2Q6AA

Crystal structure of nak channel d66e mutant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
104
structure length
104
Chain Sequence
MLSFLLTLKRMLRACLRAWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGEGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into Ca2+ specificity in tetrameric cation channels.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Metal transport, membrane protein
molecule keywords Potassium channel protein
total genus 42
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2q6aA00
3FB7C 3TCUA 1V54C 4PA7A 4GX1A 2WLIB 2P7TC 4GX5A 4MVZA 1OCRC 5EC2C 3STZC 3F5WC 4KFMA 3SYCA 4EKWA 4H33A 3TETA 2H8PC 3SJQC 5CBGA 4LP8A 4QNHB 2X6CA 5EBLC 3KG2A 1R3IC 3OGCC 4WFGA 2WLJA 3T4ZA 4RUEA 4I9WA 3E83A 4MVQA 2EIKC 3RVZA 3ZJZA 3E8HA 5B1BC 4X89A 3LDEA 4JTAB 3SPHA 1S5HC 3SPCA 3F7VC 3FB6C 4JTDB 4WFHA 2WLHA 3OR6C 3SPGA 5EC1C 2X6AA 3X2QC 5CBHA 2Y69C 4GX0A 4R6ZA 3EFFK 4UUJC 2EIJC 1XL4A 2OCCC 2Q67A 2AHZA 2EIMC 2WLKA 3E8FA 4LCUC 1R3LC 4MVOA 3WG7C 5IY5C 2QTOA 2X6BA 2ZXWC 2ITDC 4GX2A 3RW0A 5EBWC 3ASOC 4PDLA 4LBEC 3RBZA 1J95A 4DXWA 1V55C 4PA9A 3OUFA 4OXSA 3AG2C 3HPLC 2NLJC 3FB5C 4P30A 4MW3A 2DYSC 5KUMA 3RVYA 1M57C 2YEVA 2A0LA 4XDKA 3AG3C 2EILC 2WLMA 2DWEC 4PA3A 5B3SC 3T2MA 2WLIA 3SYAA 3E8GA 1JVMA 3IFXA 2DYRC 2EINC 3OUSA 5BZBA 4G28B 3K08A 4MSWC 4PDRA 4RO2A 3K0DA 3E89A 5KUKA 3E8BA 3T4DA 3STLC 3K03A 4G27B 3T1CA 4PDMA 4TWKA 2W0FC 4MS2A 4XDLA 5E1AC 2ZD9A 4HZ3A 2HG5C 5EK0A 4R8CA 1G4YB 2WLLB 4MVUA 3SYQA 4RUFA 3PJSK 4J9YB 4RAIA 3LUTB 1R3KC 3SYOA 1P7BA 3JYCA 3AG1C 4MTOA 3SYPA 3BEHA 1OCOC 3LDDA 4QE7A 3ZRSA 2Q6AA 4QE9A 2ITCC 2R9RB 3SPIA 3ASNC 1K4CC 4R7CA 5EBMC 3IGAC 1QLEC 4XDJA 2Q69A 1ORQC 1LNQA 3SPJA 1BL8A 2HFEC 2IH1C 2HVKC 4R50A 2WLLA 4BW5A 3UM7A 2BOCC 3R65A 3FB8C 4HYOA 3GB7C 1R3JC 3AG4C 1K4DC 1OCZC 2A79B 2HJFC 3OR7C 4ZBMA 3E86A 2DWDC 4P2ZA 1M56C 4PA4A 3VOUA 2JK5C 2QKSA 4WFFA 3UKMA 2Q68A 3K06A 4X88A 1OCCC 1KKDA 1XL6A 4PDVA 3ABKC 4P9PA 3LNMB 5J9PC 3K0GA 2IH3C 2A9HA 3LDCA 4MW8A 2K1EA 4MTGA 4P9OA 4F4LA 5CBFA 2BOBC 4MVSA 3ABLC 4X8AA 5B1AC 4J9ZB 2WLNA 4WFEA 1ZWIC 2KB1A 2HVJC 2AHYA 4MVMA 4PA6A 3K04A 4MVRA 4MTFA 2ATKC 4CBCA 3ABMC 4H37A 4JTCB 3F7YC
chains in the Genus database with same CATH superfamily
3FB7C 1UJWB 3B8MA 2GHYA 2E5LO 1SKVA 5EC2C 1KUQA 1N4CA 4X1IB 4QPJA 3UCSC 1VF6C 4RUEA 4I55A 3E83A 5JJJB 1D2DA 2UXXA 4DR5B 5IWAO 1AROP 1NH2D 4TUYB 3SPCA 1GN2A 2UXBO 2PF4E 4LF9O 4CH3A 3K5NA 4R6ZA 4NXMB 1B06A 4ZOLA 2OIGA 4JYCA 4UCRA 1E1RG 4FLZA 4DUZO 4TUYA 1FFTB 3ML0A 4LF4B 2A0LA 1NR7A 4O4HB 1F4NA 1XMQO 4XDLA 1NH2B 2XT9A 1XHXA 2Q7HA 1V9PA 2UUBB 4DR4B 1VQ7V 4YHHO 1YHQV 3A0BZ 3UT5A 4U3JA 3SYPA 5EIBC 1OCOC 1BHBA 3K5OA 2R9RB 4W4LA 1S72V 4YJ2B 4JF3A 2QDOA 1QLEC 2ZNIA 4DR2O 2IH1C 2A7WA 2CGNA 3OAAG 2FYUH 4L8JA 3FB8C 3JARA 4U7NA 2ZT9B 3G6EV 4P2ZA 2YIDA 3KZIZ 2A06H 2UXCO 5J9PC 1AP5A 4GKJB 2ADQB 1Q8IA 5B3SB 2LGWA 3HKCA 5J2TA 4PD4F 4UCSA 2R72A 3JARB 4IT5A 2LJ2A 3ABUA 4UVBA 3TCUA 1H2KA 2VQFO 2LQTA 1JX9A 5KHKA 3F5WC 2D2CB 3J7AU 4H33A 3OT7A 1XNRB 3OGCC 4FLVA 1I5YA 2IBZH 4O4IA 4J7KA 3IC9A 3CCJV 3RYCA 2E76B 1KKCA 4IHJB 1MSDA 1VQ8V 2HEPA 1FS0G 2XHBA 3P32A 5LXTA 1TVKA 1Z2GA 2EIMC 2OWOA 5B1NA 4RQFA 1M57B 4LF7B 2ZXWC 2JEUA 1H2MA 5EBWC 3RBZA 3ZMZA 2F4VB 1NBMG 5KUMA 3Q4HA 2QWRB 1OCZB 2WLMA 4DO2A 5BZBA 5IJ9A 4FFBA 3SDLA 4DV0B 4JI1O 3T4DA 5KHHA 1QR8A 3QO8A 1GN4A 3JASB 4I0XA 4ZHQA 2GDSA 3Q4HB 1Z5VA 1P7BA 3FYIB 3T1YB 2QA4V 1PL4A 1GO3F 1MA1A 3RYFB 3LDDA 3CXCU 1SRYA 5L3FA 1FAFA 1JFFA 1M5IA 2IJIA 4LFAB 1QHTA 4OX9O 4PI0A 2YI8A 1ORQC 1BL8A 3AK2A 2WLLA 4X9QA 4YJ3A 4IIJB 1K4DC 2A79B 3E86A 4DV6O 5BR8B 2Q68A 1SERA 4O2AA 2Q4PA 1K3EA 2HLDG 2R9IA 1PL0A 3A8TA 2KQXA 3UO2A 1SETA 4PA6A 1YITV 5JQGA 3M7MX 1IX9A 3FFQA 5BMVB 1GK9A 3F7YC 2H94A 3L73H 1F7YA 4AI8A 3H1IH 5LP6B 1JA8A 2X6CA 3LSSA 1VQ5V 3T1HO 1NU1H 2EBOA 4D6TH 5B1BC 1TAEA 4QIWF 5HFMA 1OHHG 1S3JA 4E4EA 4DUYB 3K9AA 2UUCO 1S5HC 1L8DA 3ZS8C 1K33A 4IGGA 3W7UA 4X1YB 2B9ZA 2Q7EA 5LMNO 3JALA 2EIJC 2NNUA 3BA8A 4AQYB 1FD9A 4B3TB 2QTOA 4XBFA 3W7WA 2E3CA 3HKCB 1OCOB 1V55C 2Q73A 3AG2C 1WLEA 4K0KB 5ITZB 2YEVA 4UCUA 1WB8A 3N2KA 2EILB 3PN1A 3SYAA 1S77D 4G27B 4JI5O 3AK3A 3K5LA 1BHAA 4MT8A 1G4YB 3JD1A 2UU9O 1Q6IA 2AXTZ 3ZRWB 1GM7A 3OW2U 3CRQA 3ZRSA 1K9MW 4JI0O 2BSKA 1MG1A 4IHJA 4H13B 4HBNA 1SQPH 2NR5A 4NTWA 1WP7A 3RWRD 2BOCC 1R3JC 4JI5B 2OIEA 2GUZB 4GUNA 2UXNA 4DRXB 5LHGA 2YIBA 4MTGA 3ABLC 1GAXA 2W6IG 2MW2B 3OMAB 2AHYA 1GN6A 3GWOA 2DYSB 3K04A 1N33O 4I9QA 1DLBA 1AJQA 3WB0A 1YTFD 1DK1A 3K57A 3TETA 1P84F 1E79G 2WLJA 3OTOO 1WA8A 3SR2C 1J5EO 3C90A 4PHZA 5CB4B 4X89A 3UQ8A 5KAFZ 1G6UA 5LYJB 4J41A 4UUJC 5CMUA 1PP9H 1R3LC 1YIJV 2EULA 4FM0A 2YSUB 4UCOA 1EN6A 2X6BA 2PI5A 3S3WA 2R70A 3W7TA 4ZKIA 5LBQA 2P4KA 1V55B 2AGAA 3SGIA 1ZL8A 2UUAO 3BFRA 4P30A 5J2UB 2CAZC 1JMKC 1URFA 3U0ZA 4O2BB 2CUGA 1SS3A 4JI7O 4O4JA 3H1LH 4TSFG 3J81N 2KSDA 3RGBA 2VQEB 1ZL8B 4B3SB 1BGYH 4LF9B 4LFAO 4FVMA 3CXHF 5B1BB 2UXBB 1GTOA 2Q6AA 4DR5O 2DN9A 2YIBD 3JATA 4TQDA 4NXNB 4WF9V 1KECA 4U3JB 1EN4A 2JK5C 4WFFA 4X88A 3N2KB 5IYBO 3K0GA 2A9HA 3DC6A 3VQVA 4WFEA 5H6QA 3ETEA 4KL1A 4JI7B 4O4IB 5LMNB 1QBZA 2Z5UA 4KXRA 3CJHA 1N36B 4U3FH 4KFMA 5KA6A 2H8PC 4QNHB 4JZGA 4WFGA 2K9PA 3N27A 4DYLA 5E79Z 5GONA 1XMOO 1P49A 5IYCO 2VQEO 2QE7G 5EC1C 3OE7G 3VQWA 5CA1B 2O57A 1SA0A 5KHGA 3ZHUA 4MVOA 3RFRA 4GX2A 4PDLA 1FXKB 4IYIA 5HFLA 2FTKA 3HPLC 4CH6A 5IT9N 2JJ2G 1ZLZA 2LFSA 1N32B 3DXRB 4EB6B 2EIMB 2EINC 3KCYA 1UPGA 3MDSA 1XHZA 1QVGU 3K03A 1SQGA 3ABMB 4YXWG 1K34A 5EK0A 2WLLB 4DR2B 1M4UA 2BTQB 4EB6A 5KHJA 1GMGA 4D7SA 4TV8B 2X0LA 3WFVA 4F6EA 1M9NA 1HP8A 2CTRA 3APOA 3CSXA 5EYPB 5BXZA 1HNXB 5J2UA 1VIBA 4LC1A 2EZOA 5KLVH 1R6KA 1XNQO 5KHIA 5LP6A 2IH3C 2K1EA 4LF4O 4F4LA 3MHSC 5CBFA 5L3CA 4LF7O 3JAKA 4WBNA 2Q9LA 2WLNA 3L75H 4DUZB 1IBKO 2QM4A 4JI3O 4NYKA 5A9GA 4UVAA 1XQ8A 2OYQA 2N05A 4NB5A 4K0KO 4HAMA 3BY6A 1B04A 1PNMA 1H8EG 1HNXO 4LFCB 3SJBC 1R3IC 3T4ZA 3CCLV 1MZEA 4F6RB 4UVCA 1N34O 2ZQMA 3CHXA 3FB6C 4JTDB 4FLYA 4NXNO 3R66A 3WB2A 1Y67A 3X2QC 2W6JG 3CMAV 1XL4A 2Q67A 2WLKA 4CC6A 2P22C 1X4TA 1Q6UA 2DJVA 3B77A 3ASNB 1BQ0A 2LW7A 1NTMH 2IM9A 1Q5OA 4YY3O 1YXBA 4LF6O 1IVSA 3EVKA 1M93A 4I50A 3AG3C 2WWWA 1FXVA 3T2MA 1OZ0A 3TXQA 5B1AB 4I4TB 1JVMA 4G28B 5KUKA 1K5SA 3P3NA 4JI2B 4TWKA 1VQ6V 4GKKB 2RMKB 1XI1A 3P3PA 3BHPA 4DR7B 3LUTB 1E1QG 3KKYA 2YDEA 1Z5WA 1HDJA 1KB9F 2XAGA 3ZEDA 2DOSA 4FFKA 3SPIA 4KP4A 2ZDIA 1K4CC 1VQ4V 2OT5A 1JJ2U 1SA0B 3FD9A 5LXTB 3H1HH 1DTOA 5FLXN 3GB7C 4CH5A 2UXDO 4BW9A 1WPBA 1G8MA 3ZMSA 1RP3B 4JI2O 1YJNV 1WNSA 4FPPA 2JS5A 4P9OA 4UFZA 2RJZA 3OFNG 4CS4A 2QWOB 4PI2A 4MTFA 2ATKC 4FZ0A 3HKBA 1Y4MA 4NXMO 4YY3B 4ZHQB 1VQMV 2Y0IA 2XAJA 3HKEB 1TGOA 2HKOA 4X65O 3RVZA 3O65A 3ZIAG 2P6JA 1I08A 3FX7A 3H1KH 4FJCC 3B8NA 2QWQB 4YJ3B 4WFHA 5EYPA 3K5MA 3X2QB 3CRMA 2OCCC 2AHZA 1YVWA 4UXNA 2GSMB 1B6QA 1PNLA 1XOUA 1XNRO 3N2GB 1NZ6A 3FB5C 1LUVA 3D3QA 2P67A 2DWEC 2YXHA 3LSQA 1AILA 4JI4B 2PYLA 3OUSA 4PDRA 3I5DA 4Q6GA 2RNBA 1F51A 4UB6Z 5LL6Y 2JJ1G 1AI6A 4Z2WA 3CRAA 2PYJA 1O9GA 1TUBA 2ILMA 2LFRA 4L87A 4WFBV 1XNQB 3JSNA 4QE7A 1MMMA 4NKGB 1Y66A 2CH7A 3K58A 2UXDB 4X1YA 2Y0PA 5DECA 3WG7B 2PTMA 1K5QA 1K7DA 2P90A 2XAQA 3CC4V 1ZSPA 1I94O 2CGOA 2GTAA 2QSAA 1KBHA 3ZMTA 3JSLA 4FLTA 2YUAA 5GW7A 5FPOA 1I94B 4X62B 1EN5A 1PV0A 2HJDA 4JYAB 4LWSA 1N32O 2D3OW 4CBCA 2EJ7A 3CCQV 3ETDA 4JTCB 1SQXH 5EZYA 5IJ0B 1V54C 4GX1A 4BIOA 4Z1MG 4FFBB 2BSKB 5L3BA 5BR8O 2E75B 2EIKC 2ZE8A 2JGDA 3OTFA 5CN0A 2Q0OC 3CJHB 1AR1B 1O9HA 3OR6C 2R9AA 4JI0B 2Y69C 4FZ1A 4GX0A 1SQBH 4FLUA 1A32A 2ZR3A 2QEXV 2RQ6A 1NTZH 1Y76A 2ITDC 4DV5O 1AJPA 5GONB 1N36O 4I0XB 4YIOA 4FMTA 1EZVH 1PNKA 5DM6V 3HKBB 2DE0X 1S0VA 3RYFA 2LW1A 3H1JH 1HNWO 4MSWC 4DV4B 4X1IA 1ZAUA 1G1XB 3CX5F 2ZD9A 1Q81W 4B3TO 2FL4A 5C8YA 3THOA 5JVDA 4TT3G 1VQOV 4GYCB 1KP3A 3OGIB 1IURA 4IIJA 2B5UA 4AQYO 1OCRB 2HFEC 5H9CA 1JOYA 5C8YB 4TV9A 4DV2B 2XNDG 5LGNA 2C2AA 1VP7A 3U11A 2P5OA 5BMVA 2BTQA 4DK1A 5LGTA 3CRCA 5IE9A 1W2BU 3T1HB 2L6LA 4HNAA 4O2BA 2WA4A 1GM9A 4B3SO 3QG5A 4H0LB 1H2LA 3ETQA 3ABMC 2YEVB 1IXMA 2XASA 1XBLA 2EINB 2WLIB 3CE2A 2QM7A 4BR6A 4B08A 4DR3B 4IL6Z 5GTHZ 3JALB 4DV7B 3G80A 1Y74B 3JAWB 2W0XA 3W7XA 1CPYA 1YZBA 2BTOA 1RPOA 4DV6B 4K8XA 3QO7A 2X7RB 4JYAO 5JJEB 4K35A 4YIPA 3GWKC 3OEEG 4W4KA 5LOVB 3T1YO 3LSUA 3JD2A 5IY5C 2DQ3A 4JGSA 1N0JA 2Y69B 4B7KA 3B2EE 5JWPA 4PA9A 1J5EB 4X1KA 5H2FZ 1WPXA 3RVYA 1N8RW 1N34B 3OD4A 2GBOA 1FJGO 2VWKA 3BA9A 3HR0A 4ZIBA 2HP8A 4RUFA 3ZHTA 3KCXA 2ETNA 4JI6O 2ZIOA 3EHBB 3RYCB 1SQVH 4AHCA 4DR6O 1NS1A 1PPJH 4OPHA 2VS0A 4EFEA 2CTQA 1YSCA 1VQKV 1FXKA 1SC5B 2PI4A 4GT1A 4ABMA 2F66C 1NTKH 3UO3A 5CA3A 3L72H 3L71H 4C7UA 3ICXA 2KG7B 1R73A 4MW8A 4X8AA 4DR6B 1HR0B 1NKDA 2HVJC 4MVMA 4JI6B 3QVNA 1JCHA 1RM1C 2QJ1A 4JI3B 4ZI7B 3TXSA 1YTFB 4B3RO 3EXAA 1WJZA 1AB3A 3G6BA 4LP8A 3KG2A 3W7SA 5CA0B 3CCMV 2UXCB 3P30A 3LDEA 4JTAB 3BCCH 2Q0AA 2IJJA 1WN7A 3ZN1A 2CE4A 4JPRA 1P7GA 4X66B 4X20B 3JATB 4N21A 3HKEA 4YHHB 1VF5B 2QWPB 3ETGA 5H6RA 1FXHA 1U97A 2ZE6A 4QPKA 3OTOB 1M1KW 4LFBO 1JQ0A 5LA6B 1JPXA 3RYHA 1FPOA 1KP2A 1XMOB 4CH4A 4RWUA 1LR1A 1SZXA 4NTYA 4NVPA 1R6TA 1LUWA 1MZFA 3M99B 5L3EA 3N2GA 5K1XA 3B4SA 3ZHVA 2N04A 3JCZA 3NXSA 3RYHB 3SYOA 2FKXA 3CD6V 4J80A 1D5AA 5KMGA 4R7CA 5D5QA 4DW1A 2AZ0A 4LF6B 3HB3B 2IJHA 4CZZA 1ZTEA 4HYOA 1F23A 2HJFC 1CP9A 1M56B 2P4VA 2CH7B 3ZHQA 4I50B 4FM1A 1OCCC 1XL6A 1VF7A 3TJTA 2ZE7A 2AW9A 3E2EA 1DGSA 2Z0AA 3L74H 2F4VO 1ROPA 4DV0O 3DGEA 3D8CA 2ZE5A 3LNNA 1H8HG 2HR3A 5IY5B 4LFCO 1ZX3A 3A0HZ 4G2KA 2XTAA 2M7WA 3JCUZ 1H2SB 5IJ0A 4LF8O 3HKDB 3F7VC 1Q90D 1XREA 4DV5B 1FFXB 3QNEA 2X6AA 4WCEV 5CBHA 3IC7A 4DRXA 1KD1W 4OGQB 3CCEV 3RT3C 3RYIB 1VARA 3TK1A 4MW3A 1WP8A 2ZXWB 4XDKA 2VWJA 1THZA 3ZHSA 2DMXA 2V1DA 4E2LA 3K08A 3E89A 1Q6HA 1RPRA 1SF9A 3J80N 3STLC 4GKKO 2XAHA 4B7EA 2P06A 4UB8Z 3OM3B 2HG5C 3SYQA 4X66O 4FLXA 3PJSK 2RDCA 1MNGA 2QKAA 1NI8A 4FIPC 3DC5A 4K3AA 1N33B 1BE3H 4QE9A 5LHHA 5EBMC 2ODMA 1OJHA 3IGAC 1IBLO 2Q69A 4ZOLB 3I56V 4OX9B 3VQYA 3OMNB 1YF2A 4GLXA 1OCZC 1Q86W 4ZBMA 4FLWA 3AK1A 2LO1A 5LA6A 3ABLB 5IYZB 2YIAA 4PJ0Z 1KKDA 3FKSG 1KYOF 1Q43A 4O4HA 2QM8A 5JCOA 1XMQB 3U10A 1BSMA 2IU0A 2BOBC 1QR9A 3BPZA 5B1AC 4O4JB 2UUBO 4DR4O 4TV9B 3DTUB 3JAWA 4J9ZB 5BY1A 1ZWIC 3WU2Z 4MVRA 5FL7G 3RN4A 4J42A 2DYRB 5A2QN 4I4TA 1YJWV 4GX5A 4MVZA 4EKWA 3G71V 1NVPB 4JI4O 2LP7A 5LMUB 4I9WA 2IJKA 2Y48A 1IDSA 1S76D 5JH7B 1KMIZ 1EZJA 4X1KB 1HNZO 4AILC 3K59A 3I55V 2Q5ZA 3ABKB 1FXKC 1EM1A 1QCEA 2A3QA 4WFAV 3H01A 4NTXA 1FJGB 1T5EA 2XOKG 4LBEC 2EIJB 4U7OA 3IAYA 3OUFA 1XEQA 2NLJC 1XUQA 2LGQA 2ZCEA 2EJRA 5EZYB 2UUCB 1MSWD 3CP1A 4PA3A 4X65B 1VMGA 1JR9A 2DYRC 3ZBHA 3T1CA 2ARHA 4PDMA 1VQPV 2VRZA 5E1AC 2QR4A 4GKJO 4ASUG 2GV9A 1YI2V 1EFRG 2ZDIC 4UV8A 1COWG 1CEZA 1U96A 2RN9A 2HHHB 4DV7O 4JI8B 2N74A 4JI8O 2IU3A 2UUAB 3CC2V 2L35A 1WAZA 3QTCA 4DUYO 2ZM6B 3SJAC 1M56C 1QLNA 1CXZB 1OCCB 5DEDA 4D7TA 5DN6G 1IXBA 2OCHA 3TGUH 4UCTA 5IJ9B 1JJOA 4JAUA 2EX3A 2JS3A 1IBMO 1ZUQA 1MABG 3JASA 5H5NA 1K92A 5JVDB 2JGUA 1NJIW 3CYOA 4Q20A 2YI9A 5CBGA 1N0NA 2B1GA 5EBLC 4GCZA 1JFFB 2YICA 1SQFA 2JEXA 1Q82W 4MVQA 2V4DA 1K8AW 2G38A 3SJCC 1YDXA 1SZTA 5LP6C 2EZPA 3ZMVA 3UT5B 2WLHA 1I0HA 4JZ2A 2CK3G 3SPGA 3CB2A 2QWNB 1KC8W 2ZKOA 3CRRA 2ZR2A 4B3RB 4LCUC 3OEHG 1NT2B 5CA0A 2PGGA 3JD4A 2WPDG 4HNAB 1AI4A 5KAIZ 3WG7C 5JJNB 3G4SV 3ASOC 3S3XA 5IYDO 2WAMA 3MHHC 4OXSA 5JQGB 2E5LB 5AG2A 1TUBB 3K3WA 1ENVA 2BCCH 2WLIA 3VQXA 1TUEB 1V54B 1GM8A 3A2FA 4O4LB 3E8BA 2JIZG 4DR1B 2PUSA 1DF5A 3E22B 2UU9B 4MVUA 4F6RA 4J9YB 1KQSU 1IBKB 3MD0A 5KX5A 4JAAA 1F4MA 1PM9A 5FPRA 4DK0A 3C3TA 2JGDB 4J11A 4XDJA 3SPJA 2ZIMA 1YEWA 4BAYA 3UM7A 3ASOB 4OPAA 2QTSA 4K8ZA 4UCVA 5KX5B 4FM2A 4PA4A 3FAVB 3ZN0A 2Z3YA 5ITZA 3K06A 2M6YA 3CCUV 3LNMB 2CTWA 2Y4UA 2XUMA 1YJ9V 2WSSG 1BT8A 4NR1A 1BS3A 3QF7A 2P7TC 2E74B 3BVOA 3NR7A 1Q3EA 1IZ3A 1NR1A 1I5XA 2EIKB 3O9OA 3ZJZA 1VQ9V 3SPHA 1HW7A 3BRCA 5KA5A 4DV1O 5L3DA 5IDJA 3ZRVA 1P4RA 4LH6A 3CS5A 1FKAO 1NQTA 2V7QG 3EFFK 3B40A 1W0JG 4I55B 3CMEV 4LR3A 3AG1B 3D36C 2OTJV 4KHPB 3IJ4A 4DV3B 4PV1B 5K1PA 1FFXA 2JVDA 4JAVA 5FNVB 1RM1B 3D36A 1VF6A 3CWBH 4JYBA 3JAKB 4WBNB 4X64B 1UFIA 4J7JA 1W0KG 3RYIA 4HZ3A 3CCRV 1EBOA 4BIZA 1XDCA 1L0LH 4CS3A 4JI1B 3A0RA 5IYZA 3M8AA 2CTPA 4LF5B 1QLEB 5F2VO 4LF5O 4RQEA 1HNZB 1LNQA 4BWAA 1BQZA 1M90W 1KU9A 2Y4TA 5J2TB 1H2GA 5LHIA 1AR5A 3OR7C 5C93A 2DWDC 1HNWB 5LOVA 4MTXA 2QKSA 4PDVA 4X64O 3ABKC 3MAQA 3LDCA 2XAFA 3K79A 4B3MB 2ZNJA 4N23A 1Y74A 1TA8A 4H37A 4DV3O 3K9SA 5JH7A 1Y6XA 2Q8VA 4PA7A 1RSOB 1OCRC 3SJQC 4PELA 4LFBB 1PD3A 3ZCCA 5LGUA 2F43G 2ZM6O 4KHPO 3ZRXA 3E8HA 3ZHRA 1XILA 1L1FA 2JDIG 2HHHO 1AR4A 1RSOA 1IBLB 4DR7O 2FMLA 5TISZ 1L0NH 4LNUA 1BCCH 1VEWA 3FYEB 4DV1B 3C3SA 2H3OA 3CCSV 1BMFG 2Q7GA 1J95A 1YCIA 2GUZA 2DQ0A 4TQFA 4EFBA 1M57C 2GTSA 1OV9A 4I5SA 5JCOC 5CA1A 3E8GA 2PY5A 1NVPD 3ZMUA 3B09A 4B3MO 2W0FC 3VBBA 4MS2A 2F95B 4ZI7A 4R8CA 4TOIA 5EIBD 3CEIA 3L70H 3CC7V 3HKDA 1K73W 2WA3A 5B1OA 1HWYA 2B1IA 2ITCC 1WA8B 1US6A 5CB4A 2KG7A 3APQA 2RCVA 3QO5A 1AI7A 1BZKA 3JD3A 4BW5A 4DV4O 1W59A 1Y76B 5LMUO 3BABA 1R6NA 5LYJA 1H2NA 1QU7A 1HR0O 2F93B 2QKCA 2DW4A 4JASA 5FNVA 4TV8A 1SQQH 2F1MA 3DXRA 4Z1VA 1I7FA 2QGNA 2OTLV 2PZSA 1QVFU 4MVSA 1AP6A 4J7ZA 2KB1A 4DR1O 3CPWU 1RFYA 1VQNV 1AJNA 1S5LZ 3WB1A 3JAMN 2VQFB 4X20A 4O2AB 3STZC 1D5NA 1R1BA 3AEIA 3SYCA 3AG3B 5B5EZ 4JV5O 3L9DA 4CS2A 5L3GA 2KKWA 2YXYA 1Q7YW 4BIUA 3ABTA 3GVMA 2YC0A 3AG7A 4YJ2A 4I7ZB 1K97A 4FK5C 3E8FA 1B3QA 3OMIB 2BE3A 1MOFA 3ZX6A 2AZ2A 3RW0A 5B66Z 4DR3O 2OCCB 3E22A 4DXWA 4X62O 4GZRB 1VQLV 2YS8A 2DYSC 3D3IA 1X59A 3ZRWA 2EILC 1IBMB 5B3SC 1GKFA 2CDYA 3IFXA 4J10A 2JRIA 4RO2A 3K0DA 3AG2B 4LWSB 5KMGB 2YXLA 1AVMA 4ICGA 3JD0A 4CC5A 4RAIA 1R3KC 1PKXA 3JYCA 3AG1C 4MTOA 1S5JA 3BEHA 4UV9A 2NN4A 3DSQA 3FAVA 1WB7A 3H9VA 4KUMA 3G67A 3ASNC 4O4LA 3CCVV 4LF8B 3BAAA 4QJFB 4LNUB 1SESA 1GN3A 4H44B 2HVKC 3E35A 4R50A 2IW5A 3R65A 4QGPA 3AG4C 2ADPA 1QNMA 4EEQA 3VOUA 4IYHA 4DW0A 5GTIZ 3UKMA 1TVKB 2ZINA 5D5PA 4P9PA 1GH6A 1GRJA 1QQCA 2FB5A 3F5TA 4A5UB 5IWAB 1AI5A 1FYJA 4LH7A 1H38A 3AG4B 2F23A 2MK3A 1DF4A 4JYYA 4JV5B 4DV2O
chains in the Genus database with same CATH topology
3FB7C 2Z5UA 1UJWB 2XASA 1NJIW 3B8MA 3CYOA 2EINB 2WLIB 2GHYA 4Q20A 5EC2C 4KFMA 5KA6A 2QM7A 2H8PC 5CBGA 4QPJA 4QNHB 2B1GA 5EBLC 4GCZA 4WFGA 4RUEA 2JEXA 1Q82W 1K8AW 3E83A 4MVQA 2UXXA 3W7XA 1CPYA 1SZTA 1AROP 1RPOA 2EZPA 1NH2D 3ZMVA 3QO7A 2X7RB 5IYCO 3SPCA 2WLHA 2CK3G 3SPGA 2QE7G 5EC1C 3OE7G 3OEEG 1KC8W 4R6ZA 2ZR2A 4LCUC 3OEHG 4JYCA 3JD4A 2WPDG 4MVOA 3JD2A 1AI4A 3WG7C 5IY5C 1E1RG 3G4SV 2DQ3A 4JGSA 4GX2A 3ASOC 4PDLA 1FXKB 2Y69B 1FFTB 5IYDO 5HFLA 2WAMA 2FTKA 3MHHC 4PA9A 4OXSA 1WPXA 3HPLC 3ML0A 3RVYA 3K3WA 2JJ2G 1N8RW 2A0LA 1NR7A 2LFSA 1ENVA 1F4NA 2WLIA 2EIMB 1TUEB 1V54B 2EINC 1GM8A 3E8BA 1QVGU 3K03A 3ABMB 2JIZG 4YXWG 4XDLA 1NH2B 1DF5A 1K34A 5EK0A 2WLLB 4MVUA 4RUFA 4J9YB 1KQSU 1VQ7V 1YHQV 3MD0A 3EHBB 3SYPA 1BHBA 1OCOC 1F4MA 1GMGA 2R9RB 1S72V 4JF3A 1QLEC 2X0LA 3WFVA 4XDJA 3SPJA 2IH1C 1M9NA 3OAAG 4BAYA 3UM7A 1YSCA 3FB8C 1VQKV 1FXKA 2PI4A 4GT1A 3ASOB 4U7NA 3G6EV 4P2ZA 5CA3A 4PA4A 4LC1A 2EZOA 3ZN0A 2Z3YA 1R6KA 3K06A 3CCUV 3LNMB 5J9PC 2IH3C 1R73A 4MW8A 2K1EA 4F4LA 3MHSC 5CBFA 5B3SB 4X8AA 5L3CA 2WLNA 1NKDA 2HVJC 4MVMA 1YJ9V 2WSSG 1JCHA 1RM1C 4UVAA 4UVBA 3ABUA 3TCUA 1YTFB 4HAMA 3BY6A 1PNMA 1JX9A 2P7TC 3F5WC 1H8EG 4H33A 4LP8A 3KG2A 1R3IC 3OGCC 3T4ZA 3CCLV 3W7SA 3CCMV 1NR1A 1I5XA 2EIKB 3ZJZA 3P30A 1I5YA 3LDEA 4UVCA 4JTAB 3SPHA 1VQ9V 5KA5A 2ZQMA 2IJJA 3CCJV 3FB6C 4JTDB 3ZN1A 5L3DA 4JPRA 5IDJA 3ZRVA 1P4RA 3X2QC 2W6JG 1NQTA 4N21A 3CMAV 1VQ8V 2V7QG 3EFFK 1FS0G 1XL4A 2Q67A 2WLKA 3P32A 2EIMC 1W0JG 3B77A 3ETGA 5H6RA 3ASNB 5B1NA 4RQFA 1M57B 3CMEV 1FXHA 2ZXWC 2JEUA 4QPKA 5EBWC 1M1KW 3AG1B 3RBZA 3ZMZA 1JQ0A 2OTJV 1JPXA 1NBMG 5KUMA 1KP2A 4JAVA 1RM1B 1OCZB 3AG3C 2WWWA 2WLMA 3D36A 1FXVA 4DO2A 3T2MA 1OZ0A 5B1AB 1JVMA 5BZBA 4JYBA 4G28B 5KUKA 1K5SA 3T4DA 1W0KG 4TWKA 1VQ6V 1QR8A 3QO8A 3M99B 5L3EA 4HZ3A 3CCRV 1EBOA 4BIZA 3LUTB 1E1QG 3JCZA 3NXSA 3SYOA 3FYIB 1P7BA 2QA4V 1GO3F 3CD6V 3LDDA 2XAGA 3A0RA 3CXCU 1SRYA 5L3FA 3SPIA 4KP4A 2ZDIA 1K4CC 1VQ4V 1QLEB 2OT5A 4R7CA 1JJ2U 2IJIA 4RQEA 1ORQC 1LNQA 1BL8A 1DTOA 1M90W 3HB3B 2WLLA 2IJHA 4CZZA 1H2GA 4HYOA 3GB7C 1F23A 5LHIA 1K4DC 2A79B 2HJFC 3OR7C 5C93A 1CP9A 3E86A 1M56B 2DWDC 4MTXA 2QKSA 2Q68A 1G8MA 3ZMSA 1OCCC 1YJNV 1SERA 1XL6A 4PDVA 3ABKC 1K3EA 3LDCA 4FPPA 2HLDG 4P9OA 2R9IA 1PL0A 2XAFA 3E2EA 3K79A 4N23A 1SETA 3OFNG 4PA6A 1YITV 4MTFA 2ATKC 4H37A 1Y4MA 1ROPA 1GK9A 3DGEA 3F7YC 2H94A 4PA7A 1H8HG 2HR3A 1VQMV 5IY5B 1OCRC 2XAJA 4G2KA 3SJQC 4PELA 2M7WA 1PD3A 2X6CA 3ZCCA 2HKOA 3LSSA 5LGUA 2F43G 1VQ5V 3RVZA 2EBOA 3ZRXA 3E8HA 5B1BC 3ZIAG 4QIWF 5HFMA 1OHHG 2P6JA 1S3JA 1L1FA 4FJCC 3K9AA 3B8NA 1S5HC 2JDIG 3F7VC 4WFHA 1K33A 3X2QB 3QNEA 2X6AA 3W7UA 4WCEV 5CBHA 3IC7A 2EIJC 2OCCC 2AHZA 3FYEB 2NNUA 4UXNA 1KD1W 2GSMB 2QTOA 3CCSV 4XBFA 1B6QA 1PNLA 3W7WA 1BMFG 3CCEV 1OCOB 1J95A 1V55C 3TK1A 2DQ0A 3AG2C 3FB5C 4MW3A 1M57C 1WLEA 2ZXWB 2YEVA 4XDKA 1THZA 4I5SA 2P67A 2DWEC 2V1DA 2EILB 3LSQA 3SYAA 3E8GA 4E2LA 3OUSA 1NVPD 3K08A 4PDRA 3ZMUA 3E89A 1RPRA 1S77D 3STLC 4G27B 1F51A 2W0FC 2XAHA 2JJ1G 3VBBA 1AI6A 4MS2A 1BHAA 4MT8A 3OM3B 2HG5C 4R8CA 1G4YB 3JD1A 3SYQA 3PJSK 2LFRA 4L87A 3ZRWB 4FIPC 4WFBV 1GM7A 3CC7V 3OW2U 1K73W 4QE7A 3ZRSA 1K9MW 5B1OA 1HWYA 4QE9A 1MG1A 1Y66A 2B1IA 2ITCC 3WG7B 5LHHA 1K5QA 3IGAC 5EBMC 1K7DA 2P90A 2XAQA 2Q69A 3CC4V 3I56V 3QO5A 1AI7A 3JD3A 3OMNB 4BW5A 2BOCC 1R3JC 1OCZC 1R6NA 1Q86W 4ZBMA 3ZMTA 3ABLB 5GW7A 2UXNA 5LHGA 2DW4A 4JASA 1KKDA 3FKSG 2QM8A 1QVFU 2OTLV 4MTGA 2BOBC 4MVSA 1QR9A 3ABLC 2IU0A 5B1AC 2W6IG 3DTUB 4J9ZB 1ZWIC 2KB1A 3OMAB 2AHYA 2D3OW 3GWOA 2DYSB 3K04A 4MVRA 4CBCA 3CPWU 3CCQV 3ETDA 4JTCB 1VQNV 1DLBA 5FL7G 1AJNA 1AJQA 1V54C 1YTFD 4GX1A 2DYRB 1YJWV 4GX5A 4MVZA 4Z1MG 3STZC 3SYCA 3AEIA 4EKWA 3TETA 3AG3B 3G71V 1E79G 5L3BA 1NVPB 2WLJA 2LP7A 4I9WA 2IJKA 2EIKC 2Y48A 4X89A 5L3GA 1S76D 5CN0A 1EZJA 1Q7YW 1AR1B 4BIUA 3OR6C 3ABTA 3I55V 3ABKB 1K97A 2Y69C 4GX0A 1FXKC 4FK5C 4UUJC 3E8FA 5CMUA 2ZR3A 1R3LC 1QCEA 1YIJV 2QEXV 3OMIB 4WFAV 3H01A 1MOFA 2YSUB 2X6BA 2PI5A 2ITDC 3RW0A 1AJPA 3W7TA 2XOKG 4LBEC 2EIJB 2OCCB 4ZKIA 5LBQA 1V55B 4U7OA 4DXWA 3OUFA 1VQLV 4FMTA 4P30A 2NLJC 1PNKA 2DYSC 3D3IA 2EJRA 5DM6V 3ZRWA 1S0VA 1MSWD 2EILC 3CP1A 4PA3A 5B3SC 1GKFA 3IFXA 2DYRC 4MSWC 4RO2A 3K0DA 3AG2B 3T1CA 4PDMA 4TSFG 1VQPV 5E1AC 2ZD9A 1Q81W 3JD0A 4ASUG 4TT3G 4RAIA 1VQOV 5B1BB 1KP3A 1R3KC 1PKXA 3JYCA 1YI2V 2B5UA 3AG1C 4MTOA 1EFRG 3BEHA 1GTOA 4UV9A 2Q6AA 2ZDIC 4UV8A 1COWG 4KUMA 3ASNC 1CEZA 1OCRB 3CCVV 4QJFB 1SESA 2HFEC 2IU3A 3CC2V 2HVKC 3E35A 5H9CA 4WF9V 4R50A 1JOYA 1KECA 2IW5A 2XNDG 3R65A 5LGNA 2C2AA 3AG4C 5LGTA 1M56C 1QLNA 3VOUA 2JK5C 1W2BU 4WFFA 3UKMA 4X88A 1OCCB 4P9PA 5IYBO 3K0GA 2A9HA 5DN6G 1GM9A 1AI5A 4JAUA 4WFEA 5H6QA 3ETEA 1H38A 3AG4B 1MABG 2MK3A 3ABMC 1DF4A 1K92A 2YEVB 1IXMA 1QBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB7 C;  3TCU A;  1V54 C;  4PA7 A;  4GX1 A;  2WLI B;  2P7T C;  4GX5 A;  4MVZ A;  1OCR C;  5EC2 C;  3STZ C;  3F5W C;  4KFM A;  3SYC A;  4EKW A;  4H33 A;  3TET A;  2H8P C;  3SJQ C;  5CBG A;  4LP8 A;  4QNH B;  2X6C A;  5EBL C;  3KG2 A;  1R3I C;  3OGC C;  4WFG A;  2WLJ A;  3T4Z A;  4RUE A;  4I9W A;  3E83 A;  4MVQ A;  2EIK C;  3RVZ A;  3ZJZ A;  3E8H A;  5B1B C;  4X89 A;  3LDE A;  4JTA B;  3SPH A;  1S5H C;  3SPC A;  3F7V C;  3FB6 C;  4JTD B;  4WFH A;  2WLH A;  3OR6 C;  3SPG A;  5EC1 C;  2X6A A;  3X2Q C;  5CBH A;  2Y69 C;  4GX0 A;  4R6Z A;  3EFF K;  4UUJ C;  2EIJ C;  1XL4 A;  2OCC C;  2Q67 A;  2AHZ A;  2EIM C;  2WLK A;  3E8F A;  4LCU C;  1R3L C;  4MVO A;  3WG7 C;  5IY5 C;  2QTO A;  2X6B A;  2ZXW C;  2ITD C;  4GX2 A;  3RW0 A;  5EBW C;  3ASO C;  4PDL A;  4LBE C;  3RBZ A;  1J95 A;  4DXW A;  1V55 C;  4PA9 A;  3OUF A;  4OXS A;  3AG2 C;  3HPL C;  2NLJ C;  3FB5 C;  4P30 A;  4MW3 A;  2DYS C;  5KUM A;  3RVY A;  1M57 C;  2YEV A;  2A0L A;  4XDK A;  3AG3 C;  2EIL C;  2WLM A;  2DWE C;  4PA3 A;  5B3S C;  3T2M A;  2WLI A;  3SYA A;  3E8G A;  1JVM A;  3IFX A;  2DYR C;  2EIN C;  3OUS A;  5BZB A;  4G28 B;  3K08 A;  4MSW C;  4PDR A;  4RO2 A;  3K0D A;  3E89 A;  5KUK A;  3E8B A;  3T4D A;  3STL C;  3K03 A;  4G27 B;  3T1C A;  4PDM A;  4TWK A;  2W0F C;  4MS2 A;  4XDL A;  5E1A C;  2ZD9 A;  4HZ3 A;  2HG5 C;  5EK0 A;  4R8C A;  1G4Y B;  2WLL B;  4MVU A;  3SYQ A;  4RUF A;  3PJS K;  4J9Y B;  4RAI A;  3LUT B;  1R3K C;  3SYO A;  1P7B A;  3JYC A;  3AG1 C;  4MTO A;  3SYP A;  3BEH A;  1OCO C;  3LDD A;  4QE7 A;  3ZRS A;  2Q6A A;  4QE9 A;  2ITC C;  2R9R B;  3SPI A;  3ASN C;  1K4C C;  4R7C A;  5EBM C;  3IGA C;  1QLE C;  4XDJ A;  2Q69 A;  1ORQ C;  1LNQ A;  3SPJ A;  1BL8 A;  2HFE C;  2IH1 C;  2HVK C;  4R50 A;  2WLL A;  4BW5 A;  3UM7 A;  2BOC C;  3R65 A;  3FB8 C;  4HYO A;  3GB7 C;  1R3J C;  3AG4 C;  1K4D C;  1OCZ C;  2A79 B;  2HJF C;  3OR7 C;  4ZBM A;  3E86 A;  2DWD C;  4P2Z A;  1M56 C;  4PA4 A;  3VOU A;  2JK5 C;  2QKS A;  4WFF A;  3UKM A;  2Q68 A;  3K06 A;  4X88 A;  1OCC C;  1KKD A;  1XL6 A;  4PDV A;  3ABK C;  4P9P A;  3LNM B;  5J9P C;  3K0G A;  2IH3 C;  2A9H A;  3LDC A;  4MW8 A;  2K1E A;  4MTG A;  4P9O A;  4F4L A;  5CBF A;  2BOB C;  4MVS A;  3ABL C;  4X8A A;  5B1A C;  4J9Z B;  2WLN A;  4WFE A;  1ZWI C;  2KB1 A;  2HVJ C;  2AHY A;  4MVM A;  4PA6 A;  3K04 A;  4MVR A;  4MTF A;  2ATK C;  4CBC A;  3ABM C;  4H37 A;  4JTC B;  3F7Y C; 
#chains in the Genus database with same CATH topology
 3FB7 C;  1UJW B;  3B8M A;  2GHY A;  2E5L O;  1SKV A;  5EC2 C;  1KUQ A;  1N4C A;  4X1I B;  4QPJ A;  3UCS C;  1VF6 C;  4RUE A;  4I55 A;  3E83 A;  5JJJ B;  1D2D A;  2UXX A;  4DR5 B;  5IWA O;  1ARO P;  1NH2 D;  4TUY B;  3SPC A;  1GN2 A;  2UXB O;  2PF4 E;  4LF9 O;  4CH3 A;  3K5N A;  4R6Z A;  4NXM B;  1B06 A;  4ZOL A;  2OIG A;  4JYC A;  4UCR A;  1E1R G;  4FLZ A;  4DUZ O;  4TUY A;  1FFT B;  3ML0 A;  4LF4 B;  2A0L A;  1NR7 A;  4O4H B;  1F4N A;  1XMQ O;  4XDL A;  1NH2 B;  2XT9 A;  1XHX A;  2Q7H A;  1V9P A;  2UUB B;  4DR4 B;  1VQ7 V;  4YHH O;  1YHQ V;  3A0B Z;  3UT5 A;  4U3J A;  3SYP A;  5EIB C;  1OCO C;  1BHB A;  3K5O A;  2R9R B;  4W4L A;  1S72 V;  4YJ2 B;  4JF3 A;  2QDO A;  1QLE C;  2ZNI A;  4DR2 O;  2IH1 C;  2A7W A;  2CGN A;  3OAA G;  2FYU H;  4L8J A;  3FB8 C;  3JAR A;  4U7N A;  2ZT9 B;  3G6E V;  4P2Z A;  2YID A;  3KZI Z;  2A06 H;  2UXC O;  5J9P C;  1AP5 A;  4GKJ B;  2ADQ B;  1Q8I A;  5B3S B;  2LGW A;  3HKC A;  5J2T A;  4PD4 F;  4UCS A;  2R72 A;  3JAR B;  4IT5 A;  2LJ2 A;  3ABU A;  4UVB A;  3TCU A;  1H2K A;  2VQF O;  2LQT A;  1JX9 A;  5KHK A;  3F5W C;  2D2C B;  3J7A U;  4H33 A;  3OT7 A;  1XNR B;  3OGC C;  4FLV A;  1I5Y A;  2IBZ H;  4O4I A;  4J7K A;  3IC9 A;  3CCJ V;  3RYC A;  2E76 B;  1KKC A;  4IHJ B;  1MSD A;  1VQ8 V;  2HEP A;  1FS0 G;  2XHB A;  3P32 A;  5LXT A;  1TVK A;  1Z2G A;  2EIM C;  2OWO A;  5B1N A;  4RQF A;  1M57 B;  4LF7 B;  2ZXW C;  2JEU A;  1H2M A;  5EBW C;  3RBZ A;  3ZMZ A;  2F4V B;  1NBM G;  5KUM A;  3Q4H A;  2QWR B;  1OCZ B;  2WLM A;  4DO2 A;  5BZB A;  5IJ9 A;  4FFB A;  3SDL A;  4DV0 B;  4JI1 O;  3T4D A;  5KHH A;  1QR8 A;  3QO8 A;  1GN4 A;  3JAS B;  4I0X A;  4ZHQ A;  2GDS A;  3Q4H B;  1Z5V A;  1P7B A;  3FYI B;  3T1Y B;  2QA4 V;  1PL4 A;  1GO3 F;  1MA1 A;  3RYF B;  3LDD A;  3CXC U;  1SRY A;  5L3F A;  1FAF A;  1JFF A;  1M5I A;  2IJI A;  4LFA B;  1QHT A;  4OX9 O;  4PI0 A;  2YI8 A;  1ORQ C;  1BL8 A;  3AK2 A;  2WLL A;  4X9Q A;  4YJ3 A;  4IIJ B;  1K4D C;  2A79 B;  3E86 A;  4DV6 O;  5BR8 B;  2Q68 A;  1SER A;  4O2A A;  2Q4P A;  1K3E A;  2HLD G;  2R9I A;  1PL0 A;  3A8T A;  2KQX A;  3UO2 A;  1SET A;  4PA6 A;  1YIT V;  5JQG A;  3M7M X;  1IX9 A;  3FFQ A;  5BMV B;  1GK9 A;  3F7Y C;  2H94 A;  3L73 H;  1F7Y A;  4AI8 A;  3H1I H;  5LP6 B;  1JA8 A;  2X6C A;  3LSS A;  1VQ5 V;  3T1H O;  1NU1 H;  2EBO A;  4D6T H;  5B1B C;  1TAE A;  4QIW F;  5HFM A;  1OHH G;  1S3J A;  4E4E A;  4DUY B;  3K9A A;  2UUC O;  1S5H C;  1L8D A;  3ZS8 C;  1K33 A;  4IGG A;  3W7U A;  4X1Y B;  2B9Z A;  2Q7E A;  5LMN O;  3JAL A;  2EIJ C;  2NNU A;  3BA8 A;  4AQY B;  1FD9 A;  4B3T B;  2QTO A;  4XBF A;  3W7W A;  2E3C A;  3HKC B;  1OCO B;  1V55 C;  2Q73 A;  3AG2 C;  1WLE A;  4K0K B;  5ITZ B;  2YEV A;  4UCU A;  1WB8 A;  3N2K A;  2EIL B;  3PN1 A;  3SYA A;  1S77 D;  4G27 B;  4JI5 O;  3AK3 A;  3K5L A;  1BHA A;  4MT8 A;  1G4Y B;  3JD1 A;  2UU9 O;  1Q6I A;  2AXT Z;  3ZRW B;  1GM7 A;  3OW2 U;  3CRQ A;  3ZRS A;  1K9M W;  4JI0 O;  2BSK A;  1MG1 A;  4IHJ A;  4H13 B;  4HBN A;  1SQP H;  2NR5 A;  4NTW A;  1WP7 A;  3RWR D;  2BOC C;  1R3J C;  4JI5 B;  2OIE A;  2GUZ B;  4GUN A;  2UXN A;  4DRX B;  5LHG A;  2YIB A;  4MTG A;  3ABL C;  1GAX A;  2W6I G;  2MW2 B;  3OMA B;  2AHY A;  1GN6 A;  3GWO A;  2DYS B;  3K04 A;  1N33 O;  4I9Q A;  1DLB A;  1AJQ A;  3WB0 A;  1YTF D;  1DK1 A;  3K57 A;  3TET A;  1P84 F;  1E79 G;  2WLJ A;  3OTO O;  1WA8 A;  3SR2 C;  1J5E O;  3C90 A;  4PHZ A;  5CB4 B;  4X89 A;  3UQ8 A;  5KAF Z;  1G6U A;  5LYJ B;  4J41 A;  4UUJ C;  5CMU A;  1PP9 H;  1R3L C;  1YIJ V;  2EUL A;  4FM0 A;  2YSU B;  4UCO A;  1EN6 A;  2X6B A;  2PI5 A;  3S3W A;  2R70 A;  3W7T A;  4ZKI A;  5LBQ A;  2P4K A;  1V55 B;  2AGA A;  3SGI A;  1ZL8 A;  2UUA O;  3BFR A;  4P30 A;  5J2U B;  2CAZ C;  1JMK C;  1URF A;  3U0Z A;  4O2B B;  2CUG A;  1SS3 A;  4JI7 O;  4O4J A;  3H1L H;  4TSF G;  3J81 N;  2KSD A;  3RGB A;  2VQE B;  1ZL8 B;  4B3S B;  1BGY H;  4LF9 B;  4LFA O;  4FVM A;  3CXH F;  5B1B B;  2UXB B;  1GTO A;  2Q6A A;  4DR5 O;  2DN9 A;  2YIB D;  3JAT A;  4TQD A;  4NXN B;  4WF9 V;  1KEC A;  4U3J B;  1EN4 A;  2JK5 C;  4WFF A;  4X88 A;  3N2K B;  5IYB O;  3K0G A;  2A9H A;  3DC6 A;  3VQV A;  4WFE A;  5H6Q A;  3ETE A;  4KL1 A;  4JI7 B;  4O4I B;  5LMN B;  1QBZ A;  2Z5U A;  4KXR A;  3CJH A;  1N36 B;  4U3F H;  4KFM A;  5KA6 A;  2H8P C;  4QNH B;  4JZG A;  4WFG A;  2K9P A;  3N27 A;  4DYL A;  5E79 Z;  5GON A;  1XMO O;  1P49 A;  5IYC O;  2VQE O;  2QE7 G;  5EC1 C;  3OE7 G;  3VQW A;  5CA1 B;  2O57 A;  1SA0 A;  5KHG A;  3ZHU A;  4MVO A;  3RFR A;  4GX2 A;  4PDL A;  1FXK B;  4IYI A;  5HFL A;  2FTK A;  3HPL C;  4CH6 A;  5IT9 N;  2JJ2 G;  1ZLZ A;  2LFS A;  1N32 B;  3DXR B;  4EB6 B;  2EIM B;  2EIN C;  3KCY A;  1UPG A;  3MDS A;  1XHZ A;  1QVG U;  3K03 A;  1SQG A;  3ABM B;  4YXW G;  1K34 A;  5EK0 A;  2WLL B;  4DR2 B;  1M4U A;  2BTQ B;  4EB6 A;  5KHJ A;  1GMG A;  4D7S A;  4TV8 B;  2X0L A;  3WFV A;  4F6E A;  1M9N A;  1HP8 A;  2CTR A;  3APO A;  3CSX A;  5EYP B;  5BXZ A;  1HNX B;  5J2U A;  1VIB A;  4LC1 A;  2EZO A;  5KLV H;  1R6K A;  1XNQ O;  5KHI A;  5LP6 A;  2IH3 C;  2K1E A;  4LF4 O;  4F4L A;  3MHS C;  5CBF A;  5L3C A;  4LF7 O;  3JAK A;  4WBN A;  2Q9L A;  2WLN A;  3L75 H;  4DUZ B;  1IBK O;  2QM4 A;  4JI3 O;  4NYK A;  5A9G A;  4UVA A;  1XQ8 A;  2OYQ A;  2N05 A;  4NB5 A;  4K0K O;  4HAM A;  3BY6 A;  1B04 A;  1PNM A;  1H8E G;  1HNX O;  4LFC B;  3SJB C;  1R3I C;  3T4Z A;  3CCL V;  1MZE A;  4F6R B;  4UVC A;  1N34 O;  2ZQM A;  3CHX A;  3FB6 C;  4JTD B;  4FLY A;  4NXN O;  3R66 A;  3WB2 A;  1Y67 A;  3X2Q C;  2W6J G;  3CMA V;  1XL4 A;  2Q67 A;  2WLK A;  4CC6 A;  2P22 C;  1X4T A;  1Q6U A;  2DJV A;  3B77 A;  3ASN B;  1BQ0 A;  2LW7 A;  1NTM H;  2IM9 A;  1Q5O A;  4YY3 O;  1YXB A;  4LF6 O;  1IVS A;  3EVK A;  1M93 A;  4I50 A;  3AG3 C;  2WWW A;  1FXV A;  3T2M A;  1OZ0 A;  3TXQ A;  5B1A B;  4I4T B;  1JVM A;  4G28 B;  5KUK A;  1K5S A;  3P3N A;  4JI2 B;  4TWK A;  1VQ6 V;  4GKK B;  2RMK B;  1XI1 A;  3P3P A;  3BHP A;  4DR7 B;  3LUT B;  1E1Q G;  3KKY A;  2YDE A;  1Z5W A;  1HDJ A;  1KB9 F;  2XAG A;  3ZED A;  2DOS A;  4FFK A;  3SPI A;  4KP4 A;  2ZDI A;  1K4C C;  1VQ4 V;  2OT5 A;  1JJ2 U;  1SA0 B;  3FD9 A;  5LXT B;  3H1H H;  1DTO A;  5FLX N;  3GB7 C;  4CH5 A;  2UXD O;  4BW9 A;  1WPB A;  1G8M A;  3ZMS A;  1RP3 B;  4JI2 O;  1YJN V;  1WNS A;  4FPP A;  2JS5 A;  4P9O A;  4UFZ A;  2RJZ A;  3OFN G;  4CS4 A;  2QWO B;  4PI2 A;  4MTF A;  2ATK C;  4FZ0 A;  3HKB A;  1Y4M A;  4NXM O;  4YY3 B;  4ZHQ B;  1VQM V;  2Y0I A;  2XAJ A;  3HKE B;  1TGO A;  2HKO A;  4X65 O;  3RVZ A;  3O65 A;  3ZIA G;  2P6J A;  1I08 A;  3FX7 A;  3H1K H;  4FJC C;  3B8N A;  2QWQ B;  4YJ3 B;  4WFH A;  5EYP A;  3K5M A;  3X2Q B;  3CRM A;  2OCC C;  2AHZ A;  1YVW A;  4UXN A;  2GSM B;  1B6Q A;  1PNL A;  1XOU A;  1XNR O;  3N2G B;  1NZ6 A;  3FB5 C;  1LUV A;  3D3Q A;  2P67 A;  2DWE C;  2YXH A;  3LSQ A;  1AIL A;  4JI4 B;  2PYL A;  3OUS A;  4PDR A;  3I5D A;  4Q6G A;  2RNB A;  1F51 A;  4UB6 Z;  5LL6 Y;  2JJ1 G;  1AI6 A;  4Z2W A;  3CRA A;  2PYJ A;  1O9G A;  1TUB A;  2ILM A;  2LFR A;  4L87 A;  4WFB V;  1XNQ B;  3JSN A;  4QE7 A;  1MMM A;  4NKG B;  1Y66 A;  2CH7 A;  3K58 A;  2UXD B;  4X1Y A;  2Y0P A;  5DEC A;  3WG7 B;  2PTM A;  1K5Q A;  1K7D A;  2P90 A;  2XAQ A;  3CC4 V;  1ZSP A;  1I94 O;  2CGO A;  2GTA A;  2QSA A;  1KBH A;  3ZMT A;  3JSL A;  4FLT A;  2YUA A;  5GW7 A;  5FPO A;  1I94 B;  4X62 B;  1EN5 A;  1PV0 A;  2HJD A;  4JYA B;  4LWS A;  1N32 O;  2D3O W;  4CBC A;  2EJ7 A;  3CCQ V;  3ETD A;  4JTC B;  1SQX H;  5EZY A;  5IJ0 B;  1V54 C;  4GX1 A;  4BIO A;  4Z1M G;  4FFB B;  2BSK B;  5L3B A;  5BR8 O;  2E75 B;  2EIK C;  2ZE8 A;  2JGD A;  3OTF A;  5CN0 A;  2Q0O C;  3CJH B;  1AR1 B;  1O9H A;  3OR6 C;  2R9A A;  4JI0 B;  2Y69 C;  4FZ1 A;  4GX0 A;  1SQB H;  4FLU A;  1A32 A;  2ZR3 A;  2QEX V;  2RQ6 A;  1NTZ H;  1Y76 A;  2ITD C;  4DV5 O;  1AJP A;  5GON B;  1N36 O;  4I0X B;  4YIO A;  4FMT A;  1EZV H;  1PNK A;  5DM6 V;  3HKB B;  2DE0 X;  1S0V A;  3RYF A;  2LW1 A;  3H1J H;  1HNW O;  4MSW C;  4DV4 B;  4X1I A;  1ZAU A;  1G1X B;  3CX5 F;  2ZD9 A;  1Q81 W;  4B3T O;  2FL4 A;  5C8Y A;  3THO A;  5JVD A;  4TT3 G;  1VQO V;  4GYC B;  1KP3 A;  3OGI B;  1IUR A;  4IIJ A;  2B5U A;  4AQY O;  1OCR B;  2HFE C;  5H9C A;  1JOY A;  5C8Y B;  4TV9 A;  4DV2 B;  2XND G;  5LGN A;  2C2A A;  1VP7 A;  3U11 A;  2P5O A;  5BMV A;  2BTQ A;  4DK1 A;  5LGT A;  3CRC A;  5IE9 A;  1W2B U;  3T1H B;  2L6L A;  4HNA A;  4O2B A;  2WA4 A;  1GM9 A;  4B3S O;  3QG5 A;  4H0L B;  1H2L A;  3ETQ A;  3ABM C;  2YEV B;  1IXM A;  2XAS A;  1XBL A;  2EIN B;  2WLI B;  3CE2 A;  2QM7 A;  4BR6 A;  4B08 A;  4DR3 B;  4IL6 Z;  5GTH Z;  3JAL B;  4DV7 B;  3G80 A;  1Y74 B;  3JAW B;  2W0X A;  3W7X A;  1CPY A;  1YZB A;  2BTO A;  1RPO A;  4DV6 B;  4K8X A;  3QO7 A;  2X7R B;  4JYA O;  5JJE B;  4K35 A;  4YIP A;  3GWK C;  3OEE G;  4W4K A;  5LOV B;  3T1Y O;  3LSU A;  3JD2 A;  5IY5 C;  2DQ3 A;  4JGS A;  1N0J A;  2Y69 B;  4B7K A;  3B2E E;  5JWP A;  4PA9 A;  1J5E B;  4X1K A;  5H2F Z;  1WPX A;  3RVY A;  1N8R W;  1N34 B;  3OD4 A;  2GBO A;  1FJG O;  2VWK A;  3BA9 A;  3HR0 A;  4ZIB A;  2HP8 A;  4RUF A;  3ZHT A;  3KCX A;  2ETN A;  4JI6 O;  2ZIO A;  3EHB B;  3RYC B;  1SQV H;  4AHC A;  4DR6 O;  1NS1 A;  1PPJ H;  4OPH A;  2VS0 A;  4EFE A;  2CTQ A;  1YSC A;  1VQK V;  1FXK A;  1SC5 B;  2PI4 A;  4GT1 A;  4ABM A;  2F66 C;  1NTK H;  3UO3 A;  5CA3 A;  3L72 H;  3L71 H;  4C7U A;  3ICX A;  2KG7 B;  1R73 A;  4MW8 A;  4X8A A;  4DR6 B;  1HR0 B;  1NKD A;  2HVJ C;  4MVM A;  4JI6 B;  3QVN A;  1JCH A;  1RM1 C;  2QJ1 A;  4JI3 B;  4ZI7 B;  3TXS A;  1YTF B;  4B3R O;  3EXA A;  1WJZ A;  1AB3 A;  3G6B A;  4LP8 A;  3KG2 A;  3W7S A;  5CA0 B;  3CCM V;  2UXC B;  3P30 A;  3LDE A;  4JTA B;  3BCC H;  2Q0A A;  2IJJ A;  1WN7 A;  3ZN1 A;  2CE4 A;  4JPR A;  1P7G A;  4X66 B;  4X20 B;  3JAT B;  4N21 A;  3HKE A;  4YHH B;  1VF5 B;  2QWP B;  3ETG A;  5H6R A;  1FXH A;  1U97 A;  2ZE6 A;  4QPK A;  3OTO B;  1M1K W;  4LFB O;  1JQ0 A;  5LA6 B;  1JPX A;  3RYH A;  1FPO A;  1KP2 A;  1XMO B;  4CH4 A;  4RWU A;  1LR1 A;  1SZX A;  4NTY A;  4NVP A;  1R6T A;  1LUW A;  1MZF A;  3M99 B;  5L3E A;  3N2G A;  5K1X A;  3B4S A;  3ZHV A;  2N04 A;  3JCZ A;  3NXS A;  3RYH B;  3SYO A;  2FKX A;  3CD6 V;  4J80 A;  1D5A A;  5KMG A;  4R7C A;  5D5Q A;  4DW1 A;  2AZ0 A;  4LF6 B;  3HB3 B;  2IJH A;  4CZZ A;  1ZTE A;  4HYO A;  1F23 A;  2HJF C;  1CP9 A;  1M56 B;  2P4V A;  2CH7 B;  3ZHQ A;  4I50 B;  4FM1 A;  1OCC C;  1XL6 A;  1VF7 A;  3TJT A;  2ZE7 A;  2AW9 A;  3E2E A;  1DGS A;  2Z0A A;  3L74 H;  2F4V O;  1ROP A;  4DV0 O;  3DGE A;  3D8C A;  2ZE5 A;  3LNN A;  1H8H G;  2HR3 A;  5IY5 B;  4LFC O;  1ZX3 A;  3A0H Z;  4G2K A;  2XTA A;  2M7W A;  3JCU Z;  1H2S B;  5IJ0 A;  4LF8 O;  3HKD B;  3F7V C;  1Q90 D;  1XRE A;  4DV5 B;  1FFX B;  3QNE A;  2X6A A;  4WCE V;  5CBH A;  3IC7 A;  4DRX A;  1KD1 W;  4OGQ B;  3CCE V;  3RT3 C;  3RYI B;  1VAR A;  3TK1 A;  4MW3 A;  1WP8 A;  2ZXW B;  4XDK A;  2VWJ A;  1THZ A;  3ZHS A;  2DMX A;  2V1D A;  4E2L A;  3K08 A;  3E89 A;  1Q6H A;  1RPR A;  1SF9 A;  3J80 N;  3STL C;  4GKK O;  2XAH A;  4B7E A;  2P06 A;  4UB8 Z;  3OM3 B;  2HG5 C;  3SYQ A;  4X66 O;  4FLX A;  3PJS K;  2RDC A;  1MNG A;  2QKA A;  1NI8 A;  4FIP C;  3DC5 A;  4K3A A;  1N33 B;  1BE3 H;  4QE9 A;  5LHH A;  5EBM C;  2ODM A;  1OJH A;  3IGA C;  1IBL O;  2Q69 A;  4ZOL B;  3I56 V;  4OX9 B;  3VQY A;  3OMN B;  1YF2 A;  4GLX A;  1OCZ C;  1Q86 W;  4ZBM A;  4FLW A;  3AK1 A;  2LO1 A;  5LA6 A;  3ABL B;  5IYZ B;  2YIA A;  4PJ0 Z;  1KKD A;  3FKS G;  1KYO F;  1Q43 A;  4O4H A;  2QM8 A;  5JCO A;  1XMQ B;  3U10 A;  1BSM A;  2IU0 A;  2BOB C;  1QR9 A;  3BPZ A;  5B1A C;  4O4J B;  2UUB O;  4DR4 O;  4TV9 B;  3DTU B;  3JAW A;  4J9Z B;  5BY1 A;  1ZWI C;  3WU2 Z;  4MVR A;  5FL7 G;  3RN4 A;  4J42 A;  2DYR B;  5A2Q N;  4I4T A;  1YJW V;  4GX5 A;  4MVZ A;  4EKW A;  3G71 V;  1NVP B;  4JI4 O;  2LP7 A;  5LMU B;  4I9W A;  2IJK A;  2Y48 A;  1IDS A;  1S76 D;  5JH7 B;  1KMI Z;  1EZJ A;  4X1K B;  1HNZ O;  4AIL C;  3K59 A;  3I55 V;  2Q5Z A;  3ABK B;  1FXK C;  1EM1 A;  1QCE A;  2A3Q A;  4WFA V;  3H01 A;  4NTX A;  1FJG B;  1T5E A;  2XOK G;  4LBE C;  2EIJ B;  4U7O A;  3IAY A;  3OUF A;  1XEQ A;  2NLJ C;  1XUQ A;  2LGQ A;  2ZCE A;  2EJR A;  5EZY B;  2UUC B;  1MSW D;  3CP1 A;  4PA3 A;  4X65 B;  1VMG A;  1JR9 A;  2DYR C;  3ZBH A;  3T1C A;  2ARH A;  4PDM A;  1VQP V;  2VRZ A;  5E1A C;  2QR4 A;  4GKJ O;  4ASU G;  2GV9 A;  1YI2 V;  1EFR G;  2ZDI C;  4UV8 A;  1COW G;  1CEZ A;  1U96 A;  2RN9 A;  2HHH B;  4DV7 O;  4JI8 B;  2N74 A;  4JI8 O;  2IU3 A;  2UUA B;  3CC2 V;  2L35 A;  1WAZ A;  3QTC A;  4DUY O;  2ZM6 B;  3SJA C;  1M56 C;  1QLN A;  1CXZ B;  1OCC B;  5DED A;  4D7T A;  5DN6 G;  1IXB A;  2OCH A;  3TGU H;  4UCT A;  5IJ9 B;  1JJO A;  4JAU A;  2EX3 A;  2JS3 A;  1IBM O;  1ZUQ A;  1MAB G;  3JAS A;  5H5N A;  1K92 A;  5JVD B;  2JGU A;  1NJI W;  3CYO A;  4Q20 A;  2YI9 A;  5CBG A;  1N0N A;  2B1G A;  5EBL C;  4GCZ A;  1JFF B;  2YIC A;  1SQF A;  2JEX A;  1Q82 W;  4MVQ A;  2V4D A;  1K8A W;  2G38 A;  3SJC C;  1YDX A;  1SZT A;  5LP6 C;  2EZP A;  3ZMV A;  3UT5 B;  2WLH A;  1I0H A;  4JZ2 A;  2CK3 G;  3SPG A;  3CB2 A;  2QWN B;  1KC8 W;  2ZKO A;  3CRR A;  2ZR2 A;  4B3R B;  4LCU C;  3OEH G;  1NT2 B;  5CA0 A;  2PGG A;  3JD4 A;  2WPD G;  4HNA B;  1AI4 A;  5KAI Z;  3WG7 C;  5JJN B;  3G4S V;  3ASO C;  3S3X A;  5IYD O;  2WAM A;  3MHH C;  4OXS A;  5JQG B;  2E5L B;  5AG2 A;  1TUB B;  3K3W A;  1ENV A;  2BCC H;  2WLI A;  3VQX A;  1TUE B;  1V54 B;  1GM8 A;  3A2F A;  4O4L B;  3E8B A;  2JIZ G;  4DR1 B;  2PUS A;  1DF5 A;  3E22 B;  2UU9 B;  4MVU A;  4F6R A;  4J9Y B;  1KQS U;  1IBK B;  3MD0 A;  5KX5 A;  4JAA A;  1F4M A;  1PM9 A;  5FPR A;  4DK0 A;  3C3T A;  2JGD B;  4J11 A;  4XDJ A;  3SPJ A;  2ZIM A;  1YEW A;  4BAY A;  3UM7 A;  3ASO B;  4OPA A;  2QTS A;  4K8Z A;  4UCV A;  5KX5 B;  4FM2 A;  4PA4 A;  3FAV B;  3ZN0 A;  2Z3Y A;  5ITZ A;  3K06 A;  2M6Y A;  3CCU V;  3LNM B;  2CTW A;  2Y4U A;  2XUM A;  1YJ9 V;  2WSS G;  1BT8 A;  4NR1 A;  1BS3 A;  3QF7 A;  2P7T C;  2E74 B;  3BVO A;  3NR7 A;  1Q3E A;  1IZ3 A;  1NR1 A;  1I5X A;  2EIK B;  3O9O A;  3ZJZ A;  1VQ9 V;  3SPH A;  1HW7 A;  3BRC A;  5KA5 A;  4DV1 O;  5L3D A;  5IDJ A;  3ZRV A;  1P4R A;  4LH6 A;  3CS5 A;  1FKA O;  1NQT A;  2V7Q G;  3EFF K;  3B40 A;  1W0J G;  4I55 B;  3CME V;  4LR3 A;  3AG1 B;  3D36 C;  2OTJ V;  4KHP B;  3IJ4 A;  4DV3 B;  4PV1 B;  5K1P A;  1FFX A;  2JVD A;  4JAV A;  5FNV B;  1RM1 B;  3D36 A;  1VF6 A;  3CWB H;  4JYB A;  3JAK B;  4WBN B;  4X64 B;  1UFI A;  4J7J A;  1W0K G;  3RYI A;  4HZ3 A;  3CCR V;  1EBO A;  4BIZ A;  1XDC A;  1L0L H;  4CS3 A;  4JI1 B;  3A0R A;  5IYZ A;  3M8A A;  2CTP A;  4LF5 B;  1QLE B;  5F2V O;  4LF5 O;  4RQE A;  1HNZ B;  1LNQ A;  4BWA A;  1BQZ A;  1M90 W;  1KU9 A;  2Y4T A;  5J2T B;  1H2G A;  5LHI A;  1AR5 A;  3OR7 C;  5C93 A;  2DWD C;  1HNW B;  5LOV A;  4MTX A;  2QKS A;  4PDV A;  4X64 O;  3ABK C;  3MAQ A;  3LDC A;  2XAF A;  3K79 A;  4B3M B;  2ZNJ A;  4N23 A;  1Y74 A;  1TA8 A;  4H37 A;  4DV3 O;  3K9S A;  5JH7 A;  1Y6X A;  2Q8V A;  4PA7 A;  1RSO B;  1OCR C;  3SJQ C;  4PEL A;  4LFB B;  1PD3 A;  3ZCC A;  5LGU A;  2F43 G;  2ZM6 O;  4KHP O;  3ZRX A;  3E8H A;  3ZHR A;  1XIL A;  1L1F A;  2JDI G;  2HHH O;  1AR4 A;  1RSO A;  1IBL B;  4DR7 O;  2FML A;  5TIS Z;  1L0N H;  4LNU A;  1BCC H;  1VEW A;  3FYE B;  4DV1 B;  3C3S A;  2H3O A;  3CCS V;  1BMF G;  2Q7G A;  1J95 A;  1YCI A;  2GUZ A;  2DQ0 A;  4TQF A;  4EFB A;  1M57 C;  2GTS A;  1OV9 A;  4I5S A;  5JCO C;  5CA1 A;  3E8G A;  2PY5 A;  1NVP D;  3ZMU A;  3B09 A;  4B3M O;  2W0F C;  3VBB A;  4MS2 A;  2F95 B;  4ZI7 A;  4R8C A;  4TOI A;  5EIB D;  3CEI A;  3L70 H;  3CC7 V;  3HKD A;  1K73 W;  2WA3 A;  5B1O A;  1HWY A;  2B1I A;  2ITC C;  1WA8 B;  1US6 A;  5CB4 A;  2KG7 A;  3APQ A;  2RCV A;  3QO5 A;  1AI7 A;  1BZK A;  3JD3 A;  4BW5 A;  4DV4 O;  1W59 A;  1Y76 B;  5LMU O;  3BAB A;  1R6N A;  5LYJ A;  1H2N A;  1QU7 A;  1HR0 O;  2F93 B;  2QKC A;  2DW4 A;  4JAS A;  5FNV A;  4TV8 A;  1SQQ H;  2F1M A;  3DXR A;  4Z1V A;  1I7F A;  2QGN A;  2OTL V;  2PZS A;  1QVF U;  4MVS A;  1AP6 A;  4J7Z A;  2KB1 A;  4DR1 O;  3CPW U;  1RFY A;  1VQN V;  1AJN A;  1S5L Z;  3WB1 A;  3JAM N;  2VQF B;  4X20 A;  4O2A B;  3STZ C;  1D5N A;  1R1B A;  3AEI A;  3SYC A;  3AG3 B;  5B5E Z;  4JV5 O;  3L9D A;  4CS2 A;  5L3G A;  2KKW A;  2YXY A;  1Q7Y W;  4BIU A;  3ABT A;  3GVM A;  2YC0 A;  3AG7 A;  4YJ2 A;  4I7Z B;  1K97 A;  4FK5 C;  3E8F A;  1B3Q A;  3OMI B;  2BE3 A;  1MOF A;  3ZX6 A;  2AZ2 A;  3RW0 A;  5B66 Z;  4DR3 O;  2OCC B;  3E22 A;  4DXW A;  4X62 O;  4GZR B;  1VQL V;  2YS8 A;  2DYS C;  3D3I A;  1X59 A;  3ZRW A;  2EIL C;  1IBM B;  5B3S C;  1GKF A;  2CDY A;  3IFX A;  4J10 A;  2JRI A;  4RO2 A;  3K0D A;  3AG2 B;  4LWS B;  5KMG B;  2YXL A;  1AVM A;  4ICG A;  3JD0 A;  4CC5 A;  4RAI A;  1R3K C;  1PKX A;  3JYC A;  3AG1 C;  4MTO A;  1S5J A;  3BEH A;  4UV9 A;  2NN4 A;  3DSQ A;  3FAV A;  1WB7 A;  3H9V A;  4KUM A;  3G67 A;  3ASN C;  4O4L A;  3CCV V;  4LF8 B;  3BAA A;  4QJF B;  4LNU B;  1SES A;  1GN3 A;  4H44 B;  2HVK C;  3E35 A;  4R50 A;  2IW5 A;  3R65 A;  4QGP A;  3AG4 C;  2ADP A;  1QNM A;  4EEQ A;  3VOU A;  4IYH A;  4DW0 A;  5GTI Z;  3UKM A;  1TVK B;  2ZIN A;  5D5P A;  4P9P A;  1GH6 A;  1GRJ A;  1QQC A;  2FB5 A;  3F5T A;  4A5U B;  5IWA B;  1AI5 A;  1FYJ A;  4LH7 A;  1H38 A;  3AG4 B;  2F23 A;  2MK3 A;  1DF4 A;  4JYY A;  4JV5 B;  4DV2 O; 
#chains in the Genus database with same CATH homology
 3FB7 C;  2Z5U A;  1UJW B;  2XAS A;  1NJI W;  3B8M A;  3CYO A;  2EIN B;  2WLI B;  2GHY A;  4Q20 A;  5EC2 C;  4KFM A;  5KA6 A;  2QM7 A;  2H8P C;  5CBG A;  4QPJ A;  4QNH B;  2B1G A;  5EBL C;  4GCZ A;  4WFG A;  4RUE A;  2JEX A;  1Q82 W;  1K8A W;  3E83 A;  4MVQ A;  2UXX A;  3W7X A;  1CPY A;  1SZT A;  1ARO P;  1RPO A;  2EZP A;  1NH2 D;  3ZMV A;  3QO7 A;  2X7R B;  5IYC O;  3SPC A;  2WLH A;  2CK3 G;  3SPG A;  2QE7 G;  5EC1 C;  3OE7 G;  3OEE G;  1KC8 W;  4R6Z A;  2ZR2 A;  4LCU C;  3OEH G;  4JYC A;  3JD4 A;  2WPD G;  4MVO A;  3JD2 A;  1AI4 A;  3WG7 C;  5IY5 C;  1E1R G;  3G4S V;  2DQ3 A;  4JGS A;  4GX2 A;  3ASO C;  4PDL A;  1FXK B;  2Y69 B;  1FFT B;  5IYD O;  5HFL A;  2WAM A;  2FTK A;  3MHH C;  4PA9 A;  4OXS A;  1WPX A;  3HPL C;  3ML0 A;  3RVY A;  3K3W A;  2JJ2 G;  1N8R W;  2A0L A;  1NR7 A;  2LFS A;  1ENV A;  1F4N A;  2WLI A;  2EIM B;  1TUE B;  1V54 B;  2EIN C;  1GM8 A;  3E8B A;  1QVG U;  3K03 A;  3ABM B;  2JIZ G;  4YXW G;  4XDL A;  1NH2 B;  1DF5 A;  1K34 A;  5EK0 A;  2WLL B;  4MVU A;  4RUF A;  4J9Y B;  1KQS U;  1VQ7 V;  1YHQ V;  3MD0 A;  3EHB B;  3SYP A;  1BHB A;  1OCO C;  1F4M A;  1GMG A;  2R9R B;  1S72 V;  4JF3 A;  1QLE C;  2X0L A;  3WFV A;  4XDJ A;  3SPJ A;  2IH1 C;  1M9N A;  3OAA G;  4BAY A;  3UM7 A;  1YSC A;  3FB8 C;  1VQK V;  1FXK A;  2PI4 A;  4GT1 A;  3ASO B;  4U7N A;  3G6E V;  4P2Z A;  5CA3 A;  4PA4 A;  4LC1 A;  2EZO A;  3ZN0 A;  2Z3Y A;  1R6K A;  3K06 A;  3CCU V;  3LNM B;  5J9P C;  2IH3 C;  1R73 A;  4MW8 A;  2K1E A;  4F4L A;  3MHS C;  5CBF A;  5B3S B;  4X8A A;  5L3C A;  2WLN A;  1NKD A;  2HVJ C;  4MVM A;  1YJ9 V;  2WSS G;  1JCH A;  1RM1 C;  4UVA A;  4UVB A;  3ABU A;  3TCU A;  1YTF B;  4HAM A;  3BY6 A;  1PNM A;  1JX9 A;  2P7T C;  3F5W C;  1H8E G;  4H33 A;  4LP8 A;  3KG2 A;  1R3I C;  3OGC C;  3T4Z A;  3CCL V;  3W7S A;  3CCM V;  1NR1 A;  1I5X A;  2EIK B;  3ZJZ A;  3P30 A;  1I5Y A;  3LDE A;  4UVC A;  4JTA B;  3SPH A;  1VQ9 V;  5KA5 A;  2ZQM A;  2IJJ A;  3CCJ V;  3FB6 C;  4JTD B;  3ZN1 A;  5L3D A;  4JPR A;  5IDJ A;  3ZRV A;  1P4R A;  3X2Q C;  2W6J G;  1NQT A;  4N21 A;  3CMA V;  1VQ8 V;  2V7Q G;  3EFF K;  1FS0 G;  1XL4 A;  2Q67 A;  2WLK A;  3P32 A;  2EIM C;  1W0J G;  3B77 A;  3ETG A;  5H6R A;  3ASN B;  5B1N A;  4RQF A;  1M57 B;  3CME V;  1FXH A;  2ZXW C;  2JEU A;  4QPK A;  5EBW C;  1M1K W;  3AG1 B;  3RBZ A;  3ZMZ A;  1JQ0 A;  2OTJ V;  1JPX A;  1NBM G;  5KUM A;  1KP2 A;  4JAV A;  1RM1 B;  1OCZ B;  3AG3 C;  2WWW A;  2WLM A;  3D36 A;  1FXV A;  4DO2 A;  3T2M A;  1OZ0 A;  5B1A B;  1JVM A;  5BZB A;  4JYB A;  4G28 B;  5KUK A;  1K5S A;  3T4D A;  1W0K G;  4TWK A;  1VQ6 V;  1QR8 A;  3QO8 A;  3M99 B;  5L3E A;  4HZ3 A;  3CCR V;  1EBO A;  4BIZ A;  3LUT B;  1E1Q G;  3JCZ A;  3NXS A;  3SYO A;  3FYI B;  1P7B A;  2QA4 V;  1GO3 F;  3CD6 V;  3LDD A;  2XAG A;  3A0R A;  3CXC U;  1SRY A;  5L3F A;  3SPI A;  4KP4 A;  2ZDI A;  1K4C C;  1VQ4 V;  1QLE B;  2OT5 A;  4R7C A;  1JJ2 U;  2IJI A;  4RQE A;  1ORQ C;  1LNQ A;  1BL8 A;  1DTO A;  1M90 W;  3HB3 B;  2WLL A;  2IJH A;  4CZZ A;  1H2G A;  4HYO A;  3GB7 C;  1F23 A;  5LHI A;  1K4D C;  2A79 B;  2HJF C;  3OR7 C;  5C93 A;  1CP9 A;  3E86 A;  1M56 B;  2DWD C;  4MTX A;  2QKS A;  2Q68 A;  1G8M A;  3ZMS A;  1OCC C;  1YJN V;  1SER A;  1XL6 A;  4PDV A;  3ABK C;  1K3E A;  3LDC A;  4FPP A;  2HLD G;  4P9O A;  2R9I A;  1PL0 A;  2XAF A;  3E2E A;  3K79 A;  4N23 A;  1SET A;  3OFN G;  4PA6 A;  1YIT V;  4MTF A;  2ATK C;  4H37 A;  1Y4M A;  1ROP A;  1GK9 A;  3DGE A;  3F7Y C;  2H94 A;  4PA7 A;  1H8H G;  2HR3 A;  1VQM V;  5IY5 B;  1OCR C;  2XAJ A;  4G2K A;  3SJQ C;  4PEL A;  2M7W A;  1PD3 A;  2X6C A;  3ZCC A;  2HKO A;  3LSS A;  5LGU A;  2F43 G;  1VQ5 V;  3RVZ A;  2EBO A;  3ZRX A;  3E8H A;  5B1B C;  3ZIA G;  4QIW F;  5HFM A;  1OHH G;  2P6J A;  1S3J A;  1L1F A;  4FJC C;  3K9A A;  3B8N A;  1S5H C;  2JDI G;  3F7V C;  4WFH A;  1K33 A;  3X2Q B;  3QNE A;  2X6A A;  3W7U A;  4WCE V;  5CBH A;  3IC7 A;  2EIJ C;  2OCC C;  2AHZ A;  3FYE B;  2NNU A;  4UXN A;  1KD1 W;  2GSM B;  2QTO A;  3CCS V;  4XBF A;  1B6Q A;  1PNL A;  3W7W A;  1BMF G;  3CCE V;  1OCO B;  1J95 A;  1V55 C;  3TK1 A;  2DQ0 A;  3AG2 C;  3FB5 C;  4MW3 A;  1M57 C;  1WLE A;  2ZXW B;  2YEV A;  4XDK A;  1THZ A;  4I5S A;  2P67 A;  2DWE C;  2V1D A;  2EIL B;  3LSQ A;  3SYA A;  3E8G A;  4E2L A;  3OUS A;  1NVP D;  3K08 A;  4PDR A;  3ZMU A;  3E89 A;  1RPR A;  1S77 D;  3STL C;  4G27 B;  1F51 A;  2W0F C;  2XAH A;  2JJ1 G;  3VBB A;  1AI6 A;  4MS2 A;  1BHA A;  4MT8 A;  3OM3 B;  2HG5 C;  4R8C A;  1G4Y B;  3JD1 A;  3SYQ A;  3PJS K;  2LFR A;  4L87 A;  3ZRW B;  4FIP C;  4WFB V;  1GM7 A;  3CC7 V;  3OW2 U;  1K73 W;  4QE7 A;  3ZRS A;  1K9M W;  5B1O A;  1HWY A;  4QE9 A;  1MG1 A;  1Y66 A;  2B1I A;  2ITC C;  3WG7 B;  5LHH A;  1K5Q A;  3IGA C;  5EBM C;  1K7D A;  2P90 A;  2XAQ A;  2Q69 A;  3CC4 V;  3I56 V;  3QO5 A;  1AI7 A;  3JD3 A;  3OMN B;  4BW5 A;  2BOC C;  1R3J C;  1OCZ C;  1R6N A;  1Q86 W;  4ZBM A;  3ZMT A;  3ABL B;  5GW7 A;  2UXN A;  5LHG A;  2DW4 A;  4JAS A;  1KKD A;  3FKS G;  2QM8 A;  1QVF U;  2OTL V;  4MTG A;  2BOB C;  4MVS A;  1QR9 A;  3ABL C;  2IU0 A;  5B1A C;  2W6I G;  3DTU B;  4J9Z B;  1ZWI C;  2KB1 A;  3OMA B;  2AHY A;  2D3O W;  3GWO A;  2DYS B;  3K04 A;  4MVR A;  4CBC A;  3CPW U;  3CCQ V;  3ETD A;  4JTC B;  1VQN V;  1DLB A;  5FL7 G;  1AJN A;  1AJQ A;  1V54 C;  1YTF D;  4GX1 A;  2DYR B;  1YJW V;  4GX5 A;  4MVZ A;  4Z1M G;  3STZ C;  3SYC A;  3AEI A;  4EKW A;  3TET A;  3AG3 B;  3G71 V;  1E79 G;  5L3B A;  1NVP B;  2WLJ A;  2LP7 A;  4I9W A;  2IJK A;  2EIK C;  2Y48 A;  4X89 A;  5L3G A;  1S76 D;  5CN0 A;  1EZJ A;  1Q7Y W;  1AR1 B;  4BIU A;  3OR6 C;  3ABT A;  3I55 V;  3ABK B;  1K97 A;  2Y69 C;  4GX0 A;  1FXK C;  4FK5 C;  4UUJ C;  3E8F A;  5CMU A;  2ZR3 A;  1R3L C;  1QCE A;  1YIJ V;  2QEX V;  3OMI B;  4WFA V;  3H01 A;  1MOF A;  2YSU B;  2X6B A;  2PI5 A;  2ITD C;  3RW0 A;  1AJP A;  3W7T A;  2XOK G;  4LBE C;  2EIJ B;  2OCC B;  4ZKI A;  5LBQ A;  1V55 B;  4U7O A;  4DXW A;  3OUF A;  1VQL V;  4FMT A;  4P30 A;  2NLJ C;  1PNK A;  2DYS C;  3D3I A;  2EJR A;  5DM6 V;  3ZRW A;  1S0V A;  1MSW D;  2EIL C;  3CP1 A;  4PA3 A;  5B3S C;  1GKF A;  3IFX A;  2DYR C;  4MSW C;  4RO2 A;  3K0D A;  3AG2 B;  3T1C A;  4PDM A;  4TSF G;  1VQP V;  5E1A C;  2ZD9 A;  1Q81 W;  3JD0 A;  4ASU G;  4TT3 G;  4RAI A;  1VQO V;  5B1B B;  1KP3 A;  1R3K C;  1PKX A;  3JYC A;  1YI2 V;  2B5U A;  3AG1 C;  4MTO A;  1EFR G;  3BEH A;  1GTO A;  4UV9 A;  2Q6A A;  2ZDI C;  4UV8 A;  1COW G;  4KUM A;  3ASN C;  1CEZ A;  1OCR B;  3CCV V;  4QJF B;  1SES A;  2HFE C;  2IU3 A;  3CC2 V;  2HVK C;  3E35 A;  5H9C A;  4WF9 V;  4R50 A;  1JOY A;  1KEC A;  2IW5 A;  2XND G;  3R65 A;  5LGN A;  2C2A A;  3AG4 C;  5LGT A;  1M56 C;  1QLN A;  3VOU A;  2JK5 C;  1W2B U;  4WFF A;  3UKM A;  4X88 A;  1OCC B;  4P9P A;  5IYB O;  3K0G A;  2A9H A;  5DN6 G;  1GM9 A;  1AI5 A;  4JAU A;  4WFE A;  5H6Q A;  3ETE A;  1H38 A;  3AG4 B;  1MAB G;  2MK3 A;  3ABM C;  1DF4 A;  1K92 A;  2YEV B;  1IXM A;  1QBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...