2Q6WB

The structure of hla-dra, drb3*0101 (dr52a) with bound platelet integrin peptide associated with fetal and neonatal alloimmune thrombocytopenia
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
188
Chain Sequence
b'TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystallographic Structure of the Human Leukocyte Antigen DRA, DRB3*0101: Models of a Directional Alloimmune Response and Autoimmunity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q6wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2q6wB01
5I8CB 2HYMA 4Y4KD 5FF6B 1TTFA 3U36A 4XPGH 2AERT 2X4UA 3VRLF 4N0UE 2AGJH 3F65A 4N5EC 2QSQA 5D6CB 5JW3L 1FYTB 5TE7L 4O2CA 1C7SA 2BNRB 1NCWH 4S1RL 1NGZA 3GRWL 2GT9A 1VFAA 1NLDH 3C8KB 3CFDA 1MCHA 3PGFL 4GAYA 1F3JA 2G75B 1D7FA 3GBNH 1CF8H 4YEFA 3GDBA 3VFRB 4PB0L 2WV3A 1OHQA 3C6LD 3VJ6B 1NGWA 4Q9RL 5D2NA 4HK3N 3AMKA 3OTTA 1KT2A 3G6JF 3HZMA 1HSAA 1CL7L 3SDYL 4XH2A 1T3FB 2VZVA 4K8RL 1NGXB 1NSNH 2B1HH 1ZLUH 2FX9H 4CDGC 1KJMB 1CGVA 3EZ8A 3T4YB 4BH8B 4XP1H 4X8JA 5I73C 3WXWL 5DD6A 2HP4A 1LE9B 3U7WL 4M1GH 2DS4A 2A2QT 3S5LB 2FO4B 5CSGA 1IAKA 4JO3H 4HUVA 3V79C 1HHIA 1QQDB 2EDHA 3OPZH 3FO1B 4K3JL 1NEZA 5DURD 4DKAA 3P0VL 5FEBA 2IAMB 4D3CH 5ANMA 3L1OL 5F6IB 3HE7D 1F2QA 1UH3A 4EIZC 3T2NL 4OV6F 1U3HD 1KXQE 3RWHB 2VWEE 2X6MA 1UZ6E 4ZFGL 3ZTJH 4DFHA 5EPMB 4L4VE 3FT3B 4ACPA 1DVFD 5JIKA 2AQ1A 3TPKA 1UB5A 1OGAE 3JV6B 3QI9C 3HA0A 3DV6B 5I1KL 3HC3H 1UM5H 5AZEL 2V2XB 3ARRA 1BFOA 5ACMA 1NCTA 3HE6A 4KKCC 4I3RL 2YZ8A 4FQLH 5DRWA 1CQKA 5C09A 2JJTA 4JZOA 4ZSOB 2GSIA 4P4RA 3OKNA 1BGXL 1X4XA 4I2XA 1WV7T 4WNQB 1FVDA 3HMWH 4PJXB 1S9KC 3MV8A 2ZUQB 4DKFH 2VE6A 5DD3H 1KJ3L 3HNSH 4G8FA 5C09E 5T3XD 2ITCA 2RBLA 4WFED 4X5XB 5L2KE 3NCYS 1JIBA 3QIUA 4FNLH 4JQXA 4MAYC 1DL7H 3WUWG 3NIFF 3NZHH 3QZWB 4LVNC 2R15A 1F90H 3W0WD 3EOYG 5HGDB 4P2OC 4FQQB 4R2GD 1BQHB 4KKCD 3E3QC 1YQVL 4N0YH 4OZFH 4P4KB 3LN5A 2IJ0C 5HI3D 3LKRB 1K85A 3LIZH 3K74B 4PRHB 5KN5A 3OXSA 2ZNXA 1W0WB 5FCUL 4QRTA 2HRPL 4M1DH 3BGFB 3JZ7A 2XG5A 1QSEB 4QRPD 4O2EB 4X98B 4XMKL 1JYXA 4D0CA 3FQTA 1KSRA 3WIHL 3SE8H 1UEYA 3VXSA 1B4RA 5D4QA 5TPWH 3H0TA 4M48H 1N59B 3TH2T 3FOLA 4HBCL 5BRZD 1AIFB 2VQ1B 3D2UB 4KI5F 4XX1E 1AO7B 4P2OD 5BZDB 3DO3A 1U8QB 3KLHD 3TNNA 1CXEA 4QTIH 1GAFH 2R23B 3KPQA 1OAQL 4Z78A 2FSEA 4PGEA 1SYSB 5KW9H 4M9PA 5I15L 2OTUA 3F7YA 1S9XA 5DK0A 8FABB 1CFVL 2FHCA 4WTZA 4NM4L 5C6TH 5EO0B 3WD5L 2DQFB 1IGCH 2E7MA 1SY6H 3FO2B 1LDSA 2R0LH 4P5TB 4U6VH 3M1BA 5I1IL 4NFBA 1FFOB 1IC7H 4HMEA 4LOUC 2X9WA 1JPFB 4J4PA 3VFSA 4H0GA 3F7RA 3FQWA 2CLZB 3KXFB 1A6ZA 4LDEB 3U4BL 4POZD 3MRFA 2XKSA 4J3XA 5DQDH 1DZBA 1ACYL 3H7BA 3KYMA 4PJDE 3ARFD 4J3OC 4LMQI 4R3SB 3QXWA 1FBIH 2NY1C 4R90H 4ONHA 4L29A 5JQ6H 4PY7B 4ONGH 1QR4A 3GSUA 4AM0A 5F70A 3P30L 3EFFA 4AY0A 1E0OB 1ES0B 4LLYA 5ADOH 4JZJB 1TVBA 4MLIA 4U4BA 1XEDA 1Z9SA 1QO3B 3LKSB 4MA8L 5TGBB 4JFDE 5GGQL 1V05A 4O5LH 3ZHDA 2MMXA 1J8HA 4HF5H 2OR8A 4XPFH 4K3HA 2IH1A 2VO5A 1BECA 5CBAA 4NNXB 5C1MB 2WBKA 1DLHB 3RDTB 1T89C 4K9EL 1PVHA 1ZVSA 2R2CA 3EO1B 5GGVL 1KTLB 2ZP0T 3MNWA 2NY1D 2W0PA 3IDUA 5DRNA 1H3TA 1FG2A 1LO4H 4GG6B 2GW5A 4X6EA 1H3UA 3EGSA 2E7LA 1FRGL 4Y4HB 5CLWA 5IMLB 3HTLX 1T66C 3BQUA 5T33H 2BCKA 4KI1A 3GSWA 1J1XH 4KKLD 2VDLL 1CT8A 1V8HA 5DJAB 1A7QL 1JGUH 2M2DA 1LO0L 1YNTA 1PZ5B 3P77A 4ODUB 4NO0B 1D5XA 3EHBC 1U8LA 5HYJB 5ID1A 5HHMB 4I77H 5B38G 5CWSA 1P53A 3TBSB 3TGXA 4LU5L 1TQBB 3GM8A 3V6ZB 2H8PA 4PJ9D 4OZ4A 3VD3A 1DFBH 1Z9MA 2GHWB 3SGEH 3SGKC 4PRNA 1KN4H 3CFEB 3VXQB 4OZGF 4FFYL 5JPMB 1Q38A 2ARWA 4S1SH 2FHBA 4PPTA 3PWUB 3WJJA 3D87B 3D3VD 2WK2A 2F54D 1R3HB 5GS1B 5DT1L 1DN0A 2YD3A 1Q72L 4PJ8A 1A7NL 3QDMD 3DVFA 4JREB 4YHMH 4AG4H 1MLBA 1HQRA 3FKUS 2VLLB 1FL5A 2ICEB 5FOBA 1YEHH 1UXWB 2NMSA 5DZOA 1R0AH 1NKRA 1EA9C 4QNPE 3CSGA 2X4TB 4HWUA 5D2LA 1VEOA 1A4KB 4UOJA 5DC9B 1QA9B 4YEEA 1B88A 4GUPB 4L3CB 3TO4A 4Z0XB 5CIPH 2W65B 2X4RB 1YQ2A 2YA1A 3QWQB 2APVA 2Z4QA 3D85A 3HRZA 2PR4L 3SY0B 3T77A 4U1LA 4C56D 3QWRA 2ADFH 2BVPA 4ODXA 3QJHA 1NDMB 2WWKT 4KXZI 3ULVE 1I9EA 3L6FA 5JOFA 1FL3A 5T5FL 2D7NA 1ZK9A 3DX6A 3H3BC 5DD1H 4ZTPL 2UWEB 3TVMC 1ZE3C 3QA3A 4NN7B 1HIMH 3E8UL 1OW0C 2KH2B 3OKDB 4F57L 5EA0H 5CEZE 3RU8H 2FJGA 2BP3A 4I5BA 1NKOA 3VXNB 5F9WC 1A64A 2CSPA 3B2VH 1PG7L 4P3WA 4CVXB 3IAQA 2H41A 3BPLB 3UJIL 4RAUB 1FCGA 5KOMC 1XH3B 3VI4E 1BHGA 5LCVL 3LD8C 3CVHB 4ORZC 4GRWB 3LEXA 2MWCA 3KNBA 1EEQA 3BGMB 3ZTNH 5INDB 2ESVA 3QDJA 4QTHB 1QRNB 3TVMD 3I6KA 3SKOB 2BRRH 1HOCB 4N0RA 5HD8D 3UPRB 3UBXI 2WM0A 3VH8G 4BJLA 1X5HA 2J88H 5CILH 4D9LH 1BWMA 3O3DB 3EIFA 4K3GA 2I07A 1Q9LA 5D1QC 5HGBB 3U0WH 4XPBL 3P73B 1YEFL 3D69B 4Y4KA 3S34L 4BKLA 4NUGL 4PJGB 4TVPH 1FORH 4FFVC 1CGUA 4DK6A 1ETZB 5JDJA 4S2SA 3GSNA 3AU1B 3G5ZA 5BXFB 1M6OA 2X7LA 5T3ZL 2X4QB 3LV3B 4JFQB 2VC2L 1JNNH 4NZUL 2DQIH 3TZVC 2X09A 4CADA 4YNYB 1BJ1H 1N26A 1R3IH 4OLVL 3MA9H 5EB9A 4HAFA 4JDZB 3SKJH 3AB0B 3L9RB 4OIBA 5BV7C 3VWJC 4HWZA 3TFKD 3JVGA 1R5VA 4NPYA 3C6LA 3F8UB 5E8DH 2BDNH 2PXYC 4X4YB 4Z76B 5D1QD 5E08L 4YWGL 5JW5A 5E8PA 5LQBL 2VXTH 2GK0A 5JNYA 4HKXB 1LDPH 5INCB 4FFVD 1LGVA 3K2UH 2DJ4A 4KKAD 4U1SA 5SX5K 4JRXD 3IAPA 3RUGB 5ESVB 1M7XA 5CD3B 4QT5A 4K3EH 4C55A 1U3ZA 4U31A 3I85A 1URLA 3AC0A 1VFMA 2QJDA 3GB7B 3Q48A 3IJSB 4HZLB 3JTSA 5EBLB 4HG4K 1I8IA 2NX5D 3VWJD 3NBNA 1J88A 4FQXC 3HC0A 1G7PA 3HE7A 3WFHA 2PXYD 1W72H 1MCPL 1U3HA 1FL6B 4Y4FC 4QRSA 4YO0A 4JLRB 4KJWD 4WO4B 1UCTA 1NCCH 4NJ9H 4QF1B 4HIIB 3RVVD 1DVFA 3PWVA 3OZ9L 1H3XA 2R69L 3BSZL 4EOWL 1K2DA 4WTWA 1LVEA 5FYLL 2PYEE 3OKEA 2ZUWA 4UB0H 2DTML 4HJ0C 3BP5A 1CCZA 1YDPB 4OIIL 1LP9A 5J11B 1H3PL 3MRQA 3H9SD 3ARVA 5GGTH 2RR3A 4F33B 3VRJA 2IH3B 1RUPH 4HWBA 3RPIB 2LU3A 3L7EB 5D7JD 1LP9E 3GI8L 1XAUA 3HZKB 3K8KA 3WUWB 2EYRB 3ULSB 4CU7A 5EO1B 3MJGX 4M8QA 4OQ1A 3CU1A 3HAEG 3VE0B 2O5YL 4HV8A 3RKDC 1N5YL 3BJ91 2DAVA 4MNGA 1DQJB 5IIEA 4IRZH 3GMNA 3T0ED 2AVGA 1Q0XH 4GAGH 3V5KA 2AQ3A 2EKJA 1LK3L 4PG2C 5T3XE 4D0BB 4WFEE 1F4WL 3N06B 5ALBL 2AEWA 1N4XL 3QCTH 4MNGE 2C3XA 4K7PL 5EC2A 3WFEH 5D9SB 3OWEA 1KN2L 2CDEA 1MREH 5J1TC 1NLBH 3W0WE 4PP2A 1WC7A 5I1LA 1CLYH 1YYML 2UZIH 4QRPA 3MA7A 1U8MA 3V0VA 5KSVB 2R39A 1I3VA 4G7VL 4UV7L 5F9DC 5GGRB 4NKMA 4F3FB 4LGPB 2EDRA 4JKPH 3CSYB 4FHBD 4ZPVB 4OCXL 3SBWC 3TA3B 4EDXB 4Z6AT 4KPHL 4BH7A 4QO1A 4QRPE 2YRLA 3TYFA 5HVHB 5E2JA 3O2VL 2GIYA 5C0AB 3MRBB 2XWTA 3CH1A 4PTTA 4M6OL 3GMRB 1A0QL 5BRZE 5IMOA 4KRPC 2VLRB 1FVEA 3WNPA 1A7RH 3BKJH 1RIHH 1MAJA 4MQTB 4ETQB 2LFGA 2ZJSH 3PQYD 3TJEL 4C83A 1BEYL 3WFBL 2VERN 4OZHA 2IMMA 3RWFA 4KGJA 4XNUH 3QBTB 5GRWA 3SQBA 3VGEA 5C0GA 4YE4H 1EGJH 4XCFH 1ADQH 3C60B 5F9JA 3O4OC 4MWFB 2NZIA 4R4BB 1XGPA 2CIKA 3T09A 1L4IA 5DQJA 4JY5L 5IMMA 5ID0A 4MCYB 4IM8A 1EHLL 3MRGB 5E2VH 1A3RL 5KOVC 2AJUL 4XHQA 2F53D 3RTQC 3MJ7A 1HH6B 4ZO6A 2OSLB 2QQKH 4H8WC 5FA4A 1Q94B 5CUSL 3VXRE 3LQZA 4IMLA 2ZZUT 2BOBB 2EC8A 3WSQH 5MEOA 3BPCB 2XKNB 4JM4L 4R97C 1P5UA 3QFDB 5L6YH 1DEEA 3B9KC 5F1NA 4LPUA 5H94B 1NBZB 5TE6L 5LVEA 4XI5C 4G6AC 2HTKC 2EYTB 1JWUA 4OJFL 4G9FB 4UUJA 3QUXC 2I9TB 4PJIE 1JGVH 1C5CL 2FB4L 3X13A 3O6FA 2Q3ZA 4NNPL 2GJ6B 3FOMB 5D5MB 1JGLL 4XRCA 4F37F 1MHPL 4HLZG 3DI2B 2BSTB 4RMRA 5GHWL 1VGKA 5FECA 4MLSA 4W68A 3OSKA 4QY8B 2XQYK 3TP4A 4GSDH 1RZFH 5EUOA 4IOIB 3HMXL 4NZTH 4IS6B 3QUXD 4PGJA 4HPOH 4N68A 2VDNH 1U8IA 4ZPTB 1IQWL 4PJCF 5IFHL 1KLUA 3BW9A 1BAFH 1RJYB 3I50L 4N0FB 4NQSB 1MWAH 3IT8D 3D0VA 4NP4L 1S78C 4PJ9A 5I66B 1G6RH 3MZTA 1CZ8H 3PWJA 4MJID 5IFJA 4MA7L 1TVHA 4RGOL 1MJUL 1F6AA 4N90D 4DEPC 4NJAH 4ZOBA 1Y18B 1MHCA 2P48B 3FQRB 3MLYL 4IOFC 3TEUA 3V0AC 4EXPX 3D3VA 4WVRA 3HPLA 1I1YB 5K9OB 4AT6B 3DIFB 2F54A 5IBUB 4CW1B 2A73B 3OHXA 4I3SL 4RZCB 2Q8AL 4TSCH 4PJ5D 3D3VE 4JHAH 3OKOB 1QACA 1DBBH 4BQ6A 4NUJB 2F54E 1BLNA 4XPTL 2FRGP 3QDMA 3EYUL 1GC1C 1KB9J 3PDOB 4KUCD 3L3KA 2XZZA 2MNUA 1CE6B 4MVBC 5JXED 3LDBC 4AEHH 4APQB 4OZIA 4QXGL 2YPLD 3MLZH 3QDME 3UROR 1IM3A 4TUKH 3D18A 5JUEL 4WI6A 2QL1A 4IOFD 4MXQD 5E7FA 1H3GA 2YN5A 1T0NB 3NCBB 5DA0B 4XWGL 3DO7B 5TQ2H 3BE1L 3GUTB 3UZEA 3HZYA 1T7YA 4Y5YB 3BP6A 2MHAB 1VESA 4DN3L 4XPHH 4PJHF 4U49A 1AGFA 5I1DB 1FFNA 4C56A 3B4NA 1EHNA 1GGUA 2HJKA 5ALCL 1IT9H 3QG6B 5EORL 4NYLA 5ISZB 1VDGA 1G9NH 4TNVF 2FX7H 5FKAB 3WS6C 1UYWH 4X9GA 1XFPA 3HHRB 4NDMB 4C56E 3F7PC 3T4AB 3O9WC 2MJWA 2YN3A 3G6JB 3UJJH 1H8SA 3ZSSA 1EAPA 1Q9WA 2E27H 4LPVA 1P4LB 2IAMC 1U95A 4HKZA 4LCCA 4MQXD 5F6IC 1P1ZA 1ZLVK 1RJZA 2KUTA 1SYVB 3EOBB 2E9WA 5C0CB 3RL1B 1YN7B 2WUCL 4HBQA 1O7SA 4M6ML 4X6BB 3SDAA 3CNKA 1ZHLB 2L7UA 3JV0A 3WE6B 1XCTA 2JJWA 1DQLH 2ED7A 1YJDC 5F71A 2J8UB 1XR8A 5FGBA 2A9MH 4L9LB 3RX5A 1OSZA 3VXPB 3EDEA 3EFDL 3EDKA 2NLJA 2GSGA 4IDJL 3VH8B 1NFKA 5CKGA 4YFLI 5C0FB 1MF2L 2YPVH 2XRAH 4RFNB 3O9WD 3GI9L 1M7DB 3VFMA 4YBQC 5DHXB 3TF7C 3FL7A 5JHDD 2VAAA 3QSKB 2X1QA 4LAJH 2OMNA 3DRTA 4YHNA 4MJ6A 3VXTB 2ZUQC 5T1KB 5DWUH 4DCQA 1HQ4A 4XCEA 2FX8L 2MFNA 5KVDL 4JDTH 1CGSL 1S7SB 1I3RA 3MGAA 3T0WA 1BOGA 4OGAD 2HJFA 5D72H 3MCKA 4GKNA 3C6SB 3S8WA 4GAJH 5ACZB 3ROOA 4PS4L 5KSBE 3R06A 4P4KC 1OAZL 4P3DB 2WBWB 3LEVL 2Q7YA 1HZHH 1UACH 4DAGH 2GAZA 4LEOA 3JWDL 4YUEL 2QEJA 1YEGL 3RAJH 4LLWA 2AK4D 3G08A 4HULB 2GFBB 4JRXA 3L3JB 3C2AH 4HIXH 4IHOA 2FD6L 4WUUB 3OB0K 3RZCD 4NWUL 3S3SA 2G9HA 4EIGB 3W9DB 3ECBB 1T04B 2WIIA 2C1PB 3LSOB 3WN5B 4CJ1A 2GJJA 2NX5A 4ODHL 4RBPH 3LKPB 3MCLH 1JHKL 1NL0H 5JOEA 4HQQL 4D94A 2HKHL 4OLXH 4NHCH 4FQJL 2BNQB 3X11B 3I3EA 1UZ6F 2DWEA 2NX5E 1F00I 3HG1D 3WL9A 2BVTA 4ODSH 1P2CB 4XAWL 1D6EA 4BYHA 1DQDL 5GS0C 3INUH 1KB5L 3MOAH 4HS8H 5FGRA 2AJSL 5MEPA 5I76A 3BHBB 1WIUA 3VRIA 5ABDE 4PGZA 1X5ZA 1LO5B 3RIFF 1ZV5A 4DZ8B 3DRQB 4HX1A 4LVEA 3M17B 3HI6L 3P4NA 5EUKA 4OD1H 1X4YA 2DJSA 4J7RA 5GSRA 3HAEB 4X6CF 1TIUA 4NQEB 3QIWC 5D7JA 3OJMB 3UC0L 3I3BA 5JPNA 2V17H 4RQQB 1JPTL 1ZGLM 3MV01 2XY1A 3GSVA 3H9SE 3C5JB 1WT5C 2BOCA 1RU9H 1WCQA 4TSAH 1CG9A 5I6XB 2B2XL 2A9NL 4M43L 1SY6A 1T7XA 5TFSL 3REWB 5IJVA 3FB6B 3EYQC 5C2BH 4YC2B 1GGBL 3T0EA 4JZJC 4FZEL 1ED3B 4H1LB 4M61B 2Q3AA 2ARJB 1FNGB 4CN6A 4G8GD 2BVOA 3QEUB 2Q8BL 5A16B 3QIWD 4O51A 2Z8WC 5I8EA 4IMKC 3RDTC 4JZNA 1NJ9B 3OGCA 5JIPA 4UDUB 3L5JA 5J9PB 4OCSL 1CLZL 2MSPA 3HPJB 3WDHA 3RVWD 5I16B 3EYQD 4Y4HC 3KPSD 3MUHL 4EVNB 4YQXH 1OPGL 1J8KA 3NGBC 4PRBA 3TIEB 1ORQB 1T1ZB 4DOHE 2DBLH 4NQVB 5GJTH 4UTAH 4E42A 1MHHB 2BHYA 4FXGB 1XGYH 4NT6A 4WTXA 1FLRH 1QG3A 5A2IH 3PQYA 1IBGL 1FNEA 3G9AB 4CMMB 4NGHH 1HHJA 2NY4B 2NY7H 3PWNA 1IEBB 2E9JA 4X80L 3VGAB 1TQBC 3MXVH 3NABL 5FKPA 5K93A 4KXZH 4AEIL 1S8DA 3PQYE 1KPUB 4OCYL 4LSPH 4DVRH 4JGJA 3L3GB 3V0WH 1RZKC 4XC3H 4WEMB 3HRPA 4LFHD 1V3JA 4NKOB 5GS1C 1S5IL 3T3PF 1FZMA 1AXTL 2EDWA 3V95A 5I1AA 2WBJA 1U2CA 1JYVA 4OCWH 4PJDF 4DTGL 3SKNB 1KBGH 2H32H 2F53A 1KCRH 25C8H 4HIHB 3T0DA 4JREC 3SJVA 4JO4H 1W8OA 1EO8L 2KQNA 4OIAA 2NY0D 5HHNB 2ZPKL 4JPKL 5KSUA 1JFQH 5IR1B 1VFUA 2HTLC 4W4OA 5HBBA 2LAAA 5CJQH 4Q6IA 1R3JB 5GIRB 1MCEA 2YEZA 2P4AB 2AJZB 1KIQB 3IFLL 4EN3B 4DUXA 1OAKL 1EEZB 3TCLB 1UG9A 3GGWA 1RI8A 32C2A 2R1YB 1ZT1A 1UM6L 4JQVA 5IVXA 3QYCA 2W0LA 3CLFH 4U6YB 2DBJA 3VFOB 3CIQA 4Z8FH 2NCMA 2CKNA 4FTVD 4MYWB 3FB7A 5AG9A 3TBYB 4TQEL 1QFUH 2NNAB 1RVFL 4XCCH 4MB5A 5CLTA 2CDGA 1A7OL 3A67H 4KK8C 5IVXE 2ZUUA 2VZSA 1QFPA 1KNOB 3MV7D 2WP3T 5DO2C 1GRWA 2VXUH 2VZOA 3PV6A 2D31A 2I9LB 4NN7C 4U1MB 3TYGH 1MIMH 2ATPA 1X5LA 4DJMA 2DLEA 3EO0A 4MMZC 4NNYA 2XWBA 5C2UB 3P3YA 3SE3A 1M71B 5E94B 5C0EA 3BPLC 1BD2D 3O8XB 4HUMB 5I75B 4YGVA 5DJZB 1Z2KA 2OL3B 4TUOB 3HUJA 1B9ZA 2DM4A 4XVSL 2FJFB 1H5BA 4G42A 3C5ZD 4L4TA 4G6KL 4YX2H 4XAKD 4KK8D 2WWKO 1FO0B 4MJIA 5DO2D 1QFWI 4CRPA 3LN4B 4MNQB 2JB6A 3WJLA 3HUJE 2P24B 4XBEL 3VFTB 3QUMH 1JV5B 4U2YA 3MGOB 1H15B 4HGMA 4MJIE 1QLEH 4ZO9A 2H3NB 5DMIL 1QYGH 2MPAL 1SJXA 3WFDL 1I1AD 4XXDA 4AENA 1UZ8A 3UXFA 2FL5A 5IOPA 5A2FA 3VD9A 1Q9KB 2DMKA 5T1LB 5HHOB 4HK0A 4PJ5E 4RMQA 5JHLH 1AD9A 5JXEA 1RFDH 2YPLA 1N3NB 3AB0C 4F9PC 1QBLL 3GBML 4XP9L 3K4ZA 1F97A 2XTJB 3QHFH 2NPLX 5IVOA 3BWAA 4R9HA 2B0SL 2YPLE 1U58B 2FR4A 1MFDH 2XNAB 1P4BL 3L3DB 3VFVB 1U92B 3EYFA 1U93A 4U0RB 2DQHL 5EOTB 5DFVD 4PJBA 2KZ1B 2O93L 1MFCH 1IAMA 4MAUL 5KZCD 3TBTA 1UB6A 5FYKD 3B9DA 1YPZF 3DTXB 4Y19D 3MGTA 1AQDB 1AP2A 1RSFA 1IMHC 1YEIL 4FFZL 3MJ8A 4QOKA 3O0RH 4ELMA 3VXOA 4PJBE 3FB5A 3CXDH 1JF6A 1U8JB 2C4XA 2FECL 3VWKD 1A3QA 1LE5B 4TSBH 4P9HL 1QLRB 2DLIA 2MCPH 3X3GL 1JZ4A 3MLSL 4ELME 4BQBA 3V4VL 5HDBE 3RHWF 4C59B 1ITBB 2HT4C 4KVCL 1M4KA 2W60A 4U7SA 4LQFH 2PTTB 3PGDA 2RCSL 4HPYL 1IEHA 5C7XL 1YEJH 1HEZA 4L8SB 4X7SH 4RIRA 5EU4B 4FQHA 1KEML 1NMAH 4G6FD 3KJ4B 3WS3A 4ODVH 1AGCB 4F7EA 4U6TA 1N0XL 1QVOA 5C0ND 1W72A 3V4PH 4MHHG 5ECJE 1LMKA 4YHKL 4JFOB 2IGFL 1YNKH 1BF8A 5DJYB 4S1QL 1NEZG 4K8RD 3KLAB 1KJ2H 5I17B 2HT4D 3DSFH 3OAZK 5JHDE 1FGNH 1WWCA 2DN7A 4RFOH 4KWUA 4ZFOL 2ZOKB 3QQ9D 4EZMA 3CPLB 1UCBH 1KPRB 1MLCB 4P5KB 3CX5J 4JPWL 5GGTA 4QGTA 3G9VA 2MTPA 2VLKB 5KTEL 2D0HA 3ROLA 1B6DA 1J0IA 1SVZA 1XF5B 3EW3B 4D2NA 1I7TB 2XYCA 3P2TA 3L95B 5E8NA 4M62L 2B4CL 4IRJD 4CN4A 2JK5B 2AK4A 3N50A 4O02L 1XMWA 2VXQH 4L3ED 3S98A 5CJXC 4KDTA 1QSFD 3TA3C 2Z31D 3RZCA 4I0PB 4PJXE 2PO6A 2DJUA 2AK4E 3PF2A 4P57A 4GKZB 5HVHC 1BM3L 3U79A 1HINL 1TXKA 2YUVA 3JV5A 3RFZC 3SQOL 1JJUA 2VXSH 1I9IH 5IB1A 3OB8A 5D7SH 3EO9H 4ZUWB 5AYUH 4ENED 3HNTL 3HG1A 3DGGA 5EU6D 1ZT7B 4OI8A 2EDLA 1ONQB 4WW2A 4UIKH 4FABL 3NH7H 3T2QA 3KYAA 1AR1C 5SWQB 1I85C 5EBWA 1EH9A 4OT1H 3C60C 1O0VA 3VFUA 1ND0A 5GISL 2GJZA 5T1MA 4K55A 3LOWA 5L2JB 4XX1G 4KK9D 4P59L 3SCMB 3O3BA 1EMTH 1YEEL 3OG6B 3O6KH 3U2SA 3FB8B 1XCQA 2X9XA 3QXDA 1OWRM 3KPRD 3PHQA 1V7MH 3NCEB 1LP9F 1PG7X 1L0QA 4LLUA 1Q8MA 2DM7A 3DOSA 3SO3B 5D71H 5E56A 2K3TA 3VA2C 4XVUC 4FQCL 5K9JL 4EUPA 1ADQA 6FABH 1AR1D 4AIOA 5MERB 2R56L 1RK0A 2JB5L 4MA3A 3S35X 4OF3A 3DUUA 5J4MA 4WTZG 3QR2A 4NFCA 4X4ZA 1FPTH 3GNML 5TDNA 3DWTA 4G8GA 4BFBD 2LU4A 3RNQB 4JY6A 2CR6A 2CXGA 4DW2H 5J3HD 2ZUVA 3MFFA 4AMKL 5F7EH 2FLBT 2DKSA 4OF5A 4G8GE 4XVUD 2DQCL 1UQSA 1D5ZB 4LRNL 2NTFA 2DTSA 3VI3E 2E3VA 2OTPA 2OTWA 2ZKHL 2X70B 1XF2B 2BSSA 1A6UL 3DV4A 4LIQL 2FECI 5AWNH 2R0ZL 5HVGB 4NQDB 3KPSE 1FV1B 5TF1H 4JEGB 2VISA 4GRLD 3TIDA 4LLDA 5HYSB 4H8WH 2XZAL 1DANU 3U30B 5HHQA 4UILL 1FIGL 5DRXB 1ZWIA 3CFKA 1F4YL 3REVB 1IFHL 3TPUA 2GCYA 1CE1L 2P5WB 3O6MH 3P9MB 4LLVA 1WZ1L 4HJJL 2CO7B 1K5NA 4PJAA 2X4PB 5E99L 2VLMD 5B39A 3P40A 4UT7H 3LH2L 5IEHB 3N9GH 5A2LH 1S7UB 3OAYH 1SEQL 4XPAH 1FH5L 2VUYA 1B2WL 1OAUL 1F11B 5EOCH 1CD1B 3I6LD 1EEYA 3HS0B 4N9GB 4UQ3A 3DX8A 3MO1A 1YEDB 3KJ6L 4NWTL 3IETB 5BS0B 1AI1L 4R26L 1MWAA 1PYWA 5ENWA 5E8OB 1ZLWH 4H26A 4APQC 5AEAA 3D39D 3WIFB 3G6AA 4X83A 2Y36H 5E1AA 1KACB 4L4JA 4HWEH 1NCAL 4HHAB 1ZA3B 4Y16B 4PGDB 2KL6A 3VXUA 5ITBH 5IMKA 3V5HB 3LPWA 1OD7A 3ULVL 1KEGH 2KZWA 4PJIF 3NMEA 4WWKD 3L5XL 2X1OA 2VN4A 3LPFA 4FTVA 2IG2L 1NFDF 4LDLB 1R24A 5FO8B 4ZAKC 1T21B 5LXGH 2EH7L 1X5KA 1NEUA 3LKQA 1YN6B 4UTBL 3QPXL 3MV7A 4XNYL 2A74A 4FRWA 5MENB 5CEZL 4YXLH 4FTVE 1S5HA 5C8JA 2R4SL 3SGDH 4YDJA 1KIUA 4PJHB 4MJ5A 5E2TH 4KV5E 2V7NB 3MV7E 3KPPA 2G60H 4OCRH 1GC1H 3PIQB 2W92A 1T1YB 4ODBD 1CICD 4WUKL 1I3GH 4OTXL 1BD2A 1K9TA 1SJEA 3GMOA 2DQUL 1G9ML 1MQKL 5LJYH 4L9LC 4ZAKD 2F74A 2PNDA 3MLRL 2WLYA 2OQJA 43CAA 2BXYA 4E0RB 1BJ1J 1E28B 5I0DA 5C0DB 4GKOA 4RFNC 3SOBH 5IB3B 3L3HA 4LF3B 4XGZA 1KTDA 5CP3H 3QEHB 2J5LC 3FQNA 4MD5B 2YWYA 2C5DC 1XIWB 4NO3B 3LAFA 5F7LB 5F3HB 5JR1H 1DUYB 5CEYA 3RZWA 2BSED 2DIAA 1I1AA 3PWPD 3F7VA 4LAQL 3KR3L 1IAIL 5F96H 3QDGB 1UWXK 4CVZB 5GGSA 1VA9A 1RJLB 1TJHH 2A6JB 3MX0A 3IDMA 4JO2H 3GSNL 2G2RA 4XMLL 4PTUB 2MOVA 1LEIB 4U1HA 3SE4A 4G80A 3VFWA 2R2HA 4WI4A 1IGYA 4PBWD 4XP5H 3FT4A 4JPIB 4OLEA 3TV3L 1QNZL 3G5YB 4JHWL 3RGHA 4OSUL 4NQCD 4GRWE 1KULA 3B6SB 3OBAA 2UY6A 1KELL 1SM3L 3F5WB 4L5FL 2VDMH 4N0UB 1JGEB 4KJQC 4ISVA 4JFEB 1RUML 4OAWA 1YJDH 4ZFZA 1WTLA 5DMGC 3FQXA 3KPMA 4YDVA 2Z0BA 3U36B 2GQHA 2X4UB 4Q9QH 1Q1JL 1RZIA 3WHE1 2JJUA 4OGYH 5J6GA 4U3HA 3ULUD 3BISA 4KQ4L 9CGTA 1RIVL 4Y19A 4PJGE 4S0TD 5H8DA 2CIIB 2GT9B 3CFDB 3QNYB 3MUZ1 2CRIA 5E9DD 1KIPA 3WN5C 1F3JB 5JORA 3CFCH 4X5LA 5FYKE 1NMBL 3M8OH 4M8VA 3AVEA 4Y19E 4XHJC 3VWKA 3ZHLA 2JELH 1NGWB 5E24E 2ORBL 3QH3B 1YECL 4F7PA 1KT2B 4CN1A 3HZMB 4LSTL 4PG9A 2O61A 1HSAB 3OG4B 1DTUA 5HGHA 2EC9U 4XH2B 2EXWC 2IALA 1HN1A 1VACA 3MR9B 1NC4B 2DM2A 3PP4L 4V1DD 3V6OA 4X8JB 5I8KL 5BZWA 4QHLA 4ODWA 3T2PA 2YK1L 1YZZA 1I7RA 3KPLA 4ALAH 4QXTA 4O2FA 43C9A 1IAKB 1FNSH 3ETBF 4X5WA 3STZB 1HHIB 1IC4H 1MI5D 1NEZB 4Z7VA 2QR0A 1CXHA 4I18B 4JG0L 4GXVL 1K8DA 2J6EA 1DQQA 4U1NA 4HWBL 4ORGB 2H2PC 2A83B 4ZUSA 2E8ZA 1OGAB 1QSZA 1W0VA 4DGVH 2Q7NA 4KVNH 5I6XC 4LGRB 2W9LA 1OAYH 2J4WH 4NOFA 35C8L 3S36L 2ADGB 4G6MH 3QUZB 2C9AA 5FV2A 1MJ8H 4YC2C 2COQA 1J87A 3H3PH 4OQTH 4OBSA 3HI5H 1ZLSH 1E6JL 2LV4A 3G04A 1BFOB 5KSBF 4XTRC 3V9FA 3HE6B 1MUJB 1KPVA 2VDKL 2A1WL 2BC4B 5C09B 5GS0H 3UYRH 5L2KB 3F7QA 2GSIB 4P4RB 3OKNB 4I2XB 3TC9A 4LSSH 4IRJA 4KK6C 1FVDB 4DN4H 2VE6B 3QPQD 4G8FB 1S9YA 2I24N 1WJ3A 4L3EA 4HS3A 3S37H 1QSFA 2P46B 2Z31A 1MY7A 5FYLD 1OQOA 4L8BA 5CINH 2QKIA 3FHAA 5DI8A 1HWGB 4ODTL 5JDSA 3ELAT 3DVGA 3Q6GL 3N1QC 4L3EE 2BX5A 4G6JH 1QSFE 4UT9L 1ORSA 5D8JL 2W9EH 3LN5B 3SDCB 2LVEA 3QHZL 2CUHA 3UTSA 5KG9A 4RFEB 1OB1A 5KN5B 3OXSB 4QRTB 3T8XB 1A21A 5EU6A 5MP6H 5T5NF 4E41A 5DJXA 2NY4C 4FQ1H 3VGAC 1VB9A 1XGTA 3J8F7 2IPUK 2MQ3A 3MRLA 5EU6E 2A77L 5CEXA 4M1CC 3OJVC 1F58H 2CMRH 2H2SC 1S7QA 1T22A 2V7HA 3IFPA 1U8NA 3TNNB 4RRPA 1EIBA 2VLJA 1N5AB 2X4SA 3BRFA 3KPRA 2FSEB 4U1IA 4Z78B 4OV5A 4F15B 1PW3A 4HUWA 1A22B 5GXBB 2IPTL 5C0AE 3LRSA 4HUNB 4WFGD 2I25N 4C57C 1A14H 2OTUB 3F7YB 1S9XB 3DURA 5DK0B 3GHEH 2AXHA 3GIVA 2NYYC 3KPRE 5CZVL 4GBXD 3T0VA 3GJFK 2VXVL 3MUGA 3QEQD 1T89A 3AAZA 3M1BB 1PX4A 1Z9LA 4ZMAT 1Q9OB 4PJDB 1UWGL 3CX2A 2C4FU 4KROB 4EN3C 2BMKA 2NY5H 3FQWB 4Z7UA 3VMNA 2CR3A 1A6ZB 3ILPA 5J1AA 1OP5H 3EJJX 1MH5B 2QADB 3KYMB 3RA7H 2Y07L 4QHUA 4Z7UE 4J8RA 3FTGA 3RIAK 4L29B 1HHKA 1R3LA 3MRCA 3GSUB 4JFDB 4AM0B 2XI9A 4MD4A 4OD3L 4KJPC 3EFFB 1OQXA 4LLYB 4QWWD 4EDWH 2YSSB 5ELIA 2DDQL 3OJDA 3C9NA 4NHUB 4XNQA 3UBXA 4KQ3H 1X5YA 5IQ7H 2XIDA 1TLKA 1Y6MR 2AEPL 2IH1B 3BP7A 4QHKJ 4GRLA 3MRRA 2RB8A 5CBAB 5D1ZB 5B3JE 1ZVSB 3HCVA 3RI5F 5LWYL 5CP7A 5I75C 3MNWB 3TH4T 4F7MA 3NFPA 2LVCA 4MQ7A 2F58H 1FG2B 5IT2L 5JO5A 4N1HB 5F9OH 3D9AH 5EIIA 1GOHA 4X6EB 3BAEL 1NAMA 1T1XA 1OP3K 1EAJA 5F21B 3BQUB 1F2XK 1TENA 2BCKB 3GSWB 3FFCD 4OLUL 1FNAA 2WP3O 4I8DA 3GK8H 1CT8B 3KHQA 5E6ID 2IBGA 2NXZD 2KBGA 4OF0A 3UO1L 3VD7A 1YNTB 5DJ6A 5GS3A 2VLME 1Z3GH 2DLFH 5H37H 4FZ8L 5DEFA 3H6JA 1U8LB 4DVBA 5ID1B 2P5ED 1ZHNA 3U7YL 3MRMB 1SHMA 1NAKH 4KTDL 3I6LE 5DJ0A 1HYSC 3TT3H 5EULV 5IWLC 2H8PB 4KDVA 4OZ4B 1AJ7L 5ICYA 3ABZA 1EPFA 2DQGH 1WTGT 4K23L 3QISA 4JY4A 3Q1SH 3QUMA 1NFIB 4Y5VA 2XTJC 1RIUL 1PY9A 1IE5A 2Y06H 3D39E 3MBED 1NGPH 3CVHH 3VGGA 2FO1A 4GRWH 4WWKA 2AGJL 4F9LC 4U0RC 2V5RA 4PJ8B 2EDEA 4KKBD 3RGVD 1RULH 2WW8A 1MLBB 4Z7WF 2EKSB 1HQRB 4ERSH 4Y89A 1FL5B 1ZXQA 3NACH 4PJFE 2F5BL 5C08D 4MX7A 3TT1L 1CTNA 2Y23A 4ZO7A 3PL6B 4WU7A 5I1GL 1CF8L 5LAXA 1WCBA 2NR6C 3RNKA 2E6QA 2YA2A 4MDJB 4YHOH 3V6FA 4XXCA 4QYOA 2H9GA 3Q5OA 2CLVB 2XXMB 1KCKA 1CICA 1NSNL 1MHEA 2OX5A 2Z4QB 1P9MC 3HRZB 3H2WA 3V52H 5L8LB 4U1LB 4XP1L 1PJ9A 4JVWA 1A7BA 2BVPB 3QJHB 3ARDD 3GMPA 4UNUA 2NXYB 5JOFB 4XP4H 1FL3B 4LARH 2HLAA 4K2UH 4CMHB 3DX6B 4L8SC 4GQPH 4G8EA 2QBWA 2X4NA 4Y2DB 5T1DH 1IAIM 3DXAD 4Q0XH 4P46D 3U9PH 5DUBA 3RPKA 4D3CL 4HGWA 1DN2A 5DHYA 2H26B 5JW3H 2V5SA 3RQ3A 1I7ZA 4R8WH 2FJGB 2HKFL 4I5BB 2IBBA 4LEXL 2Y25A 1NQBA 2ICWI 4ZFFA 3GRWH 4HKJA 3MRKA 1C12A 5H35A 3RWGB 1UM4L 2Y4SA 1I1CA 2IC2A 3TJHD 2FNBA 2AJ3A 1UJ3B 3KNBB 3PWPE 1G7LB 1OCWH 3ZKSD 1D9KD 3HC3L 4JJ5A 1UM5L 3HC4H 3DVIA 1CL7H 3QFJD 3I6KB 4KUCF 5E5RB 1A9BA 4FQLL 4NZRH 2HN7A 4M7LH 4I48A 1PLGL 3T65B 2D7TH 3S3JA 3GM0A 4UOW1 1KJ2A 5FV1L 4NQCE 4DKFL 4Y4KB 1T20B 4BKLB 5DD3L 3HNSL 1YNLL 3ZT5A 3KDMA 3QWOA 3U82B 3GSNB 4MZ3A 3X17A 4FNLL 3G5ZB 5D6DC 4OCLC 1X4ZA 1DL7L 1M6OB 4Q97A 3NZHL 3JV4A 4I0PC 4P23D 4XZUA 3N1FC 5DR5L 4CADB 4WU5A 4L9DA 1QSVA 3UTTA 3S3PA 4YXKL 4Y0GA 4YXHL 4X7DC 3ULUE 3QCUH 4Z5RA 4KZDL 2FEDD 1VSCA 2D7QA 3QCVL 1R5VB 3WHXA 3C6LB 4AK1A 3B5HA 2P8MB 5F7NC 2GTWA 5E70A 5E9DE 5JW5B 4CBPA 5HDBF 2VL5A 2GK0B 5JNYB 3BEVA 5D96B 4WDIA 3GSRA 4U1SB 5AZEH 4V1DA 3SE8L 4QT5B 5TPWL 1D5BB 2J8HA 4M48L 5L88H 4UV4H 2HA1A 2NY2D 4QGYA 3IDIA 1MI5A 5DURB 2XG4A 4GW1A 3JTSB 1KJ3H 3QQ4A 3CDYA 5AUMA 1GAFL 5KW9L 3CXHJ 1G7PB 3HC0B 3HE7B 5C92A 3WFHB 5IV2A 4LCYA 1U3HB 4NN6C 4P2RD 2QHLA 1MI5E 4ZUUA 4QRSB 3SO3C 1PQZA 4HIJB 4DUWA 2EXYD 5T5NG 1ZMYA 1DVFB 5C6TL 1MELA 1HH9A 3PWVB 4FG6D 1SY6L 1WWAX 2BK8A 4LKXA 4JKMA 2AI0L 3BH8A 2XN9D 2R0LL 4LHUD 1I1FA 3OKEB 1IC7L 4QRQA 4WRLA 3BP5B 3X14B 1LP9B 2DQDH 4BELD 3MRQB 2GY5A 1MFEL 4PRDA 4XMKH 3VRJB 4P9ML 5CCKL 4KRLB 3BVNB 3WIHH 3KYOA 3SBWA 3CFBA 3K0WA 1HSBA 5EFIB 3DMMA 2I60L 3DROA 1IARB 3OMZA 5IW3A 4M8QB 1AGBB 5IHZA 4ONGL 4X9IA 1CFSA 5KSAD 3DYMA 4MNGB 5DJ2B 4PJXF 5ADOL 2PTVA 5DVMA 3GMNB 3IU3A 5IK3A 5F7DB 5FK9A 1NC2D 4GG8B 3IJHB 5IF0A 3W0WB 4O5LL 1BFVH 3Q3GA 4HIEA 2HH0H 4R2GB 3KPTA 4ZQKA 4HF5L 5FYLE 4K71B 4XPFL 4A6YA 4DQOH 4PJ7A 5EC2B 1DBAH 4NQXA 2CDEB 3GO1H 3D25A 4UBDC 3WD5H 4JE4B 4PP2B 1Y6KR 1WC7B 1E6OH 5I1LB 1ZEAH 3BD3A 3MA7B 1U8MB 1V3KA 2R4RL 4QRPB 3V0VB 3ZDYE 3LCYA 4HJGB 4NKMB 2FBOJ 3D5OF 3MLTB 3TLRA 1KCVL 4BH7B 3U4BH 1ZGLA 1J1XL 1M05B 5BRZB 3HNVL 3WNMA 1TETH 2DMCA 1R3KA 4P2OB 1JGUL 2QQNH 3CCHA 3CH1B 4PTTB 2HLFC 1A3LH 4AL8L 3PWLA 3QUYD 5IMOB 2IMNA 3O11A 1JZ7A 1FVEB 2ZSWA 3N85H 4I77L 3AMLA 2HAZA 3ES6B 4W70A 5HDQH 4C83B 2IADA 3B2UC 1U3YA 1OTUC 4HS6B 2UUDK 4OZHB 4GBXA 1DFBL 1YMMA 5EBGA 1B0RA 2O26U 4TRPL 4WFGE 1KN4L 5C0GB 5A2JH 3QEQA 1MCCA 4S1SL 3IS0X 1YY8A 2OJEA 5GGVH 5E00A 2CIKB 4Y16C 3D0LA 1GZPA 3W11C 5DQJB 3QEQE 2QSCH 1UKQA 4XCYA 3JXAA 3DI3B 5ID0B 1L7TL 3BUYA 3ARFB 4JN2B 4AG4L 2HWZH 3MJ7B 1A1MA 3L5WA 3B2UD 5CMAA 3DARA 1A7QH 3BXNA 1GOGA 1JCKA 1TJGH 1UXSA 3ZE0E 5FA4B 3H9HB 1LO0H 1R0AL 1WEJH 3LQZB 2ED9A 4IMLB 1G84A 3MV9A 2VR5A 5MEOB 2Z91B 4QRRD 4PJIB 2ENYA 3LEYH 1DEEB 5BO1H 3DHMA 1G7QB 1BZ7A 1VKXA 1JWUB 4UUJB 4GMSH 2ADFL 4HKBB 2AW2A 3IJYB 1KYOK 2NY1B 1WGOA 1E4JA 5DD1L 3DPBA 3LN9A 1WF5A 4E9LA 4PJEA 5DT1H 4WFHD 1HIML 1VGKB 2IQ9L 3FFCA 5FGSA 4NRXA 2JCCE 1Q72H 1FYTA 5E6IA 5EA0L 5EC1A 2YPKA 3RU8L 1XIWC 3MRNB 4JFYB 3WKMH 2ZCKL 4LNRA 4OF7A 4PJEE 5C3LD 1U8OB 5EUOB 2BJMH 3FFCE 3TO2B 2NQCA 4NBYB 1FN4B 1JNHA 5CJOH 4NRYA 3BDBA 2P5EA 1U8IB 2YWZA 2ZCHH 3WLWC 3VFRA 1KLUB 3VJ6A 3ZTNL 5BOZG 4PJ9B 2UV3A 5BOPA 2JJVA 2P5EE 5CP3A 3IXTB 1TVHB 1F6AB 5I9QB 1MHCB 3IU4H 2PR4H 1WITA 1JZ6A 2CGRH 3BT2L 3D3VB 3HPLB 5F8RC 5CILL 4D9LL 2F54B 3MBEA 3K7UA 3HMXA 3U0WL 3LQAL 5DK2A 1RK1A 3MLWH 2EE3A 4TVPL 1FORL 3QJFA 4YK4B 1F4XH 1QQDA 5MI0B 2ENSA 3FO1A 4J3UA 4ZTPH 4KHTL 3RGVA 1BLNB 2IAMA 3QDMB 3E8UH 1ZSDB 4U1KA 4Z7QF 1JNNL 3UYPA 2DQIL 3TN0D 4F57H 4WFFD 5C08A 1JHLL 1R3IL 3EZJB 4OZIB 1EHXA 5CGTA 4ZS7L 1IM3B 3D18B 4RISH 2GEEA 5EPMA 3UJIH 3RP1A 4KV5F 2BDNL 2EH8L 4ZNEA 4Q6YA 5LCVH 3HZYB 1KLGA 4X4MA 3S88H 3BP6B 4Y88A 5ILTH 5SWSD 3K2UL 4WCYL 1AGFB 3TESA 1FFNB 4C56B 4ZNEE 3BOVA 3DLQR 2HJKB 3FFDA 2AQ2A 3ARDA 1FJ1B 2QLVB 1NPUA 2FYYB 2QSVA 5EZJA 1A5FH 2P43B 3DXAA 1F4HA 4P46A 2VIRB 4PFEA 5DHVB 3FN3A 4NUGH 4I18C 1EAPB 1Q9WB 5FO9B 3L5IA 1C08B 4HKZB 1U95B 4LCCB 4P9HC 1P1ZB 4M9OA 1WSST 1W72L 3VCLA 2W0KA 3DXAE 5T3ZH 3A0OA 3QZWA 1V7NH 3P4OA 2N1KA 1PZUB 3NCFB 1NCCL 1XCTB 3PV7A 4OLVH 1BQHA 4P4KA 5HPMA 1XR8B 3OR7A 1OSZB 3SGEI 3QT2A 1G6VK 2NLJB 4UB0L 4PRHA 1W0WA 3VG0H 1IGML 3P11H 4PD4K 3TVMB 4DZBB 3QFJA 1KOAA 5GGTL 2NZ9D 5LQBH 4GRWF 3HE6C 2EYSA 3VFMB 1RUPL 4Y1AD 2Y6SC 3S5LG 2JJTC 3VDCA 4OI7A 2VR4A 5KVMC 3JTTA 3QFJE 2YD9A 5F9WB 3DRTB 4YHNB 3BN9D 4MJ6B 1X5JA 4FQ2H 5BZDA 5IM7A 4DCQB 1U8QA 3OX8A 1PAMA 5HDLA 4XCEB 3QIUC 4HXAH 4JQXC 4XC1L 4IRZL 3W5NA 1HCFX 4PJGF 4GAGL 2EDOA 4P23A 1I3RB 3LHPH 3HAEH 1X5FA 1BOGB 1MCPH 1FVCB 2HJFB 3MCKB 4GKNB 3QCTL 1RUAH 2ADIA 3ROOB 1FCCA 3VGFA 2UZYB 1MREL 2Y6SD 4NKDA 1NLBL 2DQFA 3OZ9H 2HFTA 4ZD3L 5HY9B 3FO2A 5D1QB 2GAZB 4LEOB 3I6GB 1CLYL 1QZ1A 2UZIL 4P5TA 1QLFA 5AAWA 1X7QB 2ADJA 3MV8D 3S9DB 4LLWB 4WHCA 4J3SA 4JRXB 4H1LH 5IESH 4IHOB 3QIUD 1FSKC 4C58B 3CU7A 2G9HB 1KCUH 1YYLL 1JN6B 3DETD 3RUGF 4R3SA 5BV7B 2NX5B 3SGJC 3VWJB 2DI8A 2OXHA 4P3CH 3BZEA 1K8IB 1BZQK 2PXYB 4F15C 4ZDHB 4ZS6D 4P2RA 1A7RL 4TTGA 3BKJL 1RIHL 2MCG1 1D5IL 4URTB 4RGND 3WL9B 3BMWA 1LK3H 3LKSA 1D6EB 5EH1A 2V5YA 3EUUA 1NGQH 4P2RE 3VXSD 4K7PH 4YE4L 4XCFL 2CLRA 1ADQL 3SDDD 2DL2A 2XN9A 4LHUA 1LK2B 5MEPB 1KN2H 4NNXA 3W82A 5I76B 1DLHA 2K7PA 3VRIB 3EO1A 1M7IB 4YZFF 1KTLA 5I30H 3H9SB 2X42A 1YYMH 4HX1B 4J4PC 4NC1C 3RWDA 3P4NB 1BP3B 1QBBA 4G7VH 4KROC 4UV7H 2KKQA 2XN9E 5GSRB 3PHSA 4X6DA 5D7JB 3T2OA 5JPNB 3GJFA 4R4FH 5E2VL 1JE6A 2QADC 2UVFA 4KPHH 2W1NA 2BOCB 2YD1A 3V6BR 1CG9B 4B7LA 4X6DE 1CDHA 5IJVB 4M6OH 2FGWH 5KSAA 3EJYD 3EYSH 4PLKD 1BMGA 5C0BD 3T0EB 1X6LA 2OK0L 1JWSA 4YBHA 1NC2A 5EDXA 3V7MA 5L6YL 3O81A 5HYJA 1OM3H 4EUPG 1QD0A 3BRDA 1OTTD 3TJEH 4LGSB 1Y0LB 1LEKB 4MS8C 3TBSA 3WFBH 1TZIA 2BVOB 3V6ZA 4UMGA 4RMUA 4O51B 4PREB 2FBJH 1JGVL 5I8EB 2EEDA 4JZNB 3ZKND 2APBA 3VXQA 1EFQA 5KS9A 3OGCB 3PWUA 4JCMA 3F12B 1ZS8B 2R1WA 5GRYA 5GS1A 1CR9L 5JZ7C 2E7LC 4DOHB 2W91A 3BQUC 5CGYC 2CKBB 1EHLH 1D6VL 4HC1H 4OM0L 4RNRB 1A3RH 4XWOC 2MQ0A 2NY6D 4GSDL 1U8HA 2N7AA 1J8HD 4PRBB 1RZFL 4NZTL 3QUYA 1MCWM 5JOPD 4HPOL 4AYFA 1BX2B 2X4TA 1A4KA 1QA9A 3PQYB 3UAJC 15C8H 1BAFL 4NKIL 1OTSC 4JM4H 4GUPA 1MWAL 4L3CA 1HHJB 2ZG3A 3PWNB 1G6RL 3ZYIA 4G8IA 1CZ8L 5TE6H 5FKPB 1S8DB 4NJAL 3AFLA 3FO9A 2XQYG 3WJJC 5DUPH 3BPOB 1DANT 2YMXH 3C09C 4NNPH 2OL3H 5I8OL 4TSCL 5BQ7B 2BVQA 4JHAL 5I1AB 2UWEA 3QDAA 1MHPH 4C54A 1DBBL 3IDGA 4KKNA 4LFHG 1FO0H 2F53B 4PJ8C 4PP1C 4Z7UF 3UDWA 3DX9A 5E5MA 4WGWB 1D5MA 5HGAA 5KSUB 2LTQC 1J10A 3MLZL 5GZOD 4TUKL 4RMSA 3QULB 1F13A 4N8CH 1U2HA 3GBLA 1MNUL 3LVEA 1VEPA 1XGQA 4M5ZL 4OM1L 1XH3A 2YEZB 4HG4J 1KC5H 1IQWH 1PFCA 3CVHA 3VD4A 5JLZA 2AEQH 3ZZ1A 3ULVC 5INDA 5DDHB 4XPHL 3GGWB 4QRRE 2EICA 32C2B 4NP4H 5B3JF 1ZT1B 3FZUD 5IVXB 2A6IA 4RGOH 3GMLA 4LLQA 4NZDA 1EBPA 2XWJA 3FB7B 1UYWL 4TPRH 1FAIL 2XPGA 3AY4A 4CMHC 4BK5A 1YA5A 3I2CL 5EOQH 3QXTA 5HGBA 4POUB 3P73A 3D69A 1GHFH 2K1MA 1ZAGA 3B3IB 4I3SH 3UJJL 3PV6B 2D31B 2E27L 3ARWA 5D5MF 1ETZA 1RMFH 2FWOA 5HGGS 3EO0B 4NNYB 3TO4D 2X4QA 4X6FA 5FB8A 3N1MC 4WFHE 3DSNA 3MLXH 3RWIB 4YNYA 1TPXB 3QUXB 5FAAA 1DQLL 3D85D 2EO1A 1G9MC 3QWRD 5I0ZA 4YGVB 4F9PA 3BO8A 3HUJB 1H5BB 4XWGH 5JXAH 3SDXE 3BE1H 4Z76A 1VFBA 2YPVL 2XRAL 3KPNA 2D0GA 4MJIB 3ZT7A 5TH2A 3QAZB 4DN3H 2A6KB 1JWMB 3NFSL 3PGCA 5ESVA 5EORH 2E7BA 1MCIA 4Y4KC 1JI2A 1S3KH 1EFXD 5D7IA 1XF4A 3GB7A 4LLMB 1WAAA 5EU3B 4HZLA 4KUZH 2FL5B 1FFPA 2RAMA 4R96B 2HVJA 4JDTL 3CFIC 2DQJH 4PJFF 3V8OA 1AD9B 5D7IE 2ESVD 5D72L 4ZODA 5JW4N 3QDJD 1EO7A 2YPLB 3WCYA 4GAJL 1J7VR 3IFOA 4WO4A 4TULH 2YZ1A 3P4LA 5DJ8A 3JVGC 4WFFE 2EDJA 3C6LC 1HZHL 2VITB 4KI5D 1UACL 2B5IC 2FR4B 3RJDA 3EFDH 3RAJL 4ZUVA 1U8PA 1J5OL 5D96C 5SWSA 4Z7OE 2Q76A 2IEPA 4JFEE 4OCNC 4HIXL 4PJBB 2BSRA 1MAKA 2B1AL 3ZKQD 2X9YA 3S4SG 1X5IA 3L7EA 5ICZB 4LSRH 5EU7E 5SWSE 3DX7A 4OFIA 2C3HA 1AP2B 3LDBB 4ZOCA 3HZKA 2ZUYA 3MJ8B 3O4LD 3ULSA 3WXVL 4ELMB 5EO1A 1REIA 3MCLL 3VE0A 2JIXD 1NL0L 1JUFA 2R9HD 3HE7C 4OLYH 4RAHA 1IZKA 3FN0H 1JK8A 4OLXL 5E2UL 2FIRT 2J6EL 4NHCL 1U3HC 3SKMB 1CFQA 4RGMC 4ODSL 1J11A 3WV0A 4D0BA 5FYJH 3INUL 3MOAL 4OF8A 3B43A 4HS8L 5GJSL 1DVFC 2W60B 5D2NE 4PS4H 1NUFA 1OAZH 4Y8AA 4GMTL 2WQ8A 1KENH 4G9DA 1HEZB 1ZLUK 2J8UF 4FQHB 2HT3D 2N7BA 3WS3B 5L9DL 2PYFA 1U91A 3CSBA 3VGBA 3O9WB 4PBXA 4KMTL 4F7EB 1IKFL 1OL0A 4Y1AA 1QVOB 1OP9A 3UJTL 4F3FA 2EC9T 5JHDB 4MDIB 2FD6H 4KAQH 1U36A 1RU9L 2GY7B 3L3OA 4TSAL 4Y1AE 3QRFM 5ANME 1RUQL 1J0ZA 1JF1A 5J6HB 4PYGA 2PKDA 3MRHA 1WK0A 4IIQA 1J1PH 2EE2A 1HI6A 2XZQH 2ZG1A 4ONFH 2E9BA 1P6AB 2D0FA 1G7JA 1RURH 2XFXA 2HKHH 1QUNA 1AXSA 4ETQA 2X89D 4R2GC 3NOIA 3U6RB 1F5WA 2YHGA 4K71C 4EI5D 1DQTA 3RVTC 1B0GB 4O9HH 5HI3C 3OKKA 5E8NB 5FUOH 4FA8A 2AK4B 3AM8C 1FZKA 4H25A 4HCRH 1T0MB 4LVHC 4ZFOA 2O5ZL 1Y6NR 2OMBA 2F8VA 4I2XE 4K94C 1C16A 4NO2B 3RZCB 3MV8E 4MA1B 4P57B 1SEBB 1JPTH 4YQXL 1F3RB 4K7FA 1HH6A 2GUOB 2YA0A 3KLHC 3MRDA 2DBLL 3QNXB 3RVTD 4R7NA 4M43H 4UTAL 5IB1B 1S7WA 5DLML 2BOBA 1FLRL 1RZJC 4NKQB 3HG1B 3C2SA 3BPCA 4NGHL 3DGGB 2NTSP 1FAKT 1UA6L 5K59F 4WW2B 5HHVH 3MXVL 1NBZA 3IDXH 2AJVH 2KPNA 2R0WL 4RGNE 2RIKA 4R7DB 3SDDA 5EBWB 1AGDA 4PY8I 4DVRL 1ND0B 5T1MB 1S9VB 2GJZB 3V0WL 4ELKA 4XC3L 3VW3H 3VXSE 1BOYA 1CYGA 1XCQB 1CK0H 1FG9C 3GKWH 3PHQB 4POZC 3BI9X 1KIRA 4LLUB 1KBGL 1MY5A 3ARFC 4F37K 2IWGA 3O45B 4JO4L 3LZFH 2K9UA 4RRPG 5LGJA 1OPGH 5B38A 4EUPB 1B6UA 2EDNA 5C0BA 1WZLA 2V9QA 4W6WB 4MA3B 1RK0B 2A38A 1VGEH 3DUUB 2H6PA 2V5MA 3BZFA 1HE7A 5F93C 5D7LD 4HDIA 1RJYA 5C0BE 5TDNB 4G8GB 4P2YA 4JY6B 3QIWB 3NABH 3CLFL 5EZLA 1JRHH 1Z6JT 2V5TA 2VDRL 3MFFB 4JM2D 4NC1E 4RAVA 4R6UA 4Z8FL 3FQRA 1RHFA 4NQTA 4OCYH 1QFUL 4XCCL 3EJZC 1J86A 1ZGLP 2GKIA 4G3YH 2NTFB 2VXUL 3KPSB 4G7YL 1YC8A 1NAML 2C4FT 5I2IB 3TYGL 1FNLA 2OTWB 1MIML 4KKLC 1QEWB 3OKOA 3DJ9A 4DTGH 2BSSB 3DV4B 1V5JA 1LO3L 5GS2D 3GSXB 1EO8H 1CE6A 5DF0A 4LDOB 4JPKH 3STLB 2CK2A 3CZFA 4F80A 3MJ9H 3ZE1F 5FM5M 2NW3A 1J8HE 3CFKB 5KVEH 5IHBA 4P5MB 3JWOH 5C07D 3O6FD 5J89A 3EJZD 2GCYB 4YX2L 4LPWA 4BA8A 5JOPE 1FZJA 3CH8A 5LBSL 3GUTA 3DUSB 4PJ9C 4LLVB 4Y5YA 1K5NB 5JA8B 5I9QC 4HWNA 3VRLE 3QG6A 3QUML 5E7BA 1AFVL 1OD9A 5ISZA 3NGBB 1QLEL 4RA0C 2I26N 2VQTA 3KGRA 1QYGL 1RVFH 3CD4A 3MNZA 1PGRB 3RBGA 4LIQE 4YK4C 3T4AA 4UQ3B 5MI0C 3DX8B 3MO1B 3K80A 3I84A 3G6JA 1CGYA 1P4LA 4M7JH 1RUKH 2X41A 1S9WA 1PYWB 5ENWB 4JFPA 1SYVA 3L3IB 3ZE0F 5JHLL 5C0CA 2NY0B 5F7UA 4Q7DA 1RFDL 2VOTA 4Q9CA 1AQKH 1HYRC 4FMKA 3G6AB 4JKLA 1A6TA 1IGTB 1BZ9A 5C0IA 1FQ9C 2FH6A 3QHFL 4NM8H 3ZHKA 3V4UH 4L9LA 3VXPA 3BD5A 4YFLF 5FHBH 5IMKB 4NC2B 3ZDZE 1F6FB 2P8PB 3QNZB 3VH8A 1CQYA 4MXWL 3AXLB 4YIQA 3HR5B 1LILA 1IAOA 5E8EA 1MRDH 1MFCL 4FTVB 4RA3A 5IBUG 1R24B 3LKQB 5IQ9A 3U0TB 3MV7B 3O0RL 2A74B 2VDOL 1MCOL 3VXTA 1S5HB 3WFDH 3CXDL 5T1KA 5C8JB 3MRIB 1QBML 2JCCF 4WHDA 4Z9KB 3X3FH 4LCCC 4CAGA 4TSBL 2MCPL 3GIZH 2IFGA 2AJYL 3TBVB 4MJ5B 4AQ1B 1JP5A 3KPPB 2ICES 1S7SA 4XVJL 5D2LE 3SDAC 5D1XD 3PP3H 5D70L 1BD2B 2IQAB 3IDYB 1SJEB 1J0JA 2UY7A 5C70A 1FLTX 4LQFL 2FZ3A 3PABB 1L0XA 5FGBC 1K4DA 5DS8A 1KCSH 3GBMH 4JN1L 4P3DA 2F74B 4XP9H 2F8XC 43CAB 3C5ZB 3BX7C 4X7SL 4D0DA 3NAAL 2AV1B 1KXVC 1TQCB 1NMAL 3MUY1 4WV1A 4ODVL 3L3HB 4J12A 4XGZB 1KTDB 2DKMA 4JFXA 5HD8C 3FQNB 2Z35B 1YNKL 3BYYA 3NIFE 2BRQA 3S96B 4JQIH 5CEYB 3SDAD 1I1AB 1KJ2L 3ECBA 3F7VB 1EFXA 1YEIH 2R0KL 4IJ3B 1FGNL 2C1PA 2BY2A 3LSOA 4JHBA 4PYHA 5FDWA 5GGSB 4Y5XB 3BDYH 2G2RB 4U1HB 3ULUL 3HKFA 4P9HH 4G80B 3VFWB 3IGAB 2R2HB 3CDGA 1WIPA 1IGYB 3GJEB 3S35L 1GPOH 2AEIT 2HFFB 3ARXA 3TFKC 3L7FA 1C5BH 2ESVE 2XA8H 3QDJE 4OAWB 2NY3D 1E4KA 4ZFZB 1PX3A 1T2QL 3IF1A 3FQXB 4YDVB 1SQ2N 5IROA 1BVLA 3S4SB 3NCYP 5C6PB 1KEMH 5CGMA 4KKAC 4KI5E 3M17A 5KZCB 1N0XH 3RIFK 2EE6A 3HAEA 4NQEA 4Y19B 3KG5A 3LMJL 2HJLB 4BQ9A 4XP6L 3O4LA 5A3IC 3SPVA 5TQ0L 5JORB 3IDNB 2JIXA 4JB9H 3VWKB 3MBXL 3FB6A 2W9DL 4N8VA 3O4LE 1AXIB 5GGRY 1P6FA 4F7PB 3BP4B 2JLLA 4XNXL 3UPCA 2O61B 4KJWC 5HGHB 5CSBA 3DBXA 4MZ2A 3ORJA 1VACB 3NH7L 3RVVC 3KPOA 3MRPA 4UT6H 2DQTL 2WMPA 4YDKH 4OT1L 3O6LH 5A16A 4BSWA 1I7RB 3KPLB 2JE8A 4O2FB 4P48A 5DJCA 43C9B 1NJ9A 4QHNA 4X5WB 1OOAA 4G6FB 3UYOD 5A3ID 4JDVB 3HZVB 1EMTL 5KBNC 3O2DH 4MNHB 3O6KL 4X4XB 4XCNA 3HLAA 5J9PA 1CVSC 2DB8A 1V7ML 5D7JC 1DQQB 4U1NB 1G7MA 5AAMA 5D71L 1MCKA 1ZOXA 1W0VB 1MAMH 2D03L 1BM3H 4DFIA 1GIGH 3VFGL 3ARBD 3SQOH 1T1ZA 1IQDA 2AKRA 4U33A 4D9RD 3NCJL 4NQVA 5F89A 3T0EC 1KCLA 1DLFH 3DUHA 2QV2A 1BVZA 3HNTH 1A6VL 2X89A 5EZOL 3G04B 5CSZB 1KPVB 4EI5A 1CN4A 3EDDA 4Z0BH 4A6YL 2AJXL 4BZ1H 3HI1A 4DW2L 1INEL 4GAFB 4IRJB 4Q2ZB 1EHAA 3L3GA 3FO0L 4RCAA 4L3EB 4HS3B 4NKOA 1QSFB 2Z31B 3O3AA 4DKDC 2C7UA 4WEUD 2BVUA 4BSVA 4L8BB 2Q6WB 2QKIB 5DI8B 2OYPA 5JDSB 1UKSA 3DVGB 4GS7B 3ZL4H 3MOBH 3BRGC 1WFTA 4OZGA 3DGCR 5TF1L 4AZ8A 1CXLA 3HN3A 5C0JB 5K9JH 1TCMA 5KG9B 4H1LG 3V5DA 1OB1B 4X7EC 2R56H 2I27N 2JB5H 3K46A 3QO1B 4OZGE 3E0GA 5EU6B 4YDIH 5DJXB 2AJZA 1F3DJ 1SMAA 3O6ML 2EDXA 3OXRB 5DFWH 4EN3A 2BVYA 4RX4A 5CBEB 3TCLA 2C1OB 1XGTB 4HC1A 3MRLB 4Z77A 3A6OA 3N9GL 1HK6A 4U6YA 4DGIL 4J23A 2EE9A 3D6GA 5IB5A 4XPAL 3BPOC 4AMKH 2W0FA 3ZKMD 4X8XA 1S7QB 5GGVY 1T2JA 5DD0L 2R29H 2NNAA 5EOCL 4ZUTA 1U6AL 2X4SB 3KPRB 4U1IB 3JBG7 4LRNH 1EO5A 4HUWB 2WBJC 3IKCB 1VENA 3LRSB 4QXUL 2I9LA 5KANI 3DURB 3GIVB 2VKWA 1A6UH 4FXKA 1UFUA 4XB7A 2R0ZH 1AE6H 4LCUB 1RD6A 4QEGA 1ACZA 2Y36L 4W4OC 1I8KA 3AAZB 3RVXD 4Q6IC 3VFNB 4HWEL 2PN5A 3O8XA 4OZHE 5D7LA 5DJZA 4TUOA 3H7LA 2AABL 5AD0A 3FCTA 2BMKB 4Z7UB 3E1F1 5H2BA 1RZ7L 1KEGL 5J1AB 1TDQA 2WBJD 2ICWA 3B9EA 4JQVC 5EBMB 5D7LE 3J7HA 3LN4A 4JM2A 5E03A 4S10A 2P24A 4XMPH 1BQLH 1S7XA 5LXGL 3FTGB 3SJVD 4JFFD 1HHKB 1H15A 4PGCA 3MACL 4U6XB 1MPAH 4MD4B 5IW1B 1OAUH 4YXLL 4ZTOL 1CDJA 3WIIH 1G0XA 3FMGL 5C9KA 5E2TL 1I9RH 4OCRL 4XNQB 3UBXB 1Q9KA 4F7CB 4RDQF 1GC1L 2F5AL 3BP7B 4GRLB 3MRRB 1TPXC 4E5XA 4KH2A 3QIBD 3TNMB 3HCVB 4FP8H 1N3NA 5M7QA 1OARL 4HFWA 4JG1L 5CP7B 3NFNA 4YHIB 5C07A 3CSPA 1CIUA 4MQ7B 1H5BC 2CD0A 4PUBL 1MFNA 3DHJA 5EIIB 2ZCLH 2XNAA 1NBYB 1NAMB 3SOBL 2VZ3A 2VZUA 3QAZC 3ULVH 4LQ1A 4J6RH 5C07E 3VFVA 3WJLC 5CZXD 1F6LL 5DYOA 5EOTA 1JI1A 1OSPH 4NIKB 4OGXH 1U0QA 3CUPA 2YD2A 5JR1L 3EOTL 5DJ6B 2EH7H 5CZKA 2WINA 1LEGA 1NUNB 4UTBH 3R4DA 5F96L 3KWWB 2OR9H 2AXGB 5CEZH 1MCDA 1INQA 4JO2L 5EZIH 4FQPA 5GSVB 5EUOE 1LE5A 5DMKA 4L4TD 4XP5L 5JXEC 3D39B 5DJDA 4FXLA 1DSFH 3TWCH 1B0WA 3G5XA 4JY4B 4MXQC 2VDML 2CUIA 2PW1B 4Y5VB 3RHWK 4CKVX 2VR9A 2DQUH 2PTTA 1X5AA 3LQAC 1MQ8A 4LASH 2HT2C 4L8SA 3MOQA 5DK3A 4Q9QL 2GTZA 4O4YH 5EU4A 4WWKB 4PJFB 4OGYL 2BZDA 1KXTB 3AS1A 2D7PA 4CU6A 3CK0H 5ICXB 3FRPA 4L4VD 3KS0J 3NIDF 5IBTH 5DJYA 5I1JL 3LPGA 4KY1H 4MX7B 7FABH 3KLAA 2P44B 3CFCL 3H42H 1BBJB 3KR3H 1IAIH 5F3BA 4MQXC 5LAXB 4H88H 2G5BA 2JELL 5GZND 3RNKB 4NCC1 2ITDB 2QHRL 3GSNH 4OZIE 4G43A 3V6FB 2HT2D 4PV9B 4TVPD 2H9GB 2WIMA 1CICB 5D1XA 4KJYB 4LSQL 4KTEL 4B0MM 4JANA 3MCG1 4RWYL 2VLKA 3TV3H 4JHWH 3ARGD 3GMPB 1SM3H 2D7MA 4ZAKB 3WFCH 1R5WA 4ALAL 3SDXF 1A9EB 4GW5B 1RUMH 1IC4L 1WUNT 4QOKD 3W2DL 4PRAB 3ZYOA 2VMFA 1J05A 5DUBB 3BESR 1OAXH 2HVKA 1IGJB 1Q1JH 5F44A 3O3EA 2VKXA 1ZVYA 4KFZC 1RQ5A 3I3DA 1LHZA 3MRJB 3K3QA 1I7ZB 1RIVH 4DGVL 2D7OA 4ZXBD 3PWPB 2E8YA 4KVNL 3RY6A 4ZFFB 1T1WB 4AH2A 2Y7QB 4JCLA 3MRKB 2ZOLA 5H35B 2J4WL 1P7KA 4G6ML 1ZVHA 1NMBH 1NGYA 1MJ8L 5DMYA 5D93B 1TNMA 2L7JA 5HYFA 3O2WL 4OQTL 3HI5L 4JJ5B 4OGAC 5JTWA 1MVUA 1CGXA 5F6HJ 3ZYZA 4Q9BA 4LRIA 4NQCB 1ZT7A 4TNWK 2HN7B 2J5LB 1TZHB 2J7LA 4I48B 3UYRL 4XNMA 5ETUB 5FOJA 5L0QB 2CRZA 5SWQA 4LSSL 2YK1H 3AS2A 3ARED 5J1SC 4Z7OF 1UADC 1T7VA 5E2WL 5FHAH 3G5VB 4CUCA 4TUJA 5L2JA 3SCMA 3KDMB 1T80A 4W6XB 2VUOA 4L8DB 4KDTC 5J06A 4JG0H 2B39A 3ARQA 3JV4B 3RZCC 5CINL 2PO6C 4MA1C 3BEWA 4WU5B 3SGDI 3KYKH 4G6JL 5E9DB 4PLJD 4LCWD 4Z5RB 1GZQA 1DE4A 2W9EL 2Z92A 4OGZA 1RJCA 5T3XH 3LS4H 5F72S 5MERA 2GTWB 5FA3A 2ZNWA 2CK0H 4M5YH 4HCRA 5ITFA 5MP6L 3BEVB 4CNIA 2FJHB 4WDIB 4PRID 1E6JH 4WW2C 4V1DB 3E6FA 2PETA 4HUUB 3RNQA 2X5PA 1OY3B 2J3SA 1WLHA 2PO6D 4K7PY 3GKZA 5E1HB 1F58L 3BKML 4JRXE 3IDIB 4OZFA 4AIZA 1MI5B 1PSKH 1A2YA 1DDHA 4GW1B 1A4JB 4YHLH 1IL1A 3CMOL 1OGTA 1LD9A 4PB9L 5IV2B 3MSPA 4K94H 4ZUUB 2CO6B 1LO2L 4RBPK 1JHTB 4GO6B 3GHEL 1XF2A 1PQZB 4ODTH 3Q6GH 5TJWK 3ARBA 4NQDA 3RX7A 1TZGH 1UENA 4M7KL 2C26A 2VQUA 4LKXB 5CD5D 1AD0B 1B3JA 5EO9A 3WYRA 1I1FB 5EIVA 3EDFA 3RVUC 1KJVB 1IRAY 4MD0A 4QRQB 5DRXA 1HHHB 1QFWL 3Q2CA 2X1PA 1RZJH 3EYOA 3T1FB 4D9RE 2NY5L 2OM5A 1UKTA 5HVWA 2LU7A 4LHUG 3P9MA 3MNVA 3KYOB 2F8OA 4MCZA 1IM9D 4NN5C 5B4MD 1HSBB 4S1DC 3WFZA 5SX4I 3RA7L 5BCAA 5F7YC 3DROB 4R4ND 2EDFA 1A1OB 5IHZB 2A77H 2YD6A 5DGQA 1N2RA 1MEXL 3GSQB 5DEGA 3RVWC 4PJCA 3BPNB 3EYVB 2RFXA 1WBXA 5E6YA 3SN6N 4EDWL 3IU3B 5IK3B 3RVUD 5FK9B 2V2WA 1YEDA 2R1XA 3STBA 4GJTB 4HIEB 3Q3GB 1P4IH 4PJCE 4ZQKB 5IQ7L 1S7TA 1KFAL 4A6YB 3T0EE 4NQXB 5CZVH 2Q87A 3D25B 1UH2A 1CU4L 4S1DD 4OD2A 3ARTA 2F58L 3SEPA 3ARZA 3MYZA 4HHAA 5F9OL 2VDPH 3D9AL 3CXHK 4PGDA 1G7HA 4LBEA 4EBQL 1DBJL 2LAGB 1ZGLB 1KF9B 2HFGH 4JRWA 3GK8L 3VFPA 3NTCH 1HHGA 1FDLH 1T21A 1QHPA 1Z3GL 4TOYH 4HUKB 3PWLB 4RDQG 1DUZA 2DLFL 5BVJB 4Z95H 5MENA 3O11B 4OD3H 2ZSWB 4IRSD 1A6PA 3T0XA 1N64H 2V2TA 4PJHA 3TT3L 5HYSG 2Y5TA 2NY0C 3CAFA 4GBXB 2EDYA 1B0RB 3BGAA 3QEQB 3Q1SL 1YY8B 3T3ME 2ATKB 1OLZA 1G1CA 5DVOA 2A0LD 2Y06L 5BW7A 3PDDA 5E00B 4M4PA 1NGPL 3CVHL 4OB5H 1GZPB 2DD8L 4E0RA 2GK2A 4GFTB 2PW2B 5DRZB 5IT2H 4XCYB 2VSDA 1MCRA 1JF5A 5C0DA 4UDTA 4X9FA 2JJSC 1GGCH 4LF3A 3WDJA 1RULL 1RY7B 4JFFA 5HI4D 1A1MB 3L5WB 4YHZH 4ERSL 5IEKB 4MD5A 2VN7A 3W39A 1UXSB 1TJIH 3CDFA 1DUYA 2F53E 2XZCH 4Y7MA 5TDPA 4OKVA 3SJVE 3MLPA 1H9VA 4JFFE 5AZ2H 4FZ8H 3VG9B 4YHOL 3VXUD 4KTDH 3RWEA 1BZ7B 1VKXB 3QO0A 2NW2B 3V52L 4OFVA 3BKYH 3QIBA 4JPIA 5C6WH 3IDYC 4PV8A 4K23H 4XNZC 5SWZD 1CFTA 4N0UA 1ITCA 1JGEA 4OFPA 5HYEA 2JCCB 3KAAA 3C5ZC 1ZTXH 4WHTA 4MB4A 1TQCC 5T1DL 4R0LA 4Q0XL 3U9PL 4PJEB 5C86A 3LRHA 4OLWH 3FFCB 4UINH 4NRXB 5CIPA 3I75A 4NRZB 4WI9A 3CVIH 5K9QI 5E6IB 2NXZB 5EC1B 2YPKB 4R8WL 3FAWA 5MEQB 3QQ3A 4LNRB 5I1EL 3IDJA 1MFAH 2CIIA 1I1AC 2F5BH 1DQMH 3QNYA 3TT1H 1JNHB 4IJ3C 4X9BA 5IJKA 1EX0A 4NRYB 2P5EB 5I1GH 4Y5XC 4K3DL 5DHVH 4D9QD 1OCWL 3BD4A 3SE4C 1X44A 3QH3A 3HC4L 1CWVA 4NZRL 3MR9A 1NC4A 4M7LL 4D8PA 4N5ED 2VSCA 4L4TE 3TBWA 3WEXA 3BKCH 2D7TL 2OJZH 1JGDB 4GQ9H 3ZDZF 3MBEB 3SE9H 2R8SL 4N90E 5DK2B 1RK1B 5GRUL 3QJFB 4BFIB 3STZA 1F4AA 3PHOB 4I18A 5DFVC 3RGVB 1CVRA 3CGTA 4U1KB 4L4VA 1N6QH 3ZE2E 1BBDH 4ORGA 2A83A 4N1EA 3P9LA 5C08B 4ZYKA 4LSUH 4Q58C 1ZT4A 4QNPF 2HKFH 1OGAA 1OWWA 4I3GA 1QKZH 4LEXH 1B4JH 3QCUL 4X7TA 3WLBA 2PYED 2QTEA 1I4FA 1OT1A 3VWKC 1UM4H 2DWDB 2YR3A 4X7FC 5TDOA 2ADGA 3QUZA 1II4E 2CJUH 4I0CC 5D2LF 4CVWA 1KLGB 1I8MA 3C5SA 2YXMA 5HYIA 5E4EC 4X6CA 3QG7L 3MYJA 1XGRA 3V6OC 3FFDB 1MUJA 3ARGA 4G5ZH 3C08H 3ULVF 3ARDB 1AC0A 4TVPE 5L88L 2BC4A 2F19H 4UV4L 4X6CE 2GITB 5L2KA 1PLGH 2EDBA 5EZJB 1CXFA 3FN9A 3DVNB 3DXAB 4P46B 1ZHBB 5SV4A 4X0KA 1YNLH 5IVZA 5JW4R 1DR9A 5TE4L 5C0NC 2V6HA 5EWIH 1WIOA 2PCPA 3VCLB 4EQ3A 4QOKE 2HFEB 2IPKA 4ZXBA 3P4OB 3QI9D 4K8RC 3RRQA 3CC5B 3LS5H 5DR5H 1R5IB 4KZEL 1L9MA 1AKJD 4HH8A 2AXFA 4YXKH 1Q0YH 3PE9A 3VI4F 4YXHH 4KZDH 5HPMB 5KVGH 4LNVA 3GMQA 1OF2A 3OR7B 3SDCA 5BV7H 3QQ9C 5HSFA 4DGYL 3QCVH 4RFEA 1D9KB 2K7QA 3VGDA 1A7PH 3O2DA 3T8XA 2DQDL 5FM5O 4LSVH 3P4MB 3QFJB 4U3CA 2DQEL 2H1PL 2EYSB 1JPGB 3QB7C 1QBAA 4EI6B 1IEAA 1K3IA 1JMZA 4O58L 4MAYD 4JFZH 4I1NB 1WFNA 3JTTB 2R2BB 3AREA 4IRJC 2AK1L 1X9QA 4YR6A 5IM7B 3SGJA 5I19H 3OX8B 1UC6A 3PJSA 1I8LA 1N5AA 2Z31C 2IF7A 4F58L 4P23B 1DP0A 3ZLQC 2OP4H 1QTYT 3X12A 2OR7A 2M8XA 3U9UA 1BFVL 5IHLB 2HH0L 4GS7C 4TVSa 2F15A 4LCWA 2ADIB 4DQOL 5L8KB 1DBAL 4P2QD 3GO1L 4NKDB 4ENEC 2P7TB 3CFJB 4M00A 1E6OL 4F2MA 4GKSA 1EJOH 1Z9OA 2AI0H 2HG5A 1ZEAL 3N1GC 4LCWE 1QLFB 1SJHB 2ADJB 3MLUL 3WNKA 4PRIA 4OF6A 4BZ2H 4PGBA 2AS5M 1FE8L 1Q9OA 4PJDA 1BIIA 1MFEH 3OKLB 1JYNA 5HHXL 4PLOB 4P9MH 3T3PE 1FC2D 5CCKH 1HCVA 1I3UA 2NY2B 4PRIE 2XY2A 1MH5A 1TETL 2WAHA 3VXRD 2I60H 4GW4B 2QQNL 4KK9C 1YC7A 4HXBH 1JPSH 4OI9A 2OBGA 1BPVA 3AROA 1A3LL 3BZEB 1INDH 2VYRE 3MMEA 4JFDA 1XF1A 3RWJA 1MCNA 3GMMA 3UTSD 5CAYB 1A1NA 3N85L 4P2RB 2YBRB 4JVUA 1U9KA 1QFWM 2YSSA 2IAND 2EEAA 5HDQL 4JO1H 4LOUD 5IP4A 1ZHKA 2CKBH 1IGIL 2P42B 4E41D 4NHUA 2BHUA 2WWMC 1KG0B 1U3JA 2X4OA 4GLRH 1MOEA 3OJ2C 3HG1E 2AAVA 2CLRB 2ZSVB 2XN9B 3BN3B 4LHUB 1CL7I 4MXVE 5ERWA 5D1ZA 1NCBL 3WNOA 1DBMH 1A6AA 1X5GA 3GHBH 2R4RH 3RWDB 2MQCA 3BH9B 3RI5K 2XT1B 4M6NH 2QSCL 4U1JA 2VLJD 4X6DB 1F8TH 1IM9A 1AY1L 3GJFB 4NN6B 5J3HC 1KCVH 2XV6B 5FYJU 5BVPL 2A6DB 2HWZL 3HNVH 1KB5B 3ZDXE 1TJGL 2WWMD 1EGJA 4N0CC 1WEJL 5KSAB 3OR6A 5ADPL 1A6WH 4AL8H 1GYAA 4K07A 3MXWL 1JWSB 1NC2B 1NCDL 3LEYL 5J0BA 2FIKA 5K9KB 5BO1L 1K6QH 1TCRB 3MRMA 2DOCA 3SO5A 5A2KH 1TZIB 4CL7A 2O5XH 4GRLC 1WBYB 4GMSL 1HNFA 1SBBA 4NO5A 4TRPH 1T66D 4U1GB 1L6ZA 2C3GA 5KS9B 4HMCA 4FS0A 1NFIA 2EIBA 5C0RH 2R1WB 4GRMA 1CDUA 4N0CD 5FO7B 1MJJA 2VAJA 5DC0A 4DWHA 3NPZB 3EHBD 1L7TH 3IVKA 1F02I 2UYLB 1U8HB 3IB4A 3WKML 1JTPA 2BY1A 2EKSA 3E6HA 2BJML 2ZUSA 12E8H 3MODL 2EDQA 3LKOA 3QUYB 4K9EC 1J18A 5CJOL 1GJIA 5DSCB 4IRSA 3PL6A 1U8KA 1CXIA 2ZCHL 1WBZA 5FUZL 2ZUXA 5C9JA 2XTLA 1E4XH 1MRFH 1NANI 4MDJA 4KHXH 4G8IB 1T6VN 4AIXA 2CLVA 3U0PA 1YPZA 3IU4L 3FO9B 2CGRL 3VXMD 3LKNB 4OZHF 1EUTA 4YPGA 1T03H 4Y5VC 3A6BL 5F88B 4PJAE 4QCIB 3MLWL 1YPZE 1ZA6A 2BVQB 1F4XL 3I9GH 3G6DL 4Y2DA 4EQ2A 2WUBH 1DBKH 4JR9H 4WWKC 5B8CB 5DUML 5HYQA 3OAYK 3IDGB 1JZ3A 5ESQA 2IQ9H 3B9AA 1T5XA 2H26A 1JNLH 3DX9B 3W5MA 3IFNH 1G6RA 5E5MB 4EXKA 3A6CH 4B53A 2D3VA 3U46A 1D5MB 4JM2F 5HGAB 1G0DA 2ZCKH 5DD5L 3QQNA 4RISL 2VDQL 1AHWA 3FONA 2XACC 4QRRB 3RWGA 5J13B 1XGQB 1VADB 3OKMB 1F45A 1ZLWK 4KK5C 3K2MC 1UJ3A 1YMHA 3S88L 1G7LA 5JLZB 4XXCC 2OXGA 4P0DA 5ILTL 4TN9A 1KTKE 1CICC 2VABB 2A6IB 4JPVL 3NA9H 3VXUE 3GMLB 2WLZA 2J8OA 1E27A 4LLQB 5SWZA 1X5XA 2XWJB 4UQ2A 3BT2H 1J0KA 1BFTA 1CI5A 2XPGB 3T65A 1MRCH 1CFNA 1A5FL 1MCJA 2DYPD 3LQAH 1T20A 5BMFH 3K8MA 4F8QA 5SWZE 4WEBH 1CD8A 3NZ8B 2FWOB 5J12B 4KHTH 3QEGH 4KK5D 2ZWLT 3QP3A 1T83A 1V7NL 4X6FB 5FB8B 4LVOC 2P45B 1T4KA 5IW6A 5CHNB 1JHLH 3SDXB 4LK4A 4TYUA 4ZS7H 4HT1H 5HI5C 4LP5A 5EUOF 3HB3C 5DGRA 3BO8B 5D93C 5LGKA