2Q6AA

Crystal structure of nak channel d66e mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGEGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
total genus 42
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q6aA00
3SYOA 4HZ3A 2QTOA 4MVMA 4ZBMA 1OCRC 4QE7A 5B1BC 4WFEA 4P9OA 2WLJA 4F4LA 5EK0A 5B3SC 2HG5C 1R3LC 2HVJC 2Q6AA 2WLLA 3ASNC 2W0FC 3ABKC 4P9PA 4CBCA 3TETA 4XDJA 2HVKC 4JTAB 2NLJC 2WLIB 3K08A 2DWDC 3T4ZA 4QNHB 3X2QC 5CBFA 4PDVA 4JTDB 5IY5C 2IH1C 1K4CC 1JVMA 2KB1A 4MSWC 4MVRA 1R3JC 2AHYA 2ATKC 4JTCB 3AG4C 3E8BA 4PA3A 3ABLC 3STZC 1LNQA 3EFFK 1M57C 4MVSA 5BZBA 2DYRC 2WLIA 4P30A 3ZJZA 4GX1A 3FB7C 3K0GA 4XDLA 1ZWIC 4GX5A 3SYAA 3ASOC 4RUEA 2ITCC 5EC1C 3K06A 2H8PC 2A0LA 4X89A 1XL4A 3SPCA 3STLC 2WLHA 2Y69C 4WFGA 2Q67A 4DXWA 2P7TC 3E83A 2R9RB 3AG2C 3K04A 3PJSK 4I9WA 4PDRA 1OCZC 2ZD9A 5KUKA 4MW3A 3TCUA 2WLNA 4X88A 1S5HC 3OGCC 4PA7A 4BW5A 3E89A 4PDLA 3OR7C 3OUFA 4TWKA 4OXSA 3SPIA 3E8GA 3HPLC 3VOUA 3SYPA 3LNMB 4MVQA 4QE9A 4G28B 3FB6C 3UKMA 2EIKC 4R8CA 5B1AC 3SYQA 2X6CA 3AG3C 2A9HA 3K0DA 3F7YC 4EKWA 1ORQC 4LCUC 3SPHA 5CBHA 1P7BA 4G27B 3T4DA 3E8HA 4XDKA 3E86A 1OCCC 4PDMA 2QKSA 4X8AA 2YEVA 3RW0A 2Q69A 1V55C 1R3KC 3OUSA 4H33A 1G4YB 2ZXWC 3KG2A 4WFHA 4MTFA 2BOBC 4LP8A 2ITDC 1OCOC 2DWEC 1J95A 2HJFC 4R7CA 2X6BA 3F7VC 3JYCA 3AG1C 4P2ZA 2OCCC 3F5WC 2HFEC 2A79B 2DYSC 3BEHA 4MVUA 5EBWC 3WG7C 3LDCA 4RAIA 3FB5C 3T1CA 3GB7C 3FB8C 3IGAC 2EINC 4H37A 3ZRSA 4PA9A 2X6AA 5EBLC 3OR6C 3R65A 4GX2A 4PA6A 3RVZA 5CBGA 1M56C 4J9YB 2JK5C 5EC2C 3SJQC 3K03A 1R3IC 3SPGA 3SYCA 4RUFA 3LDEA 4MTOA 4R50A 4MVZA 3LUTB 3LDDA 2WLKA 4LBEC 4MS2A 4J9ZB 2WLMA 1QLEC 2EIMC 4WFFA 3RVYA 1V54C 4UUJC 2WLLB 4R6ZA 4RO2A 3SPJA 3T2MA 3ABMC 2IH3C 1BL8A 1K4DC 4PA4A 5E1AC 5KUMA 3UM7A 1KKDA 4MTGA 2BOCC 4MVOA 4KFMA 2AHZA 2EILC 3IFXA 4GX0A 3RBZA 3E8FA 5J9PC 2K1EA 1XL6A 4MW8A 2Q68A 4HYOA 5EBMC 2EIJC
chains in the Genus database with same CATH superfamily
4FLXA 2P06A 1Z5WA 3RYCA 4X65B 1M57B 2GUZA 2N04A 1L1FA 2WLLA 2ADPA 4RQEA 5CMUA 1K8AW 4FK5C 3FAVB 2CGOA 3F5TA 1K34A 3A0HZ 4O2AB 1HNZO 3L74H 1JVMA 4DV5O 3QO7A 4QGPA 1H2NA 4DUZB 2UU9O 3CRRA 4D7SA 1XNRB 2Q0OC 3JALA 1LNQA 3HB3B 1M57C 4MVSA 4P30A 3K5OA 3CP1A 5DECA 4RQFA 4LF7B 4AHCA 3JARA 5EC1C 2YI9A 1M56B 2RQ6A 2UXCO 2QWRB 4NR1A 1LUWA 4TQFA 1MABG 1QR9A 1Q82W 1TAEA 3OUFA 2XAGA 1HR0O 2YIDA 5EYPA 2XAHA 2HP8A 2Q8VA 3AK3A 3F7YC 3OTOB 2LP7A 2XTAA 5CBHA 4X65O 4LF9B 2QKSA 3TGUH 1JOYA 3LNNA 3ML0A 4YJ2A 4DYLA 1XUQA 2AZ2A 1XDCA 1PV0A 2LGQA 2N74A 1VQPV 4TV9B 5KAIZ 4RAIA 1OCRB 1WP7A 3CCEV 4H37A 4YHHB 3JD2A 4CS4A 2JGDA 3RYHA 1V9PA 3K03A 4RUFA 4R50A 4X66B 4MS2A 1MOFA 1HNWO 3S3WA 3VQWA 5BMVA 2Q0AA 4DR4B 1GKFA 3RVYA 1ZAUA 4OX9O 2UXBB 1XMQB 5CA3A 4X1KB 2OIEA 4DR3O 4FFBB 4HZ3A 2QTOA 1RFYA 3N27A 2JVDA 3O65A 4P9PA 4CBCA 2DOSA 4JYBA 1A32A 1GH6A 4JYYA 1Q6IA 3K59A 4LFBO 2LW7A 5EZYA 3ETEA 3WB1A 1K9MW 2XAFA 1BT8A 4DR2O 4UCSA 4PELA 3OAAG 2ADQB 3ABKB 4HAMA 4DRXA 2WLHA 3P3PA 5LHHA 4DV2O 1MSDA 4DV0O 2H3OA 1KC8W 1N33B 2XHBA 4JZGA 3VOUA 1WN7A 3LSSA 4MVQA 2EIKC 3CC4V 5JWPA 2ODMA 1GN2A 2JS3A 4LCUC 3CC2V 1N0NA 1V55C 4H44B 1KUQA 4LP8A 4WCEV 3K9SA 1URFA 3AG1C 2A79B 3ZX6A 3FB5C 5C8YA 2EIJB 5EBLC 1COWG 1QCEA 5CA0A 1R6KA 2ZIOA 1NR7A 4I0XA 5GONB 1NZ6A 4BIZA 1J5EB 1OV9A 2EIMC 1FYJA 1H2MA 2P4KA 2F95B 1PNMA 5E79Z 2RDCA 5EYPB 4UCTA 1JA8A 4DR3B 2F4VO 4X1KA 4GZRB 3UO2A 4YY3B 4FZ1A 4F4LA 3G6EV 1AJQA 2Q6AA 1VP7A 3ZCCA 1TVKB 1ZTEA 1KBHA 4QNHB 4FZ0A 3JARB 1VF7A 1X59A 4TQDA 3DC5A 4IHJB 4UCOA 1KB9F 5KHJA 2JGDB 2F93B 3GWKC 4IYHA 4NXNB 2FTKA 1VF5B 1QR8A 3ABTA 2LQTA 3AK1A 1IBMO 2A0LA 1NI8A 2Y69C 3BVOA 3ZHUA 2KG7A 4PA7A 4BW5A 2OT5A 2HHHO 3OFNG 3BAAA 2FB5A 2UUBB 3DSQA 5B1BB 5JH7A 3AG3C 4MTXA 3G71V 4EKWA 1ORQC 1JQ0A 4CH4A 4PDMA 4EB6B 3Q4HA 1Y74A 3H01A 5DN6G 4DUZO 2LJ2A 3JSNA 5LBQA 4WFHA 2ITDC 4JI5O 1KQSU 4O2BB 3WG7C 4X1YB 3T1CA 1GM9A 1GK9A 5IYDO 4FJCC 1VQ9V 5DEDA 5EC2C 3VQVA 4DW1A 4DR6O 2IJIA 4MTOA 4FLZA 4LFAB 1DTOA 3FAVA 3L73H 5C93A 1FXKC 3T1YO 2WLLB 2BCCH 3E22A 2ZNJA 3K5MA 1JPXA 2P22C 4RWUA 2KKWA 2X0LA 1UPGA 2AHZA 3IFXA 1H2GA 4X20A 3L70H 3B40A 3SR2C 1WB8A 4P9OA 5JJNB 1AP5A 2FL4A 3CE2A 2HVKC 3RFRA 5KHKA 4JI7O 5FPOA 3CMAV 4DR7B 1GN3A 4FFKA 4B3MO 2ZE7A 3E8BA 4ZOLA 1I7FA 3QVNA 2WLIA 5LYJB 2ZE8A 2B1IA 3FKSG 1N32B 1JFFA 1V55B 1U97A 2Q7EA 5EIBC 4FPPA 3JASA 1XBLA 3JD0A 4PDRA 4Q6GA 1OCZC 3B2EE 2EULA 2ZM6B 5JCOC 1JX9A 2A7WA 4WBNB 4K0KB 1WPBA 5BXZA 1TUBB 5LXTA 1PNLA 3LNMB 4KUMA 5KHHA 2FYUH 2EX3A 5D5QA 2HLDG 3ZRWA 4JV5O 2ZT9B 3EVKA 4JI8O 1D5AA 2QA4V 2BOBC 1NVPD 1W2BU 4LF8B 2CH7A 2EILB 5EBWC 4EEQA 4LF4O 1HW7A 3OM3B 2AGAA 5JVDA 1WJZA 3R65A 3CRCA 4PI2A 2YSUB 1N33O 1AI6A 4JI2B 1SQFA 5KX5A 1N8RW 5LXTB 1NTKH 2JS5A 2PZSA 4DR2B 1O9GA 2PTMA 4X62B 1OCCB 1FKAO 1JJOA 3RBZA 3TXQA 3CWBH 3C3TA 4LC1A 4QE7A 1TUEB 2Y69B 3PN1A 3ZS8C 1R3LC 2E76B 1LUVA 2GDSA 3P32A 1PPJH 3E35A 1IZ3A 5BR8O 4X66O 4JTCB 1THZA 3AG4C 5LL6Y 3TJTA 1BHAA 1YZBA 2CH7B 5ITZA 4JPRA 5BZBA 1WNSA 2NNUA 4JI0B 1H8EG 3ZHTA 1IBKB 2IU3A 2Y4TA 3FX7A 1B06A 3N2KA 1U96A 5IYCO 1N36B 1S0VA 5DM6V 2E74B 3OEHG 2DJVA 1PL4A 3OGIB 3TCUA 5IWAO 1I08A 1S5LZ 4YY3O 4OXSA 5CA1B 1BMFG 3CCSV 1K92A 5B1AC 2F4VB 3ZMUA 3P3NA 5LP6C 2WWWA 1NR1A 4X8AA 5J2UA 4UVCA 5FNVA 1MZEA 1QNMA 5B3SB 2D2CB 3UO3A 1N36O 3AK2A 4FLWA 1QBZA 3BPZA 2X6BA 2XNDG 1IDSA 4MT8A 2NR5A 3VQXA 2CDYA 4O4JA 3L75H 1AROP 4J7ZA 1XHXA 1HNXO 3OR6C 5KHGA 1M56C 2ZNIA 1HR0B 2ILMA 4A5UB 2NN4A 3OMNB 4U3FH 1XEQA 1OCOB 5JJEB 4KP4A 1V54C 3J7AU 1WLEA 1GM7A 2E3CA 4LNUA 2GV9A 1XL6A 4MW8A 2Q68A 1G8MA 3HKEB 4N23A 1SZTA 4DV0B 4I50B 5EK0A 2F66C 1AI4A 3B8NA 4DUYO 2RN9A 4K8XA 2XOKG 2UUCO 3ZMTA 4TT3G 1FXKA 1DLBA 2IJJA 3CCMV 2YIAA 4B7EA 5BMVB 5B5EZ 2PI5A 4DR5O 3L72H 1I5YA 3OMIB 3A2FA 5KX5B 1BQZA 4GKKO 1K7DA 4CC5A 3I5DA 4LF8O 4DUYB 4KXRA 1AR4A 3AG2C 5KUKA 1VQMV 2LW1A 2HKOA 2YXHA 3OGCC 2G38A 3WB2A 2Y4UA 2P5OA 2PI4A 5LA6A 1KP3A 1F23A 2MW2B 3AG2B 1Q6UA 4ZKIA 1Q43A 1RM1C 4O4IB 3T4DA 3RW0A 3ABLB 2PYLA 1SQBH 2ZXWC 4ASUG 3D3QA 1E79G 4ZHQA 4CS3A 1OCOC 2HJFC 1J95A 4NTWA 3F7VC 1OCZB 3DTUB 2FMLA 3ZHVA 3H1KH 3MAQA 2AW9A 2A3QA 4TUYB 3SJBC 3GB7C 2ZE5A 3QNEA 2OTLV 2QTSA 2X6AA 3HKBB 2IJKA 3MD0A 4MVZA 4XBFA 4X9QA 3K57A 2Q73A 2R9IA 3K9AA 5LYJA 4QPKA 2IH3C 1ZL8B 5IJ9B 4MTGA 1FXVA 1YCIA 1GN4A 1N34O 5GONA 3RYCB 4MVMA 2EJ7A 3TETA 3ZN1A 3DC6A 3P30A 4NYKA 1HNXB 4DR6B 2YIBA 3SGIA 4E4EA 4JI4O 1Y4MA 3EFFK 3WU2Z 4Z2WA 5A2QN 3B4SA 2QDOA 4YIPA 1R6TA 4JYCA 1H38A 2CTRA 2YI8A 4FIPC 4EFEA 4GCZA 4UCRA 1UJWB 4DXWA 2VQEB 3HKDB 1BGYH 4MW3A 3H1LH 5FNVB 4X88A 4DV5B 1HDJA 1AVMA 2BTOA 3HPLC 5CB4A 4TSFG 5LGTA 4OPAA 5K1PA 1QLNA 2X7RB 2M7WA 5IWAB 1N34B 1L8DA 2YC0A 1TGOA 2UXBO 2RNBA 4TUYA 2Q5ZA 3DGEA 4B3TB 1D2DA 4XDKA 3E86A 1OCCC 2YEVA 1R3KC 4NXNO 2YXLA 1EFRG 1DGSA 3C3SA 2QWQB 4TV9A 4PD4F 3F5WC 2HEPA 2RCVA 4K3AA 4CZZA 1K73W 2OIGA 5LA6B 4F6EA 3K3WA 4BWAA 3SYCA 2GBOA 1SQQH 3LDEA 3C90A 5KAFZ 2WLKA 4J9ZB 4FFBA 5LHGA 4WF9V 3QO8A 3VBBA 4LF9O 2CE4A 3OT7A 2JEXA 1PD3A 3ABMC 1K4DC 1K5QA 4GX0A 2ZE6A 4IHJA 1VMGA 1MMMA 3W7SA 4ZBMA 1OCRC 2BTQA 4YXWG 2EZOA 1CEZA 2D3OW 3OTFA 2Z3YA 4BIUA 4DR1O 1CXZB 2IJHA 4JTAB 4JTDB 2Q7GA 3JALB 1BQ0A 2ARHA 4J10A 1ENVA 3G80A 4AI8A 2CTQA 4J42A 1T5EA 3H1HH 3JAKB 3ZEDA 3ASOC 4DV3O 1GAXA 4UVBA 4LF4B 1TA8A 4X89A 5AG2A 3AG1B 4GKJB 1QVFU 2LGWA 1S5HC 4I7ZB 1VIBA 4JYAB 4C7UA 3LSQA 3ZRWB 1LR1A 3SYPA 4G28B 4PV1B 3HKCA 4LR3A 4DV7O 2CK3G 3ZMSA 2PYJA 5FLXN 1HNWB 1ZL8A 1NKDA 2ZDIC 2UXXA 2AXTZ 1SQGA 2E5LO 1K5SA 1JCHA 3WB0A 1F4NA 3BEHA 4MVUA 1KD1W 2E75B 3ETQA 3L9DA 3FB8C 1H2LA 3ABUA 1Z2GA 5KMGB 2DN9A 1FFXB 5CBGA 5LHIA 1AI7A 1RPRA 4J80A 3G6BA 4B08A 2GUZB 1K97A 5LP6A 4LBEC 3HKCB 3HR0A 2UUBO 3JAWA 1KU9A 4WFFA 2L35A 1Y76B 4ZI7B 4O4HA 5KUMA 4WFAV 5J9PC 1SRYA 4O4IA 3AG3B 4EFBA 5ITZB 3W7WA 2N05A 4FLVA 1SESA 4BW9A 3APQA 1VQOV 4D7TA 2NLJC 3K08A 1FD9A 2Z0AA 1Z5VA 5H6QA 4JI6B 2OTJV 1IBLB 4W4KA 3CYOA 2JDIG 2ATKC 1SQVH 1XQ8A 3UCSC 1WAZA 3JATA 1S5JA 4IL6Z 4YJ3A 2A06H 4E2LA 4B3TO 1VARA 1Q5OA 1I94B 1FXHA 2YDEA 3D8CA 1AB3A 3ETGA 4CS2A 5L3FA 3E83A 3JD4A 1XILA 1Y74B 3ICXA 2L6LA 4NTXA 3RYFA 2UU9B 3SPIA 4X64O 2QGNA 1PP9H 3S3XA 1CPYA 2VQEO 2B5UA 4W4LA 4LF7O 2KQXA 5L3GA 3G4SV 4G27B 2LFRA 4CC6A 3KZIZ 2XUMA 1IBMB 2ZKOA 3OUSA 3D36A 3KG2A 4I4TA 1YTFB 5JCOA 4JI3O 3W7TA 2DYSC 1XNRO 2VWKA 2ZQMA 1V54B 1FPOA 5D5PA 1DK1A 1PNKA 5LMNB 1YXBA 3SJCC 2JK5C 1YDXA 4I9QA 2BTQB 1H8HG 2WLMA 4UB8Z 5BY1A 4LH7A 3U11A 5HFLA 4K35A 1HP8A 3QG5A 3T2MA 3JATB 4PA4A 5KA5A 4MVOA 5FL7G 3QTCA 1N0JA 3R66A 4K0KO 4DV3B 4WFEA 4QJFB 3SJAC 1D5NA 5B3SC 5CA1A 4IGGA 4O4LB 1F4MA 4IYIA 3OEEG 4LNUB 4I5SA 1EN4A 4KHPO 2IH1C 3FD9A 4JYAO 2KB1A 2CGNA 2QWNB 3CRQA 2VS0A 1Q90D 4O4HB 2GTAA 3ZHRA 5B1NA 4J41A 3BHPA 3ZJZA 2ZR3A 2XT9A 4GX1A 4X20B 3X2QB 3JAWB 5BR8B 1UFIA 2YEVB 3I56V 4TV8B 2DMXA 2JIZG 1PL0A 1FFXA 2PF4E 1BSMA 5IJ9A 3BA9A 5KMGA 5CB4B 3RWRD 3ZRVA 4JV5B 3O9OA 3CRMA 1WB7A 4B3MB 1B3QA 1I0HA 5J2UB 3QO5A 5IT9N 3HKDA 1YJNV 2WAMA 3JCZA 3IAYA 1SKVA 3IC9A 4B7KA 4HNAA 2IW5A 3ABMB 2R72A 1X4TA 1XMOB 4DRXB 4KHPB 5CN0A 3RYHB 4FVMA 2E5LB 4P2ZA 2W6IG 4DO2A 2ZINA 2YICA 3N2KB 3KKYA 2EINC 3MHHC 1QLEB 5A9GA 1L0NH 2GTSA 5JVDB 4I4TB 1NH2D 2UUCB 1OJHA 1QLEC 1MNGA 4PJ0Z 4GKJO 3CSXA 4QPJA 4R6ZA 1G1XB 4U3JB 1GN6A 4KL1A 2EILC 1AJPA 2QEXV 3VQYA 1DF5A 1BS3A 3CCUV 2RJZA 1YSCA 2BE3A 3SYOA 3I55V 2QM8A 4UV9A 1BZKA 3H9VA 3HKBA 5CBFA 5IYZB 2QWOB 4JI1B 4NVPA 2AHYA 2EZPA 4OX9B 3DXRA 1PM9A 2W6JG 2ZR2A 4IT5A 2V1DA 4N21A 2LO1A 1BCCH 4J7KA 4X1IB 4O2AA 2YIBD 2ITCC 4Q20A 4NTYA 3K06A 4B3RO 3GWOA 1SZXA 2FKXA 2DE0X 2MK3A 4I0XB 3CCRV 1O9HA 2P4VA 1SERA 1PKXA 4TWKA 1IX9A 4B3SB 2XAQA 4IIJB 3CCQV 1E1RG 3JD3A 3FB6C 1SF9A 4LH6A 1AILA 5B1AB 3A8TA 2P90A 1KECA 2JRIA 1VF6C 1G4YB 5LP6B 4MTFA 3ZHSA 1VQ4V 1NQTA 1IBLO 2DWEC 1AJNA 3OW2U 4WBNA 1Q86W 3JYCA 4JI1O 2ZXWB 4JAUA 4Z1VA 1FXKB 1VQ5V 3RVZA 1Q81W 1Q8IA 4CH6A 1JR9A 2ZCEA 1R6NA 2UXDO 3TK1A 3AG4B 3BRCA 1SETA 3HKEA 5HFMA 4DV4B 1OZ0A 3CC7V 2EIKB 4UUJC 3SPJA 3EHBB 5E1AC 3W7UA 1RM1B 1SS3A 3SYAA 1SQPH 2V4DA 2QWPB 2QE7G 1VF6A 2IU0A 4CH3A 2PY5A 3JCUZ 1OHHG 3A0RA 1NU1H 4DV2B 2HVJC 4JI8B 3ASNC 3ABKC 5FPRA 3FYIB 1GMGA 3OMAB 4DV1O 4U7OA 1MSWD 5GTHZ 2QM4A 2EINB 3NR7A 1E1QG 1K4CC 4O4JB 1FJGB 3BA8A 2HJDA 4MSWC 4PA3A 3JSLA 4NB5A 1NS1A 1NT2B 1P4RA 4XDLA 1ZWIC 4RUEA 1YJWV 1L0LH 4DK0A 2H8PC 1ZLZA 4FM1A 4WFGA 2Y48A 5K1XA 2PGGA 3K79A 4O2BA 4UB6Z 4LWSB 5LOVB 3CHXA 3CXHF 3NXSA 1ZSPA 1RP3B 1MA1A 2WA4A 2IBZH 4R8CA 3EXAA 1YEWA 1N32O 3ETDA 4AQYB 3D3IA 3CMEV 1S72V 3T1HO 3CS5A 2UUAB 2OCCC 3M7MX 2AZ0A 1Q7YW 3CEIA 1WP8A 3IJ4A 3LSUA 1AI5A 2HR3A 4WFBV 4X1IA 4K8ZA 2DQ3A 5C8YB 4PA6A 3THOA 1US6A 2WA3A 3N2GA 1I5XA 4UV8A 5F2VO 3OTOO 4BR6A 2Y0IA 3ZBHA 1W59A 2P6JA 4KFMA 5L3BA 3MHSC 1TVKA 4LF6O 1Y66A 4DK1A 3BFRA 2JEUA 2W0FC 5B1OA 2WLIB 4AILC 4DV6B 3B09A 2P67A 5KLVH 5IY5C 2IM9A 2ETNA 3RYIA 1M93A 1QU7A 2BSKB 3ABLC 4GLXA 2DYSB 4LF5B 5IE9A 4J7JA 2DYRC 3FB7C 4J11A 4GYCB 3W7XA 3J81N 1Y76A 2Q67A 2R9RB 4ABMA 3ZIAG 4DW0A 1YJ9V 3RGBA 3UQ8A 4Z1MG 1BE3H 4LWSA 2HHHB 5LGUA 4QE9A 2GHYA 2CTPA 3SYQA 1EM1A 3E2EA 2X6CA 2R70A 1SQXH 1QHTA 3E8HA 4NXMB 1GO3F 1IVSA 1IXMA 3MDSA 3K5LA 4DV4O 3WFVA 3QF7A 2Q9LA 1YIJV 3CPWU 2CUGA 5H2FZ 3J80N 3LDCA 3K5NA 5LMUB 5JQGB 1WA8B 1VQLV 4HBNA 1KMIZ 2ZM6O 1J5EO 2DYRB 4EB6A 4GX2A 2JJ1G 3SPGA 1R3IC 1VQ8V 1XNQB 5JH7B 1GM8A 1K3EA 4JF3A 1XOUA 2VQFB 4ICGA 1XMOO 1DF4A 5IJ0A 5IY5B 2YS8A 1F7YA 2JJ2G 4ZIBA 1VQKV 3AEIA 4JGSA 3CCJV 2BSKA 3RN4A 4O4LA 1N4CA 3RYIB 3M99B 3ZN0A 4B3SO 2EBOA 3CCVV 4FLYA 4DR1B 1B6QA 2OYQA 4I55B 3T4ZA 2UXCB 3X2QC 5H5NA 3ZMVA 3DXRB 1M90W 4DR7O 2JGUA 3B8MA 5JJJB 2W0XA 5IYZA 1KYOF 2DW4A 2O57A 5LMUO 5EIBD 3L71H 2CAZC 3T1HB 4GX5A 1EN5A 2QKAA 2QJ1A 5IYBO 4X62O 4UVAA 4ZHQB 3BCCH 3A0BZ 1NTZH 4I9WA 3PJSK 3JAMN 1MG1A 1NH2B 4LFCB 2WLNA 1MZFA 1SA0A 4IIJA 1G6UA 1VEWA 3CXCU 4YJ2B 2K9PA 3CX5F 2KG7B 2QSAA 2PUSA 3CRAA 3UKMA 3T1YB 2R9AA 2F23A 4JI5B 4DV1B 2VRZA 3K0DA 4JAAA 1NTMH 4F6RB 1EZVH 5LMNO 4GKKB 1FFTB 1SA0B 3WG7B 2XASA 4B3RB 1NBMG 3RYFB 1AR1B 3APOA 2RMKB 1HWYA 4FMTA 4GT1A 3ZHQA 2C2AA 1XMQO 3KCXA 2B1GA 2GSMB 5LOVA 1YITV 1FJGO 4DV7B 4JI3B 4H0LB 4HNAB 2XAJA 1NVPB 2WPDG 4J9YB 1Y6XA 4H13B 4LFBB 3LUTB 1M5IA 3ASOB 4G2KA 4YHHO 4I55A 4UXNA 1ZUQA 2F43G 4UCVA 1IURA 3ZMZA 1BL8A 1JMKC 3UM7A 5LGNA 4JI4B 4X64B 3ASNB 3E8FA 3U10A 1QQCA 5GTIZ 4TV8A 5B1BC 1M9NA 1EZJA 2WLJA 1EN6A 1YI2V 2Q7HA 4PI0A 4QIWF 3H1JH 1BHBA 2DWDC 4L87A 4PDVA 4ZI7A 2VQFO 1R3JC 1RSOA 2UXDB 2YUAA 1XNQO 1I94O 1XI1A 1ZX3A 4L8JA 3E22B 5JQGA 2F1MA 2VWJA 3UT5B 3FFQA 2H94A 4OPHA 1XREA 3AG7A 3SPCA 1XL4A 3STLC 1SC5B 4FLTA 2P7TC 3K04A 2ZD9A 5H9CA 4JI0O 4PHZA 5KA6A 2DQ0A 3E89A 4FLUA 4PDLA 2CTWA 3E8GA 4OGQB 3RT3C 1AP6A 3M8AA 1CP9A 2WSSG 1W0JG 1R1BA 1Q3EA 2UUAO 3CB2A 4JZ2A 1Q6HA 3SPHA 1F51A 1YHQV 3B77A 3N2GB 3FYEB 4H33A 4BIOA 1QVGU 2B9ZA 1R73A 1P49A 2EIMB 3G67A 1AR5A 1Y67A 2HFEC 5GW7A 2QM7A 4YIOA 4F6RA 1GRJA 5KHIA 3IGAC 4JI2O 3CJHB 3ZRSA 4PA9A 2Z5UA 3CD6V 1WPXA 1P7GA 3JD1A 4LF5O 3JAKA 3SDLA 2OCCB 1HNZB 2OWOA 3KCYA 1YF2A 2M6YA 1RPOA 3OD4A 4AQYO 1GTOA 1KKDA 2BOCC 1H2SB 2ZDIA 2K1EA 2QKCA 2ZIMA 2HG5C 1KKCA 3CCLV 5H6RA 5TISZ 4XDJA 1NJIW 1JJ2U 4LFCO 2YXYA 2V7QG 1KP2A 1JFFB 4JI6O 3GVMA 3H1IH 4MVRA 4FM0A 4UFZA 5L3EA 4ZOLB 3STZC 4I50A 1VQ6V 4U3JA 4DR4O 3UT5A 4LF6B 3K0GA 2Y0PA 1W0KG 2QR4A 3CJHA 4JAVA 5L3DA 5L3CA 1RSOB 4DV6O 5CA0B 5IJ0B 4NKGB 5B66Z 1S77D 3OR7C 3TXSA 5IDJA 1VQNV 3D36C 1VQ7V 4JI7B 1FS0G 2Q4PA 4CH5A 2OCHA 2A9HA 1WA8A 1M4UA 1TUBA 1S76D 1P7BA 4BAYA 3K58A 2Q69A 4JASA 4U7NA 4YJ3B 3ZRXA 1K33A 4R7CA 1B04A 3JASB 1IBKO 1M1KW 1ROPA 3U0ZA 4X1YA 1H2KA 2LFSA 3OE7G 1FAFA 4DR5B 2UXNA 3SJQC 1P84F 1YVWA 1XHZA 1YTFD 3LDDA 3IC7A 3Q4HB 1EBOA 4GUNA 4NXMO 4RO2A 4D6TH 5J2TA 1IXBA 2KSDA 2EJRA 4TOIA 5J2TB 3BY6A 3BABA 5EZYB 4LFAO 4UCUA 4FM2A 4HYOA 1S3JA 5EBMC 2EIJC
chains in the Genus database with same CATH topology
4LC1A 1Y66A 4QE7A 1TUEB 3W7WA 2JEUA 2Y69B 1M57B 1SESA 1L1FA 1R3LC 2WLLA 4RQEA 1K8AW 2W0FC 5CMUA 5B1OA 4FK5C 1VQOV 2NLJC 2WLIB 3K08A 1K34A 2P67A 5H6QA 2OTJV 5IY5C 3P32A 3CYOA 3E35A 2JDIG 1JVMA 3QO7A 2ATKC 4JTCB 1THZA 3AG4C 3ABLC 1BHAA 2DYSB 1LNQA 3HB3B 1M57C 4MVSA 4JPRA 5BZBA 2DYRC 4P30A 2NNUA 3FB7C 3CP1A 4E2LA 4RQFA 1H8EG 3W7XA 5EC1C 2IU3A 1FXHA 1M56B 3ETGA 5IYCO 2Q67A 5L3FA 3E83A 3JD4A 2R9RB 1S0VA 5DM6V 3OEHG 1MABG 3TCUA 3ZIAG 1QR9A 1YJ9V 1Q82W 3OUFA 4OXSA 4Z1MG 3SPIA 2XAGA 5LGUA 1CPYA 1BMFG 4QE9A 2GHYA 3CCSV 1K92A 2XAHA 5B1AC 3SYQA 3ZMUA 3E2EA 2X6CA 2B5UA 3F7YC 2LP7A 5CBHA 5L3GA 3G4SV 4G27B 2LFRA 3E8HA 1GO3F 2WWWA 1NR1A 4X8AA 2QKSA 4UVCA 1IXMA 1JOYA 5B3SB 3OUSA 3D36A 3KG2A 3ML0A 3WFVA 1YTFB 1QBZA 2X6BA 2XNDG 1YIJV 3W7TA 4MT8A 2DYSC 3CPWU 1VQPV 3LDCA 4RAIA 2ZQMA 1VQLV 1V54B 1AROP 1OCRB 3CCEV 4H37A 3JD2A 2DYRB 1PNKA 2JJ1G 3OR6C 4GX2A 1M56C 2JK5C 3SPGA 3K03A 1R3IC 1VQ8V 4RUFA 4R50A 4MS2A 1MOFA 1GM8A 1K3EA 1H8HG 4JF3A 2WLMA 3OMNB 1DF4A 1OCOB 5IY5B 4KP4A 1GKFA 1V54C 3RVYA 5HFLA 1WLEA 1GM7A 3T2MA 2JJ2G 4PA4A 5CA3A 5KA5A 4MVOA 1VQKV 3AEIA 4JGSA 5FL7G 3CCJV 1XL6A 3M99B 4MW8A 2Q68A 3ZN0A 1G8MA 4HZ3A 2QTOA 2EBOA 4N23A 1SZTA 4WFEA 4QJFB 3CCVV 5EK0A 5B3SC 3B8NA 1AI4A 4P9PA 1B6QA 4CBCA 1F4MA 4JYBA 3OEEG 2XOKG 3T4ZA 3X2QC 4I5SA 3ZMTA 4TT3G 2IH1C 1FXKA 1DLBA 2IJJA 3ZMVA 3CCMV 2KB1A 1M90W 2PI5A 3B8MA 3ETEA 2DW4A 5B1NA 1I5YA 1K9MW 2XAFA 3ZJZA 2ZR3A 4GX1A 3X2QB 3OMIB 4GX5A 4PELA 1K7DA 2YEVB 3OAAG 3ABKB 5IYBO 3I56V 4HAMA 4UVAA 2WLHA 2JIZG 4I9WA 3AG2C 3PJSK 5LHHA 1PL0A 5KUKA 1MG1A 1VQMV 1NH2B 2WLNA 2HKOA 3OGCC 3ZRVA 1KC8W 3CXCU 3VOUA 2PI4A 3LSSA 4MVQA 1KP3A 3UKMA 2EIKC 1F23A 3QO5A 3CC4V 3K0DA 2WAMA 3AG2B 3JCZA 1YJNV 4ZKIA 4LCUC 1RM1C 3T4DA 1FFTB 3CC2V 3WG7B 3RW0A 3ABLB 1V55C 2IW5A 2XASA 3ABMB 2ZXWC 1NBMG 4ASUG 4LP8A 1E79G 4WCEV 1AR1B 1OCOC 2HJFC 1J95A 5CN0A 3F7VC 1OCZB 3AG1C 4P2ZA 1HWYA 3DTUB 2W6IG 2A79B 4FMTA 4GT1A 2C2AA 4DO2A 3FB5C 2B1GA 3GB7C 2GSMB 1YITV 2EINC 3MHHC 3QNEA 1QLEB 2EIJB 2OTLV 2X6AA 5EBLC 1COWG 1QCEA 2IJKA 1R6KA 2XAJA 3MD0A 2WPDG 4J9YB 1NVPB 1NR7A 4MVZA 1NH2D 3LUTB 4XBFA 3ASOB 4G2KA 4BIZA 1QLEC 2EIMC 4UXNA 2R9IA 2F43G 4QPJA 3K9AA 1PNMA 4R6ZA 3ZMZA 4QPKA 2IH3C 1BL8A 3UM7A 5LGNA 4MTGA 3ASNB 2EILC 1AJPA 2QEXV 1FXVA 3E8FA 1DF5A 3CCUV 1YSCA 3SYOA 3I55V 4MVMA 5B1BC 1M9NA 1EZJA 2WLJA 4F4LA 3G6EV 1AJQA 2QM8A 4UV9A 3TETA 2Q6AA 1YI2V 3ZCCA 4QIWF 1BHBA 2DWDC 3ZN1A 4QNHB 5CBFA 3P30A 4L87A 4PDVA 1R3JC 2AHYA 2EZPA 2W6JG 2ZR2A 1Y4MA 3EFFK 2FTKA 1QR8A 2V1DA 4N21A 3ABTA 2H94A 4JYCA 1H38A 2ITCC 4FIPC 4Q20A 4GCZA 3K06A 2A0LA 3SPCA 1XL4A 3STLC 1UJWB 2Y69C 4DXWA 2P7TC 3GWOA 3K04A 2ZD9A 5H9CA 4MW3A 5KA6A 2MK3A 4X88A 3CCRV 4PA7A 4BW5A 2DQ0A 1SERA 3E89A 4PDLA 2OT5A 1PKXA 4TWKA 3OFNG 3E8GA 2XAQA 3HPLC 4TSFG 5LGTA 3CCQV 1CP9A 1E1RG 2WSSG 3JD3A 3FB6C 1W0JG 5B1BB 2X7RB 1QLNA 2M7WA 3AG3C 5B1AB 4MTXA 3G71V 4EKWA 1ORQC 1JQ0A 3SPHA 3DGEA 1F51A 4XDKA 1YHQV 2P90A 3E86A 1OCCC 1KECA 4PDMA 2YEVA 3B77A 3H01A 1R3KC 3FYEB 4H33A 1G4YB 5DN6G 5LBQA 4WFHA 1EFRG 4MTFA 1QVGU 2ITDC 1VQ4V 1NQTA 1R73A 2DWEC 2EIMB 1AJNA 3OW2U 1Q86W 3JYCA 1KQSU 3F5WC 2HFEC 5GW7A 2ZXWB 2QM7A 4JAUA 3WG7C 3T1CA 1GM9A 1GK9A 4CZZA 1FXKB 3IGAC 1K73W 5IYDO 3ZRSA 1VQ5V 4FJCC 4PA9A 1VQ9V 2Z5UA 3CD6V 1WPXA 3K3WA 3JD1A 3RVZA 1Q81W 5EC2C 3SYCA 1R6NA 2IJIA 3LDEA 4MTOA 3TK1A 3AG4B 2WLKA 1SETA 4J9ZB 2OCCB 5HFMA 5LHGA 4WF9V 1DTOA 1OZ0A 3QO8A 3CC7V 2EIKB 3VBBA 5C93A 1FXKC 4UUJC 2WLLB 3SPJA 3EHBB 1RPOA 2JEXA 1PD3A 3ABMC 1K4DC 1GTOA 1JPXA 1K5QA 5E1AC 1KKDA 2X0LA 2BOCC 2AHZA 3IFXA 4GX0A 3W7UA 2ZDIA 2K1EA 1H2GA 1RM1B 3SYAA 3W7SA 2QE7G 2IU0A 4ZBMA 1OCRC 1OHHG 4YXWG 4P9OA 2EZOA 3A0RA 2D3OW 1CEZA 2HG5C 2HVJC 2Z3YA 5H6RA 4BIUA 3ASNC 3ABKC 3CCLV 4XDJA 3FYIB 2HVKC 1GMGA 2IJHA 4JTAB 3OMAB 1NJIW 4U7OA 1JJ2U 1MSWD 4JTDB 2V7QG 1KP2A 2EINB 3CMAV 1E1QG 1K4CC 4MVRA 4MSWC 4PA3A 3E8BA 5L3EA 3STZC 1ENVA 1VQ6V 2WLIA 1P4RA 3K0GA 4XDLA 2B1IA 1ZWIC 3ASOC 3FKSG 1W0KG 1V55B 4RUEA 4UVBA 1YJWV 4FPPA 2H8PC 4JAVA 4X89A 3JD0A 4WFGA 2Y48A 5L3DA 5L3CA 4PDRA 1OCZC 3AG1B 1QVFU 1JX9A 3K79A 1S5HC 1S77D 3OR7C 3LSQA 5IDJA 3ZRWB 1VQNV 1VQ7V 3NXSA 1PNLA 3LNMB 3SYPA 4G28B 1FS0G 4KUMA 4R8CA 2A9HA 2HLDG 3ZRWA 1S76D 3ETDA 1P7BA 2CK3G 3ZMSA 4BAYA 2Q69A 4JASA 4U7NA 3D3IA 3CMEV 2QA4V 3ZRXA 1NKDA 2BOBC 2ZDIC 2UXXA 1S72V 1NVPD 1K33A 1K5SA 1JCHA 4R7CA 1W2BU 2OCCC 1M1KW 1ROPA 2EILB 1F4NA 3BEHA 4MVUA 5EBWC 1KD1W 1Q7YW 1AI5A 3OM3B 3FB8C 2HR3A 2LFSA 3ABUA 4WFBV 3OE7G 2DQ3A 3R65A 4PA6A 5CBGA 5LHIA 1AI7A 1RPRA 2UXNA 3SJQC 1YTFD 1K97A 2YSUB 3LDDA 3IC7A 4LBEC 1AI6A 1EBOA 1I5XA 4UV8A 1N8RW 4WFFA 4RO2A 5KUMA 2EJRA 2P6JA 1OCCB 3BY6A 4KFMA 5L3BA 3RBZA 4WFAV 5J9PC 1SRYA 3MHSC 4HYOA 1S3JA 3AG3B 5EBMC 2EIJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYO A;  4HZ3 A;  2QTO A;  4MVM A;  4ZBM A;  1OCR C;  4QE7 A;  5B1B C;  4WFE A;  4P9O A;  2WLJ A;  4F4L A;  5EK0 A;  5B3S C;  2HG5 C;  1R3L C;  2HVJ C;  2Q6A A;  2WLL A;  3ASN C;  2W0F C;  3ABK C;  4P9P A;  4CBC A;  3TET A;  4XDJ A;  2HVK C;  4JTA B;  2NLJ C;  2WLI B;  3K08 A;  2DWD C;  3T4Z A;  4QNH B;  3X2Q C;  5CBF A;  4PDV A;  4JTD B;  5IY5 C;  2IH1 C;  1K4C C;  1JVM A;  2KB1 A;  4MSW C;  4MVR A;  1R3J C;  2AHY A;  2ATK C;  4JTC B;  3AG4 C;  3E8B A;  4PA3 A;  3ABL C;  3STZ C;  1LNQ A;  3EFF K;  1M57 C;  4MVS A;  5BZB A;  2DYR C;  2WLI A;  4P30 A;  3ZJZ A;  4GX1 A;  3FB7 C;  3K0G A;  4XDL A;  1ZWI C;  4GX5 A;  3SYA A;  3ASO C;  4RUE A;  2ITC C;  5EC1 C;  3K06 A;  2H8P C;  2A0L A;  4X89 A;  1XL4 A;  3SPC A;  3STL C;  2WLH A;  2Y69 C;  4WFG A;  2Q67 A;  4DXW A;  2P7T C;  3E83 A;  2R9R B;  3AG2 C;  3K04 A;  3PJS K;  4I9W A;  4PDR A;  1OCZ C;  2ZD9 A;  5KUK A;  4MW3 A;  3TCU A;  2WLN A;  4X88 A;  1S5H C;  3OGC C;  4PA7 A;  4BW5 A;  3E89 A;  4PDL A;  3OR7 C;  3OUF A;  4TWK A;  4OXS A;  3SPI A;  3E8G A;  3HPL C;  3VOU A;  3SYP A;  3LNM B;  4MVQ A;  4QE9 A;  4G28 B;  3FB6 C;  3UKM A;  2EIK C;  4R8C A;  5B1A C;  3SYQ A;  2X6C A;  3AG3 C;  2A9H A;  3K0D A;  3F7Y C;  4EKW A;  1ORQ C;  4LCU C;  3SPH A;  5CBH A;  1P7B A;  4G27 B;  3T4D A;  3E8H A;  4XDK A;  3E86 A;  1OCC C;  4PDM A;  2QKS A;  4X8A A;  2YEV A;  3RW0 A;  2Q69 A;  1V55 C;  1R3K C;  3OUS A;  4H33 A;  1G4Y B;  2ZXW C;  3KG2 A;  4WFH A;  4MTF A;  2BOB C;  4LP8 A;  2ITD C;  1OCO C;  2DWE C;  1J95 A;  2HJF C;  4R7C A;  2X6B A;  3F7V C;  3JYC A;  3AG1 C;  4P2Z A;  2OCC C;  3F5W C;  2HFE C;  2A79 B;  2DYS C;  3BEH A;  4MVU A;  5EBW C;  3WG7 C;  3LDC A;  4RAI A;  3FB5 C;  3T1C A;  3GB7 C;  3FB8 C;  3IGA C;  2EIN C;  4H37 A;  3ZRS A;  4PA9 A;  2X6A A;  5EBL C;  3OR6 C;  3R65 A;  4GX2 A;  4PA6 A;  3RVZ A;  5CBG A;  1M56 C;  4J9Y B;  2JK5 C;  5EC2 C;  3SJQ C;  3K03 A;  1R3I C;  3SPG A;  3SYC A;  4RUF A;  3LDE A;  4MTO A;  4R50 A;  4MVZ A;  3LUT B;  3LDD A;  2WLK A;  4LBE C;  4MS2 A;  4J9Z B;  2WLM A;  1QLE C;  2EIM C;  4WFF A;  3RVY A;  1V54 C;  4UUJ C;  2WLL B;  4R6Z A;  4RO2 A;  3SPJ A;  3T2M A;  3ABM C;  2IH3 C;  1BL8 A;  1K4D C;  4PA4 A;  5E1A C;  5KUM A;  3UM7 A;  1KKD A;  4MTG A;  2BOC C;  4MVO A;  4KFM A;  2AHZ A;  2EIL C;  3IFX A;  4GX0 A;  3RBZ A;  3E8F A;  5J9P C;  2K1E A;  1XL6 A;  4MW8 A;  2Q68 A;  4HYO A;  5EBM C;  2EIJ C; 
#chains in the Genus database with same CATH topology
 4FLX A;  2P06 A;  1Z5W A;  3RYC A;  4X65 B;  1M57 B;  2GUZ A;  2N04 A;  1L1F A;  2WLL A;  2ADP A;  4RQE A;  5CMU A;  1K8A W;  4FK5 C;  3FAV B;  2CGO A;  3F5T A;  1K34 A;  3A0H Z;  4O2A B;  1HNZ O;  3L74 H;  1JVM A;  4DV5 O;  3QO7 A;  4QGP A;  1H2N A;  4DUZ B;  2UU9 O;  3CRR A;  4D7S A;  1XNR B;  2Q0O C;  3JAL A;  1LNQ A;  3HB3 B;  1M57 C;  4MVS A;  4P30 A;  3K5O A;  3CP1 A;  5DEC A;  4RQF A;  4LF7 B;  4AHC A;  3JAR A;  5EC1 C;  2YI9 A;  1M56 B;  2RQ6 A;  2UXC O;  2QWR B;  4NR1 A;  1LUW A;  4TQF A;  1MAB G;  1QR9 A;  1Q82 W;  1TAE A;  3OUF A;  2XAG A;  1HR0 O;  2YID A;  5EYP A;  2XAH A;  2HP8 A;  2Q8V A;  3AK3 A;  3F7Y C;  3OTO B;  2LP7 A;  2XTA A;  5CBH A;  4X65 O;  4LF9 B;  2QKS A;  3TGU H;  1JOY A;  3LNN A;  3ML0 A;  4YJ2 A;  4DYL A;  1XUQ A;  2AZ2 A;  1XDC A;  1PV0 A;  2LGQ A;  2N74 A;  1VQP V;  4TV9 B;  5KAI Z;  4RAI A;  1OCR B;  1WP7 A;  3CCE V;  4H37 A;  4YHH B;  3JD2 A;  4CS4 A;  2JGD A;  3RYH A;  1V9P A;  3K03 A;  4RUF A;  4R50 A;  4X66 B;  4MS2 A;  1MOF A;  1HNW O;  3S3W A;  3VQW A;  5BMV A;  2Q0A A;  4DR4 B;  1GKF A;  3RVY A;  1ZAU A;  4OX9 O;  2UXB B;  1XMQ B;  5CA3 A;  4X1K B;  2OIE A;  4DR3 O;  4FFB B;  4HZ3 A;  2QTO A;  1RFY A;  3N27 A;  2JVD A;  3O65 A;  4P9P A;  4CBC A;  2DOS A;  4JYB A;  1A32 A;  1GH6 A;  4JYY A;  1Q6I A;  3K59 A;  4LFB O;  2LW7 A;  5EZY A;  3ETE A;  3WB1 A;  1K9M W;  2XAF A;  1BT8 A;  4DR2 O;  4UCS A;  4PEL A;  3OAA G;  2ADQ B;  3ABK B;  4HAM A;  4DRX A;  2WLH A;  3P3P A;  5LHH A;  4DV2 O;  1MSD A;  4DV0 O;  2H3O A;  1KC8 W;  1N33 B;  2XHB A;  4JZG A;  3VOU A;  1WN7 A;  3LSS A;  4MVQ A;  2EIK C;  3CC4 V;  5JWP A;  2ODM A;  1GN2 A;  2JS3 A;  4LCU C;  3CC2 V;  1N0N A;  1V55 C;  4H44 B;  1KUQ A;  4LP8 A;  4WCE V;  3K9S A;  1URF A;  3AG1 C;  2A79 B;  3ZX6 A;  3FB5 C;  5C8Y A;  2EIJ B;  5EBL C;  1COW G;  1QCE A;  5CA0 A;  1R6K A;  2ZIO A;  1NR7 A;  4I0X A;  5GON B;  1NZ6 A;  4BIZ A;  1J5E B;  1OV9 A;  2EIM C;  1FYJ A;  1H2M A;  2P4K A;  2F95 B;  1PNM A;  5E79 Z;  2RDC A;  5EYP B;  4UCT A;  1JA8 A;  4DR3 B;  2F4V O;  4X1K A;  4GZR B;  3UO2 A;  4YY3 B;  4FZ1 A;  4F4L A;  3G6E V;  1AJQ A;  2Q6A A;  1VP7 A;  3ZCC A;  1TVK B;  1ZTE A;  1KBH A;  4QNH B;  4FZ0 A;  3JAR B;  1VF7 A;  1X59 A;  4TQD A;  3DC5 A;  4IHJ B;  4UCO A;  1KB9 F;  5KHJ A;  2JGD B;  2F93 B;  3GWK C;  4IYH A;  4NXN B;  2FTK A;  1VF5 B;  1QR8 A;  3ABT A;  2LQT A;  3AK1 A;  1IBM O;  2A0L A;  1NI8 A;  2Y69 C;  3BVO A;  3ZHU A;  2KG7 A;  4PA7 A;  4BW5 A;  2OT5 A;  2HHH O;  3OFN G;  3BAA A;  2FB5 A;  2UUB B;  3DSQ A;  5B1B B;  5JH7 A;  3AG3 C;  4MTX A;  3G71 V;  4EKW A;  1ORQ C;  1JQ0 A;  4CH4 A;  4PDM A;  4EB6 B;  3Q4H A;  1Y74 A;  3H01 A;  5DN6 G;  4DUZ O;  2LJ2 A;  3JSN A;  5LBQ A;  4WFH A;  2ITD C;  4JI5 O;  1KQS U;  4O2B B;  3WG7 C;  4X1Y B;  3T1C A;  1GM9 A;  1GK9 A;  5IYD O;  4FJC C;  1VQ9 V;  5DED A;  5EC2 C;  3VQV A;  4DW1 A;  4DR6 O;  2IJI A;  4MTO A;  4FLZ A;  4LFA B;  1DTO A;  3FAV A;  3L73 H;  5C93 A;  1FXK C;  3T1Y O;  2WLL B;  2BCC H;  3E22 A;  2ZNJ A;  3K5M A;  1JPX A;  2P22 C;  4RWU A;  2KKW A;  2X0L A;  1UPG A;  2AHZ A;  3IFX A;  1H2G A;  4X20 A;  3L70 H;  3B40 A;  3SR2 C;  1WB8 A;  4P9O A;  5JJN B;  1AP5 A;  2FL4 A;  3CE2 A;  2HVK C;  3RFR A;  5KHK A;  4JI7 O;  5FPO A;  3CMA V;  4DR7 B;  1GN3 A;  4FFK A;  4B3M O;  2ZE7 A;  3E8B A;  4ZOL A;  1I7F A;  3QVN A;  2WLI A;  5LYJ B;  2ZE8 A;  2B1I A;  3FKS G;  1N32 B;  1JFF A;  1V55 B;  1U97 A;  2Q7E A;  5EIB C;  4FPP A;  3JAS A;  1XBL A;  3JD0 A;  4PDR A;  4Q6G A;  1OCZ C;  3B2E E;  2EUL A;  2ZM6 B;  5JCO C;  1JX9 A;  2A7W A;  4WBN B;  4K0K B;  1WPB A;  5BXZ A;  1TUB B;  5LXT A;  1PNL A;  3LNM B;  4KUM A;  5KHH A;  2FYU H;  2EX3 A;  5D5Q A;  2HLD G;  3ZRW A;  4JV5 O;  2ZT9 B;  3EVK A;  4JI8 O;  1D5A A;  2QA4 V;  2BOB C;  1NVP D;  1W2B U;  4LF8 B;  2CH7 A;  2EIL B;  5EBW C;  4EEQ A;  4LF4 O;  1HW7 A;  3OM3 B;  2AGA A;  5JVD A;  1WJZ A;  3R65 A;  3CRC A;  4PI2 A;  2YSU B;  1N33 O;  1AI6 A;  4JI2 B;  1SQF A;  5KX5 A;  1N8R W;  5LXT B;  1NTK H;  2JS5 A;  2PZS A;  4DR2 B;  1O9G A;  2PTM A;  4X62 B;  1OCC B;  1FKA O;  1JJO A;  3RBZ A;  3TXQ A;  3CWB H;  3C3T A;  4LC1 A;  4QE7 A;  1TUE B;  2Y69 B;  3PN1 A;  3ZS8 C;  1R3L C;  2E76 B;  1LUV A;  2GDS A;  3P32 A;  1PPJ H;  3E35 A;  1IZ3 A;  5BR8 O;  4X66 O;  4JTC B;  1THZ A;  3AG4 C;  5LL6 Y;  3TJT A;  1BHA A;  1YZB A;  2CH7 B;  5ITZ A;  4JPR A;  5BZB A;  1WNS A;  2NNU A;  4JI0 B;  1H8E G;  3ZHT A;  1IBK B;  2IU3 A;  2Y4T A;  3FX7 A;  1B06 A;  3N2K A;  1U96 A;  5IYC O;  1N36 B;  1S0V A;  5DM6 V;  2E74 B;  3OEH G;  2DJV A;  1PL4 A;  3OGI B;  3TCU A;  5IWA O;  1I08 A;  1S5L Z;  4YY3 O;  4OXS A;  5CA1 B;  1BMF G;  3CCS V;  1K92 A;  5B1A C;  2F4V B;  3ZMU A;  3P3N A;  5LP6 C;  2WWW A;  1NR1 A;  4X8A A;  5J2U A;  4UVC A;  5FNV A;  1MZE A;  1QNM A;  5B3S B;  2D2C B;  3UO3 A;  1N36 O;  3AK2 A;  4FLW A;  1QBZ A;  3BPZ A;  2X6B A;  2XND G;  1IDS A;  4MT8 A;  2NR5 A;  3VQX A;  2CDY A;  4O4J A;  3L75 H;  1ARO P;  4J7Z A;  1XHX A;  1HNX O;  3OR6 C;  5KHG A;  1M56 C;  2ZNI A;  1HR0 B;  2ILM A;  4A5U B;  2NN4 A;  3OMN B;  4U3F H;  1XEQ A;  1OCO B;  5JJE B;  4KP4 A;  1V54 C;  3J7A U;  1WLE A;  1GM7 A;  2E3C A;  4LNU A;  2GV9 A;  1XL6 A;  4MW8 A;  2Q68 A;  1G8M A;  3HKE B;  4N23 A;  1SZT A;  4DV0 B;  4I50 B;  5EK0 A;  2F66 C;  1AI4 A;  3B8N A;  4DUY O;  2RN9 A;  4K8X A;  2XOK G;  2UUC O;  3ZMT A;  4TT3 G;  1FXK A;  1DLB A;  2IJJ A;  3CCM V;  2YIA A;  4B7E A;  5BMV B;  5B5E Z;  2PI5 A;  4DR5 O;  3L72 H;  1I5Y A;  3OMI B;  3A2F A;  5KX5 B;  1BQZ A;  4GKK O;  1K7D A;  4CC5 A;  3I5D A;  4LF8 O;  4DUY B;  4KXR A;  1AR4 A;  3AG2 C;  5KUK A;  1VQM V;  2LW1 A;  2HKO A;  2YXH A;  3OGC C;  2G38 A;  3WB2 A;  2Y4U A;  2P5O A;  2PI4 A;  5LA6 A;  1KP3 A;  1F23 A;  2MW2 B;  3AG2 B;  1Q6U A;  4ZKI A;  1Q43 A;  1RM1 C;  4O4I B;  3T4D A;  3RW0 A;  3ABL B;  2PYL A;  1SQB H;  2ZXW C;  4ASU G;  3D3Q A;  1E79 G;  4ZHQ A;  4CS3 A;  1OCO C;  2HJF C;  1J95 A;  4NTW A;  3F7V C;  1OCZ B;  3DTU B;  2FML A;  3ZHV A;  3H1K H;  3MAQ A;  2AW9 A;  2A3Q A;  4TUY B;  3SJB C;  3GB7 C;  2ZE5 A;  3QNE A;  2OTL V;  2QTS A;  2X6A A;  3HKB B;  2IJK A;  3MD0 A;  4MVZ A;  4XBF A;  4X9Q A;  3K57 A;  2Q73 A;  2R9I A;  3K9A A;  5LYJ A;  4QPK A;  2IH3 C;  1ZL8 B;  5IJ9 B;  4MTG A;  1FXV A;  1YCI A;  1GN4 A;  1N34 O;  5GON A;  3RYC B;  4MVM A;  2EJ7 A;  3TET A;  3ZN1 A;  3DC6 A;  3P30 A;  4NYK A;  1HNX B;  4DR6 B;  2YIB A;  3SGI A;  4E4E A;  4JI4 O;  1Y4M A;  3EFF K;  3WU2 Z;  4Z2W A;  5A2Q N;  3B4S A;  2QDO A;  4YIP A;  1R6T A;  4JYC A;  1H38 A;  2CTR A;  2YI8 A;  4FIP C;  4EFE A;  4GCZ A;  4UCR A;  1UJW B;  4DXW A;  2VQE B;  3HKD B;  1BGY H;  4MW3 A;  3H1L H;  5FNV B;  4X88 A;  4DV5 B;  1HDJ A;  1AVM A;  2BTO A;  3HPL C;  5CB4 A;  4TSF G;  5LGT A;  4OPA A;  5K1P A;  1QLN A;  2X7R B;  2M7W A;  5IWA B;  1N34 B;  1L8D A;  2YC0 A;  1TGO A;  2UXB O;  2RNB A;  4TUY A;  2Q5Z A;  3DGE A;  4B3T B;  1D2D A;  4XDK A;  3E86 A;  1OCC C;  2YEV A;  1R3K C;  4NXN O;  2YXL A;  1EFR G;  1DGS A;  3C3S A;  2QWQ B;  4TV9 A;  4PD4 F;  3F5W C;  2HEP A;  2RCV A;  4K3A A;  4CZZ A;  1K73 W;  2OIG A;  5LA6 B;  4F6E A;  3K3W A;  4BWA A;  3SYC A;  2GBO A;  1SQQ H;  3LDE A;  3C90 A;  5KAF Z;  2WLK A;  4J9Z B;  4FFB A;  5LHG A;  4WF9 V;  3QO8 A;  3VBB A;  4LF9 O;  2CE4 A;  3OT7 A;  2JEX A;  1PD3 A;  3ABM C;  1K4D C;  1K5Q A;  4GX0 A;  2ZE6 A;  4IHJ A;  1VMG A;  1MMM A;  3W7S A;  4ZBM A;  1OCR C;  2BTQ A;  4YXW G;  2EZO A;  1CEZ A;  2D3O W;  3OTF A;  2Z3Y A;  4BIU A;  4DR1 O;  1CXZ B;  2IJH A;  4JTA B;  4JTD B;  2Q7G A;  3JAL B;  1BQ0 A;  2ARH A;  4J10 A;  1ENV A;  3G80 A;  4AI8 A;  2CTQ A;  4J42 A;  1T5E A;  3H1H H;  3JAK B;  3ZED A;  3ASO C;  4DV3 O;  1GAX A;  4UVB A;  4LF4 B;  1TA8 A;  4X89 A;  5AG2 A;  3AG1 B;  4GKJ B;  1QVF U;  2LGW A;  1S5H C;  4I7Z B;  1VIB A;  4JYA B;  4C7U A;  3LSQ A;  3ZRW B;  1LR1 A;  3SYP A;  4G28 B;  4PV1 B;  3HKC A;  4LR3 A;  4DV7 O;  2CK3 G;  3ZMS A;  2PYJ A;  5FLX N;  1HNW B;  1ZL8 A;  1NKD A;  2ZDI C;  2UXX A;  2AXT Z;  1SQG A;  2E5L O;  1K5S A;  1JCH A;  3WB0 A;  1F4N A;  3BEH A;  4MVU A;  1KD1 W;  2E75 B;  3ETQ A;  3L9D A;  3FB8 C;  1H2L A;  3ABU A;  1Z2G A;  5KMG B;  2DN9 A;  1FFX B;  5CBG A;  5LHI A;  1AI7 A;  1RPR A;  4J80 A;  3G6B A;  4B08 A;  2GUZ B;  1K97 A;  5LP6 A;  4LBE C;  3HKC B;  3HR0 A;  2UUB O;  3JAW A;  1KU9 A;  4WFF A;  2L35 A;  1Y76 B;  4ZI7 B;  4O4H A;  5KUM A;  4WFA V;  5J9P C;  1SRY A;  4O4I A;  3AG3 B;  4EFB A;  5ITZ B;  3W7W A;  2N05 A;  4FLV A;  1SES A;  4BW9 A;  3APQ A;  1VQO V;  4D7T A;  2NLJ C;  3K08 A;  1FD9 A;  2Z0A A;  1Z5V A;  5H6Q A;  4JI6 B;  2OTJ V;  1IBL B;  4W4K A;  3CYO A;  2JDI G;  2ATK C;  1SQV H;  1XQ8 A;  3UCS C;  1WAZ A;  3JAT A;  1S5J A;  4IL6 Z;  4YJ3 A;  2A06 H;  4E2L A;  4B3T O;  1VAR A;  1Q5O A;  1I94 B;  1FXH A;  2YDE A;  3D8C A;  1AB3 A;  3ETG A;  4CS2 A;  5L3F A;  3E83 A;  3JD4 A;  1XIL A;  1Y74 B;  3ICX A;  2L6L A;  4NTX A;  3RYF A;  2UU9 B;  3SPI A;  4X64 O;  2QGN A;  1PP9 H;  3S3X A;  1CPY A;  2VQE O;  2B5U A;  4W4L A;  4LF7 O;  2KQX A;  5L3G A;  3G4S V;  4G27 B;  2LFR A;  4CC6 A;  3KZI Z;  2XUM A;  1IBM B;  2ZKO A;  3OUS A;  3D36 A;  3KG2 A;  4I4T A;  1YTF B;  5JCO A;  4JI3 O;  3W7T A;  2DYS C;  1XNR O;  2VWK A;  2ZQM A;  1V54 B;  1FPO A;  5D5P A;  1DK1 A;  1PNK A;  5LMN B;  1YXB A;  3SJC C;  2JK5 C;  1YDX A;  4I9Q A;  2BTQ B;  1H8H G;  2WLM A;  4UB8 Z;  5BY1 A;  4LH7 A;  3U11 A;  5HFL A;  4K35 A;  1HP8 A;  3QG5 A;  3T2M A;  3JAT B;  4PA4 A;  5KA5 A;  4MVO A;  5FL7 G;  3QTC A;  1N0J A;  3R66 A;  4K0K O;  4DV3 B;  4WFE A;  4QJF B;  3SJA C;  1D5N A;  5B3S C;  5CA1 A;  4IGG A;  4O4L B;  1F4M A;  4IYI A;  3OEE G;  4LNU B;  4I5S A;  1EN4 A;  4KHP O;  2IH1 C;  3FD9 A;  4JYA O;  2KB1 A;  2CGN A;  2QWN B;  3CRQ A;  2VS0 A;  1Q90 D;  4O4H B;  2GTA A;  3ZHR A;  5B1N A;  4J41 A;  3BHP A;  3ZJZ A;  2ZR3 A;  2XT9 A;  4GX1 A;  4X20 B;  3X2Q B;  3JAW B;  5BR8 B;  1UFI A;  2YEV B;  3I56 V;  4TV8 B;  2DMX A;  2JIZ G;  1PL0 A;  1FFX A;  2PF4 E;  1BSM A;  5IJ9 A;  3BA9 A;  5KMG A;  5CB4 B;  3RWR D;  3ZRV A;  4JV5 B;  3O9O A;  3CRM A;  1WB7 A;  4B3M B;  1B3Q A;  1I0H A;  5J2U B;  3QO5 A;  5IT9 N;  3HKD A;  1YJN V;  2WAM A;  3JCZ A;  3IAY A;  1SKV A;  3IC9 A;  4B7K A;  4HNA A;  2IW5 A;  3ABM B;  2R72 A;  1X4T A;  1XMO B;  4DRX B;  4KHP B;  5CN0 A;  3RYH B;  4FVM A;  2E5L B;  4P2Z A;  2W6I G;  4DO2 A;  2ZIN A;  2YIC A;  3N2K B;  3KKY A;  2EIN C;  3MHH C;  1QLE B;  5A9G A;  1L0N H;  2GTS A;  5JVD B;  4I4T B;  1NH2 D;  2UUC B;  1OJH A;  1QLE C;  1MNG A;  4PJ0 Z;  4GKJ O;  3CSX A;  4QPJ A;  4R6Z A;  1G1X B;  4U3J B;  1GN6 A;  4KL1 A;  2EIL C;  1AJP A;  2QEX V;  3VQY A;  1DF5 A;  1BS3 A;  3CCU V;  2RJZ A;  1YSC A;  2BE3 A;  3SYO A;  3I55 V;  2QM8 A;  4UV9 A;  1BZK A;  3H9V A;  3HKB A;  5CBF A;  5IYZ B;  2QWO B;  4JI1 B;  4NVP A;  2AHY A;  2EZP A;  4OX9 B;  3DXR A;  1PM9 A;  2W6J G;  2ZR2 A;  4IT5 A;  2V1D A;  4N21 A;  2LO1 A;  1BCC H;  4J7K A;  4X1I B;  4O2A A;  2YIB D;  2ITC C;  4Q20 A;  4NTY A;  3K06 A;  4B3R O;  3GWO A;  1SZX A;  2FKX A;  2DE0 X;  2MK3 A;  4I0X B;  3CCR V;  1O9H A;  2P4V A;  1SER A;  1PKX A;  4TWK A;  1IX9 A;  4B3S B;  2XAQ A;  4IIJ B;  3CCQ V;  1E1R G;  3JD3 A;  3FB6 C;  1SF9 A;  4LH6 A;  1AIL A;  5B1A B;  3A8T A;  2P90 A;  1KEC A;  2JRI A;  1VF6 C;  1G4Y B;  5LP6 B;  4MTF A;  3ZHS A;  1VQ4 V;  1NQT A;  1IBL O;  2DWE C;  1AJN A;  3OW2 U;  4WBN A;  1Q86 W;  3JYC A;  4JI1 O;  2ZXW B;  4JAU A;  4Z1V A;  1FXK B;  1VQ5 V;  3RVZ A;  1Q81 W;  1Q8I A;  4CH6 A;  1JR9 A;  2ZCE A;  1R6N A;  2UXD O;  3TK1 A;  3AG4 B;  3BRC A;  1SET A;  3HKE A;  5HFM A;  4DV4 B;  1OZ0 A;  3CC7 V;  2EIK B;  4UUJ C;  3SPJ A;  3EHB B;  5E1A C;  3W7U A;  1RM1 B;  1SS3 A;  3SYA A;  1SQP H;  2V4D A;  2QWP B;  2QE7 G;  1VF6 A;  2IU0 A;  4CH3 A;  2PY5 A;  3JCU Z;  1OHH G;  3A0R A;  1NU1 H;  4DV2 B;  2HVJ C;  4JI8 B;  3ASN C;  3ABK C;  5FPR A;  3FYI B;  1GMG A;  3OMA B;  4DV1 O;  4U7O A;  1MSW D;  5GTH Z;  2QM4 A;  2EIN B;  3NR7 A;  1E1Q G;  1K4C C;  4O4J B;  1FJG B;  3BA8 A;  2HJD A;  4MSW C;  4PA3 A;  3JSL A;  4NB5 A;  1NS1 A;  1NT2 B;  1P4R A;  4XDL A;  1ZWI C;  4RUE A;  1YJW V;  1L0L H;  4DK0 A;  2H8P C;  1ZLZ A;  4FM1 A;  4WFG A;  2Y48 A;  5K1X A;  2PGG A;  3K79 A;  4O2B A;  4UB6 Z;  4LWS B;  5LOV B;  3CHX A;  3CXH F;  3NXS A;  1ZSP A;  1RP3 B;  1MA1 A;  2WA4 A;  2IBZ H;  4R8C A;  3EXA A;  1YEW A;  1N32 O;  3ETD A;  4AQY B;  3D3I A;  3CME V;  1S72 V;  3T1H O;  3CS5 A;  2UUA B;  2OCC C;  3M7M X;  2AZ0 A;  1Q7Y W;  3CEI A;  1WP8 A;  3IJ4 A;  3LSU A;  1AI5 A;  2HR3 A;  4WFB V;  4X1I A;  4K8Z A;  2DQ3 A;  5C8Y B;  4PA6 A;  3THO A;  1US6 A;  2WA3 A;  3N2G A;  1I5X A;  4UV8 A;  5F2V O;  3OTO O;  4BR6 A;  2Y0I A;  3ZBH A;  1W59 A;  2P6J A;  4KFM A;  5L3B A;  3MHS C;  1TVK A;  4LF6 O;  1Y66 A;  4DK1 A;  3BFR A;  2JEU A;  2W0F C;  5B1O A;  2WLI B;  4AIL C;  4DV6 B;  3B09 A;  2P67 A;  5KLV H;  5IY5 C;  2IM9 A;  2ETN A;  3RYI A;  1M93 A;  1QU7 A;  2BSK B;  3ABL C;  4GLX A;  2DYS B;  4LF5 B;  5IE9 A;  4J7J A;  2DYR C;  3FB7 C;  4J11 A;  4GYC B;  3W7X A;  3J81 N;  1Y76 A;  2Q67 A;  2R9R B;  4ABM A;  3ZIA G;  4DW0 A;  1YJ9 V;  3RGB A;  3UQ8 A;  4Z1M G;  1BE3 H;  4LWS A;  2HHH B;  5LGU A;  4QE9 A;  2GHY A;  2CTP A;  3SYQ A;  1EM1 A;  3E2E A;  2X6C A;  2R70 A;  1SQX H;  1QHT A;  3E8H A;  4NXM B;  1GO3 F;  1IVS A;  1IXM A;  3MDS A;  3K5L A;  4DV4 O;  3WFV A;  3QF7 A;  2Q9L A;  1YIJ V;  3CPW U;  2CUG A;  5H2F Z;  3J80 N;  3LDC A;  3K5N A;  5LMU B;  5JQG B;  1WA8 B;  1VQL V;  4HBN A;  1KMI Z;  2ZM6 O;  1J5E O;  2DYR B;  4EB6 A;  4GX2 A;  2JJ1 G;  3SPG A;  1R3I C;  1VQ8 V;  1XNQ B;  5JH7 B;  1GM8 A;  1K3E A;  4JF3 A;  1XOU A;  2VQF B;  4ICG A;  1XMO O;  1DF4 A;  5IJ0 A;  5IY5 B;  2YS8 A;  1F7Y A;  2JJ2 G;  4ZIB A;  1VQK V;  3AEI A;  4JGS A;  3CCJ V;  2BSK A;  3RN4 A;  4O4L A;  1N4C A;  3RYI B;  3M99 B;  3ZN0 A;  4B3S O;  2EBO A;  3CCV V;  4FLY A;  4DR1 B;  1B6Q A;  2OYQ A;  4I55 B;  3T4Z A;  2UXC B;  3X2Q C;  5H5N A;  3ZMV A;  3DXR B;  1M90 W;  4DR7 O;  2JGU A;  3B8M A;  5JJJ B;  2W0X A;  5IYZ A;  1KYO F;  2DW4 A;  2O57 A;  5LMU O;  5EIB D;  3L71 H;  2CAZ C;  3T1H B;  4GX5 A;  1EN5 A;  2QKA A;  2QJ1 A;  5IYB O;  4X62 O;  4UVA A;  4ZHQ B;  3BCC H;  3A0B Z;  1NTZ H;  4I9W A;  3PJS K;  3JAM N;  1MG1 A;  1NH2 B;  4LFC B;  2WLN A;  1MZF A;  1SA0 A;  4IIJ A;  1G6U A;  1VEW A;  3CXC U;  4YJ2 B;  2K9P A;  3CX5 F;  2KG7 B;  2QSA A;  2PUS A;  3CRA A;  3UKM A;  3T1Y B;  2R9A A;  2F23 A;  4JI5 B;  4DV1 B;  2VRZ A;  3K0D A;  4JAA A;  1NTM H;  4F6R B;  1EZV H;  5LMN O;  4GKK B;  1FFT B;  1SA0 B;  3WG7 B;  2XAS A;  4B3R B;  1NBM G;  3RYF B;  1AR1 B;  3APO A;  2RMK B;  1HWY A;  4FMT A;  4GT1 A;  3ZHQ A;  2C2A A;  1XMQ O;  3KCX A;  2B1G A;  2GSM B;  5LOV A;  1YIT V;  1FJG O;  4DV7 B;  4JI3 B;  4H0L B;  4HNA B;  2XAJ A;  1NVP B;  2WPD G;  4J9Y B;  1Y6X A;  4H13 B;  4LFB B;  3LUT B;  1M5I A;  3ASO B;  4G2K A;  4YHH O;  4I55 A;  4UXN A;  1ZUQ A;  2F43 G;  4UCV A;  1IUR A;  3ZMZ A;  1BL8 A;  1JMK C;  3UM7 A;  5LGN A;  4JI4 B;  4X64 B;  3ASN B;  3E8F A;  3U10 A;  1QQC A;  5GTI Z;  4TV8 A;  5B1B C;  1M9N A;  1EZJ A;  2WLJ A;  1EN6 A;  1YI2 V;  2Q7H A;  4PI0 A;  4QIW F;  3H1J H;  1BHB A;  2DWD C;  4L87 A;  4PDV A;  4ZI7 A;  2VQF O;  1R3J C;  1RSO A;  2UXD B;  2YUA A;  1XNQ O;  1I94 O;  1XI1 A;  1ZX3 A;  4L8J A;  3E22 B;  5JQG A;  2F1M A;  2VWJ A;  3UT5 B;  3FFQ A;  2H94 A;  4OPH A;  1XRE A;  3AG7 A;  3SPC A;  1XL4 A;  3STL C;  1SC5 B;  4FLT A;  2P7T C;  3K04 A;  2ZD9 A;  5H9C A;  4JI0 O;  4PHZ A;  5KA6 A;  2DQ0 A;  3E89 A;  4FLU A;  4PDL A;  2CTW A;  3E8G A;  4OGQ B;  3RT3 C;  1AP6 A;  3M8A A;  1CP9 A;  2WSS G;  1W0J G;  1R1B A;  1Q3E A;  2UUA O;  3CB2 A;  4JZ2 A;  1Q6H A;  3SPH A;  1F51 A;  1YHQ V;  3B77 A;  3N2G B;  3FYE B;  4H33 A;  4BIO A;  1QVG U;  2B9Z A;  1R73 A;  1P49 A;  2EIM B;  3G67 A;  1AR5 A;  1Y67 A;  2HFE C;  5GW7 A;  2QM7 A;  4YIO A;  4F6R A;  1GRJ A;  5KHI A;  3IGA C;  4JI2 O;  3CJH B;  3ZRS A;  4PA9 A;  2Z5U A;  3CD6 V;  1WPX A;  1P7G A;  3JD1 A;  4LF5 O;  3JAK A;  3SDL A;  2OCC B;  1HNZ B;  2OWO A;  3KCY A;  1YF2 A;  2M6Y A;  1RPO A;  3OD4 A;  4AQY O;  1GTO A;  1KKD A;  2BOC C;  1H2S B;  2ZDI A;  2K1E A;  2QKC A;  2ZIM A;  2HG5 C;  1KKC A;  3CCL V;  5H6R A;  5TIS Z;  4XDJ A;  1NJI W;  1JJ2 U;  4LFC O;  2YXY A;  2V7Q G;  1KP2 A;  1JFF B;  4JI6 O;  3GVM A;  3H1I H;  4MVR A;  4FM0 A;  4UFZ A;  5L3E A;  4ZOL B;  3STZ C;  4I50 A;  1VQ6 V;  4U3J A;  4DR4 O;  3UT5 A;  4LF6 B;  3K0G A;  2Y0P A;  1W0K G;  2QR4 A;  3CJH A;  4JAV A;  5L3D A;  5L3C A;  1RSO B;  4DV6 O;  5CA0 B;  5IJ0 B;  4NKG B;  5B66 Z;  1S77 D;  3OR7 C;  3TXS A;  5IDJ A;  1VQN V;  3D36 C;  1VQ7 V;  4JI7 B;  1FS0 G;  2Q4P A;  4CH5 A;  2OCH A;  2A9H A;  1WA8 A;  1M4U A;  1TUB A;  1S76 D;  1P7B A;  4BAY A;  3K58 A;  2Q69 A;  4JAS A;  4U7N A;  4YJ3 B;  3ZRX A;  1K33 A;  4R7C A;  1B04 A;  3JAS B;  1IBK O;  1M1K W;  1ROP A;  3U0Z A;  4X1Y A;  1H2K A;  2LFS A;  3OE7 G;  1FAF A;  4DR5 B;  2UXN A;  3SJQ C;  1P84 F;  1YVW A;  1XHZ A;  1YTF D;  3LDD A;  3IC7 A;  3Q4H B;  1EBO A;  4GUN A;  4NXM O;  4RO2 A;  4D6T H;  5J2T A;  1IXB A;  2KSD A;  2EJR A;  4TOI A;  5J2T B;  3BY6 A;  3BAB A;  5EZY B;  4LFA O;  4UCU A;  4FM2 A;  4HYO A;  1S3J A;  5EBM C;  2EIJ C; 
#chains in the Genus database with same CATH homology
 4LC1 A;  1Y66 A;  4QE7 A;  1TUE B;  3W7W A;  2JEU A;  2Y69 B;  1M57 B;  1SES A;  1L1F A;  1R3L C;  2WLL A;  4RQE A;  1K8A W;  2W0F C;  5CMU A;  5B1O A;  4FK5 C;  1VQO V;  2NLJ C;  2WLI B;  3K08 A;  1K34 A;  2P67 A;  5H6Q A;  2OTJ V;  5IY5 C;  3P32 A;  3CYO A;  3E35 A;  2JDI G;  1JVM A;  3QO7 A;  2ATK C;  4JTC B;  1THZ A;  3AG4 C;  3ABL C;  1BHA A;  2DYS B;  1LNQ A;  3HB3 B;  1M57 C;  4MVS A;  4JPR A;  5BZB A;  2DYR C;  4P30 A;  2NNU A;  3FB7 C;  3CP1 A;  4E2L A;  4RQF A;  1H8E G;  3W7X A;  5EC1 C;  2IU3 A;  1FXH A;  1M56 B;  3ETG A;  5IYC O;  2Q67 A;  5L3F A;  3E83 A;  3JD4 A;  2R9R B;  1S0V A;  5DM6 V;  3OEH G;  1MAB G;  3TCU A;  3ZIA G;  1QR9 A;  1YJ9 V;  1Q82 W;  3OUF A;  4OXS A;  4Z1M G;  3SPI A;  2XAG A;  5LGU A;  1CPY A;  1BMF G;  4QE9 A;  2GHY A;  3CCS V;  1K92 A;  2XAH A;  5B1A C;  3SYQ A;  3ZMU A;  3E2E A;  2X6C A;  2B5U A;  3F7Y C;  2LP7 A;  5CBH A;  5L3G A;  3G4S V;  4G27 B;  2LFR A;  3E8H A;  1GO3 F;  2WWW A;  1NR1 A;  4X8A A;  2QKS A;  4UVC A;  1IXM A;  1JOY A;  5B3S B;  3OUS A;  3D36 A;  3KG2 A;  3ML0 A;  3WFV A;  1YTF B;  1QBZ A;  2X6B A;  2XND G;  1YIJ V;  3W7T A;  4MT8 A;  2DYS C;  3CPW U;  1VQP V;  3LDC A;  4RAI A;  2ZQM A;  1VQL V;  1V54 B;  1ARO P;  1OCR B;  3CCE V;  4H37 A;  3JD2 A;  2DYR B;  1PNK A;  2JJ1 G;  3OR6 C;  4GX2 A;  1M56 C;  2JK5 C;  3SPG A;  3K03 A;  1R3I C;  1VQ8 V;  4RUF A;  4R50 A;  4MS2 A;  1MOF A;  1GM8 A;  1K3E A;  1H8H G;  4JF3 A;  2WLM A;  3OMN B;  1DF4 A;  1OCO B;  5IY5 B;  4KP4 A;  1GKF A;  1V54 C;  3RVY A;  5HFL A;  1WLE A;  1GM7 A;  3T2M A;  2JJ2 G;  4PA4 A;  5CA3 A;  5KA5 A;  4MVO A;  1VQK V;  3AEI A;  4JGS A;  5FL7 G;  3CCJ V;  1XL6 A;  3M99 B;  4MW8 A;  2Q68 A;  3ZN0 A;  1G8M A;  4HZ3 A;  2QTO A;  2EBO A;  4N23 A;  1SZT A;  4WFE A;  4QJF B;  3CCV V;  5EK0 A;  5B3S C;  3B8N A;  1AI4 A;  4P9P A;  1B6Q A;  4CBC A;  1F4M A;  4JYB A;  3OEE G;  2XOK G;  3T4Z A;  3X2Q C;  4I5S A;  3ZMT A;  4TT3 G;  2IH1 C;  1FXK A;  1DLB A;  2IJJ A;  3ZMV A;  3CCM V;  2KB1 A;  1M90 W;  2PI5 A;  3B8M A;  3ETE A;  2DW4 A;  5B1N A;  1I5Y A;  1K9M W;  2XAF A;  3ZJZ A;  2ZR3 A;  4GX1 A;  3X2Q B;  3OMI B;  4GX5 A;  4PEL A;  1K7D A;  2YEV B;  3OAA G;  3ABK B;  5IYB O;  3I56 V;  4HAM A;  4UVA A;  2WLH A;  2JIZ G;  4I9W A;  3AG2 C;  3PJS K;  5LHH A;  1PL0 A;  5KUK A;  1MG1 A;  1VQM V;  1NH2 B;  2WLN A;  2HKO A;  3OGC C;  3ZRV A;  1KC8 W;  3CXC U;  3VOU A;  2PI4 A;  3LSS A;  4MVQ A;  1KP3 A;  3UKM A;  2EIK C;  1F23 A;  3QO5 A;  3CC4 V;  3K0D A;  2WAM A;  3AG2 B;  3JCZ A;  1YJN V;  4ZKI A;  4LCU C;  1RM1 C;  3T4D A;  1FFT B;  3CC2 V;  3WG7 B;  3RW0 A;  3ABL B;  1V55 C;  2IW5 A;  2XAS A;  3ABM B;  2ZXW C;  1NBM G;  4ASU G;  4LP8 A;  1E79 G;  4WCE V;  1AR1 B;  1OCO C;  2HJF C;  1J95 A;  5CN0 A;  3F7V C;  1OCZ B;  3AG1 C;  4P2Z A;  1HWY A;  3DTU B;  2W6I G;  2A79 B;  4FMT A;  4GT1 A;  2C2A A;  4DO2 A;  3FB5 C;  2B1G A;  3GB7 C;  2GSM B;  1YIT V;  2EIN C;  3MHH C;  3QNE A;  1QLE B;  2EIJ B;  2OTL V;  2X6A A;  5EBL C;  1COW G;  1QCE A;  2IJK A;  1R6K A;  2XAJ A;  3MD0 A;  2WPD G;  4J9Y B;  1NVP B;  1NR7 A;  4MVZ A;  1NH2 D;  3LUT B;  4XBF A;  3ASO B;  4G2K A;  4BIZ A;  1QLE C;  2EIM C;  4UXN A;  2R9I A;  2F43 G;  4QPJ A;  3K9A A;  1PNM A;  4R6Z A;  3ZMZ A;  4QPK A;  2IH3 C;  1BL8 A;  3UM7 A;  5LGN A;  4MTG A;  3ASN B;  2EIL C;  1AJP A;  2QEX V;  1FXV A;  3E8F A;  1DF5 A;  3CCU V;  1YSC A;  3SYO A;  3I55 V;  4MVM A;  5B1B C;  1M9N A;  1EZJ A;  2WLJ A;  4F4L A;  3G6E V;  1AJQ A;  2QM8 A;  4UV9 A;  3TET A;  2Q6A A;  1YI2 V;  3ZCC A;  4QIW F;  1BHB A;  2DWD C;  3ZN1 A;  4QNH B;  5CBF A;  3P30 A;  4L87 A;  4PDV A;  1R3J C;  2AHY A;  2EZP A;  2W6J G;  2ZR2 A;  1Y4M A;  3EFF K;  2FTK A;  1QR8 A;  2V1D A;  4N21 A;  3ABT A;  2H94 A;  4JYC A;  1H38 A;  2ITC C;  4FIP C;  4Q20 A;  4GCZ A;  3K06 A;  2A0L A;  3SPC A;  1XL4 A;  3STL C;  1UJW B;  2Y69 C;  4DXW A;  2P7T C;  3GWO A;  3K04 A;  2ZD9 A;  5H9C A;  4MW3 A;  5KA6 A;  2MK3 A;  4X88 A;  3CCR V;  4PA7 A;  4BW5 A;  2DQ0 A;  1SER A;  3E89 A;  4PDL A;  2OT5 A;  1PKX A;  4TWK A;  3OFN G;  3E8G A;  2XAQ A;  3HPL C;  4TSF G;  5LGT A;  3CCQ V;  1CP9 A;  1E1R G;  2WSS G;  3JD3 A;  3FB6 C;  1W0J G;  5B1B B;  2X7R B;  1QLN A;  2M7W A;  3AG3 C;  5B1A B;  4MTX A;  3G71 V;  4EKW A;  1ORQ C;  1JQ0 A;  3SPH A;  3DGE A;  1F51 A;  4XDK A;  1YHQ V;  2P90 A;  3E86 A;  1OCC C;  1KEC A;  4PDM A;  2YEV A;  3B77 A;  3H01 A;  1R3K C;  3FYE B;  4H33 A;  1G4Y B;  5DN6 G;  5LBQ A;  4WFH A;  1EFR G;  4MTF A;  1QVG U;  2ITD C;  1VQ4 V;  1NQT A;  1R73 A;  2DWE C;  2EIM B;  1AJN A;  3OW2 U;  1Q86 W;  3JYC A;  1KQS U;  3F5W C;  2HFE C;  5GW7 A;  2ZXW B;  2QM7 A;  4JAU A;  3WG7 C;  3T1C A;  1GM9 A;  1GK9 A;  4CZZ A;  1FXK B;  3IGA C;  1K73 W;  5IYD O;  3ZRS A;  1VQ5 V;  4FJC C;  4PA9 A;  1VQ9 V;  2Z5U A;  3CD6 V;  1WPX A;  3K3W A;  3JD1 A;  3RVZ A;  1Q81 W;  5EC2 C;  3SYC A;  1R6N A;  2IJI A;  3LDE A;  4MTO A;  3TK1 A;  3AG4 B;  2WLK A;  1SET A;  4J9Z B;  2OCC B;  5HFM A;  5LHG A;  4WF9 V;  1DTO A;  1OZ0 A;  3QO8 A;  3CC7 V;  2EIK B;  3VBB A;  5C93 A;  1FXK C;  4UUJ C;  2WLL B;  3SPJ A;  3EHB B;  1RPO A;  2JEX A;  1PD3 A;  3ABM C;  1K4D C;  1GTO A;  1JPX A;  1K5Q A;  5E1A C;  1KKD A;  2X0L A;  2BOC C;  2AHZ A;  3IFX A;  4GX0 A;  3W7U A;  2ZDI A;  2K1E A;  1H2G A;  1RM1 B;  3SYA A;  3W7S A;  2QE7 G;  2IU0 A;  4ZBM A;  1OCR C;  1OHH G;  4YXW G;  4P9O A;  2EZO A;  3A0R A;  2D3O W;  1CEZ A;  2HG5 C;  2HVJ C;  2Z3Y A;  5H6R A;  4BIU A;  3ASN C;  3ABK C;  3CCL V;  4XDJ A;  3FYI B;  2HVK C;  1GMG A;  2IJH A;  4JTA B;  3OMA B;  1NJI W;  4U7O A;  1JJ2 U;  1MSW D;  4JTD B;  2V7Q G;  1KP2 A;  2EIN B;  3CMA V;  1E1Q G;  1K4C C;  4MVR A;  4MSW C;  4PA3 A;  3E8B A;  5L3E A;  3STZ C;  1ENV A;  1VQ6 V;  2WLI A;  1P4R A;  3K0G A;  4XDL A;  2B1I A;  1ZWI C;  3ASO C;  3FKS G;  1W0K G;  1V55 B;  4RUE A;  4UVB A;  1YJW V;  4FPP A;  2H8P C;  4JAV A;  4X89 A;  3JD0 A;  4WFG A;  2Y48 A;  5L3D A;  5L3C A;  4PDR A;  1OCZ C;  3AG1 B;  1QVF U;  1JX9 A;  3K79 A;  1S5H C;  1S77 D;  3OR7 C;  3LSQ A;  5IDJ A;  3ZRW B;  1VQN V;  1VQ7 V;  3NXS A;  1PNL A;  3LNM B;  3SYP A;  4G28 B;  1FS0 G;  4KUM A;  4R8C A;  2A9H A;  2HLD G;  3ZRW A;  1S76 D;  3ETD A;  1P7B A;  2CK3 G;  3ZMS A;  4BAY A;  2Q69 A;  4JAS A;  4U7N A;  3D3I A;  3CME V;  2QA4 V;  3ZRX A;  1NKD A;  2BOB C;  2ZDI C;  2UXX A;  1S72 V;  1NVP D;  1K33 A;  1K5S A;  1JCH A;  4R7C A;  1W2B U;  2OCC C;  1M1K W;  1ROP A;  2EIL B;  1F4N A;  3BEH A;  4MVU A;  5EBW C;  1KD1 W;  1Q7Y W;  1AI5 A;  3OM3 B;  3FB8 C;  2HR3 A;  2LFS A;  3ABU A;  4WFB V;  3OE7 G;  2DQ3 A;  3R65 A;  4PA6 A;  5CBG A;  5LHI A;  1AI7 A;  1RPR A;  2UXN A;  3SJQ C;  1YTF D;  1K97 A;  2YSU B;  3LDD A;  3IC7 A;  4LBE C;  1AI6 A;  1EBO A;  1I5X A;  4UV8 A;  1N8R W;  4WFF A;  4RO2 A;  5KUM A;  2EJR A;  2P6J A;  1OCC B;  3BY6 A;  4KFM A;  5L3B A;  3RBZ A;  4WFA V;  5J9P C;  1SRY A;  3MHS C;  4HYO A;  1S3J A;  3AG3 B;  5EBM C;  2EIJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...