JAK A;  4YHH O;  1MG1 A;  3E89 A;  2Z5U A;  4ZBM A;  4WFH A;  1WB8 A;  2ITD C;  4LWS A;  4X9Q A;  2N74 A;  1OHH G;  2GUZ B;  3RGB A;  2CAZ C;  1R3I C;  3E22 B;  1YF2 A;  3CCR V;  3HKD B;  5IY5 C;  4I7Z B;  1J95 A;  2PI5 A;  4LF5 B;  2QGN A;  5L3F A;  2NR5 A;  4JI5 O;  4JPR A;  1H2K A;  4I5S A;  4UVC A;  5KUM A;  1FKA O;  1QCE A;  4DR6 B;  2ZE8 A;  1XUQ A;  2GDS A;  3WB1 A;  1BCC H;  4QNH B;  2UUB B;  2X6B A;  3E8H A;  4K8X A;  2E3C A;  5CB4 B;  4TWK A;  1Y74 A;  4G28 B;  2HKO A;  4JI0 O;  4FM0 A;  4X64 B;  3WFV A;  2OCC C;  1MSD A;  3OAA G;  3ABK C;  3Q4H B;  3I56 V;  3G4S V;  1I5X A;  1S76 D;  3ZRW A;  1HR0 B;  1SZX A;  3VQV A;  4CC5 A;  2FB5 A;  1MAB G;  4DV0 B;  5FPR A;  4BR6 A;  4OPH A;  3AG3 C;  5LL6 Y;  5H5N A;  2QDO A;  3JAL B;  3OMI B;  4ABM A;  2ETN A;  4X89 A;  1NTK H;  1HNX B;  1E1Q G;  4NKG B;  3B8N A;  1XMO B;  4O4L A;  2QKC A;  1SF9 A;  4J10 A;  4RO2 A;  4GLX A;  4YIP A;  1KC8 W;  4J9Y B;  3E2E A;  1SC5 B;  1N34 O;  1VQ8 V;  2EIM B;  4LFC O;  4YIO A;  4ZKI A;  5KMG B;  2PGG A;  4AHC A;  4JI1 B;  4F4L A;  2XAH A;  3K0G A;  1F4M A;  3DC5 A;  2EUL A;  4PI0 A;  3TGU H;  1G6U A;  1VQ6 V;  2YDE A;  3BCC H;  3ZMT A;  3N2G A;  3DC6 A;  1S0V A;  1QLN A;  4EEQ A;  3E8G A;  4GT1 A;  3K3W A;  2A3Q A;  4XBF A;  1SQB H;  3FAV A;  4IGG A;  3HKE A;  1NI8 A;  4PDL A;  1GH6 A;  3ZED A;  2JEX A;  5LP6 A;  3D36 A;  4OX9 B;  4WFG A;  1V54 B;  2DMX A;  1YIJ V;  1RSO A;  2D2C B;  4DV5 O;  4IL6 Z;  4X8A A;  3ZS8 C;  3RN4 A;  2XAQ A;  2CK3 G;  4UCT A;  4MVQ A;  1TUE B;  4ZHQ A;  4FM2 A;  1XBL A;  4RQF A;  1DGS A;  5B1N A;  3SYO A;  2ZR3 A;  1VQM V;  1Y76 B;  1S5H C;  1RPR A;  4DV3 O;  1R6N A;  3ASO B;  1GRJ A;  5CN0 A;  4DR1 O;  4UCS A;  4NTX A;  4O4J A;  3E83 A;  1N32 O;  1YCI A;  4O2A B;  5LYJ B;  1HNW O;  4IYI A;  1IBM B;  3IGA C;  1U97 A;  3JD3 A;  3CYO A;  5BMV B;  2DYR C;  1I94 O;  5D5Q A;  1KD1 W;  4UV8 A;  1HNZ B;  2QEX V;  1Q7Y W;  3CSX A;  2QKA A;  4RWU A;  4X1K A;  1XNQ B;  2Y4U A;  4W4L A;  2EZO A;  3SPI A;  4JI2 B;  1VF7 A;  4N21 A;  3CX5 F;  3OFN G;  3SYP A;  4DXW A;  2CE4 A;  4H13 B;  2V1D A;  1Q86 W;  4DR4 B;  5F2V O;  2XHB A;  3K79 A;  4GKK B;  3E8B A;  2QKS A;  5L3G A;  4YY3 B;  3BHP A;  4EFB A;  4G27 B;  2F66 C;  1P4R A;  4YHH B;  3FD9 A;  4TQF A;  3OD4 A;  4FLY A;  3CEI A;  3CMA V;  5CA0 B;  3TXQ A;  1SQX H;  1K92 A;  2BSK B;  1P84 F;  2DN9 A;  3ZHR A;  3M7M X;  4B7K A;  3TK1 A;  4B3M O;  1KKC A;  4UB6 Z;  2B5U A;  1ZWI C;  3FX7 A;  3CXH F;  1MSW D;  3RT3 C;  1VAR A;  3ETD A;  2JGD B;  3SJA C;  2V4D A;  4FLV A;  4D7S A;  4PA7 A;  2PI4 A;  1W2B U;  1WPX A;  2N04 A;  3D3Q A;  1ROP A;  3EFF K;  1ZL8 A;  1Q90 D;  1RPO A;  4WFA V;  5LGT A;  4JI7 B;  1K8A W;  2CTP A;  1Y4M A;  3MDS A;  4OGQ B;  4X66 B;  1GN3 A;  3STZ C;  3L75 H;  1H2S B;  3OR7 C;  5B1B B;  5EZY A;  1B6Q A;  2Q69 A;  1H8E G;  3LUT B;  4X1Y A;  2DYS C;  1SER A;  1XNR B;  1NS1 A;  1GAX A;  2NLJ C;  2JGU A;  1RM1 C;  2ITC C;  2CH7 B;  1CP9 A;  3AK2 A;  4W4K A;  3VOU A;  2L6L A;  3QNE A;  5EC1 C;  1NKD A;  3OT7 A;  3VQW A;  5IDJ A;  2YXH A;  4FMT A;  2VQF B;  5CA1 A;  3CCV V;  3A0B Z;  3K9S A;  4DV7 O;  2AXT Z;  4LFC B;  1Q5O A;  3T2M A;  4DUY B;  3HKC A;  2EIK B;  5ITZ A;  3ABM C;  1AJN A;  1NTZ H;  3KZI Z;  2BCC H;  4C7U A;  1Q43 A;  3LSQ A;  4LF4 O;  3VBB A;  3AG4 C;  3CD6 V;  4R6Z A;  4OPA A;  2Q7G A;  1R1B A;  5EIB C;  4H0L B;  1YJW V;  1OCO B;  1QBZ A;  3RVZ A;  1GM8 A;  1R3K C;  4DV1 O;  1KP2 A;  2K9P A;  2OIG A;  2P22 C;  1R6T A;  1B3Q A;  3ETE A;  1PL4 A;  1MNG A;  1Q8I A;  4DV5 B;  3GB7 C;  3KKY A;  4DR2 B;  2F95 B;  3WB2 A;  4YJ2 B;  1BE3 H;  3K59 A;  4GX2 A;  4YXW G;  2HVK C;  5J2T A;  1SQV H;  2CGN A;  4DV3 B;  1XMQ B;  3LNN A;  4LF5 O;  4DR1 B;  3X2Q B;  2YID A;  1WN7 A;  1N32 B;  1CXZ B;  4I0X B; 
#chains in the Genus database with same CATH homology
 4R7C A;  1YJ9 V;  1M1K W;  4MW8 A;  5C93 A;  2P7T C;  2EIM C;  4DO2 A;  3FKS G;  1GK9 A;  1HWY A;  2XAF A;  2ZXW B;  3OW2 U;  2DW4 A;  1AJQ A;  1BL8 A;  4MVS A;  3B77 A;  1KKD A;  4WFB V;  1OZ0 A;  1PNM A;  1SES A;  2EBO A;  4HYO A;  4KFM A;  4WCE V;  3ZRS A;  1H2G A;  2HR3 A;  2AHY A;  4Q20 A;  4MTX A;  3LDD A;  3SPC A;  4G2K A;  1BHB A;  2EIL C;  2LFS A;  3LDC A;  2X7R B;  3W7T A;  2A0L A;  3JD4 A;  4MVM A;  2XND G;  1L1F A;  3ZRX A;  5CA3 A;  1S72 V;  4RAI A;  3K06 A;  2QM8 A;  3ZIA G;  3ZMS A;  2EIN B;  5EC2 C;  3SYA A;  5L3E A;  3QO5 A;  5KUK A;  3FB7 C;  3CCS V;  4QE9 A;  3ZMV A;  2UXX A;  3F7Y C;  2X0L A;  1W0J G;  3LDE A;  1JCH A;  4MVR A;  5EBL C;  5KA5 A;  2NNU A;  1NVP D;  2WAM A;  2QE7 G;  1EZJ A;  1W0K G;  4LC1 A;  3W7W A;  1OCZ C;  1V54 C;  4PA4 A;  5L3D A;  1JOY A;  1M56 C;  4PEL A;  3QO8 A;  5H6Q A;  1PNK A;  3KG2 A;  2WLM A;  4UXN A;  1AI6 A;  2W6I G;  4MVU A;  3W7U A;  1K33 A;  1DF4 A;  5CMU A;  1MG1 A;  3E89 A;  4P9P A;  2Z5U A;  5B1B C;  1LNQ A;  4ZBM A;  4FJC C;  3BY6 A;  4WFH A;  2YEV B;  2DYS B;  3ASN B;  3TET A;  2ITD C;  2JDI G;  3ASO C;  3R65 A;  4BAY A;  2DQ0 A;  4KP4 A;  2EJR A;  3FB5 C;  3OUS A;  1OHH G;  2Q68 A;  1RM1 B;  1GMG A;  3ZRW B;  2EIJ B;  3OGC C;  1R3I C;  5HFM A;  1SET A;  5CBF A;  5LHI A;  3K0D A;  3CCR V;  1NQT A;  5IY5 C;  5J9P C;  3CCU V;  2PI5 A;  1J95 A;  2R9R B;  3F7V C;  5L3F A;  5B1O A;  1OCR B;  4JPR A;  4I5S A;  4UVC A;  5KUM A;  3SJQ C;  3ABT A;  1IXM A;  1QCE A;  4P9O A;  2K1E A;  2LP7 A;  3DTU B;  1S77 D;  2GHY A;  4JAU A;  5B1A C;  4R50 A;  1P7B A;  3JD1 A;  3ABM B;  3IC7 A;  4QNH B;  3G71 V;  2X6B A;  3E8H A;  3GWO A;  1K9M W;  2B1I A;  3E8F A;  2Y69 C;  4TWK A;  4G28 B;  2HLD G;  3OMN B;  1YSC A;  2HKO A;  3AG4 B;  5E1A C;  3AG2 B;  3WFV A;  3D3I A;  2OCC C;  3JYC A;  5H6R A;  3OAA G;  4U7O A;  4MTG A;  1EFR G;  3ABK C;  3JD2 A;  4RUE A;  3I56 V;  1YI2 V;  3G4S V;  1I5X A;  1F51 A;  1S76 D;  3OMA B;  3ZRW A;  3ZN0 A;  1K3E A;  1NR1 A;  2MK3 A;  4LCU C;  5CBH A;  3HPL C;  1MAB G;  3CME V;  1V55 C;  3SPH A;  1I5Y A;  4UVA A;  4FPP A;  4CZZ A;  1EBO A;  3AG3 C;  3W7X A;  2H8P C;  2JEU A;  1Q82 W;  3OMI B;  3T4D A;  2X6C A;  4X89 A;  1JJ2 U;  2D3O W;  2LFR A;  3AG1 B;  4JTD B;  1YHQ V;  1E1Q G;  1WLE A;  3DGE A;  4N23 A;  1AJP A;  3B8N A;  1NVP B;  1JVM A;  4JAV A;  1MOF A;  1K97 A;  3P30 A;  1ENV A;  2IW5 A;  2WPD G;  1DTO A;  1SRY A;  3ML0 A;  4PA9 A;  3G6E V;  4RO2 A;  3X2Q C;  5L3C A;  1NH2 D;  1PL0 A;  1KC8 W;  4J9Y B;  3E2E A;  2H94 A;  1VQ8 V;  3ZMZ A;  2EIM B;  2XOK G;  2W0F C;  4PDV A;  1UJW B;  1NBM G;  4ZKI A;  2JJ1 G;  3BEH A;  3OR6 C;  4EKW A;  4F4L A;  3RVY A;  3EHB B;  1K4D C;  2XAH A;  3K0G A;  1QLE B;  2WLI B;  4GCZ A;  1CPY A;  1F4M A;  2A79 B;  3CCL V;  1JQ0 A;  1FXK A;  3ZRV A;  4Z1M G;  5IYC O;  1VQK V;  1VQ6 V;  1GM7 A;  3ZMT A;  1S0V A;  2EIL B;  1QLN A;  3K9A A;  3E8G A;  3CPW U;  3K03 A;  4GT1 A;  5KA6 A;  3F5W C;  3W7S A;  1AI7 A;  3K3W A;  5LHH A;  3TCU A;  2QA4 V;  4XBF A;  4MS2 A;  3ABL B;  4PDL A;  5L3B A;  2AHZ A;  2IU0 A;  1YIT V;  2B1G A;  1DLB A;  1OCC C;  2ZD9 A;  2C2A A;  2JEX A;  3SPG A;  1S3J A;  3D36 A;  1OCZ B;  1V54 B;  4WFG A;  1YTF D;  1YIJ V;  1GTO A;  1M56 B;  2WLK A;  4X8A A;  3QO7 A;  1R3J C;  2XAQ A;  3SYC A;  2CK3 G;  4MVQ A;  3LNM B;  1TUE B;  3T4Z A;  4GX5 A;  3K08 A;  1QVF U;  4RQF A;  2WLH A;  5B1N A;  2OTJ V;  3SYO A;  3CCJ V;  2ZR3 A;  2WLI A;  1VQM V;  1S5H C;  3CXC U;  1RPR A;  4LP8 A;  1R6N A;  3ASO B;  4JYC A;  5CN0 A;  2Q6A A;  4HAM A;  4MVO A;  2QM7 A;  3E83 A;  1Q81 W;  1Y66 A;  2DQ3 A;  1M57 C;  1VQL V;  4JYB A;  2EIJ C;  3IGA C;  3JD3 A;  2ZQM A;  1GO3 F;  4KUM A;  3OE7 G;  3CYO A;  2DYR C;  1VQ4 V;  1OCR C;  4X88 A;  2W6J G;  2EIK C;  3PJS K;  1KD1 W;  4UV8 A;  2QEX V;  1Q7Y W;  2V7Q G;  4PDR A;  2GSM B;  3A0R A;  2WSS G;  4BIU A;  5B1A B;  5LGN A;  2ZDI C;  3JD0 A;  4H33 A;  2YEV A;  3SPI A;  2EZO A;  1XL4 A;  4ASU G;  4MTF A;  1VQ5 V;  1K7D A;  3OFN G;  4N21 A;  3SYP A;  4DXW A;  4PA3 A;  2IU3 A;  2V1D A;  2HFE C;  1N8R W;  3SYQ A;  1F4N A;  1K34 A;  1Q86 W;  1H8H G;  4BIZ A;  1BMF G;  1NH2 B;  1OCO C;  1CEZ A;  4E2L A;  3ZJZ A;  4P30 A;  2OCC B;  3AG2 C;  4JF3 A;  3E86 A;  2WLL B;  4JTA B;  4XDJ A;  2P6J A;  3K79 A;  1R6K A;  4PA6 A;  5H9C A;  3E8B A;  5DM6 V;  2QKS A;  3IFX A;  5L3G A;  3CC4 V;  3WG7 C;  1V55 B;  4CBC A;  4MT8 A;  4G27 B;  3AEI A;  4BW5 A;  1P4R A;  4RUF A;  1FXK C;  2Q67 A;  2IJK A;  2HG5 C;  3AG3 B;  3I55 V;  3MHH C;  3B8M A;  1QR8 A;  4OXS A;  1SZT A;  3CMA V;  1VQP V;  2A9H A;  3OUF A;  3MD0 A;  1NJI W;  4JTC B;  3LSS A;  4QJF B;  1K92 A;  1K73 W;  3FYI B;  3OM3 B;  4P2Z A;  1G4Y B;  5HFL A;  4HZ3 A;  1THZ A;  4GX1 A;  1BHA A;  2IJJ A;  5B3S B;  1GKF A;  3TK1 A;  2XAJ A;  4XDK A;  3CCE V;  4FIP C;  2P67 A;  2ZXW C;  3CC7 V;  3CCQ V;  1YTF B;  1NR7 A;  2WLL A;  1FXH A;  3ZMU A;  2B5U A;  2XAS A;  1ZWI C;  2P90 A;  2IH3 C;  4H37 A;  1MSW D;  1GM9 A;  2QTO A;  2JIZ G;  4I9W A;  1QVG U;  5LHG A;  3M99 B;  4J9Z B;  2UXN A;  3ETD A;  4UV9 A;  4UUJ C;  1QLE C;  5EBW C;  4U7N A;  4MVZ A;  4PA7 A;  3UM7 A;  2PI4 A;  1W2B U;  1WPX A;  2EIN C;  1ROP A;  3EFF K;  2Z3Y A;  2JK5 C;  1RPO A;  4TT3 G;  4WFA V;  1ARO P;  5LGT A;  1K8A W;  2HJF C;  3RBZ A;  1Y4M A;  4R8C A;  3H01 A;  2IJH A;  2IJI A;  1E1R G;  4MW3 A;  3ABL C;  3E35 A;  3STZ C;  4FK5 C;  4PDM A;  4JAS A;  5EK0 A;  1E79 G;  3OR7 C;  2FTK A;  1OCC B;  5B1B B;  1COW G;  1B6Q A;  4TSF G;  2Q69 A;  1H8E G;  3LUT B;  5BZB A;  2JJ2 G;  2DYS C;  4UVB A;  1SER A;  3ASN C;  1FXV A;  1VQO V;  2OTL V;  5EBM C;  4LBE C;  1KQS U;  3CC2 V;  2NLJ C;  1VQN V;  4QIW F;  1RM1 C;  2ITC C;  4XDL A;  2WLJ A;  1FS0 G;  5LGU A;  1CP9 A;  3FB6 C;  5IY5 B;  4GX0 A;  3ZN1 A;  3VOU A;  4L87 A;  3QNE A;  2WLN A;  2KB1 A;  5EC1 C;  2DWD C;  1NKD A;  1M90 W;  2F43 G;  3CCM V;  1PNL A;  1G8M A;  4MTO A;  5FL7 G;  1M57 B;  4WFE A;  5IYD O;  5IDJ A;  3ZCC A;  4FMT A;  3NXS A;  3CCV V;  1DF5 A;  2XAG A;  5LBQ A;  1M9N A;  2DYR B;  2IH1 C;  3OEE G;  3UKM A;  4QE7 A;  1YJN V;  1ORQ C;  1XL6 A;  3T2M A;  3SPJ A;  2EIK B;  3ABM C;  1VQ7 V;  1KP3 A;  1VQ9 V;  3RW0 A;  2YSU B;  1AJN A;  1K4C C;  1F23 A;  2BOC C;  2Y69 B;  4MSW C;  4WF9 V;  3LSQ A;  4QPK A;  3VBB A;  3AG4 C;  1AI4 A;  3CD6 V;  3STL C;  4R6Z A;  3ABK B;  4RQE A;  1K5S A;  3FYE B;  1R3L C;  4QPJ A;  3ABU A;  1K5Q A;  3ETG A;  3OEH G;  3T1C A;  1YJW V;  1OCO B;  1QBZ A;  3RVZ A;  5CBG A;  1GM8 A;  2M7W A;  1R3K C;  2ATK C;  3K04 A;  1KP2 A;  1AR1 B;  5DN6 G;  2Y48 A;  1R73 A;  1PKX A;  3ETE A;  3FB8 C;  3WG7 B;  2ZR2 A;  3GB7 C;  3CP1 A;  1QR9 A;  1FXK B;  2BOB C;  3AG1 C;  4GX2 A;  5IYB O;  4YXW G;  2HVK C;  1PD3 A;  1KEC A;  2OT5 A;  4JGS A;  3HB3 B;  2R9I A;  3MHS C;  1H38 A;  2HVJ C;  1FFT B;  2ZDI A;  2WWW A;  1JPX A;  2X6A A;  1AI5 A;  2EZP A;  3X2Q B;  5GW7 A;  2DWE C;  3P32 A;  3JCZ A;  1JX9 A;  5B3S C;  4WFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...