2Q6AA

Crystal structure of nak channel d66e mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
b'MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGEGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
total genus 42
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q6aA00
5KUKA 3OGCC 2P7TC 2DYRC 2WLHA 4BW5A 4JTAB 3K0GA 4H37A 2KB1A 1JVMA 4RUEA 1OCZC 3VOUA 4PA9A 3SYQA 5IY5C 1ZWIC 2X6AA 2YEVA 2ITDC 4F4LA 1ORQC 3ASOC 2A9HA 2WLIA 4ZBMA 4MSWC 3STLC 4QE7A 2HG5C 3LUTB 4OXSA 1QLEC 4PDMA 4WFEA 3SYAA 2A0LA 3FB7C 3K03A 3KG2A 3E83A 4GX1A 4MS2A 4PA7A 4PA6A 2JK5C 1P7BA 2A79B 3AG3C 3UM7A 3OUSA 4G27B 5EK0A 3T4DA 3SYPA 3RVZA 2HVKC 4MVRA 5B1BC 4X8AA 3STZC 4RO2A 2EIKC 4CBCA 3OUFA 4PDRA 4LCUC 2ATKC 3SJQC 3IGAC 3FB6C 3EFFK 4RAIA 2X6CA 3LNMB 4XDLA 4P9PA 4QNHB 1G4YB 2EILC 2EIJC 2K1EA 3ASNC 3E86A 3E89A 3K0DA 2Q69A 4GX0A 2ITCC 4JTDB 4R8CA 4R7CA 3T4ZA 3BEHA 3TCUA 4X88A 3K06A 1J95A 4WFFA 3ABMC 2X6BA 4PA3A 3SPGA 1BL8A 2AHZA 4WFGA 2DWEC 3K04A 4GX2A 5EBMC 3JYCA 4GX5A 4PA4A 5CBHA 3E8FA 1M57C 3TETA 4P2ZA 3AG1C 1S5HC 2EINC 4WFHA 1M56C 2IH1C 3ABKC 3K08A 1OCCC 1K4CC 3FB5C 2AHYA 2ZXWC 4MTOA 4TWKA 2BOBC 4JTCB 2Q6AA 4MVMA 2HVJC 2BOCC 1XL6A 4MVOA 3SYOA 4G28B 3T1CA 3SYCA 4LBEC 3LDCA 1R3LC 3SPIA 4J9ZB 3GB7C 4MTFA 4MW8A 3ZJZA 3E8HA 3AG2C 4MVSA 2EIMC 2WLKA 3AG4C 3UKMA 1V54C 5E1AC 2H8PC 2HFEC 3F5WC 4MVZA 2DWDC 4MTGA 4QE9A 5J9PC 3LDEA 2QKSA 2R9RB 2WLJA 1R3KC 2OCCC 2Q68A 1LNQA 3RW0A 2ZD9A 4MVUA 2Q67A 2Y69C 4XDJA 5B1AC 2WLMA 4HYOA 5BZBA 2WLIB 4P30A 1R3IC 5CBGA 4P9OA 3IFXA 4KFMA 4XDKA 3SPHA 2IH3C 3F7VC 3WG7C 2NLJC 4R50A 3SPJA 3X2QC 1V55C 3R65A 4UUJC 3OR7C 4H33A 4MVQA 4PDLA 4R6ZA 5EBWC 3RVYA 3HPLC 3PJSK 4J9YB 3FB8C 5EC2C 3RBZA 4LP8A 4DXWA 2HJFC 3ZRSA 2QTOA 2WLLB 3F7YC 1OCOC 3E8BA 4PDVA 4I9WA 1R3JC 4HZ3A 5EBLC 5CBFA 3OR6C 4MW3A 3LDDA 1XL4A 2DYSC 3ABLC 4EKWA 5B3SC 1KKDA 3T2MA 3SPCA 4X89A 3E8GA 2WLNA 2W0FC 4RUFA 5EC1C 5KUMA 2WLLA 1OCRC 1K4DC
chains in the Genus database with same CATH superfamily
5CA1A 1FPOA 2QM8A 4E4EA 2G38A 1TAEA 3ABUA 3L72H 2PGGA 3VBBA 4X1IA 2ZIMA 1GO3F 5LHHA 2ITDC 4ABMA 4DR2O 3LUTB 5JQGA 3DC6A 5D5PA 1N36B 3DC5A 4B3MB 1GK9A 3JD4A 2HKOA 4D7SA 1S5LZ 3FAVB 4I4TA 3SYPA 1SKVA 2HVKC 4I7ZB 1Q8IA 5GTHZ 2QWOB 2GBOA 3MAQA 2CUGA 3EFFK 1MG1A 3IC7A 1NKDA 5GONA 2EILC 3ETEA 2P67A 4KHPO 1HNXB 4X88A 1L0LH 2O57A 3HB3B 1BL8A 3JSNA 1K97A 3FFQA 3UO3A 1I94B 2F1MA 3SDLA 2FL4A 3H1LH 3K08A 4JI0B 3BA8A 2AHYA 4MVOA 1AROP 3T1CA 2YIBD 1MOFA 1RSOB 1MA1A 3U0ZA 3WFVA 3F5WC 1SZTA 5B5EZ 2A7WA 4CC6A 4GKJB 1R3KC 4JI2B 3U11A 2UXDO 2H3OA 1RM1C 1O9GA 4TV9A 3EXAA 1H2NA 4Z1VA 1BZKA 4JPRA 3OEEG 4LH6A 3ZMZA 5FPRA 3E22A 4IYHA 4R50A 1FFTB 4TT3G 4JI1B 1ZUQA 5B1AB 4JI3B 3RBZA 4O2AB 4DXWA 2HJFC 5TISZ 1OHHG 5EZYB 4L87A 1ZL8B 2QWQB 3JD0A 3LDDA 4MW3A 4DRXA 1YTFB 2EJRA 3S3WA 3CRQA 3JAKB 1YJ9V 3ZMVA 1EBOA 1Q6UA 5BXZA 1VQKV 1URFA 4ZKIA 1XQ8A 4IIJA 3M8AA 1JCHA 4G2KA 4J80A 4D7TA 1JVMA 5JJNB 4GKKO 2D2CB 3SYQA 1VF7A 3A2FA 4FLUA 3ZHSA 4YY3B 4ICGA 3TJTA 2F23A 5HFMA 3KG2A 2IJHA 2IU0A 1FKAO 3C90A 4BW9A 2F4VB 4DUZB 2PZSA 4TUYA 2ZKOA 1L1FA 1TUEB 1G1XB 2CGNA 1NBMG 4A5UB 3AG3B 3K79A 4GZRB 5A9GA 1I5YA 3ZHUA 4WFGA 5CB4B 4GX5A 1E1RG 2R72A 4K3AA 2LQTA 2GTSA 1W2BU 2LGWA 1K3EA 1NQTA 2BOBC 2PYJA 2Q6AA 3ABMB 2BOCC 4LF5B 5E79Z 1QHTA 3JCZA 3K58A 4IGGA 2IJKA 2EBOA 5KMGB 3Q4HA 4LFCB 2E3CA 3RN4A 2JRIA 3AG2B 5IYZB 5B1AC 2Y0IA 2RQ6A 2UUCB 1NH2B 4ZOLB 3W7UA 4JI7O 2BTQA 1KP2A 4TSFG 5K1PA 4JI5O 2OYQA 1YTFD 1YHQV 3WG7B 3RT3C 3RWRD 3BA9A 1VF6A 3MDSA 1HNWO 1VQNV 2ZE5A 1EM1A 1Y6XA 3T2MA 5KA6A 1XMQO 4X89A 1JX9A 3OTOB 1M4UA 4WCEV 4DW0A 5BMVA 1PD3A 2DYSB 3TGUH 4IHJA 4QPKA 3CC2V 4LF6O 4GUNA 1J5EB 4YJ3A 2CTQA 5L3BA 3DTUB 2UU9O 4LNUB 3AG3C 1MZEA 5FNVB 3RYCA 1GN4A 4FZ0A 4EEQA 4NR1A 4DR3B 2LFRA 1SA0B 4K0KO 3G67A 2UUAO 4PI0A 3K0DA 1VMGA 3ZCCA 3QO8A 2Q73A 1WB8A 4I55A 2FMLA 3K06A 1R6TA 5B1BB 3ABMC 4OGQB 4B3SO 2QTSA 4UB6Z 3P3NA 5JCOA 3JYCA 1E79G 3FD9A 1D5NA 1F23A 3APQA 2D3OW 3CCMV 2ADQB 3SPIA 1OV9A 3JAMN 3AG2C 1M90W 1M57B 1IZ3A 2WLKA 2P6JA 4NVPA 2H8PC 3A8TA 4MVZA 4DR4O 2JS5A 1FJGB 5J9PC 5KHKA 2CTPA 2QWNB 4DV1O 1GRJA 4TQFA 1NH2D 1TUBA 5LMUB 3N2KA 4HYOA 5KHHA 5LHGA 2CTRA 2Q0AA 4JAVA 3JCUZ 3IFXA 1QQCA 4DV5B 3WG7C 2Q7HA 2QE7G 4DV4O 4UUJC 3CEIA 4R6ZA 4MVQA 1Q90D 3B09A 3RVYA 4AI8A 2GUZA 1NT2B 4HNAB 3F7YC 2DQ0A 4J10A 5LGNA 4CS4A 4ZIBA 1AP6A 2CH7B 3BABA 5IJ0A 2DYSC 4LF7B 2WPDG 1NJIW 2PUSA 4O4LB 3E8HA 5IJ9B 2P4KA 1VARA 1H2MA 2E5LB 4BIUA 4UVCA 3SJAC 5L3DA 2V7QG 1ORQC 4LF4B 1EN4A 1TA8A 3HKDB 1YJWV 1BHAA 2N04A 4JI8O 2A0LA 3E35A 1N34B 2A79B 1R1BA 5B1BC 4GLXA 5H9CA 2JIZG 3CCRV 3VQYA 4Z2WA 2XAHA 1P49A 4B3TB 1K73W 4OPAA 2PYLA 4WFFA 3RYIA 1GN3A 3W7WA 4CH6A 4DR7B 1XDCA 1CPYA 1M57C 2IU3A 4P2ZA 2DN9A 1H38A 2QEXV 3ABKC 4ZHQA 1XNQO 1IBLB 3BVOA 1AI7A 4BR6A 4B7KA 3UT5A 2BSKB 5IT9N 1AI5A 4MVSA 2EZPA 2EINB 1WA8B 1H2SB 4FLWA 2EULA 2ZXWB 3HKEA 3W7TA 1Q86W 5JJJB 4EFEA 4B7EA 1H2KA 1CXZB 1R3IC 1IXMA 1IBKB 2Q7EA 2E74B 1VQ6V 5IYCO 1BS3A 1X4TA 4BIOA 2ILMA 2Y0PA 5EC2C 1HNZO 4DV0B 1H2GA 4LP8A 1UJWB 4JYCA 3ZRWB 2YXLA 2XTAA 2QWRB 3SGIA 3J80N 2PI5A 1IBMB 3TK1A 4LF9O 4LFBO 5LBQA 2VQFB 2RN9A 1XMOO 4JYAB 2WLLA 3QNEA 2JVDA 2AGAA 4LC1A 2YEVA 4DV6B 1FS0G 2MW2B 5LGUA 1JFFB 2WA4A 4GT1A 2PF4E 3QTCA 4X1KA 1Y67A 2QA4V 3UM7A 5EK0A 4EB6B 3OTFA 4NXNB 1KKCA 1QLEB 3SJQC 3ZHTA 3P3PA 3A0HZ 4NTYA 4DYLA 4JTDB 1BCCH 4RQFA 4R7CA 3BEHA 4JYYA 1WAZA 1NTKH 4U7NA 4PA3A 2DWEC 4JI6B 2GSMB 3ASNB 1DTOA 3TETA 2EINC 1PKXA 4FFBB 3JARA 3EHBB 1K4CC 4J7ZA 2ZXWC 3KKYA 4O4HA 1FXHA 1VQLV 4G28B 4DR5B 3A0BZ 3LDCA 4UCVA 2JS3A 4DR6B 5BR8B 3ZN1A 4UCOA 1QVGU 5JJEB 4LF8O 3L70H 3M99B 4X65O 3AG4B 1K8AW 2WLIB 2BCCH 4DV7O 2YIBA 2R70A 2FTKA 3O9OA 5LL6Y 4RQEA 4UVBA 5D5QA 1GMGA 5C8YB 5CBGA 4IT5A 1F4NA 1JOYA 2XT9A 1SS3A 3ZS8C 2VQEO 1XHZA 2ARHA 1WP7A 2AZ0A 4JV5B 2ZM6O 3K5MA 1VQ9V 2DOSA 3BRCA 1SQBH 2DW4A 3CCEV 1F7YA 3E8GA 4O4JA 1YCIA 4F6RB 4C7UA 1KD1W 5H6QA 4BWAA 1KBHA 4H37A 1S5JA 3VOUA 4DW1A 4JI4B 5H2FZ 3RYHB 1BT8A 2ZQMA 1N33B 1QLEC 3ZMUA 1N36O 1EZJA 1L8DA 1SF9A 3N2GA 2CTWA 3FX7A 5FL7G 2CK3G 1Y76B 2NN4A 1MNGA 2B1IA 3ASNC 1THZA 4WBNB 3FAVA 1YDXA 2LO1A 3L9DA 3ZMTA 1I94O 2LW7A 4QJFB 1SQPH 2W6IG 1QVFU 3JAWA 4CS3A 1FXVA 1ZAUA 2ZE8A 3EVKA 1SETA 1V9PA 3AG4C 3KCXA 4QE9A 1YJNV 2YIAA 4FM2A 3HR0A 4JI2O 3TXQA 4B3RB 4OX9B 4X62O 1RSOA 2V4DA 5KAFZ 1VQMV 1R6NA 1NR1A 5JQGB 4X1YB 1QNMA 1BQ0A 1VP7A 5IWAO 2UXBO 1GM9A 1ZTEA 2KKWA 3D36C 4H33A 3MHSC 2UUBO 1AI6A 5KHJA 4DR2B 5LXTB 1S0VA 4TQDA 2Y48A 1XL4A 2Q7GA 1IX9A 4UB8Z 3JD3A 1PNKA 4O2AA 1PM9A 5JH7B 3GWKC 5EZYA 4KUMA 1ZL8A 3D3QA 4UXNA 5B3SB 5LHIA 1FD9A 2XASA 3JAKA 4KHPB 5J2TB 4YY3O 3AG7A 1BSMA 2Q9LA 1KU9A 2XOKG 4WFEA 4PDMA 2FYUH 2L35A 1N8RW 1R6KA 2DYRB 4PA7A 3QO7A 1XREA 1P7BA 3CCQV 1Q43A 4U7OA 1SQXH 1GAXA 4PV1B 5LYJB 3LNMB 1JQ0A 3CC4V 4DR1O 2WWWA 5CA3A 4FPPA 1MZFA 4UCSA 1M93A 3JATB 2A3QA 4F6EA 4PA4A 4CH4A 2F95B 2UXDB 3K5NA 1YVWA 4MTOA 1CEZA 4TWKA 1XL6A 3WU2Z 4K35A 1TVKA 4LFAO 1HDJA 1OJHA 2ADPA 2FKXA 2HEPA 3DGEA 5KAIZ 5CB4A 3ZJZA 3ZX6A 3AG1B 5LGTA 3ICXA 1PNLA 4IIJB 1N0JA 1XHXA 4AQYO 4PJ0Z 2RJZA 3CX5F 2F93B 2KSDA 2DQ3A 3UCSC 1RPRA 2UUCO 3CC7V 4CZZA 3J7AU 4FM0A 2OT5A 1XNRB 2OCCB 4GKKB 2Y69B 2ZT9B 5IYZA 3H1KH 4DO2A 2ZE7A 1SERA 1PL0A 3AK2A 1Y74A 2OTJV 1KKDA 5B3SC 2YXHA 2FB5A 2QM4A 2M7WA 3K3WA 4DV3O 2H94A 1HR0O 4MT8A 2CGOA 4TV8B 3ZRVA 5BY1A 2DYRC 4BW5A 1YIJV 3AEIA 2BE3A 2Z3YA 3DSQA 1RPOA 2YC0A 1OCRB 1TGOA 2XHBA 1MSWD 1GN6A 2BTOA 3WB1A 2UXXA 3CRRA 4DV2O 1PNMA 2JEUA 2PI4A 3T4DA 2OIGA 5LA6A 4X8AA 4DR3O 4U3JB 3ZEDA 1IURA 2ATKC 4X66O 4LNUA 4XDKA 2KG7B 3DXRB 1J95A 2R9IA 2X6BA 1DK1A 4NXMO 2EIKB 3HKBB 1DF5A 5LP6B 3CE2A 1WLEA 4LWSA 1SA0A 4X9QA 3K9SA 4GYCB 2A06H 5KX5A 3AG1C 2M6YA 3RGBA 4RWUA 1JMKC 3OW2U 4DUYO 1R3LC 1WP8A 4MW8A 3LSUA 2HJDA 3FKSG 1YSCA 4JI5B 2HFEC 4XBFA 3ZHVA 4WFAV 1FJGO 1RP3B 1SQGA 4O2BB 2R9RB 4FMTA 2OCCC 3CXCU 5ITZA 4QPJA 1HNWB 2Q67A 2Y69C 5B1OA 1KQSU 4PELA 1XMQB 1N4CA 2JGDA 4P9OA 2E76B 1COWG 2IH3C 2QGNA 4CBCA 1G6UA 1FXKB 1FYJA 1MSDA 2UU9B 5EBLC 2Q8VA 1NZ6A 4FLVA 1IXBA 1K9MW 4J42A 3LSSA 2WLNA 1PL4A 1H8HG 4HNAA 3T1YB 5B1NA 1YEWA 1OCRC 1Q7YW 2CH7A 1F4MA 2YXYA 4K0KB 5KA5A 2UUAB 5L3EA 1FFXB 1I0HA 1ZWIC 2P90A 1PPJH 4LF4O 4B3SB 3CJHA 2N74A 5EYPA 4O4LA 5IJ9A 3OGIB 5LMNO 4PHZA 2B1GA 3K5OA 3HKCB 2YICA 5A2QN 3HKDA 2EIKC 5LP6C 1B3QA 1YI2V 3D3IA 4GX0A 3O65A 4DR4B 4I0XB 2WSSG 3CMEV 4W4KA 1LUVA 2IW5A 1VF6C 4DV1B 1XUQA 2ODMA 2R9AA 3JALB 3W7XA 1EZVH 1GH6A 3ZHQA 1XI1A 3CSXA 4ZI7A 1H8EG 1AJNA 4DV4B 2AW9A 3UKMA 4X20B 5E1AC 1YITV 2CE4A 4NYKA 1SESA 1FXKC 2EIMB 2RNBA 4P30A 1HP8A 3APOA 1WA8A 2JEXA 1B06A 2ZNIA 3F7VC 4BAYA 3I5DA 1QBZA 3R65A 4X64O 2LGQA 4JGSA 5IDJA 1ZSPA 3QF7A 4JI8B 5IYDO 3RYFA 2RDCA 3G4SV 5H6RA 3B40A 3SPCA 3RYIB 2N05A 4JYAO 2XAGA 2ZIOA 3ZRWA 4JAAA 3K9AA 4CH3A 1WB7A 3CRAA 1M5IA 1NTZH 4ZHQB 2X6AA 3G71V 3C3SA 4F4LA 3UT5B 1SQQH 2HHHO 4QE7A 3CMAV 3WB2A 3IAYA 1JA8A 3E83A 4AHCA 5F2VO 2ZCEA 4UV8A 1XNQB 3ETGA 1G8MA 3RVZA 5KLVH 4MVRA 4RO2A 1KUQA 3OFNG 1JFFA 3M7MX 5CN0A 2LJ2A 3ZN0A 3B2EE 4EB6A 4GX2A 5EBMC 5GW7A 2XNDG 3CYOA 3E8FA 3G80A 5L3CA 1W0JG 3VQWA 1VEWA 1SZXA 1K7DA 1Y66A 1HW7A 3JASA 3QG5A 5BR8O 2EIMC 1HNZB 2ETNA 4I50A 3CCLV 4HBNA 4CC5A 3OAAG 2ZE6A 2QKSA 3K5LA 1VQPV 3RW0A 4LF9B 2QR4A 5B66Z 4Z1MG 1KB9F 4PD4F 1XMOB 4KFMA 3SPHA 4GCZA 4X1KB 1AR1B 3NR7A 5EBWC 2RCVA 1RFYA 3G6EV 1R3JC 2XAQA 2JJ1G 1O9HA 5GTIZ 1V55B 4YHHO 4H0LB 5J2UA 1VQOV 1MABG 3FYEB 3GVMA 1OCOB 1KP3A 5KUKA 3T1HO 1NU1H 1AR4A 4YJ2B 3ABLB 3JARB 3D36A 1Y4MA 2ZDIC 3QVNA 4O4HB 1VQ8V 4F6RA 3UQ8A 4FVMA 1N33O 2HG5C 2VWJA 4OXSA 2F66C 3FB7C 2ZINA 1U96A 1WPXA 2OTLV 4CS2A 1VQ4V 1BMFG 5CA0B 3OUSA 1UFIA 3ASOB 2OWOA 3RYHA 4N21A 1GKFA 3CP1A 4P9PA 3E89A 1GN2A 2K1EA 3E86A 2Q69A 3I56V 1NS1A 5JVDA 3SPGA 4JZGA 3H9VA 1US6A 3L71H 4FLZA 4NB5A 4LF8B 5CBHA 4B3MO 1Y76A 1N32B 4X65B 1S5HC 4WFHA 4WBNA 2PY5A 4DV7B 4QGPA 4LH7A 2NR5A 3K59A 4JTCB 3JD2A 2HVJC 2YDEA 3SYOA 3ZHRA 2EJ7A 4E2LA 4FLYA 4UVAA 4MTFA 1BGYH 2LW1A 4O4JB 4O4IB 2IM9A 2VQEB 3LSQA 1Q82W 1HNXO 3CCVV 4LR3A 3LDEA 3CCJV 2ZM6B 4OX9O 2ZD9A 4MVUA 3BY6A 4XDJA 2WLMA 3L73H 1Q6IA 3CS5A 4JI0O 3JSLA 3BHPA 2NLJC 3N2GB 1I08A 1I5XA 1V55C 5LOVB 3OR7C 4PDLA 5H5NA 4B08A 5IYBO 4BIZA 1OCOC 1P4RA 5CA1B 4X1YA 2UXCB 4PDVA 4UCRA 4GKJO 1D2DA 3ABLC 3BFRA 4X1IB 5LXTA 3B77A 4JTAB 1NI8A 3K0GA 4RUEA 3JAWB 4JI1O 1F51A 4I4TB 1WN7A 2YS8A 2ZNJA 4JI3O 1L0NH 4H44B 2Z0AA 3ASOC 3H01A 1S72V 4MSWC 5JH7A 2YI8A 5GONB 4GX1A 3PN1A 1OCZB 5DN6G 3MHHC 5J2TA 1NTMH 3OUFA 4PDRA 3CXHF 2CAZC 3KZIZ 4D6TH 1DLBA 3OEHG 2C2AA 1K33A 3T4ZA 2B9ZA 4J7JA 4YXWG 4QIWF 5LYJA 4X62B 1OZ0A 5K1XA 4K8XA 1S76D 4KL1A 1QR8A 1U97A 1GM8A 2LFSA 2F4VO 4FFKA 3SJCC 1KYOF 4DUZO 5IWAB 1VF5B 3JATA 2UXBB 5C93A 3ABTA 3CHXA 3GB7C 3W7SA 3OMNB 2UUBB 3BAAA 4TV9B 4MTGA 1YF2A 1DGSA 3B8MA 3E22B 5BZBA 3CRCA 3THOA 2IJIA 2QJ1A 2QKCA 3CRMA 1XNRO 4LF5O 4DRXB 1LR1A 4IYIA 4U3FH 2QTOA 1VQ7V 2Q4PA 4FZ1A 1EN6A 1MMMA 3OR6C 5CBFA 4LFCO 4J7KA 4I9QA 1GM7A 2VWKA 3UO2A 5DEDA 4KP4A 3U10A 2DE0X 3OGCC 5KMGA 1OCZC 4DR1B 1K5QA 3H1JH 2A9HA 3VQXA 1TVKB 4TUYB 4ZOLA 1XBLA 4TV8A 1I7FA 3ML0A 1DF4A 3OTOO 5HFLA 1Z5WA 4LFAB 3IGAC 1VQ5V 2QSAA 4FLXA 1S77D 1SC5B 2P22C 1IDSA 1Q6HA 1J5EO 4AQYB 2QKAA 2YIDA 4U3JA 4ASUG 1AVMA 1XEQA 1CP9A 2HP8A 4NTWA 4PI2A 1K34A 2KG7A 3DXRA 3Q4HB 1Y74B 3HKBA 5LP6A 3D8CA 4TOIA 4J9ZB 1AI4A 1XILA 1XOUA 5FNVA 2DWDC 3CCUV 4L8JA 3CCSV 1P84F 1LNQA 2BTQB 2GTAA 2P4VA 4DK0A 1PP9H 1QR9A 1V54B 3BCCH 4DV3B 1YXBA 1HR0B 4JYBA 1E1QG 4O2BA 4JI7B 5LA6B 4UCUA 3E8BA 5BMVB 4DV2B 3SR2C 3X2QB 2P5OA 4FIPC 4IHJB 5LMUO 1FXKA 4YJ3B 1R73A 5EC1C 3T1YO 3GWOA 4LWSB 3ZRSA 4X66B 4DV5O 2KB1A 5JWPA 3TXSA 4Q6GA 5KX5B 3RYCB 4LF6B 4NXMB 2ZR3A 1EFRG 2WA3A 3SYAA 2AZ2A 1YZBA 1AILA 2Q0OC 2JK5C 2JGUA 5L3GA 1QCEA 3CB2A 4LF7O 1FFXA 4I55B 2XAJA 3STZC 3N27A 1GTOA 3ZIAG 5ITZB 2PTMA 4DUYB 3R66A 3FB6C 3NXSA 1UPGA 2E5LO 1G4YB 5FPOA 3ABKB 5FLXN 3K57A 3HKCA 5EIBC 2JGDB 3BPZA 2AHZA 4W4LA 4I5SA 5EIBD 3SJBC 2OIEA 1NR7A 5DM6V 1IVSA 2EIJB 1N34O 2VS0A 1B04A 3FB5C 4I0XA 4NKGB 3ZRXA 4LBEC 1TUBB 2RMKB 2XAFA 4J41A 3OT7A 1Z2GA 3N2KB 1JJ2U 4B3TO 1V54C 3ZMSA 3JALA 1Q81W 4J11A 3AK1A 2X7RB 2Q68A 1D5AA 4DR7O 3L74H 2GUZB 3CJHB 4X20A 5EYPB 1IBLO 1A32A 2AXTZ 5IJ0B 2DJVA 2DMXA 3SPJA 1B6QA 3X2QC 3AK3A 3HPLC 1JJOA 1Z5VA 4FM1A 1BHBA 5AG2A 1W0KG 3H1HH 2GHYA 2BSKA 3A0RA 5LMNB 2JJ2G 4EKWA 1K92A 4JASA 2Z5UA 2B5UA 1IBKO 2WLHA 4JF3A 1WJZA 4PA9A 2YUAA 4FLTA 4DV0O 1FAFA 4ZBMA 3STLC 1Q5OA 4ZI7B 1BQZA 1OCCB 2L6LA 5JCOC 1JPXA 4Q20A 3K03A 5L3FA 1IBMO 3OM3B 5IY5B 5IE9A 2VQFO 3CPWU 1ROPA 4UV9A 4LCUC 3L75H 4RAIA 1X59A 4QNHB 2EIJC 2ITCC 2ZDIA 4H13B 4DV6O 2EX3A 2UXNA 3K04A 4FJCC 3MD0A 2KQXA 3C3TA 1AP5A 1ZLZA 2E75B 2IH1C 3B4SA 1QLNA 4UFZA 3HKEB 4NXNO 4JZ2A 2YSUB 4YIOA 3SYCA 1P7GA 1VIBA 1KECA 1NVPB 3RYFB 4X64B 3E2EA 1KMIZ 1M56B 3KCYA 2MK3A 4OPHA 4EFBA 2WLJA 4JI6O 2IBZH 3S3XA 4KXRA 4WF9V 5KHIA 3P32A 3ZBHA 3ETQA 2GV9A 1SQFA 2GDSA 2Q5ZA 2NNUA 3LNNA 4DR5O 4DR6O 3PJSK 3JD1A 2XUMA 3FB8C 2ZR2A 4FFBA 2HHHB 2WLLB 1SQVH 1H2LA 1PV0A 4CH5A 1KC8W 1HWYA 2YEVB 1Q3EA 4LFBB 1QU7A 1OCCC 2P7TC 3OMIB 4IL6Z 5IY5C 2WLIA 2QWPB 2WAMA 1JR9A 3JASB 2LP7A 2HR3A 4JV5O 5C8YA 4MS2A 3H1IH 3WB0A 4PA6A 1WPBA 4YJ2A 4NTXA 4I50B 4G27B 3FYIB 4FK5C 3CWBH 1M9NA 2X6CA 4XDLA 3OE7G 4R8CA 2W6JG 4AILC 5CA0A 2F43G 3TCUA 4JI4O 1AB3A 3IJ4A 2W0XA 1EN5A 3RFRA 3F5TA 3QO5A 3G6BA 1N32O 2EILB 1M56C 3IC9A 4JAUA 2K9PA 3I55V 1NVPD 4MVMA 2YI9A 2IJJA 2QDOA 4HAMA 2EZOA 5J2UB 4K8ZA 1ZX3A 1WNSA 3OMAB 5KHGA 1S3JA 1BE3H 3CD6V 4UCTA 1AJPA 3VQVA 4YHHB 1M1KW 4WFBV 4O4IA 2VRZA 1T5EA 2P06A 2CDYA 4N23A 2Y4UA 1SRYA 3T1HB 1AJQA 2JDIG 4MTXA 4DK1A 2HLDG 1RM1B 1N0NA 5DECA 2V1DA 4J9YB 1K5SA 2QM7A 4YIPA 5CMUA 2UXCO 2Y4TA 3P30A 4I9WA 4HZ3A 3J81N 1ENVA 1LUWA 4B3RO 3B8NA 5LOVA 2OCHA 5JVDB 1AR5A 2X0LA 2W0FC 3ETDA 4RUFA 5KUMA 1W59A 3OD4A 1K4DC
chains in the Genus database with same CATH topology
3OGCC 2QM8A 1Q7YW 1F4MA 5KA5A 1OCZC 3ABUA 5L3EA 4LC1A 3VBBA 1ZWIC 2YEVA 2P90A 1GO3F 1K5QA 2ITDC 5LHHA 1FS0G 2A9HA 5LGUA 3LUTB 4GT1A 1GK9A 3JD4A 2B1GA 2HKOA 2QA4V 3ML0A 3UM7A 5EK0A 3SYPA 2HVKC 1DF4A 5HFLA 2EIKC 1QLEB 3SJQC 3IGAC 3EFFK 1YI2V 1MG1A 3IC7A 1NKDA 3D3IA 1VQ5V 2EILC 4GX0A 3ETEA 2P67A 4JTDB 4RQFA 1S77D 4R7CA 3BEHA 4X88A 4U7NA 3HB3B 4PA3A 2WSSG 1BL8A 2DWEC 3CMEV 2IW5A 1K97A 4ASUG 1CP9A 2GSMB 3ASNB 1DTOA 3TETA 2EINC 3W7XA 1PKXA 3K08A 1K34A 3EHBB 1K4CC 2AHYA 2ZXWC 1FXHA 4MVOA 1AROP 1VQLV 4G28B 3T1CA 3LDCA 1H8EG 1AJNA 4J9ZB 1AI4A 1MOFA 3ZN1A 3UKMA 5E1AC 3WFVA 3F5WC 1SZTA 2DWDC 1YITV 3CCUV 3CCSV 1QVGU 1R3KC 1LNQA 1RM1C 1SESA 3M99B 1FXKC 2EIMB 3AG4B 2WLIB 1QR9A 1V54B 4P30A 1K8AW 2FTKA 4RQEA 2JEXA 4UVBA 1GMGA 5CBGA 4JPRA 4JYBA 1E1QG 3OEEG 3ZMZA 1F4NA 1JOYA 3F7VC 4BAYA 4R50A 1FFTB 4TT3G 1QBZA 3R65A 5B1AB 4JGSA 5IDJA 3RBZA 4DXWA 2HJFC 1OHHG 4L87A 3E8BA 5IYDO 3JD0A 3LDDA 4MW3A 3X2QB 4FIPC 1VQ9V 1YTFB 2EJRA 1YJ9V 2DW4A 3ZMVA 5H6RA 1EBOA 3G4SV 3CCEV 3SPCA 1FXKA 3E8GA 1R73A 1VQKV 5EC1C 2XAGA 4ZKIA 3GWOA 3ZRWA 1KD1W 3K9AA 3ZRSA 5H6QA 1JCHA 4G2KA 4H37A 2KB1A 1JVMA 3VOUA 3SYQA 2X6AA 3G71V 4F4LA 2ZR3A 1EFRG 4QE7A 2ZQMA 3CMAV 1QLEC 3SYAA 3ZMUA 5HFMA 1EZJA 3E83A 2IJHA 3KG2A 2IU0A 2JK5C 5L3GA 1QCEA 4UV8A 3ETGA 1G8MA 3RVZA 2XAJA 4MVRA 3STZC 4RO2A 1GTOA 3ZIAG 5FL7G 3OFNG 1TUEB 1L1FA 2CK3G 3FB6C 3NXSA 1NBMG 1G4YB 2B1IA 3ASNC 3AG3B 5CN0A 1THZA 3ABKB 3ZN0A 3K79A 1I5YA 2AHZA 4WFGA 4I5SA 3ZMTA 4GX2A 5EBMC 5GW7A 4GX5A 1E1RG 2XNDG 4QJFB 1NR7A 3CYOA 3E8FA 2EIJB 5DM6V 2W6IG 1W2BU 1QVFU 1K3EA 3FB5C 1NQTA 5L3CA 1FXVA 1W0JG 2BOBC 2Q6AA 3ABMB 2BOCC 3ZRXA 1K7DA 1Y66A 1SETA 4LBEC 3JCZA 2XAFA 1JJ2U 3AG4C 2EIMC 1V54C 3ZMSA 1Q81W 3CCLV 2IJKA 4QE9A 2EBOA 1YJNV 3OAAG 2QKSA 2X7RB 2Q68A 1VQPV 3RW0A 3AG2B 5B1AC 4Z1MG 1NH2B 1VQMV 1R6NA 1NR1A 3W7UA 4KFMA 3SPHA 4GCZA 1GM9A 3SPJA 1B6QA 3X2QC 1AR1B 1KP2A 4H33A 4TSFG 3MHSC 5EBWC 3HPLC 1AI6A 1YTFD 1BHBA 1W0KG 3G6EV 1R3JC 2GHYA 2XAQA 1S0VA 1YHQV 2Y48A 2JJ1G 2JJ2G 3A0RA 3WG7B 1XL4A 1V55B 4EKWA 1K92A 1VQNV 3T2MA 4JASA 5KA6A 3JD3A 2Z5UA 1MABG 4X89A 3FYEB 1VQOV 1PNKA 1JX9A 2B5UA 1OCOB 1KP3A 5KUKA 4WCEV 4KUMA 2WLHA 4UXNA 1PD3A 4JF3A 2DYSB 3ABLB 4PA9A 5B3SB 5LHIA 3D36A 1Y4MA 2XASA 2ZDIC 4QPKA 3CC2V 4ZBMA 1VQ8V 3STLC 2XOKG 5L3BA 2HG5C 4WFEA 1OCCB 4OXSA 4PDMA 1N8RW 1JPXA 3FB7C 1R6KA 2DYRB 1WPXA 3DTUB 3K03A 4PA7A 4Q20A 3QO7A 5L3FA 2OTLV 1VQ4V 3OM3B 1BMFG 1P7BA 3AG3C 3CCQV 5IY5B 3OUSA 4U7OA 3ASOB 4N21A 2LFRA 3CPWU 1ROPA 4UV9A 4LCUC 1GKFA 4RAIA 3LNMB 3CP1A 4P9PA 1JQ0A 4QNHB 3K0DA 2EIJC 3E89A 2K1EA 3E86A 3CC4V 2WWWA 2Q69A 3ZCCA 2ITCC 2ZDIA 3QO8A 5CA3A 4FPPA 3I56V 3K06A 5B1BB 3ABMC 3SPGA 2UXNA 3K04A 4FJCC 3JYCA 3MD0A 4PA4A 1E79G 5CBHA 1S5HC 4WFHA 2IH1C 4MTOA 1QLNA 1CEZA 1F23A 4TWKA 4JTCB 2D3OW 3JD2A 2HVJC 1XL6A 2YSUB 3CCMV 3SYOA 3SYCA 4E2LA 1NVPB 1KECA 3SPIA 4UVAA 3DGEA 4MTFA 3E2EA 3ZJZA 3AG2C 1M90W 1M57B 2WLKA 3AG1B 2P6JA 5LGTA 1M56B 2H8PC 3LSQA 1Q82W 1PNLA 4MVZA 2MK3A 3CCVV 5J9PC 3LDEA 3CCJV 2WLJA 2ZD9A 1NH2D 4MVUA 3BY6A 4XDJA 4WF9V 2DQ3A 2WLMA 4HYOA 1RPRA 3P32A 5LHGA 4JAVA 3CC7V 4CZZA 2OT5A 3IFXA 2NNUA 3WG7C 2OCCB 2NLJC 1I5XA 2QE7G 1V55C 4UUJC 3OR7C 2Y69B 4MVQA 4PDLA 4R6ZA 3RVYA 3PJSK 5IYBO 3JD1A 3FB8C 4DO2A 4BIZA 2ZR2A 2WLLB 3F7YC 2DQ0A 1OCOC 1P4RA 5LGNA 1SERA 4PDVA 1PL0A 2OTJV 1KC8W 1HWYA 2DYSC 3ABLC 1KKDA 5B3SC 2YEVB 2M7WA 3K3WA 2WPDG 1NJIW 2H94A 3E8HA 1OCCC 4MT8A 3ZRVA 2P7TC 2DYRC 4BW5A 3B77A 4JTAB 1YIJV 3K0GA 3AEIA 3OMIB 4BIUA 4RUEA 4UVCA 5L3DA 2V7QG 2Z3YA 1F51A 5IY5C 1RPOA 1ORQC 3ASOC 3H01A 1S72V 2WLIA 1YJWV 2WAMA 4MSWC 1BHAA 1OCRB 2LP7A 1MSWD 2A0LA 2HR3A 4GX1A 4MS2A 2UXXA 4PA6A 1OCZB 1PNMA 2JEUA 3E35A 2PI4A 2A79B 5DN6G 4G27B 3T4DA 3MHHC 3FYIB 5B1BC 4X8AA 4FK5C 5H9CA 2JIZG 3OUFA 4PDRA 2ATKC 3CCRV 2XAHA 1M9NA 2X6CA 4XDLA 3OE7G 1K73W 1DLBA 4R8CA 4XDKA 2W6JG 3OEHG 2F43G 2C2AA 1K33A 3TCUA 3T4ZA 1J95A 4WFFA 2R9IA 2X6BA 2EIKB 4YXWG 4QIWF 1DF5A 3W7WA 1WLEA 3QO5A 1OZ0A 1CPYA 1M57C 2EILB 2IU3A 1S76D 4P2ZA 1QR8A 3AG1C 1H38A 2QEXV 1M56C 3ABKC 1GM8A 2LFSA 4JAUA 3I55V 1NVPD 1AI7A 4MVMA 3OW2U 2IJJA 5C93A 1R3LC 3ABTA 3GB7C 4HAMA 3W7SA 4MW8A 2EZOA 1AI5A 3OMNB 4MVSA 2EZPA 2EINB 3OMAB 3FKSG 1YSCA 4XBFA 2HFEC 1S3JA 2ZXWB 4WFAV 4MTGA 3W7TA 1Q86W 3CD6V 2R9RB 1AJPA 3B8MA 2OCCC 4FMTA 3CXCU 4QPJA 1M1KW 2Q67A 2Y69C 5B1OA 1KQSU 4PELA 5BZBA 4WFBV 1R3IC 2IJIA 1IXMA 4N23A 1VQ6V 4P9OA 1SRYA 5IYCO 1AJQA 1COWG 2IH3C 2JDIG 4MTXA 2HLDG 1RM1B 4CBCA 2V1DA 4J9YB 1FXKB 5EC2C 1H2GA 4LP8A 1UJWB 4JYCA 1K5SA 3ZRWB 2QTOA 1VQ7V 2QM7A 5CMUA 3P30A 4I9WA 4HZ3A 1ENVA 5EBLC 3OR6C 5CBFA 2PI5A 3TK1A 3B8NA 1K9MW 1GM7A 5LBQA 3LSSA 2X0LA 2WLNA 4KP4A 2W0FC 3ETDA 4RUFA 5KUMA 1H8HG 5B1NA 2WLLA 1OCRC 3QNEA 1K4DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUK A;  3OGC C;  2P7T C;  2DYR C;  2WLH A;  4BW5 A;  4JTA B;  3K0G A;  4H37 A;  2KB1 A;  1JVM A;  4RUE A;  1OCZ C;  3VOU A;  4PA9 A;  3SYQ A;  5IY5 C;  1ZWI C;  2X6A A;  2YEV A;  2ITD C;  4F4L A;  1ORQ C;  3ASO C;  2A9H A;  2WLI A;  4ZBM A;  4MSW C;  3STL C;  4QE7 A;  2HG5 C;  3LUT B;  4OXS A;  1QLE C;  4PDM A;  4WFE A;  3SYA A;  2A0L A;  3FB7 C;  3K03 A;  3KG2 A;  3E83 A;  4GX1 A;  4MS2 A;  4PA7 A;  4PA6 A;  2JK5 C;  1P7B A;  2A79 B;  3AG3 C;  3UM7 A;  3OUS A;  4G27 B;  5EK0 A;  3T4D A;  3SYP A;  3RVZ A;  2HVK C;  4MVR A;  5B1B C;  4X8A A;  3STZ C;  4RO2 A;  2EIK C;  4CBC A;  3OUF A;  4PDR A;  4LCU C;  2ATK C;  3SJQ C;  3IGA C;  3FB6 C;  3EFF K;  4RAI A;  2X6C A;  3LNM B;  4XDL A;  4P9P A;  4QNH B;  1G4Y B;  2EIL C;  2EIJ C;  2K1E A;  3ASN C;  3E86 A;  3E89 A;  3K0D A;  2Q69 A;  4GX0 A;  2ITC C;  4JTD B;  4R8C A;  4R7C A;  3T4Z A;  3BEH A;  3TCU A;  4X88 A;  3K06 A;  1J95 A;  4WFF A;  3ABM C;  2X6B A;  4PA3 A;  3SPG A;  1BL8 A;  2AHZ A;  4WFG A;  2DWE C;  3K04 A;  4GX2 A;  5EBM C;  3JYC A;  4GX5 A;  4PA4 A;  5CBH A;  3E8F A;  1M57 C;  3TET A;  4P2Z A;  3AG1 C;  1S5H C;  2EIN C;  4WFH A;  1M56 C;  2IH1 C;  3ABK C;  3K08 A;  1OCC C;  1K4C C;  3FB5 C;  2AHY A;  2ZXW C;  4MTO A;  4TWK A;  2BOB C;  4JTC B;  2Q6A A;  4MVM A;  2HVJ C;  2BOC C;  1XL6 A;  4MVO A;  3SYO A;  4G28 B;  3T1C A;  3SYC A;  4LBE C;  3LDC A;  1R3L C;  3SPI A;  4J9Z B;  3GB7 C;  4MTF A;  4MW8 A;  3ZJZ A;  3E8H A;  3AG2 C;  4MVS A;  2EIM C;  2WLK A;  3AG4 C;  3UKM A;  1V54 C;  5E1A C;  2H8P C;  2HFE C;  3F5W C;  4MVZ A;  2DWD C;  4MTG A;  4QE9 A;  5J9P C;  3LDE A;  2QKS A;  2R9R B;  2WLJ A;  1R3K C;  2OCC C;  2Q68 A;  1LNQ A;  3RW0 A;  2ZD9 A;  4MVU A;  2Q67 A;  2Y69 C;  4XDJ A;  5B1A C;  2WLM A;  4HYO A;  5BZB A;  2WLI B;  4P30 A;  1R3I C;  5CBG A;  4P9O A;  3IFX A;  4KFM A;  4XDK A;  3SPH A;  2IH3 C;  3F7V C;  3WG7 C;  2NLJ C;  4R50 A;  3SPJ A;  3X2Q C;  1V55 C;  3R65 A;  4UUJ C;  3OR7 C;  4H33 A;  4MVQ A;  4PDL A;  4R6Z A;  5EBW C;  3RVY A;  3HPL C;  3PJS K;  4J9Y B;  3FB8 C;  5EC2 C;  3RBZ A;  4LP8 A;  4DXW A;  2HJF C;  3ZRS A;  2QTO A;  2WLL B;  3F7Y C;  1OCO C;  3E8B A;  4PDV A;  4I9W A;  1R3J C;  4HZ3 A;  5EBL C;  5CBF A;  3OR6 C;  4MW3 A;  3LDD A;  1XL4 A;  2DYS C;  3ABL C;  4EKW A;  5B3S C;  1KKD A;  3T2M A;  3SPC A;  4X89 A;  3E8G A;  2WLN A;  2W0F C;  4RUF A;  5EC1 C;  5KUM A;  2WLL A;  1OCR C;  1K4D C; 
#chains in the Genus database with same CATH topology
 5CA1 A;  1FPO A;  2QM8 A;  4E4E A;  2G38 A;  1TAE A;  3ABU A;  3L72 H;  2PGG A;  3VBB A;  4X1I A;  2ZIM A;  1GO3 F;  5LHH A;  2ITD C;  4ABM A;  4DR2 O;  3LUT B;  5JQG A;  3DC6 A;  5D5P A;  1N36 B;  3DC5 A;  4B3M B;  1GK9 A;  3JD4 A;  2HKO A;  4D7S A;  1S5L Z;  3FAV B;  4I4T A;  3SYP A;  1SKV A;  2HVK C;  4I7Z B;  1Q8I A;  5GTH Z;  2QWO B;  2GBO A;  3MAQ A;  2CUG A;  3EFF K;  1MG1 A;  3IC7 A;  1NKD A;  5GON A;  2EIL C;  3ETE A;  2P67 A;  4KHP O;  1HNX B;  4X88 A;  1L0L H;  2O57 A;  3HB3 B;  1BL8 A;  3JSN A;  1K97 A;  3FFQ A;  3UO3 A;  1I94 B;  2F1M A;  3SDL A;  2FL4 A;  3H1L H;  3K08 A;  4JI0 B;  3BA8 A;  2AHY A;  4MVO A;  1ARO P;  3T1C A;  2YIB D;  1MOF A;  1RSO B;  1MA1 A;  3U0Z A;  3WFV A;  3F5W C;  1SZT A;  5B5E Z;  2A7W A;  4CC6 A;  4GKJ B;  1R3K C;  4JI2 B;  3U11 A;  2UXD O;  2H3O A;  1RM1 C;  1O9G A;  4TV9 A;  3EXA A;  1H2N A;  4Z1V A;  1BZK A;  4JPR A;  3OEE G;  4LH6 A;  3ZMZ A;  5FPR A;  3E22 A;  4IYH A;  4R50 A;  1FFT B;  4TT3 G;  4JI1 B;  1ZUQ A;  5B1A B;  4JI3 B;  3RBZ A;  4O2A B;  4DXW A;  2HJF C;  5TIS Z;  1OHH G;  5EZY B;  4L87 A;  1ZL8 B;  2QWQ B;  3JD0 A;  3LDD A;  4MW3 A;  4DRX A;  1YTF B;  2EJR A;  3S3W A;  3CRQ A;  3JAK B;  1YJ9 V;  3ZMV A;  1EBO A;  1Q6U A;  5BXZ A;  1VQK V;  1URF A;  4ZKI A;  1XQ8 A;  4IIJ A;  3M8A A;  1JCH A;  4G2K A;  4J80 A;  4D7T A;  1JVM A;  5JJN B;  4GKK O;  2D2C B;  3SYQ A;  1VF7 A;  3A2F A;  4FLU A;  3ZHS A;  4YY3 B;  4ICG A;  3TJT A;  2F23 A;  5HFM A;  3KG2 A;  2IJH A;  2IU0 A;  1FKA O;  3C90 A;  4BW9 A;  2F4V B;  4DUZ B;  2PZS A;  4TUY A;  2ZKO A;  1L1F A;  1TUE B;  1G1X B;  2CGN A;  1NBM G;  4A5U B;  3AG3 B;  3K79 A;  4GZR B;  5A9G A;  1I5Y A;  3ZHU A;  4WFG A;  5CB4 B;  4GX5 A;  1E1R G;  2R72 A;  4K3A A;  2LQT A;  2GTS A;  1W2B U;  2LGW A;  1K3E A;  1NQT A;  2BOB C;  2PYJ A;  2Q6A A;  3ABM B;  2BOC C;  4LF5 B;  5E79 Z;  1QHT A;  3JCZ A;  3K58 A;  4IGG A;  2IJK A;  2EBO A;  5KMG B;  3Q4H A;  4LFC B;  2E3C A;  3RN4 A;  2JRI A;  3AG2 B;  5IYZ B;  5B1A C;  2Y0I A;  2RQ6 A;  2UUC B;  1NH2 B;  4ZOL B;  3W7U A;  4JI7 O;  2BTQ A;  1KP2 A;  4TSF G;  5K1P A;  4JI5 O;  2OYQ A;  1YTF D;  1YHQ V;  3WG7 B;  3RT3 C;  3RWR D;  3BA9 A;  1VF6 A;  3MDS A;  1HNW O;  1VQN V;  2ZE5 A;  1EM1 A;  1Y6X A;  3T2M A;  5KA6 A;  1XMQ O;  4X89 A;  1JX9 A;  3OTO B;  1M4U A;  4WCE V;  4DW0 A;  5BMV A;  1PD3 A;  2DYS B;  3TGU H;  4IHJ A;  4QPK A;  3CC2 V;  4LF6 O;  4GUN A;  1J5E B;  4YJ3 A;  2CTQ A;  5L3B A;  3DTU B;  2UU9 O;  4LNU B;  3AG3 C;  1MZE A;  5FNV B;  3RYC A;  1GN4 A;  4FZ0 A;  4EEQ A;  4NR1 A;  4DR3 B;  2LFR A;  1SA0 B;  4K0K O;  3G67 A;  2UUA O;  4PI0 A;  3K0D A;  1VMG A;  3ZCC A;  3QO8 A;  2Q73 A;  1WB8 A;  4I55 A;  2FML A;  3K06 A;  1R6T A;  5B1B B;  3ABM C;  4OGQ B;  4B3S O;  2QTS A;  4UB6 Z;  3P3N A;  5JCO A;  3JYC A;  1E79 G;  3FD9 A;  1D5N A;  1F23 A;  3APQ A;  2D3O W;  3CCM V;  2ADQ B;  3SPI A;  1OV9 A;  3JAM N;  3AG2 C;  1M90 W;  1M57 B;  1IZ3 A;  2WLK A;  2P6J A;  4NVP A;  2H8P C;  3A8T A;  4MVZ A;  4DR4 O;  2JS5 A;  1FJG B;  5J9P C;  5KHK A;  2CTP A;  2QWN B;  4DV1 O;  1GRJ A;  4TQF A;  1NH2 D;  1TUB A;  5LMU B;  3N2K A;  4HYO A;  5KHH A;  5LHG A;  2CTR A;  2Q0A A;  4JAV A;  3JCU Z;  3IFX A;  1QQC A;  4DV5 B;  3WG7 C;  2Q7H A;  2QE7 G;  4DV4 O;  4UUJ C;  3CEI A;  4R6Z A;  4MVQ A;  1Q90 D;  3B09 A;  3RVY A;  4AI8 A;  2GUZ A;  1NT2 B;  4HNA B;  3F7Y C;  2DQ0 A;  4J10 A;  5LGN A;  4CS4 A;  4ZIB A;  1AP6 A;  2CH7 B;  3BAB A;  5IJ0 A;  2DYS C;  4LF7 B;  2WPD G;  1NJI W;  2PUS A;  4O4L B;  3E8H A;  5IJ9 B;  2P4K A;  1VAR A;  1H2M A;  2E5L B;  4BIU A;  4UVC A;  3SJA C;  5L3D A;  2V7Q G;  1ORQ C;  4LF4 B;  1EN4 A;  1TA8 A;  3HKD B;  1YJW V;  1BHA A;  2N04 A;  4JI8 O;  2A0L A;  3E35 A;  1N34 B;  2A79 B;  1R1B A;  5B1B C;  4GLX A;  5H9C A;  2JIZ G;  3CCR V;  3VQY A;  4Z2W A;  2XAH A;  1P49 A;  4B3T B;  1K73 W;  4OPA A;  2PYL A;  4WFF A;  3RYI A;  1GN3 A;  3W7W A;  4CH6 A;  4DR7 B;  1XDC A;  1CPY A;  1M57 C;  2IU3 A;  4P2Z A;  2DN9 A;  1H38 A;  2QEX V;  3ABK C;  4ZHQ A;  1XNQ O;  1IBL B;  3BVO A;  1AI7 A;  4BR6 A;  4B7K A;  3UT5 A;  2BSK B;  5IT9 N;  1AI5 A;  4MVS A;  2EZP A;  2EIN B;  1WA8 B;  1H2S B;  4FLW A;  2EUL A;  2ZXW B;  3HKE A;  3W7T A;  1Q86 W;  5JJJ B;  4EFE A;  4B7E A;  1H2K A;  1CXZ B;  1R3I C;  1IXM A;  1IBK B;  2Q7E A;  2E74 B;  1VQ6 V;  5IYC O;  1BS3 A;  1X4T A;  4BIO A;  2ILM A;  2Y0P A;  5EC2 C;  1HNZ O;  4DV0 B;  1H2G A;  4LP8 A;  1UJW B;  4JYC A;  3ZRW B;  2YXL A;  2XTA A;  2QWR B;  3SGI A;  3J80 N;  2PI5 A;  1IBM B;  3TK1 A;  4LF9 O;  4LFB O;  5LBQ A;  2VQF B;  2RN9 A;  1XMO O;  4JYA B;  2WLL A;  3QNE A;  2JVD A;  2AGA A;  4LC1 A;  2YEV A;  4DV6 B;  1FS0 G;  2MW2 B;  5LGU A;  1JFF B;  2WA4 A;  4GT1 A;  2PF4 E;  3QTC A;  4X1K A;  1Y67 A;  2QA4 V;  3UM7 A;  5EK0 A;  4EB6 B;  3OTF A;  4NXN B;  1KKC A;  1QLE B;  3SJQ C;  3ZHT A;  3P3P A;  3A0H Z;  4NTY A;  4DYL A;  4JTD B;  1BCC H;  4RQF A;  4R7C A;  3BEH A;  4JYY A;  1WAZ A;  1NTK H;  4U7N A;  4PA3 A;  2DWE C;  4JI6 B;  2GSM B;  3ASN B;  1DTO A;  3TET A;  2EIN C;  1PKX A;  4FFB B;  3JAR A;  3EHB B;  1K4C C;  4J7Z A;  2ZXW C;  3KKY A;  4O4H A;  1FXH A;  1VQL V;  4G28 B;  4DR5 B;  3A0B Z;  3LDC A;  4UCV A;  2JS3 A;  4DR6 B;  5BR8 B;  3ZN1 A;  4UCO A;  1QVG U;  5JJE B;  4LF8 O;  3L70 H;  3M99 B;  4X65 O;  3AG4 B;  1K8A W;  2WLI B;  2BCC H;  4DV7 O;  2YIB A;  2R70 A;  2FTK A;  3O9O A;  5LL6 Y;  4RQE A;  4UVB A;  5D5Q A;  1GMG A;  5C8Y B;  5CBG A;  4IT5 A;  1F4N A;  1JOY A;  2XT9 A;  1SS3 A;  3ZS8 C;  2VQE O;  1XHZ A;  2ARH A;  1WP7 A;  2AZ0 A;  4JV5 B;  2ZM6 O;  3K5M A;  1VQ9 V;  2DOS A;  3BRC A;  1SQB H;  2DW4 A;  3CCE V;  1F7Y A;  3E8G A;  4O4J A;  1YCI A;  4F6R B;  4C7U A;  1KD1 W;  5H6Q A;  4BWA A;  1KBH A;  4H37 A;  1S5J A;  3VOU A;  4DW1 A;  4JI4 B;  5H2F Z;  3RYH B;  1BT8 A;  2ZQM A;  1N33 B;  1QLE C;  3ZMU A;  1N36 O;  1EZJ A;  1L8D A;  1SF9 A;  3N2G A;  2CTW A;  3FX7 A;  5FL7 G;  2CK3 G;  1Y76 B;  2NN4 A;  1MNG A;  2B1I A;  3ASN C;  1THZ A;  4WBN B;  3FAV A;  1YDX A;  2LO1 A;  3L9D A;  3ZMT A;  1I94 O;  2LW7 A;  4QJF B;  1SQP H;  2W6I G;  1QVF U;  3JAW A;  4CS3 A;  1FXV A;  1ZAU A;  2ZE8 A;  3EVK A;  1SET A;  1V9P A;  3AG4 C;  3KCX A;  4QE9 A;  1YJN V;  2YIA A;  4FM2 A;  3HR0 A;  4JI2 O;  3TXQ A;  4B3R B;  4OX9 B;  4X62 O;  1RSO A;  2V4D A;  5KAF Z;  1VQM V;  1R6N A;  1NR1 A;  5JQG B;  4X1Y B;  1QNM A;  1BQ0 A;  1VP7 A;  5IWA O;  2UXB O;  1GM9 A;  1ZTE A;  2KKW A;  3D36 C;  4H33 A;  3MHS C;  2UUB O;  1AI6 A;  5KHJ A;  4DR2 B;  5LXT B;  1S0V A;  4TQD A;  2Y48 A;  1XL4 A;  2Q7G A;  1IX9 A;  4UB8 Z;  3JD3 A;  1PNK A;  4O2A A;  1PM9 A;  5JH7 B;  3GWK C;  5EZY A;  4KUM A;  1ZL8 A;  3D3Q A;  4UXN A;  5B3S B;  5LHI A;  1FD9 A;  2XAS A;  3JAK A;  4KHP B;  5J2T B;  4YY3 O;  3AG7 A;  1BSM A;  2Q9L A;  1KU9 A;  2XOK G;  4WFE A;  4PDM A;  2FYU H;  2L35 A;  1N8R W;  1R6K A;  2DYR B;  4PA7 A;  3QO7 A;  1XRE A;  1P7B A;  3CCQ V;  1Q43 A;  4U7O A;  1SQX H;  1GAX A;  4PV1 B;  5LYJ B;  3LNM B;  1JQ0 A;  3CC4 V;  4DR1 O;  2WWW A;  5CA3 A;  4FPP A;  1MZF A;  4UCS A;  1M93 A;  3JAT B;  2A3Q A;  4F6E A;  4PA4 A;  4CH4 A;  2F95 B;  2UXD B;  3K5N A;  1YVW A;  4MTO A;  1CEZ A;  4TWK A;  1XL6 A;  3WU2 Z;  4K35 A;  1TVK A;  4LFA O;  1HDJ A;  1OJH A;  2ADP A;  2FKX A;  2HEP A;  3DGE A;  5KAI Z;  5CB4 A;  3ZJZ A;  3ZX6 A;  3AG1 B;  5LGT A;  3ICX A;  1PNL A;  4IIJ B;  1N0J A;  1XHX A;  4AQY O;  4PJ0 Z;  2RJZ A;  3CX5 F;  2F93 B;  2KSD A;  2DQ3 A;  3UCS C;  1RPR A;  2UUC O;  3CC7 V;  4CZZ A;  3J7A U;  4FM0 A;  2OT5 A;  1XNR B;  2OCC B;  4GKK B;  2Y69 B;  2ZT9 B;  5IYZ A;  3H1K H;  4DO2 A;  2ZE7 A;  1SER A;  1PL0 A;  3AK2 A;  1Y74 A;  2OTJ V;  1KKD A;  5B3S C;  2YXH A;  2FB5 A;  2QM4 A;  2M7W A;  3K3W A;  4DV3 O;  2H94 A;  1HR0 O;  4MT8 A;  2CGO A;  4TV8 B;  3ZRV A;  5BY1 A;  2DYR C;  4BW5 A;  1YIJ V;  3AEI A;  2BE3 A;  2Z3Y A;  3DSQ A;  1RPO A;  2YC0 A;  1OCR B;  1TGO A;  2XHB A;  1MSW D;  1GN6 A;  2BTO A;  3WB1 A;  2UXX A;  3CRR A;  4DV2 O;  1PNM A;  2JEU A;  2PI4 A;  3T4D A;  2OIG A;  5LA6 A;  4X8A A;  4DR3 O;  4U3J B;  3ZED A;  1IUR A;  2ATK C;  4X66 O;  4LNU A;  4XDK A;  2KG7 B;  3DXR B;  1J95 A;  2R9I A;  2X6B A;  1DK1 A;  4NXM O;  2EIK B;  3HKB B;  1DF5 A;  5LP6 B;  3CE2 A;  1WLE A;  4LWS A;  1SA0 A;  4X9Q A;  3K9S A;  4GYC B;  2A06 H;  5KX5 A;  3AG1 C;  2M6Y A;  3RGB A;  4RWU A;  1JMK C;  3OW2 U;  4DUY O;  1R3L C;  1WP8 A;  4MW8 A;  3LSU A;  2HJD A;  3FKS G;  1YSC A;  4JI5 B;  2HFE C;  4XBF A;  3ZHV A;  4WFA V;  1FJG O;  1RP3 B;  1SQG A;  4O2B B;  2R9R B;  4FMT A;  2OCC C;  3CXC U;  5ITZ A;  4QPJ A;  1HNW B;  2Q67 A;  2Y69 C;  5B1O A;  1KQS U;  4PEL A;  1XMQ B;  1N4C A;  2JGD A;  4P9O A;  2E76 B;  1COW G;  2IH3 C;  2QGN A;  4CBC A;  1G6U A;  1FXK B;  1FYJ A;  1MSD A;  2UU9 B;  5EBL C;  2Q8V A;  1NZ6 A;  4FLV A;  1IXB A;  1K9M W;  4J42 A;  3LSS A;  2WLN A;  1PL4 A;  1H8H G;  4HNA A;  3T1Y B;  5B1N A;  1YEW A;  1OCR C;  1Q7Y W;  2CH7 A;  1F4M A;  2YXY A;  4K0K B;  5KA5 A;  2UUA B;  5L3E A;  1FFX B;  1I0H A;  1ZWI C;  2P90 A;  1PPJ H;  4LF4 O;  4B3S B;  3CJH A;  2N74 A;  5EYP A;  4O4L A;  5IJ9 A;  3OGI B;  5LMN O;  4PHZ A;  2B1G A;  3K5O A;  3HKC B;  2YIC A;  5A2Q N;  3HKD A;  2EIK C;  5LP6 C;  1B3Q A;  1YI2 V;  3D3I A;  4GX0 A;  3O65 A;  4DR4 B;  4I0X B;  2WSS G;  3CME V;  4W4K A;  1LUV A;  2IW5 A;  1VF6 C;  4DV1 B;  1XUQ A;  2ODM A;  2R9A A;  3JAL B;  3W7X A;  1EZV H;  1GH6 A;  3ZHQ A;  1XI1 A;  3CSX A;  4ZI7 A;  1H8E G;  1AJN A;  4DV4 B;  2AW9 A;  3UKM A;  4X20 B;  5E1A C;  1YIT V;  2CE4 A;  4NYK A;  1SES A;  1FXK C;  2EIM B;  2RNB A;  4P30 A;  1HP8 A;  3APO A;  1WA8 A;  2JEX A;  1B06 A;  2ZNI A;  3F7V C;  4BAY A;  3I5D A;  1QBZ A;  3R65 A;  4X64 O;  2LGQ A;  4JGS A;  5IDJ A;  1ZSP A;  3QF7 A;  4JI8 B;  5IYD O;  3RYF A;  2RDC A;  3G4S V;  5H6R A;  3B40 A;  3SPC A;  3RYI B;  2N05 A;  4JYA O;  2XAG A;  2ZIO A;  3ZRW A;  4JAA A;  3K9A A;  4CH3 A;  1WB7 A;  3CRA A;  1M5I A;  1NTZ H;  4ZHQ B;  2X6A A;  3G71 V;  3C3S A;  4F4L A;  3UT5 B;  1SQQ H;  2HHH O;  4QE7 A;  3CMA V;  3WB2 A;  3IAY A;  1JA8 A;  3E83 A;  4AHC A;  5F2V O;  2ZCE A;  4UV8 A;  1XNQ B;  3ETG A;  1G8M A;  3RVZ A;  5KLV H;  4MVR A;  4RO2 A;  1KUQ A;  3OFN G;  1JFF A;  3M7M X;  5CN0 A;  2LJ2 A;  3ZN0 A;  3B2E E;  4EB6 A;  4GX2 A;  5EBM C;  5GW7 A;  2XND G;  3CYO A;  3E8F A;  3G80 A;  5L3C A;  1W0J G;  3VQW A;  1VEW A;  1SZX A;  1K7D A;  1Y66 A;  1HW7 A;  3JAS A;  3QG5 A;  5BR8 O;  2EIM C;  1HNZ B;  2ETN A;  4I50 A;  3CCL V;  4HBN A;  4CC5 A;  3OAA G;  2ZE6 A;  2QKS A;  3K5L A;  1VQP V;  3RW0 A;  4LF9 B;  2QR4 A;  5B66 Z;  4Z1M G;  1KB9 F;  4PD4 F;  1XMO B;  4KFM A;  3SPH A;  4GCZ A;  4X1K B;  1AR1 B;  3NR7 A;  5EBW C;  2RCV A;  1RFY A;  3G6E V;  1R3J C;  2XAQ A;  2JJ1 G;  1O9H A;  5GTI Z;  1V55 B;  4YHH O;  4H0L B;  5J2U A;  1VQO V;  1MAB G;  3FYE B;  3GVM A;  1OCO B;  1KP3 A;  5KUK A;  3T1H O;  1NU1 H;  1AR4 A;  4YJ2 B;  3ABL B;  3JAR B;  3D36 A;  1Y4M A;  2ZDI C;  3QVN A;  4O4H B;  1VQ8 V;  4F6R A;  3UQ8 A;  4FVM A;  1N33 O;  2HG5 C;  2VWJ A;  4OXS A;  2F66 C;  3FB7 C;  2ZIN A;  1U96 A;  1WPX A;  2OTL V;  4CS2 A;  1VQ4 V;  1BMF G;  5CA0 B;  3OUS A;  1UFI A;  3ASO B;  2OWO A;  3RYH A;  4N21 A;  1GKF A;  3CP1 A;  4P9P A;  3E89 A;  1GN2 A;  2K1E A;  3E86 A;  2Q69 A;  3I56 V;  1NS1 A;  5JVD A;  3SPG A;  4JZG A;  3H9V A;  1US6 A;  3L71 H;  4FLZ A;  4NB5 A;  4LF8 B;  5CBH A;  4B3M O;  1Y76 A;  1N32 B;  4X65 B;  1S5H C;  4WFH A;  4WBN A;  2PY5 A;  4DV7 B;  4QGP A;  4LH7 A;  2NR5 A;  3K59 A;  4JTC B;  3JD2 A;  2HVJ C;  2YDE A;  3SYO A;  3ZHR A;  2EJ7 A;  4E2L A;  4FLY A;  4UVA A;  4MTF A;  1BGY H;  2LW1 A;  4O4J B;  4O4I B;  2IM9 A;  2VQE B;  3LSQ A;  1Q82 W;  1HNX O;  3CCV V;  4LR3 A;  3LDE A;  3CCJ V;  2ZM6 B;  4OX9 O;  2ZD9 A;  4MVU A;  3BY6 A;  4XDJ A;  2WLM A;  3L73 H;  1Q6I A;  3CS5 A;  4JI0 O;  3JSL A;  3BHP A;  2NLJ C;  3N2G B;  1I08 A;  1I5X A;  1V55 C;  5LOV B;  3OR7 C;  4PDL A;  5H5N A;  4B08 A;  5IYB O;  4BIZ A;  1OCO C;  1P4R A;  5CA1 B;  4X1Y A;  2UXC B;  4PDV A;  4UCR A;  4GKJ O;  1D2D A;  3ABL C;  3BFR A;  4X1I B;  5LXT A;  3B77 A;  4JTA B;  1NI8 A;  3K0G A;  4RUE A;  3JAW B;  4JI1 O;  1F51 A;  4I4T B;  1WN7 A;  2YS8 A;  2ZNJ A;  4JI3 O;  1L0N H;  4H44 B;  2Z0A A;  3ASO C;  3H01 A;  1S72 V;  4MSW C;  5JH7 A;  2YI8 A;  5GON B;  4GX1 A;  3PN1 A;  1OCZ B;  5DN6 G;  3MHH C;  5J2T A;  1NTM H;  3OUF A;  4PDR A;  3CXH F;  2CAZ C;  3KZI Z;  4D6T H;  1DLB A;  3OEH G;  2C2A A;  1K33 A;  3T4Z A;  2B9Z A;  4J7J A;  4YXW G;  4QIW F;  5LYJ A;  4X62 B;  1OZ0 A;  5K1X A;  4K8X A;  1S76 D;  4KL1 A;  1QR8 A;  1U97 A;  1GM8 A;  2LFS A;  2F4V O;  4FFK A;  3SJC C;  1KYO F;  4DUZ O;  5IWA B;  1VF5 B;  3JAT A;  2UXB B;  5C93 A;  3ABT A;  3CHX A;  3GB7 C;  3W7S A;  3OMN B;  2UUB B;  3BAA A;  4TV9 B;  4MTG A;  1YF2 A;  1DGS A;  3B8M A;  3E22 B;  5BZB A;  3CRC A;  3THO A;  2IJI A;  2QJ1 A;  2QKC A;  3CRM A;  1XNR O;  4LF5 O;  4DRX B;  1LR1 A;  4IYI A;  4U3F H;  2QTO A;  1VQ7 V;  2Q4P A;  4FZ1 A;  1EN6 A;  1MMM A;  3OR6 C;  5CBF A;  4LFC O;  4J7K A;  4I9Q A;  1GM7 A;  2VWK A;  3UO2 A;  5DED A;  4KP4 A;  3U10 A;  2DE0 X;  3OGC C;  5KMG A;  1OCZ C;  4DR1 B;  1K5Q A;  3H1J H;  2A9H A;  3VQX A;  1TVK B;  4TUY B;  4ZOL A;  1XBL A;  4TV8 A;  1I7F A;  3ML0 A;  1DF4 A;  3OTO O;  5HFL A;  1Z5W A;  4LFA B;  3IGA C;  1VQ5 V;  2QSA A;  4FLX A;  1S77 D;  1SC5 B;  2P22 C;  1IDS A;  1Q6H A;  1J5E O;  4AQY B;  2QKA A;  2YID A;  4U3J A;  4ASU G;  1AVM A;  1XEQ A;  1CP9 A;  2HP8 A;  4NTW A;  4PI2 A;  1K34 A;  2KG7 A;  3DXR A;  3Q4H B;  1Y74 B;  3HKB A;  5LP6 A;  3D8C A;  4TOI A;  4J9Z B;  1AI4 A;  1XIL A;  1XOU A;  5FNV A;  2DWD C;  3CCU V;  4L8J A;  3CCS V;  1P84 F;  1LNQ A;  2BTQ B;  2GTA A;  2P4V A;  4DK0 A;  1PP9 H;  1QR9 A;  1V54 B;  3BCC H;  4DV3 B;  1YXB A;  1HR0 B;  4JYB A;  1E1Q G;  4O2B A;  4JI7 B;  5LA6 B;  4UCU A;  3E8B A;  5BMV B;  4DV2 B;  3SR2 C;  3X2Q B;  2P5O A;  4FIP C;  4IHJ B;  5LMU O;  1FXK A;  4YJ3 B;  1R73 A;  5EC1 C;  3T1Y O;  3GWO A;  4LWS B;  3ZRS A;  4X66 B;  4DV5 O;  2KB1 A;  5JWP A;  3TXS A;  4Q6G A;  5KX5 B;  3RYC B;  4LF6 B;  4NXM B;  2ZR3 A;  1EFR G;  2WA3 A;  3SYA A;  2AZ2 A;  1YZB A;  1AIL A;  2Q0O C;  2JK5 C;  2JGU A;  5L3G A;  1QCE A;  3CB2 A;  4LF7 O;  1FFX A;  4I55 B;  2XAJ A;  3STZ C;  3N27 A;  1GTO A;  3ZIA G;  5ITZ B;  2PTM A;  4DUY B;  3R66 A;  3FB6 C;  3NXS A;  1UPG A;  2E5L O;  1G4Y B;  5FPO A;  3ABK B;  5FLX N;  3K57 A;  3HKC A;  5EIB C;  2JGD B;  3BPZ A;  2AHZ A;  4W4L A;  4I5S A;  5EIB D;  3SJB C;  2OIE A;  1NR7 A;  5DM6 V;  1IVS A;  2EIJ B;  1N34 O;  2VS0 A;  1B04 A;  3FB5 C;  4I0X A;  4NKG B;  3ZRX A;  4LBE C;  1TUB B;  2RMK B;  2XAF A;  4J41 A;  3OT7 A;  1Z2G A;  3N2K B;  1JJ2 U;  4B3T O;  1V54 C;  3ZMS A;  3JAL A;  1Q81 W;  4J11 A;  3AK1 A;  2X7R B;  2Q68 A;  1D5A A;  4DR7 O;  3L74 H;  2GUZ B;  3CJH B;  4X20 A;  5EYP B;  1IBL O;  1A32 A;  2AXT Z;  5IJ0 B;  2DJV A;  2DMX A;  3SPJ A;  1B6Q A;  3X2Q C;  3AK3 A;  3HPL C;  1JJO A;  1Z5V A;  4FM1 A;  1BHB A;  5AG2 A;  1W0K G;  3H1H H;  2GHY A;  2BSK A;  3A0R A;  5LMN B;  2JJ2 G;  4EKW A;  1K92 A;  4JAS A;  2Z5U A;  2B5U A;  1IBK O;  2WLH A;  4JF3 A;  1WJZ A;  4PA9 A;  2YUA A;  4FLT A;  4DV0 O;  1FAF A;  4ZBM A;  3STL C;  1Q5O A;  4ZI7 B;  1BQZ A;  1OCC B;  2L6L A;  5JCO C;  1JPX A;  4Q20 A;  3K03 A;  5L3F A;  1IBM O;  3OM3 B;  5IY5 B;  5IE9 A;  2VQF O;  3CPW U;  1ROP A;  4UV9 A;  4LCU C;  3L75 H;  4RAI A;  1X59 A;  4QNH B;  2EIJ C;  2ITC C;  2ZDI A;  4H13 B;  4DV6 O;  2EX3 A;  2UXN A;  3K04 A;  4FJC C;  3MD0 A;  2KQX A;  3C3T A;  1AP5 A;  1ZLZ A;  2E75 B;  2IH1 C;  3B4S A;  1QLN A;  4UFZ A;  3HKE B;  4NXN O;  4JZ2 A;  2YSU B;  4YIO A;  3SYC A;  1P7G A;  1VIB A;  1KEC A;  1NVP B;  3RYF B;  4X64 B;  3E2E A;  1KMI Z;  1M56 B;  3KCY A;  2MK3 A;  4OPH A;  4EFB A;  2WLJ A;  4JI6 O;  2IBZ H;  3S3X A;  4KXR A;  4WF9 V;  5KHI A;  3P32 A;  3ZBH A;  3ETQ A;  2GV9 A;  1SQF A;  2GDS A;  2Q5Z A;  2NNU A;  3LNN A;  4DR5 O;  4DR6 O;  3PJS K;  3JD1 A;  2XUM A;  3FB8 C;  2ZR2 A;  4FFB A;  2HHH B;  2WLL B;  1SQV H;  1H2L A;  1PV0 A;  4CH5 A;  1KC8 W;  1HWY A;  2YEV B;  1Q3E A;  4LFB B;  1QU7 A;  1OCC C;  2P7T C;  3OMI B;  4IL6 Z;  5IY5 C;  2WLI A;  2QWP B;  2WAM A;  1JR9 A;  3JAS B;  2LP7 A;  2HR3 A;  4JV5 O;  5C8Y A;  4MS2 A;  3H1I H;  3WB0 A;  4PA6 A;  1WPB A;  4YJ2 A;  4NTX A;  4I50 B;  4G27 B;  3FYI B;  4FK5 C;  3CWB H;  1M9N A;  2X6C A;  4XDL A;  3OE7 G;  4R8C A;  2W6J G;  4AIL C;  5CA0 A;  2F43 G;  3TCU A;  4JI4 O;  1AB3 A;  3IJ4 A;  2W0X A;  1EN5 A;  3RFR A;  3F5T A;  3QO5 A;  3G6B A;  1N32 O;  2EIL B;  1M56 C;  3IC9 A;  4JAU A;  2K9P A;  3I55 V;  1NVP D;  4MVM A;  2YI9 A;  2IJJ A;  2QDO A;  4HAM A;  2EZO A;  5J2U B;  4K8Z A;  1ZX3 A;  1WNS A;  3OMA B;  5KHG A;  1S3J A;  1BE3 H;  3CD6 V;  4UCT A;  1AJP A;  3VQV A;  4YHH B;  1M1K W;  4WFB V;  4O4I A;  2VRZ A;  1T5E A;  2P06 A;  2CDY A;  4N23 A;  2Y4U A;  1SRY A;  3T1H B;  1AJQ A;  2JDI G;  4MTX A;  4DK1 A;  2HLD G;  1RM1 B;  1N0N A;  5DEC A;  2V1D A;  4J9Y B;  1K5S A;  2QM7 A;  4YIP A;  5CMU A;  2UXC O;  2Y4T A;  3P30 A;  4I9W A;  4HZ3 A;  3J81 N;  1ENV A;  1LUW A;  4B3R O;  3B8N A;  5LOV A;  2OCH A;  5JVD B;  1AR5 A;  2X0L A;  2W0F C;  3ETD A;  4RUF A;  5KUM A;  1W59 A;  3OD4 A;  1K4D C; 
#chains in the Genus database with same CATH homology
 3OGC C;  2QM8 A;  1Q7Y W;  1F4M A;  5KA5 A;  1OCZ C;  3ABU A;  5L3E A;  4LC1 A;  3VBB A;  1ZWI C;  2YEV A;  2P90 A;  1GO3 F;  1K5Q A;  2ITD C;  5LHH A;  1FS0 G;  2A9H A;  5LGU A;  3LUT B;  4GT1 A;  1GK9 A;  3JD4 A;  2B1G A;  2HKO A;  2QA4 V;  3ML0 A;  3UM7 A;  5EK0 A;  3SYP A;  2HVK C;  1DF4 A;  5HFL A;  2EIK C;  1QLE B;  3SJQ C;  3IGA C;  3EFF K;  1YI2 V;  1MG1 A;  3IC7 A;  1NKD A;  3D3I A;  1VQ5 V;  2EIL C;  4GX0 A;  3ETE A;  2P67 A;  4JTD B;  4RQF A;  1S77 D;  4R7C A;  3BEH A;  4X88 A;  4U7N A;  3HB3 B;  4PA3 A;  2WSS G;  1BL8 A;  2DWE C;  3CME V;  2IW5 A;  1K97 A;  4ASU G;  1CP9 A;  2GSM B;  3ASN B;  1DTO A;  3TET A;  2EIN C;  3W7X A;  1PKX A;  3K08 A;  1K34 A;  3EHB B;  1K4C C;  2AHY A;  2ZXW C;  1FXH A;  4MVO A;  1ARO P;  1VQL V;  4G28 B;  3T1C A;  3LDC A;  1H8E G;  1AJN A;  4J9Z B;  1AI4 A;  1MOF A;  3ZN1 A;  3UKM A;  5E1A C;  3WFV A;  3F5W C;  1SZT A;  2DWD C;  1YIT V;  3CCU V;  3CCS V;  1QVG U;  1R3K C;  1LNQ A;  1RM1 C;  1SES A;  3M99 B;  1FXK C;  2EIM B;  3AG4 B;  2WLI B;  1QR9 A;  1V54 B;  4P30 A;  1K8A W;  2FTK A;  4RQE A;  2JEX A;  4UVB A;  1GMG A;  5CBG A;  4JPR A;  4JYB A;  1E1Q G;  3OEE G;  3ZMZ A;  1F4N A;  1JOY A;  3F7V C;  4BAY A;  4R50 A;  1FFT B;  4TT3 G;  1QBZ A;  3R65 A;  5B1A B;  4JGS A;  5IDJ A;  3RBZ A;  4DXW A;  2HJF C;  1OHH G;  4L87 A;  3E8B A;  5IYD O;  3JD0 A;  3LDD A;  4MW3 A;  3X2Q B;  4FIP C;  1VQ9 V;  1YTF B;  2EJR A;  1YJ9 V;  2DW4 A;  3ZMV A;  5H6R A;  1EBO A;  3G4S V;  3CCE V;  3SPC A;  1FXK A;  3E8G A;  1R73 A;  1VQK V;  5EC1 C;  2XAG A;  4ZKI A;  3GWO A;  3ZRW A;  1KD1 W;  3K9A A;  3ZRS A;  5H6Q A;  1JCH A;  4G2K A;  4H37 A;  2KB1 A;  1JVM A;  3VOU A;  3SYQ A;  2X6A A;  3G71 V;  4F4L A;  2ZR3 A;  1EFR G;  4QE7 A;  2ZQM A;  3CMA V;  1QLE C;  3SYA A;  3ZMU A;  5HFM A;  1EZJ A;  3E83 A;  2IJH A;  3KG2 A;  2IU0 A;  2JK5 C;  5L3G A;  1QCE A;  4UV8 A;  3ETG A;  1G8M A;  3RVZ A;  2XAJ A;  4MVR A;  3STZ C;  4RO2 A;  1GTO A;  3ZIA G;  5FL7 G;  3OFN G;  1TUE B;  1L1F A;  2CK3 G;  3FB6 C;  3NXS A;  1NBM G;  1G4Y B;  2B1I A;  3ASN C;  3AG3 B;  5CN0 A;  1THZ A;  3ABK B;  3ZN0 A;  3K79 A;  1I5Y A;  2AHZ A;  4WFG A;  4I5S A;  3ZMT A;  4GX2 A;  5EBM C;  5GW7 A;  4GX5 A;  1E1R G;  2XND G;  4QJF B;  1NR7 A;  3CYO A;  3E8F A;  2EIJ B;  5DM6 V;  2W6I G;  1W2B U;  1QVF U;  1K3E A;  3FB5 C;  1NQT A;  5L3C A;  1FXV A;  1W0J G;  2BOB C;  2Q6A A;  3ABM B;  2BOC C;  3ZRX A;  1K7D A;  1Y66 A;  1SET A;  4LBE C;  3JCZ A;  2XAF A;  1JJ2 U;  3AG4 C;  2EIM C;  1V54 C;  3ZMS A;  1Q81 W;  3CCL V;  2IJK A;  4QE9 A;  2EBO A;  1YJN V;  3OAA G;  2QKS A;  2X7R B;  2Q68 A;  1VQP V;  3RW0 A;  3AG2 B;  5B1A C;  4Z1M G;  1NH2 B;  1VQM V;  1R6N A;  1NR1 A;  3W7U A;  4KFM A;  3SPH A;  4GCZ A;  1GM9 A;  3SPJ A;  1B6Q A;  3X2Q C;  1AR1 B;  1KP2 A;  4H33 A;  4TSF G;  3MHS C;  5EBW C;  3HPL C;  1AI6 A;  1YTF D;  1BHB A;  1W0K G;  3G6E V;  1R3J C;  2GHY A;  2XAQ A;  1S0V A;  1YHQ V;  2Y48 A;  2JJ1 G;  2JJ2 G;  3A0R A;  3WG7 B;  1XL4 A;  1V55 B;  4EKW A;  1K92 A;  1VQN V;  3T2M A;  4JAS A;  5KA6 A;  3JD3 A;  2Z5U A;  1MAB G;  4X89 A;  3FYE B;  1VQO V;  1PNK A;  1JX9 A;  2B5U A;  1OCO B;  1KP3 A;  5KUK A;  4WCE V;  4KUM A;  2WLH A;  4UXN A;  1PD3 A;  4JF3 A;  2DYS B;  3ABL B;  4PA9 A;  5B3S B;  5LHI A;  3D36 A;  1Y4M A;  2XAS A;  2ZDI C;  4QPK A;  3CC2 V;  4ZBM A;  1VQ8 V;  3STL C;  2XOK G;  5L3B A;  2HG5 C;  4WFE A;  1OCC B;  4OXS A;  4PDM A;  1N8R W;  1JPX A;  3FB7 C;  1R6K A;  2DYR B;  1WPX A;  3DTU B;  3K03 A;  4PA7 A;  4Q20 A;  3QO7 A;  5L3F A;  2OTL V;  1VQ4 V;  3OM3 B;  1BMF G;  1P7B A;  3AG3 C;  3CCQ V;  5IY5 B;  3OUS A;  4U7O A;  3ASO B;  4N21 A;  2LFR A;  3CPW U;  1ROP A;  4UV9 A;  4LCU C;  1GKF A;  4RAI A;  3LNM B;  3CP1 A;  4P9P A;  1JQ0 A;  4QNH B;  3K0D A;  2EIJ C;  3E89 A;  2K1E A;  3E86 A;  3CC4 V;  2WWW A;  2Q69 A;  3ZCC A;  2ITC C;  2ZDI A;  3QO8 A;  5CA3 A;  4FPP A;  3I56 V;  3K06 A;  5B1B B;  3ABM C;  3SPG A;  2UXN A;  3K04 A;  4FJC C;  3JYC A;  3MD0 A;  4PA4 A;  1E79 G;  5CBH A;  1S5H C;  4WFH A;  2IH1 C;  4MTO A;  1QLN A;  1CEZ A;  1F23 A;  4TWK A;  4JTC B;  2D3O W;  3JD2 A;  2HVJ C;  1XL6 A;  2YSU B;  3CCM V;  3SYO A;  3SYC A;  4E2L A;  1NVP B;  1KEC A;  3SPI A;  4UVA A;  3DGE A;  4MTF A;  3E2E A;  3ZJZ A;  3AG2 C;  1M90 W;  1M57 B;  2WLK A;  3AG1 B;  2P6J A;  5LGT A;  1M56 B;  2H8P C;  3LSQ A;  1Q82 W;  1PNL A;  4MVZ A;  2MK3 A;  3CCV V;  5J9P C;  3LDE A;  3CCJ V;  2WLJ A;  2ZD9 A;  1NH2 D;  4MVU A;  3BY6 A;  4XDJ A;  4WF9 V;  2DQ3 A;  2WLM A;  4HYO A;  1RPR A;  3P32 A;  5LHG A;  4JAV A;  3CC7 V;  4CZZ A;  2OT5 A;  3IFX A;  2NNU A;  3WG7 C;  2OCC B;  2NLJ C;  1I5X A;  2QE7 G;  1V55 C;  4UUJ C;  3OR7 C;  2Y69 B;  4MVQ A;  4PDL A;  4R6Z A;  3RVY A;  3PJS K;  5IYB O;  3JD1 A;  3FB8 C;  4DO2 A;  4BIZ A;  2ZR2 A;  2WLL B;  3F7Y C;  2DQ0 A;  1OCO C;  1P4R A;  5LGN A;  1SER A;  4PDV A;  1PL0 A;  2OTJ V;  1KC8 W;  1HWY A;  2DYS C;  3ABL C;  1KKD A;  5B3S C;  2YEV B;  2M7W A;  3K3W A;  2WPD G;  1NJI W;  2H94 A;  3E8H A;  1OCC C;  4MT8 A;  3ZRV A;  2P7T C;  2DYR C;  4BW5 A;  3B77 A;  4JTA B;  1YIJ V;  3K0G A;  3AEI A;  3OMI B;  4BIU A;  4RUE A;  4UVC A;  5L3D A;  2V7Q G;  2Z3Y A;  1F51 A;  5IY5 C;  1RPO A;  1ORQ C;  3ASO C;  3H01 A;  1S72 V;  2WLI A;  1YJW V;  2WAM A;  4MSW C;  1BHA A;  1OCR B;  2LP7 A;  1MSW D;  2A0L A;  2HR3 A;  4GX1 A;  4MS2 A;  2UXX A;  4PA6 A;  1OCZ B;  1PNM A;  2JEU A;  3E35 A;  2PI4 A;  2A79 B;  5DN6 G;  4G27 B;  3T4D A;  3MHH C;  3FYI B;  5B1B C;  4X8A A;  4FK5 C;  5H9C A;  2JIZ G;  3OUF A;  4PDR A;  2ATK C;  3CCR V;  2XAH A;  1M9N A;  2X6C A;  4XDL A;  3OE7 G;  1K73 W;  1DLB A;  4R8C A;  4XDK A;  2W6J G;  3OEH G;  2F43 G;  2C2A A;  1K33 A;  3TCU A;  3T4Z A;  1J95 A;  4WFF A;  2R9I A;  2X6B A;  2EIK B;  4YXW G;  4QIW F;  1DF5 A;  3W7W A;  1WLE A;  3QO5 A;  1OZ0 A;  1CPY A;  1M57 C;  2EIL B;  2IU3 A;  1S76 D;  4P2Z A;  1QR8 A;  3AG1 C;  1H38 A;  2QEX V;  1M56 C;  3ABK C;  1GM8 A;  2LFS A;  4JAU A;  3I55 V;  1NVP D;  1AI7 A;  4MVM A;  3OW2 U;  2IJJ A;  5C93 A;  1R3L C;  3ABT A;  3GB7 C;  4HAM A;  3W7S A;  4MW8 A;  2EZO A;  1AI5 A;  3OMN B;  4MVS A;  2EZP A;  2EIN B;  3OMA B;  3FKS G;  1YSC A;  4XBF A;  2HFE C;  1S3J A;  2ZXW B;  4WFA V;  4MTG A;  3W7T A;  1Q86 W;  3CD6 V;  2R9R B;  1AJP A;  3B8M A;  2OCC C;  4FMT A;  3CXC U;  4QPJ A;  1M1K W;  2Q67 A;  2Y69 C;  5B1O A;  1KQS U;  4PEL A;  5BZB A;  4WFB V;  1R3I C;  2IJI A;  1IXM A;  4N23 A;  1VQ6 V;  4P9O A;  1SRY A;  5IYC O;  1AJQ A;  1COW G;  2IH3 C;  2JDI G;  4MTX A;  2HLD G;  1RM1 B;  4CBC A;  2V1D A;  4J9Y B;  1FXK B;  5EC2 C;  1H2G A;  4LP8 A;  1UJW B;  4JYC A;  1K5S A;  3ZRW B;  2QTO A;  1VQ7 V;  2QM7 A;  5CMU A;  3P30 A;  4I9W A;  4HZ3 A;  1ENV A;  5EBL C;  3OR6 C;  5CBF A;  2PI5 A;  3TK1 A;  3B8N A;  1K9M W;  1GM7 A;  5LBQ A;  3LSS A;  2X0L A;  2WLN A;  4KP4 A;  2W0F C;  3ETD A;  4RUF A;  5KUM A;  1H8H G;  5B1N A;  2WLL A;  1OCR C;  3QNE A;  1K4D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...