2Q6WB

The structure of hla-dra, drb3*0101 (dr52a) with bound platelet integrin peptide associated with fetal and neonatal alloimmune thrombocytopenia
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
188
Chain Sequence
TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Structure of the Human Leukocyte Antigen DRA, DRB3*0101: Models of a Directional Alloimmune Response and Autoimmunity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 43
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q6wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2q6wB01
3FO9B 4HC1A 3MR9B 4F7PB 5I1AA 1NCDH 2YZ1A 3F62A 5KJRH 5E2VL 3FONA 1VFBA 1D5XB 2NXZB 3LPWA 3HMXL 4DVBA 3V0AC 2R0WL 4FQCH 4Y4HD 5C0FA 1UA6L 4OCXH 3ULVF 1A7NH 3DTXB 4IIQC 3V4VH 3Q5YA 1OAUL 2FO4A 4JGUA 5BJTA 5KVEL 5B38A 4ODHH 3P9MB 5JOPD 1ULVA 3OX8A 2OTUA 1E4KC 2DQFA 5GRVL 5E94A 5DYOA 3CLEH 5EUKB 4S1SL 4HLZH 1BF2A 4OLUL 5DK2B 5DSCB 3O3BB 3MBEA 5DK2A 4XX1G 5I1EL 1E27A 2DQTH 2AV1B 4HF5H 4XP9H 1FHGA 2BVPB 3HFML 2H9GA 2VERN 1O0VA 1B4RA 2XN9A 2GT9A 3U4BH 1NC2B 3DO3A 4X8JB 1IEHA 4QNPE 1A1NB 4GO6B 2HT4C 3TBTA 2CDEA 1JYWA 4YHLH 1DBBH 3NCBB 4LLDA 5HVHB 5E8OA 3ZDYE 5IW6B 1F45A 1HH6B 4DEPC 1Z6JT 3FRPA 3MR9A 5FV1L 2EXYC 2YUWA 3H9YA 1FZMA 1TQBC 2KDGA 4NKDB 5FECA 3SOBH 1MHCA 3K1KC 3WUWB 2MKLC 5DURB 4LIQE 3C5ZC 3VGBA 1H15B 4U1LB 3WS6A 3K4ZA 1YYLH 1N6VA 3DX9A 5IESL 2VXTL 1MUJA 2W0FA 2V2XB 5KSAD 2YPKB 4JG0L 2NW3B 4JO4H 4FQLH 2LV4A 5I1GL 1E4WL 5C0GA 1UCBH 4HDIA 3H7BA 4ODXA 1BJ1H 2AK4D 2KZ1B 4Y19D 4TTGA 1X44A 1ZGLP 4P2YA 2XWBA 4JM2D 3M1BB 4PJHF 1NGYB 4LHUB 1PG7L 5F3HB 4RA0C 3PNWA 1CGSL 5T33H 5IEHB 1LQSR 3LEYL 4R3SB 1UXWB 1KELH 1Z0MA 3TPKA 2XWTB 4BH8A 1NCUA 4Y8AA 4LOUC 4OGXL 3E2HC 4OLVL 7CGTA 2Z4QB 2DL2A 3HG1A 1YEIH 5L8JB 2YA0A 1RULL 2R1WB 5I8KL 1EEYA 3G5XA 3HR6A 2BVEA 4Z0XA 4DOHE 2FZ3A 4YAQB 1T6VN 3BPNC 3FTGA 3RVXD 2D7TH 1HHHB 1UWEH 1MAJA 5GRXG 4YHIA 3BZEB 1QP1A 4RZCB 2HMIC 3AREC 1RIVL 1JV5A 4LMQE 1JZ3A 3BKCL 5IFHL 3U4EB 1E6JL 5H2BA 3HRPA 1L7TL 1OPGH 1T1XB 2CLVA 3EJZC 3KYOA 5TPWH 2L7JA 2OTWB 4CADA 1LE9A 1S7QA 1YPZA 2P8PA 4P0DA 2VISB 4NOBA 2A77L 6FABH 5DK3A 4Z7OF 1AKJD 4LSSH 5EU4B 4MNGB 3JTSB 4Y2DB 1FP5A 3U7AA 1MNUL 1P84K 1IQWL 3HAEH 1YJDL 2DI9A 1U2HA 4S1QH 1EXUA 2DMCA 4RGND 4PJ7E 5K9JH 3G5VA 3BJLA 4G8EB 4LL9A 4XHJD 1BM3L 5IHZA 4AM0B 3BO8B 2HFGL 1LO2L 5JQ6L 2XN9E 4FNLL 4P3CL 5D4QA 3JWDL 4FQXC 4PJ5A 4UINL 4KPHH 4PJDF 3TO2A 5DVOA 1HQRB 3QDMB 1RZ7H 2A83A 1NGWB 3C8KB 1ZA6A 5F9WC 1FNGB 4OSUH 5D71H 4F7TA 5CIPA 1P53A 1FN4A 4LSQH 3I75B 4GRWF 4PJIE 5JO5B 4YFLI 5ITFA 4JQIH 3D25B 2GJZB 1I9EA 3VRLF 3IJYB 4FZEL 1E6OL 4HEME 3KPRD 1JI1A 2NPLX 5CSGA 3PXJA 1DANT 1QQDB 5EH1A 3L5JA 5DHVH 4WUKL 2W9DL 1IM3B 4P46D 2VDQL 4DAGL 3BWUC 1DLFL 4Z76A 2Y36L 3CDCA 4GXVL 1ZGLB 4GLRI 4XBEL 2Q86B 3VCLA 5EPMA 3X14B 5DC4B 1XCTA 5EUOE 2B2XL 2X9WA 3C5JA 2MQ0A 4HIHB 1OSZB 4LU5L 2GJJA 1V7ML 3SKUD 3WEXB 3U9PH 2NZ9C 2OK0L 4JM4L 1N5AB 4JFXA 1Q1JH 4Y8DC 2DS4A 1X5ZA 4OF5A 1WWBX 1V8HA 2VQTA 1CR9H 1OAKH 3T8XA 5DMKA 3MCKA 2EE9A 4HMDA 3HI5H 1OD9A 1KYOK 2XV6B 4OAWA 4K7PY 1UM6H 3BGAA 5A2KH 3DO7A 5BZDA 3CH8A 1DL7L 2B7DT 1Q9LB 1HCFX 1OP3K 1JHTB 4GXVH 3JWDH 3MV7E 3ROOB 2Y23A 5K59F 5D2LE 1A21A 4LVHB 3RDTA 1QSFA 5HYEA 1BFTA 2J8UA 2IMMA 4DAGH 3D18B 5LXGL 2GSGA 4GKSA 1CDBA 3BISA 1KCUL 2BVPA 3P73A 2ICEA 4KVNH 3UPAA 1K6QL 2FR4A 1MCPL 2EC8A 1T22B 5FUZH 1G7HB 5C0IB 4ONHB 1R24B 5IGXL 2ED7A 4LKCB 4X6DB 4XVSH 2KQMA 2ZUQC 3WNKA 3B9KA 3VFOB 2A74B 2Z35A 3T2PA 5I9QB 3UTTA 5F7HA 2OTUB 3QDMA 1SQ2N 4JREC 1O7VA 1NAML 3X17A 3EHBD 1IM9B 4KMTL 4HULB 5F88B 3L3OA 5EC1B 1IL1B 3TH3T 1JUFB 3D9AH 5I1EH 1IGFH 3ULVL 1R3HB 3P0YL 5HI5C 1ONQB 1PQZA 1VEOA 2AJYL 2CK0L 4FP8L 4WI3A 4C56B 1RJZB 1A6WL 4TVSa 1FFOA 5M95B 3C2AL 2FECL 5AG8A 3BAEL 2LE9A 4NJ9L 3BD3A 1I8KB 3S98A 2VQ1B 1EO5A 2ADJB 4M6NH 1ZS8A 2YK1H 3LSOB 5F3BB 4U33A 1CTNA 3S7GA 1WLHA 3X11B 2D3VA 1GC1C 1JGDA 1R5VA 5FA4A 3UTTE 2Z93B 2IFGA 3I6GA 4QHKJ 1FCGA 1RZ7L 1S8DB 2C3GA 2VZOA 4HS6A 1T04B 1IQDB 4HJJL 4JVPA 5E5UB 2VE6B 2ZUSA 4LPXA 1KB9K 1XH3A 4PJ7B 2ESVD 4X6BA 3AMLA 3KPQB 1C5BH 3PG2A 5JXAH 3CVIH 3QCVH 3I2CL 5KG9B 3RBSA 5MEPB 5C0RL 4NRZA 1S7RA 2HJFB 4Q0XL 1ZHBB 3OKMA 3VWJD 3KPTA 1PX3A 4XCYA 3VA2C 3VXSB 1INQA 1XF2A 3MUGB 2IJ0C 1XGUB 4YDIH 1N7ML 5BS0A 4AYFA 5HDLA 1QTYT 1NLBH 4W4OA 1KG0B 1BQLH 4L3EB 5CJ8A 3TA3C 4HUKB 1E4XI 1IAOA 4U7KA 1N64L 2XA8L 3WJLC 5L9DL 3REVB 4NNXB 4ODTH 2ENYA 2GSIB 2BNRE 3KYAA 3RUGB 3MRCB 3SCMD 2ZOKB 3TN0A 3WS3A 4P9MH 2R2BB 4DJMA 4HMEA 3B6SB 3GZKA 4PP2A 5CGYC 3DVFA 4HUUB 3R8QA 4NBXB 5JNYB 1JZ2A 1NGQH 4U0QB 1DZBA 5C09D 2QADC 3SGEI 1KB5H 3HB3C 4MJIB 3TVMD 2VZ3A 4NO5A 3GJEA 3ILPB 2BRRH 2JTDA 3TV3H 1JWUB 3LN9A 3AC0A 1LE5A 5F7YC 4KZDL 1NFDE 4Z7NE 3W9DA 2CO7B 2VKWA 4JPIB 1DN2A 1KBGH 4KI5E 2BRRL 4OIAA 1CVSC 4PRHE 5HI4D 1NQBA 4OM0L 1U8MB 2EEDA 4HK3N 4L4TE 2QJDA 3DX7B 3ZSSA 4JZOB 4JFPB 1YNKH 1UWXH 4MB5A 1W0VB 2DM4A 4GS7B 1QFPA 3DVGA 4KY1L 4X7SL 3UCRA 3KPLB 5F8QC 1YMMB 3KPNB 4X4ME 1YPZF 1IAKB 5MEOA 1WGOA 4Y5XC 1XFPA 2GUOB 4U1JB 1QEWA 4GBXD 4LFHD 1RZGA 5DQJA 5EU6B 3RUGE 4ZFOA 3D2UD 5L88H 5L2KB 1RZGB 5DQJB 1INDH 4L4TD 2WZPD 2YMXH 4LRNH 1G1YA 2H32A 1SJEB 3QFDB 4XP4H 1MIML 2HFEA 4NZUH 3DSFL 3LN4B 1NCBH 5EIQA 2F58L 3V4PH 3RWJB 1F4YH 1A9EB 3MJ9H 4NCDA 5GIRB 5J13B 4H1LA 1CLOH 4QTIH 4M02A 3MLWL 1CE6A 2WW8A 1P7QD 1ZTXL 2VXVL 1F4HA 1CLZH 4GKNA 3RIFK 4DVBB 4L4VB 3ZKMD 5C0BE 5CBEB 2NXYD 1VEMA 3MOBL 2P8MA 4LAQH 3GNMH 4OZFG 3HNSL 2N4IA 4L1HA 2VLLB 1EV2E 4C54A 4JZJC 3DXAB 1W0YT 4J4PC 3L5XL 4H8WH 3MBEC 4XPGH 3T0WA 1HYRC 3MRGB 2EDRA 2PO6D 3K7UA 2JELL 3SPVA 3CXHK 2WSKA 5KTEL 4PUBH 1MOEA 1HI6A 3WNLA 5IQ7H 4I4WB 3AGVA 1BF8A 3B9VA 3CZFB 5I2IB 5I9QC 5C0JB 4MS8C 1UA6H 5IB1B 2CK0H 4LLMB 5LCVL 3UTQA 3F7VA 1H3PH 4OTXH 2IF7A 3KPPA 5C1MB 5DD3H 4XB7A 2FLRT 5I1IH 3DBXA 1YEGH 4X4ZA 4HWZB 5HI3C 4N1HB 3VGAC 2ZWLT 3OTTA 5FKPB 4AMKH 3SDCD 4K23L 4YX2L 1EO7A 5L2KE 4Z77B 2VLKA 2IG2H 4Y19E 3C5ZA 1F90H 1ZHBA 1U58B 2BOBA 4Z6AT 1Q94A 2V7HB 3U1SH 5ESVA 4J12A 5E4EB 2EH8H 3QA3A 5F7FA 5CHNA 2JK5A 1I1AA 5BVJB 1G7MB 1IC5L 5CD3A 1H3GA 4PJ7A 4U6TA 4Y16A 2EIZB 3LEXB 5L2KD 1JPTH 4WTWA 5KS9F 3T0XA 4DW2H 1IKFL 4L4VD 4U1IB 4NKMB 4M5YH 2NY1C 4K7PL 3VRJB 5J56B 1ZLUK 5T3XH 1O5DT 3BWAB 2NY7H 3QI9C 3PGCA 1WZKA 1H3WM 3LEVH 3QZWB 4MNQD 1JK8A 1JE6A 3HMWL 3UC0H 1XF3B 2FSEA 1YEHL 3CK0L 3QIWB 4IRJD 3ULUE 1U8HB 3LZFL 5F7DA 1A02N 4MX7A 5CMAA 2BSED 2NY3B 2X4RB 3VFPA 4G9FB 1B90A 4D9LL 4I13B 4MWFA 5AUMA 1N3NA 5EOTA 4GBXB 1BWWA 1S7WA 3GBNH 4ZAKA 3F7PC 3TT3H 1ROWA 3QEQE 3EYQC 4KI5C 4WO4D 1JRHH 4OB5L 1HSAB 2VXUL 5AD0A 4NN7B 4WV1C 1SEQL 2Z31A 1A6VL 4ODUA 2IADB 3DYPA 4F7CB 1R24A 3MRNA 3D39D 1FH5L 5F6HI 1HINL 4TSAH 3MFFA 2VXQL 4P9HL 1CIUA 1MI5E 3U36A 3F5WA 4F2MB 3IT8D 4MJ6A 4RMVA 2FEEI 3GKWH 4P4KB 4XCCL 3RGHA 4NQUA 5LGHL 3ARGA 2VUYA 1M1SA 3K8KA 3OKEA 4MX7B 1AI1H 3ARBB 1Q9LA 4JQVC 4HFWB 4KAQH 4GKZA 2PN5A 1MIEH 2X4TB 5DC0A 4P3CH 3VWJB 1KIPA 5DF0A 5F44A 4P23B 4R8WH 3ZDZE 5DMKB 1MRCL 1QFOA 5K9JL 4XVSL 2VDML 4HG4K 5E7FA 1RFDL 1FYHB 2PCPA 5F72S 1HHGB 1MCPH 4O58L 4X6CE 4LLQB 5EIIA 5I1HL 4LHUG 3L7EA 3NPZB 1SVCP 1NCNA 3SDCC 4WW1A 1I1FB 3TCLB 5D1XC 3HLAB 3MV8E 5D7SH 3OG6B 5DHYA 4BFIB 1Z3GH 3EOTH 4NZTL 5C0AA 1I9JL 1ZK9A 4Z7QE 1F4XL 1NCAH 2J12B 1OHQA 1HHIA 4MXQD 2AXFB 4KHTH 4HG4J 2X70B 2NY3D 3A67L 3X13B 2HKFH 2R0KL 1IM3A 25C8L 4ZNCD 4G6FD 4J4PA 1R3KB 1JNLH 4I3SL 3P4NB 4XC3L 2V2WA 5EOQH 3C6LA 2A6DB 4JJHA 3HR5A 3L95B 5E00A 1VGEL 4PY7B 3CPLA 4EIGB 3SQBA 3N1MC 5DD1H 1FIGL 3EAKA 3EO1A 5ANME 4GSDL 5CSZB 1S7XA 2YXMA 4HHAB 5T3ZE 4P5TD 2NX5B 4Y5VC 4J3UA 5DJ0A 1KELL 4PJ5B 4IRSA 5I1KL 3A6BH 1KFAH 2VIRA 3QO0A 3V6FB 3ULVD 2AJXL 5FGRA 3VXMA 4G8EA 3G5VB 1V3JA 4ZO7A 3N1PC 1FYTB 5GGUB 5IROA 4NM4L 1OGAD 2XTJE 3MNWB 5FYJE 4DGVH 3UXFA 4AEIH 3VGAB 1YMHA 4LVEA 1XF3A 3GHBL 3KWWB 4K3EH 4LLAA 2R0KH 4CVZB 1FZKB 3RY6A 3RPKA 1T5WA 2VISA 4QRPD 4KUZL 1ADQA 3NCMA 4L4VA 2V9QA 5CLWA 2CMRH 2Y06L 1BMGA 3CDFA 1FRGH 2WV3A 2AJSH 4OCYL 4H1LB 5C08E 5DJZB 2ZUYA 5D70L 1FORL 4E5XA 4UV7H 4I3RL 1I3VA 3NAAH 4KKNA 4ZUTA 3EGSA 1EVUA 1TIUA 3QFDA 1SJEA 1GZPA 4MJ4A 3S34L 2IANE 5J6HA 3U46B 3VXUE 2BOBB 2X89D 2PR4H 2FL5B 4JFFB 4BFBD 3WL9A 4NO0B 1CBVH 1MRDL 4M93C 1PLGH 2VWEE 4TSCH 3GFUA 3C08L 3ZDYF 3T0BA 5DJ6A 4G8GB 2DQCL 4LSDA 1UXSA 1W0VA 1TQCC 2FBJH 5FM4A 1IE5A 3MGAA 4PRPB 1MLBB 4QCIB 2N1KA 1WCQA 4YHYB 4P2RB 4YR6A 4GG6B 3QNZB 1UWEL 3W0WB 1X5HA 4U31A 4CDGC 4K71B 1MJUL 1OAYH 5BVPL 4RBPH 5E95B 4WV1B 4ZODA 3NGBC 1WC7B 4QHNA 1S3KL 3VXQA 4XPHH 4LASL 4YBLC 1YN6A 4KKCD 4FN0A 1TETL 3P4OB 2VLJD 3MOAH 4ORGB 4OSUL 4NQDE 5HVWA 4PLKD 3GJEB 3QDMD 5JZ7C 5FDWA 4I0PB 4IRZH 1EHXA 5JW4N 4XCFL 1YJDC 5MI0C 1FAKT 2IPUK 3QXAA 1LK3H 1CK0H 4RFOH 2XKUA 5TDPB 4YGAB 1NCWL 2WINB 3OKOB 4JM4H 1MJJA 4F37F 1GH7A 1W72L 5HHMD 1CGVA 3MJ8A 2ED8A 5B3JF 1PSKL 4JKMA 4MVBD 1JZ6A 4YNYA 3REVA 4U1NB 1YYLL 4JHZA 3BKYL 3S37X 1AGEB 4I0PD 4XC1H 3IVKA 2P5WB 5C8JA 1KG0A 4G8GA 4CL7A 3I3DA 1AGDB 1XF4A 2I07B 2VLRB 4HAGA 5DS8A 3MUY1 1I4FA 3SJVA 1G7IA 1FVDB 1JF1B 3QG7L 3ZL4H 4PG9A 2EYSA 5DHVB 1B0GA 2G9HB 2NY6C 1WWWX 3QZWG 3QEHA 4D0BA 2A6IA 5JQHC 3AROA 3F12B 2KL6A 1GZPB 1N26A 3RX7A 4WTZA 1W0WB 3FT3A 4KJWC 2DMKA 3CSYA 4RBPK 1DVFB 2CJUL 4JG0H 1HHKB 5B38B 3R06B 5EU5B 1DFBL 2AQ3A 4ZDHB 4HS6B 2AEQL 3IS1X 1EAPB 2CGRH 5I0DA 3LQZA 4ELKB 3MRHA 4I18C 4YWGH 3QO1B 4ZXBD 3PF2A 1LE5B 2XA3A 5DJXB 3BI9X 4L5FH 2VQ1A 3D1MC 4KRMB 4YDVB 4R0LB 1J1OH 1FFOB 1T1YB 3BPCB 1G9NC 1AIFA 1VEPA 5HHPB 4XCNB 1FGNL 4F7EA 5GSRA 2HTLC 3D85D 1MQKL 4HXBL 1JRHL 3HAEA 2VLRE 4WFHE 2IBZX 3SQOH 3QHTC 3L5XH 5EBLB 1MVUB 4D94A 2NR6C 4LBEA 4KV5E 4NDMA 4CGTA 3O4LB 1CZ8L 1IAOB 2XXMB 5GGTH 2DWDA 4XCEB 1DLHA 3QO1A 4O2FA 2D31A 4PJHA 4PP1C 1KNOB 2HAZA 2Q20A 2V2WB 4LLWB 5EO9A 1OM3L 4Z9KB 2FJHA 1A7BA 3MRQA 3QP3A 2Q8AL 2C1OA 3DRQB 1CG9B 1TDQA 2J3SA 4ZDHA 3JTTA 4JLRA 3NZHH 4OFKA 1LD9B 2OR9L 1OM3H 1OP3H 5E2TH 2OQJA 5HYIA 2OR7A 3EOAA 3GSNL 3QQ9D 2CRZA 4PLKC 3HZYA 2DJUA 2XQBH 5FYJL 4QRRA 4K71C 3F12A 4NZJA 2ZUQB 4OLWH 3U6RB 1HEZB 2XRAL 3ULUL 2OXHA 2WLYA 2Z91B 4KDTC 1T83A 4NUGH 4G43B 4ZAKC 5A40E 4WW2B 2DLIA 4K2UH 3ARPA 4ZFFA 1T20B 4QEGA 3KPLA 4PJIF 3Q5OA 4QHLA 2ITDB 1QO3B 3VFRB 4QOKD 2DYPA 4YNYB 3MRJA 4AMKL 4IDJL 2VDNL 1AGCA 1JNNH 2P24A 1DBKH 1T0NB 3ARFB 4PYHA 4FQCL 2HN7B 1DQJB 3VXOB 1MCOL 3ALPA 4O02H 1J87A 5HXMA 4GUPA 5DVMA 3BPOC 1JFQH 3KS0J 4HS3A 4XXDB 3RAJL 1G0XA 1NSNH 1IKNC 4UB0L 5H8DA 3MA7A 4JY5H 4U3HA 3F58L 3ULUD 4HWBA 3U0WL 3VXNB 4P3WA 4KXZI 3O3EB 2VLMD 4CDHA 5HGBA 4NUGL 3EDJA 3VFVB 3OJDA 2OSLA 1VFAB 4RFNB 1AO7D 3WS3B 5FHAL 5HD8C 2FR4B 1GGIH 3TIEB 4H0HB 5GGTA 4I18B 5I8CB 1LEIA 1KJVB 3NVQA 1RK0A 3ZYOA 5EN2A 1FC2D 3SDCB 4EUPA 3AXLB 4M1DL 4X4YB 1VKXA 2PYFA 1EGJA 1CWVA 5CP3A 2AW2A 3K2UH 4FHBD 5ID0A 1PSKH 1JK8B 3WHE0 1NUGA 2A38A 5KVEH 3BGMA 4NO0D 1MWAA 3OF6A 4M7LL 5IR1A 2JELH 5J57B 3I3BA 3BP5A 3LPFA 1KV3A 4PJEE 5HJ3B 1CU4H 4HWBL 1Z9LA 1QBLH 4RFOL 3QBTB 4HWUA 3GMMB 1SBSH 1A1MA 3RNQB 2ID5A 3DHJA 4QGTA 1OAXL 2EIZA 3SKNB 3O4LD 3OKNB 5DMIH 3O9WD 1A6UL 2OL3H 4OZFA 4PJBB 5CHNB 1N0XL 3HAEG 4M43H 3RY4A 1BD2D 1BIIB 4Q97A 4Z0XB 2JCCA 2C9AA 4NRYB 4Q6YA 1QKZH 1OB1A 3K2UL 5T3ZH 2MCG1 1NMCC 4LAJH 5FA3B 2NY5L 1T3FB 1NJ9B 1I7TB 1KPVA 2E9JA 4HS8H 5ELIA 3CVIL 5DQ9A 3GJFA 4UILL 1J8KA 3BW9B 1NC4D 4FQ1L 1JZ7A 4B5EA 4Z7VA 1MFDL 4X99A 1FGVH 5ICYB 3P77B 4LNVA 4FXGB 3M1BA 3UTPE 3W2DH 1YY8B 3TFKD 4Y4FA 1T2QH 4HKZA 3FMGL 4K8RC 3IFLL 3SQOL 2XTLA 4JFHD 3EFFB 5GZND 4OKDA 4XPTL 4P59L 3N1QC 1MAML 5F9OL 3WHXA 3S34H 5I15L 3QHFH 3OV6A 1VACB 4HQQL 2W92A 1JP5A 1ZAGA 1HDMB 4G5ZL 2D7PA 4CMHC 2DICA 1JI2A 5EZIH 3O6LL 5F93C 4K3HA 3S88H 1WFTA 4O9HH 4J3SA 3ZE2F 2P8MB 5ADOL 5IW6A 4LPUA 4U1NA 4UOJA 1DUYB 1OGAE 2XTJD 3DETC 4JM2F 3VD9A 5D7LB 2BNRB 2ZSVA 1CE6B 4JVWA 4MS8D 2Y9RT 1V3LA 5HHOA 1I1AD 4C56D 3U2SA 4XGZA 3TEUA 7FABH 3MCKB 4GG6F 2FX8L 3T8XB 2EIDA 4LPTA 3QUYC 5DJ8A 3RWJA 5HHNA 1ZT7A 4YHML 1IGJA 2D2OA 4X6DE 5F71A 3D5OF 5LWYL 5DO2D 1T80A 1TZHB 1E27B 5KVFL 3P4OA 1S9KC 4Z78A 4UTBL 4EI5C 3MLRH 3TBYB 4IJ3C 4JO3L 5IEHA 1PYWA 5JDSB 2W60B 4Z76B 1MCHA 4HUNB 4ZD3L 2XY2A 4OLZL 1IGML 1WFUA 3FAWA 4QCIA 1IKNA 4EKXA 4OUUA 5GS3A 4JO2H 4OIIL 1QFWH 5E08H 2ZKHL 1GPOH 3IJYA 3BPOB 3VXSD 4X6CF 4ZTOH 2W59A 1MUJB 2PO6A 4FFWC 4TTDD 5HY9A 3VFSB 1LHZA 4WEBL 4J7RA 2X5PA 1ZOXA 5DRNA 2QHRH 4GAJL 3QDGB 4J8RA 2DWEB 4PJGA 3H2WA 4LCCC 3ZE0F 2BY0A 1OTUD 4MZ3A 5DFTA 1PBYA 1S7WB 1U8NA 5HHOE 3T2OA 5DJ8B 4B7IA 4M6MH 5IHZB 4LVOB 1ZA3A 3L1OH 1HEZA 5CUSH 5EC2A 1IGMH 2NXZC 1VGKA 5I16A 4Y4HA 3MRKA 5E8OB 4GW1B 1IGFL 1NLDL 5DXWA 4Q9QH 3E3QC 4BZ1H 3JTSA 4Y2DA 3V5DB 5HYJB 4X4MA 3O8XA 4JRYA 1RIUL 1P4BH 4RWYL 1WT5A 4U0RB 1NBZA 4LSVH 5MERB 4CU8A 4P2QA 1S7QB 1WSST 5D7IA 1UM6L 1UZ8A 1A9BB 3MBEB 3MLSL 2VDPH 1J12A 5E8DH 5HDBE 2FX9L 3CFKB 2D03L 5JMOC 4JZJB 3WBDA 1JZ8A 1LO5A 2EICA 1S7SA 4LPWA 1T5XB 4LU5H 4G7VH 4OKVA 1EIBA 1FYTE 1GOGA 1UACL 3W81A 1A5FL 4NOFA 2HRLA 4EEEA 2IEPA 2F54D 1S8DA 3HAEB 3I6GB 1UT9A 3LRGA 4LIQH 2IPUG 43CAB 3DSNA 2ICCA 1P1ZA 2HYMA 3X3GL 3VD3A 4E41E 2M2DA 4CN6A 3G6AB 1PFCA 2JF1A 2CLZB 3NIFF 3VFNB 2F5AL 5BZWB 1FYTD 3SKJH 5EOQL 3F7QA 4PJAA 3MV9E 4JFFE 4PJ8D 2FX8H 3NCFB 4ZXBC 3WDJA 3UJJL 3RKPA 4MB4A 2Q76A 3HE6D 4WI5A 3O8XC 3BD4A 4XNYL 4ELKA 1UWGH 5BRZE 4YHPA 3IFLH 2HG5B 4D2NA 5EC1A 1MHHA 3OAZK 5C2UB 3AS3A 3FB8A 4XBEH 5LG1A 4I48A 1B88A 2V7NA 3HLAA 1BBJB 3GBLA 5JUEL 4YO0B 1DVFA 4PB9L 4PPTA 4L29A 1RZKL 3K8LA 4HS8L 1M05A 2NLJB 4RFNC 4YJZL 4GRWE 3QEHB 5D7KE 4YHMH 3IF1A 4HQQH 3TIDA 1YEEL 2G60L 1HZHL 1M7XA 1G7HA 5C0IA 1TJIH 3VFTB 5IW3A 3P3YA 1Y18A 4X6CB 5GGVY 3VWJA 4A2MA 2KKQA 4BFGA 4LLDB 4JCLA 4WWKB 2X4NB 5DQDH 4Y1AB 4BH7A 3O6FA 2HTLD 1VKXB 1X5KA 3D87B 2JIXB 5I8EB 3S35H 1MRFH 4N90E 4YZFE 1G7PA 1PLGL 1KJVA 1YEGL 4NQDD 4U6XB 1FFRA 2VOTA 4HF5L 3GUTA 5C0ND 1QLEH 4OF3A 5HGAB 1RUAH 4RAVA 5CJQH 3RL1A 4B7LA 2EYRB 1A6ZB 4MXWH 3ARFC 4XBPA 4GRLD 4K3GA 5A16B 4ETQA 3FQTB 3ZKND 2RFXB 1KOAA 1EA9C 1N5AA 4JFXB 4BELD 3SKOA 5T5FH 3V6ZA 1J88A 4JQXC 3O41A 5DTFA 5E4IA 1RZ8B 5TGBB 4M43L 4IIQB 5D1QC 3GSVA 3SY0B 2YA1A 3C60C 1VSCA 3FOLB 1K3ZA 4L8DB 2KPNA 3E8UH 3SGJC 2E8YA 3AM8A 1J9CT 3U4AA 2ILLA 3PWPB 1X5YA 1F4WH 3IFOA 5D1ZA 4J3TA 1XGYH 5ERWA 2APXA 5D7IF 3VXRE 2LVCA 1MLBA 2EH8L 2E27L 3HUJA 3TA3D 1G9MH 2DYPB 1F3RB 3GMOB 3TO4B 1BOGA 2GTWA 3MRMB 2ZUXA 5C0CD 1K85A 2GAZB 4W4OC 3BSZL 3SDXE 1QKZL 3QULA 3O41B 5DTFB 2ARJQ 3AAZA 4H5SA 1W2KT 4KU1A 1H0DB 3SKOB 1BEYL 4HUUA 2QSQA 5HHQA 1FBIH 3LKQB 1FFQA 2P47B 4XVUC 3H0TB 4M5ZL 4BSVB 1IBGH 3WN5A 1HQRA 3LIZL 5DJCA 1CGSH 4AENA 3BPLC 3AY4A 4PJAE 3DX6B 4R4NC 5LVEA 1QNZH 2MTPA 2FJFB 3HE6A 2VDRL 4TN9A 1Q94B 2V7HA 4QXGL 1JHLH 1K5NB 2BY2A 4LLVA 3CK0H 3T4YA 43C9B 2ADFH 1DBBL 3MRRB 2P46B 2GEEA 4KMQA 1IEAB 2O26U 1WZ1L 4RDQG 2J6EL 2V17H 2R4SH 3SGJA 2V9RA 3KXFE 3RDTD 4PGEA 2Z8SA 3ROLB 4GRWH 1QVOB 5KG9A 1NDMB 5FUCE 3O2DH 2G5BA 4MLSA 1LP9A 4DKDC 1BGXH 3K2MC 1KF9B 1J0ZA 4YO0A 3B2UC 1PZ5B 1TTGA 4X6BB 4RAUA 4YXKH 2ZUWA 3OKDA 3T65B 4W68A 4PJFE 3CMOH 2W91A 3DUUA 4YHIB 3BZEA 3FT2A 3KPSE 2EYTA 4WTXA 3E3QE 1DN0A 5INCB 5FYKH 5HGDB 1U3HA 3O0RH 4IDLA 5ILTL 4PJXE 4PJGB 1M7DA 1GSMA 2FJGB 5DJ0B 1U8LB 5F96H 3MV8B 3H9SB 4TUOB 3LSOA 1HQ4A 4N9OB 1UB6B 3LPGA 4WFGD 2GY7B 3EUUA 4ZS6D 2EKSB 5HDOA 5B8CA 3GNML 2VSDA 2PTTB 3D0VB 4P2OC 2EIBA 3CLEL 4OM1H 4PGDA 5BXFB 1MCQA 1NMAH 2X9XA 4XI5D 3DUHA 4PJCE 5JHDE 3CFJA 4HUMB 1MWAL 1F97A 3S37L 4ORZC 1CICB 1MPAH 3GJFH 3WHE1 4ODVH 3BP6B 5IP4A 5JHDB 4HT1L 5ID1A 2VSCA 1U8PB 3PXHA 3VFOA 2XXCB 2JJSA 1AD9B 3VXPA 2O93L 1QSFD 5CP7B 3JV0A 3QUYA 1QLEL 2HLAA 5L88L 1RJCA 2Y5EA 5FYJH 5D7IB 5E03A 1GGIL 4IMKC 1YQVH 3D18A 4R6UA 2P5WA 3RBGA 5C8JB 4YFLF 4TUKH 3RDTB 3DVGB 1DCLA 4OFDA 3QUZD 3V6OE 4QXUH 1B6UA 3O8XB 4KZEH 3L3HB 4Q7DA 5CAYB 1AXTL 5GISH 5F9WB 4PJIB 4NRXB 4ZXBB 1LO3L 1PW3A 1U6AH 3Q3GB 1IGCL 1G7JB 4ZPVA 4JRXB 3SDAC 4I2XE 5SV4A 3UBXA 2V5MA 2W65B 4KK8C 4YHYC 1D7FA 1KPUA 2AJUL 3MJ9A 1DEDA 2H9GB 2WWKT 4YDKL 2H6PA 3G6DL 4KK5D 1MCOH 5FDWB 1GL4B 4WJ5A 5HYQB 4JKPH 5CJ5A 4OZIB 1RUKL 4HUXA 5FHAH 1C5CH 3U30C 4F8TA 5DRNB 4I77H 3MQIA 4JZNB 3VWKC 5C6TH 3CH1B 1QPPA 5GS1B 3BP6A 5JHDA 2Q6WB 3UAJD 3B3IA 5F1NB 4HKJA 5F1IA 2ZOKA 3ZLQC 2YUZA 4N8VA 4YHKL 1IAIM 2UYLB 1Q72L 4RWHA 3DVNA 2FEDC 2W9LA 1AGBB 4Y2OA 5J12C 3DOSA 5SX4I 4MCYA 4YBHA 1N3NB 2NYYD 1LK3L 4LVNC 1X5FA 2DLHA 2SEBA 2Y6SC 4RMQA 1FNHA 3ZDXE 3GSXB 1ZMYA 1FSKC 1EFXB 1NBQA 2KH2B 1GOFA 3KXFB 4MAYD 4OF0A 3H9HA 2NY4B 5E1AA 5FGBA 4PJGF 2UY7A 5DD0L 3V7AG 2E8ZA 3RJDA 5T1KD 4NKMA 2FWOA 4EOWH 2ZZUT 3HE6C 5L7XH 3C2AH 3O81A 1AFVL 3BH8A 5BQ7A 5DJZA 1U8KB 4KJWD 2A73A 3NACH 5A3IC 1I1CA 1G7MA 4HFUH 2AJVL 5GS0D 4JQVA 3LKRB 1T0PB 5GPRA 1AJ7H 5ESAB 1KT2B 2DL9A 3SDYH 4JRYD 3HZKB 5D2NC 3OXRA 2WLZA 3P4LA 2Z9TA 5KVDH 1XGPA 2H2SC 3TESA 3QUMA 2YD2A 3DLQR 3OZ9H 3DJ9A 1XR8B 1BWMA 1J18A 3LAFA 1YYML 1BVKA 4LLVB 5J0BA 4UT7H 1U91A 5IMKA 1IAIH 5EDXA 3SDCA 3ALWA 4Y1AD 4D0DA 5FYLL 4Z7WF 4NC2B 3TIEA 4OZGF 1CS6A 2IFFH 4CNIA 3V0WH 3PWPE 4NWTL 3H6JA 4M6AA 3HG1B 3LKQA 4UTAL 5I8OH 1YY9C 5KN5B 1UJ3A 1AGFA 2R2EA 3H42H 1JPSL 3DRTA 3TYFA 4TULL 3RA7L 1OY3B 4DUWA 4LHQB 3WO4C 4JFZH 1VPOL 4NNPL 3C6LB 3PNWB 4K07A 3WJLA 2BCKB 1CE1L 5IOPA 5DURD 5IMMB 3HNVL 5EU6E 2JKXA 4DFIA 3DMMB 4ALAH 4MMZC 2F53E 2ZUVA 4EI6A 3RHWK 2C3HA 1ZLWH 2R0ZH 4JY4B 3BDYL 4FABL 1RHHB 1NFKA 4HJGA 3WFBH 2AVGA 2PXYA 2XPGA 1NANI 1YNTA 4YEEA 5JPNB 1T4KA 4MJ2A 2LFGA 5FYLD 1CF8L 2QSTA 1VGEH 3FN0H 1ETZB 3GMQA 4KQ4L 4XPBH 2MQCA 4IOSD 3TYGL 2VB5A 3EO9L 2LAGB 5BRZD 4U4BA 3FQTA 1LILA 4D3CH 1PG7X 3BMVA 5EU6A 3K4AA 2MMXA 2A0LD 3WXVL 4WW2F 4WTZG 2Q86A 3X3GH 1S78C 4MAYA 4G3YH 5DR5L 1YMMA 3KPNA 2CDEB 2K9UA 5F7KC 4OGXH 3E6FB 2CH8A 3UJIH 4WEUD 4GAYA 4GSDH 3MBED 5D7KD 3SHSA 4ACPA 1CXHA 5T3ZD 1U8MA 3NZ8A 5AZEH 5BRZB 4KI5F 4N0CC 1FLRH 4F58L 3OF6D 4GAGL 3CSBA 4Q9BA 4XC3H 1E6OH 1E4XL 1PVHA 1VPOH 2QLVB 1BBDL 4V2CB 5C0BA 1FLRL 3EBAA 3A0OA 3V9FA 5A3ID 4LRIA 1T66D 3L3JA 1CL7L 1ACYH 2NY1B 3ARTA 2E6PA 4QTHB 1MLCB 2WIIA 3DTXA 4WHTA 1A0QL 4V1DA 5EOTB 1ED3A 2AI0H 3KPSA 1FO0A 3EYOB 4APQD 4EZMA 4JFDA 1Q0XH 1YEFH 3RL2A 3WE6A 3B5GA 1KCRH 3G08B 2V5YA 1G6RL 4MNGA 3VGHA 1BQHG 4BK5A 3BUYA 2R0LL 4GG8B 4U1HA 5DJXA 4HIJB 3MREB 4E0RB 5D8JL 4MA8H 3N50A 4R4FL 4QHLB 4QOKB 3EJYC 4B53A 2R9HD 4ZFFB 1P1ZB 3UTSD 4OZGA 2QHRL 3KGRA 4CVXA 3MLVL 3D3VD 4Z7WA 1XF2B 1NBVL 4N8PA 2AK1H 1MRDH 5D93B 5BW7C 2CDGA 5IMLB 4G8GD 3T04D 4KK5C 4D8PB 3HZYB 1CU4L 4P9HH 2VN4A 5E8NA 5HVHC 1ZANL 5I1HH 4LSPH 3NAAL 4WDIB 4WHDA 3H7LA 2RCSL 3RVVD 3ECBB 1MFCL 3ROLA 4HUVB 1WCBA 3RTQC 1XAUA 2J8OA 4NQSB 1H8OA 1MWAH 4D9RD 2Y7QB 3UTSB 3SE9L 1QRNE 2NY7L 2Z93A 5HDQH 4OLXH 3GB7B 6CGTA 4F33A 3RJQB 1J8HA 3HZKA 3QRGH 5F3HA 3QUXA 2ADJA 3ZKXB 1S5HA 1LNUA 2AJ3A 1TJHH 3UTQB 4GT7A 5IFHH 3WE6B 3FL7A 2HTKC 1MJJB 4N0UA 3Q2CA 3W39A 5GRYA 1TVHB 4O2EB 4Y16C 5DDHB 3MNZA 4PRPD 5L8LB 2B8OT 4OUOA 4PJDB 4D0CA 4QF1A 1ZA3B 4KTEH 4BSVA 4YHLL 1ZT1B 3JSSA 5EO1B 2I60L 3GSNB 3MLTA 3MRIA 2A6JA 4NFBA 4JRXD 3O2DA 1AIFB 4OQTH 4FQXD 3TT1L 3P9LA 5FUCC 3DVIA 3SOBL 1M6OA 4R7DB 1FZMB 5D1XD 4L1DA 2ZUTA 5D7LD 4FQ1H 2VDQH 4KKBD 4MA7L 3VXTA 2BJMH 5D1ZB 4LQFL 2MHAA 1LK2B 2E9BA 4BZ2H 1LO4H 5TDNB 2BHZA 3ME0A 4GKSB 5EOCH 2KZWA 5KANG 5A1AA 4PR5B 2FB4L 5JPMA 1QSFB 4NQDB 3LQMA 2WBWB 4N8VB 1L9NA 25C8H 1AHWC 1A9EA 1PYWB 5JDSA 5AEAA 5DHXB 4UTAH 2R0WH 1KPRA 3I9GH 3RVTC 3U7YL 4Z8FL 3O9WB 3P0VL 3ZYZA 4UDTA 2H32B 1EERB 5DFVC 2X40A 3DV6B 2Y25A 2MOVA 4X83A 3TCXA 4HW6A 5E99L 4IRJC 2CLRA 4RAVB 5J1AB 3DHMA 3ARGC 4M62L 5EBGA 4MQ7B 3BP4B 3PWJB 4HPOH 4RNRA 3RVXC 4ZSOB 4Y89A 1C5DA 3BUTA 3UBXB 1G7PB 2DMBA 4OZHB 1Q72H 2X4PB 2XIDA 3KYKL 2FO4B 4LPCA 4ZUWA 3BKJH 5KSBA 3VG9B 3NCJL 2R15A 1NUFA 1KN2H 2VWEC 5TDNA 4JDTH 2A9NH 2FIKA 4YX2H 1YMMD 1MCRA 3KPMA 3TJHD 5KVGH 1QBBA 4YLQT 4ERSH 4OD3L 2PXYD 2YPLA 5EORH 1Q9OA 3IDJA 4FG6D 3DMMA 1AO7E 4GG6E 3V8OA 3QQ4A 2Y07L 4I0PA 3M8OL 3PP3K 4PGBB 4R4BA 3S4SG 3WFEH 2EO9A 1I8IA 2RR3A 1KB5B 4FQIH 3FB7B 2O61A 2YHGA 5IW1A 5C0BD 5IQ9A 3EOBA 3GSNA 4KKBC 5EO1A 2YD6A 3TM6A 5DD0H 3AMKA 1KENL 4UB0H 3QH3B 3WLBA 3OKKB 3W39B 1NMAL 4V1DD 1JMZA 4XH2B 2YD7A 4XP6L 3WFCH 4DW2L 4P2RA 3BO8A 4NNXA 3WNMA 4OF8A 3OAYK 2H3NB 2NNAB 2NY2D 1D5MB 5B39A 4ZSOE 3H3KA 1J86A 3EJJX 3MOBH 1ODAA 3GB7A 3QQNA 1J0KA 3P4NA 2EDLA 4PJGE 5BOPA 4L3CA 3WL9B 2AP2A 1XZ0B 1OP5K 4JFYA 3QJFB 3MXWL 1AXSA 1FGNH 1CLOL 2AXFA 3QIWD 3PDOA 2BSSB 4ONOA 4P46C 4BFEA 3N0PB 2IAMD 4K7PH 4OZFB 1K3IA 1VHPA 3BZ4A 5T5NF 5DHYB 2XYCA 3VDBA 4IMKA 3STBA 3NTCH 3BFOA 2YMXL 4LRNL 1U8KA 4WFGE 4F9PA 4UQ3B 5E2WH 2ZOLB 5HDBF 1RAMA 3QUML 3PWNA 4AT6A 3DI2B 3RIAF 4QY8A 5I1JH 2WMPA 2XICA 3TBWB 1GCFA 5IHUL 1QLFA 1N6QH 3NGBB 2V17L 5FOBB 3FQNB 3GMPB 3D39A 4WFHD 1I8KA 4PJEB 4KK6D 3QIUA 3O0RL 1U8JA 1G9NH 1UKTA 1UM4H 3AVEA 4LCYB 3RVWD 4IOFD 2OZ4A 4XAKE 5IT2L 5GRZA 1TCMA 2QKIA 5B39B 1K5NA 1XGYL 1TQCB 2P7TA 5E5RB 2AEPL 4MA7H 3EYVB 2BVUA 2P5EE 4WHTB 1LEIB 2BY3A 5IJVA 4XNXL 1CXFA 5DD6A 2BX5A 3MFFB 4DKFH 2UYLA 3O2DL 4OFIA 3L3DB 2PW2A 2RAMA 3V2AR 4M8QB 5KSBF 3SCMB 3G5ZB 3OJDB 3L3JB 4M9OA 2I9LB 5K59E 2GK2A 1V3KA 3GRWA 1H3UA 4G6AC 1OF2B 3FO1A 4FS0A 4KK6C 3IFNH 4U3CA 2OJEB 1T22A 3B2VL 3I2CH 3TWCL 4TPRL 4D9QD 1BOGB 4MXWL 5I18H 3M17B 2EZ0D 3GGWB 3FQWA 4NP4H 3UBXG 2IPTL 2W65A 4M7ZC 1C12A 4DTGH 4LHUD 5IK3A 1X4XA 2QKIB 5F7DB 3FO0L 5KOVC 3HB3D 1BQLL 3CU1A 2X4OA 2APTA 3BN3B 5LAXA 1ZLVK 4UU9B 4PJIA 1DQMH 2HP4A 5I71B 4NBZB 3DV4A 3OR6A 5F7LB 4K94C 1PJ9A 5BV7B 2X4PA 5IBTL 2H26A 2DDQL 3V7AE 3C9NA 5L0QB 2VL5B 5BVPH 5CJOL 4NJ9H 5DFWH 1FG9C 3L7EB 5DO2C 4QY8B 4POZD 1QSEE 2XZCL 1PY4A 1NCBL 4N8VG 3ZT7A 2BJML 3MUJA 3VWKD 1TVDA 4YBQC 1CFVH 2IH1B 3OKYA 4PTUA 2X1OA 1R5WA 5BVJA 1UZ6F 2VLKE 5AAMA 4FXKA 5C7XH 4X7DC 3INUL 2CUIA 2BZDA 1YEKH 1Y6MR 3U30B 5BXFA 1MCJA 4NWUL 3BAEH 1PX4A 3FONB 4OM0H 4CN4A 2BHYA 2BVYA 1BX2A 5BOZG 3STZB 2GJZA 2FGWL 1I9RH 1A6TA 2EDNA 2K7PA 2AJXH 5C2BH 4L9DA 4FFZL 3BQUC 1FVCA 1CICD 1YA5A 5FGCB 3MV8A 1EBPA 2PYEE 3TGXA 3G5ZA 3ARGD 1Z5LA 5IG7B 3JXAA 2AABH 4XT1C 2A6JB 1HKFA 1NC4A 4PBWD 1A7OH 2WBJC 2XWJA 3QJHB 4UNUA 2F74B 4G7VL 3FQRA 4QRPE 1F42A 3QXDB 1MFCH 3UJJH 5ICYA 4PJDA 4NT6A 5E8EB 1MSPA 4MJID 5FCSH 4ZNEE 1PZ5A 2Q76B 1T1YA 3V8CA 2B1AH 2EECA 3PV7A 1NJ9A 1U2CA 1S5HB 3MROB 3VFNA 2GTZA 3R0NA 5CWSB 3DI3B 1JJUA 5DRZB 3GSWA 5HSFA 5DUMH 3MLXH 4KRLB 3VXUD 4RFEA 5MHSE 5GJSL 5DD1L 1GGBL 1MCIA 1DLFH 2DKMA 3OKNA 4ZPTA 4HAFA 5FO8B 5GS2H 3RVTD 1I3RB 4K9EH 2W38A 3IKKA 1XR9B 1A1OB 1RVFH 3DUSB 2DRUA 1SBBA 4NJAL 5ICZA 3QHFL 4M6ML 4PV8A 4PRID 5J06A 2CLRB 5CZKA 2FZ3B 4YAQA 3IU3A 5CD5D 2PETA 2MFNA 4ZOAA 3H9HB 4F15B 5MHSD 4ZFOB 3RWHB 4CRPA 3KXFA 1A0QH 3F8UB 4G8GE 3RDTC 4UDTB 1T1ZA 1NCAL 4OZGB 3QDHA 1D6VL 4OQ1A 2CKBH 3EOTL 4JPWH 3TO4D 2FNBA 4EUPB 4FMKA 2BERA 2WWMD 4HIJA 3NFPA 4Q9QL 2VDKH 4LASH 2OS7A 2IBBA 2EIEA 1LO0L 4MD5A 4TSAL 5ISZB 3QIWC 5T1LB 2QBWA 5D5MF 2NY5H 5E1HB 2QQNH 1OGAB 1CE1H 3PJSA 2HWZL 5FGSA 4JRWA 5C08B 5K9QI 2J6EA 2R29L 4P4RA 2XACC 2XOTA 1RURL 5GGVL 4O00A 4E9LA 3HC3L 2WIMA 3HNTL 4YQXL 2VYRE 2AGJH 4UIKH 3WUWA 3MO1A 3QQ4B 3MJ6A 1RIUH 3AS0A 2JJVA 4NN6B 4P4RB 4YUEH 1QBMH 4XXDA 4BM7A 5SWSD 1NKOA 2BNUA 1Q1JL 3I6LD 3RWGA 3RUGA 3CC5B 3TYGH 3SKJL 2ZNWA 1JYXA 3CDGA 3BD5A 3N9GL 4U6XA 3LEVL 4YBQD 1F8TH 1H5BA 1OGTB 1AXIB 1JTOA 3L5HA 1YEDB 1G0DA 1IMHC 5GIRA 5CGMA 5ADOH 2BXYA 4NM8H 1QFHA 4WWKA 3SDXF 4OF7A 4QRRD 3BZDA 3D6GA 3QFJB 4PRHD 3QUXC 4XHJC 1UH2A 1JN6A 4JG1L 3IF1B 3U46A 4NZRL 4HZLA 5LWYH 4NBYB 2LU3A 5JA9A 1WAAE 5J9PB 2B1HH 4DQOH 2WQ8A 4D3CL 1IAKA 4JO2L 1UKQA 2E9IA 1EK3A 2VDOL 3MNVB 1TLKA 1IGTA 3QNYA 5IESH 1JPFB 3T3ME 5C6TL 1WTGT 1JF6A 2BNRA 2CKBA 1T03L 2AABL 5E9DE 2AXHA 1C08B 4IEFB 4KRPC 1VERA 4GMSH 1RZFH 3LN5A 4GRMA 4O51A 1T5WB 3L6FA 1IGYB 1EEUA 1Y6NR 2VLRD 5C9KA 3EOYG 5CKAA 3S88L 5KS9A 1F58H 4XNUL 5F1SA 4L9LA 5F7NC 5IMMA 3VD5A 1BVZA 5AWNL 1X5AA 3RL2B 2FYYB 5GRWA 2UZYB 4IRSC 1JHKH 2B5IB 4HBCH 4OGZA 5E6IB 4ZFZA 1S78D 4NPYB 5FO7B 2R2EB 1JGEB 1A3QA 4LGRB 3RKDD 4XPTH 3ARVA 5AZ2L 3QO0B 4OZGE 3V6FA 5L0QC 1AE6L 4OFPA 3PP4H 3LMJL 3MRCA 1ORSB 4OKVB 4IJ3B 3D3VB 5ESQA 3RGVD 4JB9L 5IJKC 5KVMC 3KYMB 3GKWL 5I18L 4X99B 1OWRM 1UEYA 2ZKHH 3TNMA 5A2JH 4PGEB 5D93C 5E2TL 3T0EA 1GGYA 2JJTC 3UC0L 3KDMA 4BKLA 1U3YA 3PWLA 1CXEA 3RWEA 4PGJA 4U1GC 3DGCR 1B9ZA 1MAMH 1JTPA 1CLYL 1I8LC 3N85H 1CFQA 3MV9B 4N68A 3U4BL 4AZ8A 2R2HB 5GGQL 1BREA 5E2WL 1VGKB 1G7QA 3MLYL 2AEPH 4DTGL 1QZ1A 3UX9B 2J1KA 1II4E 2G9HA 4PG9B 1C16A 2EE2A 4QWWC 1PDKA 3ET9F 2FHFA 4X7CC 1DR9A 2OZ4L 1JGLL 4DN4L 2HT4D 1MF2H 5I76B 1CYGA 4N0YH 2QSCH 5IWLA 2B0SL 5FKAA 2I26N 1SEBA 4P5KA 3MJ8B 2F8OA 4RMTA 1RJZA 1A6UH 2OL3L 1RHHA 3VGEA 3TT3L 2EH7H 5JOFB 2DQIH 3V4UH 4OCLC 2FRGP 3I3EA 5HGHA 3K1DA 3NA9L 4TOYL 2E7CA 3GGWA 3S96B 3OHXB 1V05A 1DANU 3REWA 1H3VA 1MLCA 2WIIB 3AFLA 4G8IB 4QTHA 3TNNB 5I66B 1BPVA 5I1CH 4HKJB 3B83A 5IT2H 5DJ2B 2YD3A 1SY6H 2OCFD 3BT2L 5HYJE 1C1EH 4XAKD 4O2CB 1P2CB 2Z31B 3I02A 3VFWA 1JGLH 1PKQE 1VFMA 3B9KB 1FN4B 2PXYC 2DI7A 4QHNB 4K23H 5GHWL 5IVXF 1KXTB 4X9FA 3MLZL 2YEZA 2VLJB 3CMOL 4NYLB 3R8BB 4CUCA 3MFGB 4F3FB 3TO2B 3VE0A 1JGVH 1Y0LA 4YR6B 3OKLB 2GSGB 3F6LA 3CFDB 4OTXL 1T2JA 5GGQH 1IJ9A 3M07A 4ZPVB 5B4MC 4LCCB 3V5KA 2ZSVB 4Z7OE 3PGFL 1HNGA 4X7FC 5C9JA 1WVZA 3PV6B 5CJOH 4OAWB 4OZHF 2MKWA 5FOBA 1MI5D 2QV2A 5T1KA 4CMMA 3PGCB 4UMGA 2P8PB 4F9PC 5SWQA 1GGCH 1AY1H 1J1XL 1RIHL 4TRPL 4U1KA 3HG1D 4LEXH 4U7SA 4WI4A 1HOCB 1CXLA 2CXKA 1HXMA 1C16B 2C1PB 5TE6L 1P7HL 3RX5A 2Q87A 5MEQB 3BYYA 3DECA 1H3PL 1HSBB 3STLB 4TRPH 3AU1B 1F2QA 3HE7B 3A6CH 3S5LG 2VXVH 3PDOB 1GC1L 2H32H 5ACZB 3MOQA 3LRSB 4Q6IC 5IQ7L 4HKZB 1CFNB 1NEZG 4N0YL 4MYWB 4YDJB 3RVWC 3RZCD 4WHYG 4H88H 2XZAL 5EBWA 1VDGA 2D0FA 4NHUA 3VU2A 5JHDD 3J8F7 2C1OB 4KKAC 1RZKC 1QSVA 4DK6A 1Q9KA 2FJHB 3KDMB 5HYSG 3QQ3B 3BRGC 3EZ8A 3HPLA 5FO9B 3T0EB 1T21B 4HUWA 4Y88A 1TITA 4LK4A 5IEKB 4PJAF 1F4WL 4RRPA 1KPVB 3NIDF 4TVPD 5EORL 3CNKA 2DF3A 3JBG7 3H9SA 1RIHH 4HDIB 2A83B 5MP6L 3OKKA 3HRZB 2DQEH 1RK1B 2NMSA 2Y4SA 4EVNA 5INDB 1ITBB 2V2XA 3K46A 1S7SB 2Z31D 3EO1B 1RSFA 1U8IB 4AM0A 3O4OB 2DLGA 3SKNA 4UBDC 3RRQA 1WBYB 1RJYB 3BH9B 3ILQC 2ENSA 5BW7A 1I8IB 4KKCC 2N56A 3VXUB 4XNUH 4U1MA 5I19L 4KQ3H 4EDXA 4YHZH 4P2QB 3S8WA 4H26A 2NQCA 2UZXB 1MWAB 1QFUH 3GO1L 1N5YH 2JCCE 3GRWH 2I25N 4P5MA 2M26A 5ESAA 1WWAX 3DURA 1EHLH 3F7YB 2VRAA 4QRQA 1LDPL 5H2BB 1MJ7H 4HIEB 4P2RE 4JM2A 1BBDH 3BEVB 4UNVA 3SE4A 1F2XK 5GGSY 4ELME 3LH2H 2F53D 4ZSOA 2B5IC 1H3XA 2CDFB 1QNZL 4L8CB 4GW4B 3NA9H 5LXGH 4OLEA 2A6KB 4KJYA 1B0GB 2DD8H 2IPKA 2R23A 1UYWH 1PD6A 4XNZC 5DYOB 1NUNB 3Q0HA 4QT5B 4R2GC 5ECJE 2IANB 2CGRL 1XF4B 3FFCD 4WY7H 3EFDL 1KPRB 1QA9A 2D0GA 1UC6A 1N59B 1CICA 4FTVD 3P4MA 5DUBB 5DEFA 1CD0A 1KIQB 3EJZD 4AG4H 2OMNA 2LABA 4KRPD 2V2TB 3E6HA 1OTTD 1KCRL 3TO4C 5FYKD 3LKNB 5JHLL 2BSRB 4WRLA 3CC5A 3FHQA 5JOFA 2R69H 5BO1H 1R3IH 2MHAB 5DVLA 4OGAC 1J0IA 5DGRA 3W9DB 4TNWK 4F7CA 5CEZD 5J3HD 3NA4A 1I9IH 1QRKA 4HLZG 4Y4KB 5F21B 3AREA 1A3LL 1IM9D 3S4SB 1KCVL 2NY4D 4NM8L 2M8XA 2A9NL 5FFLA 4KH2A 4ZS6C 4WJ5B 5HYQA 1KJMA 3KYNB 3SE4C 3LS4L 4HSQA 1ORQA 1S7TA 2C4XA 4GRWB 1YN6B 2AK4A 3WD5H 4XMLH 1Z9SA 3FRUA 4RQQA 4RMRA 2HVKA 3QEGL 4LSTH 3VA6A 2UZIH 1TVHA 1H8NA 5CSBA 3KPOB 3LKNA 1OW0C 3Q6FB 5FAAA 5EZLB 2OR8A 1S9XA 2PW1B 1MFEH 5IB3A 1EUUA 3H9ZA 4L3EA 3V6OC 2P5EA 2ZCKH 1N59A 4Y16D 3VRJA 5DZNA 4F33B 3DRQA 2QQKL 2NZIA 2J5LC 4G8FB 2PTVA 4X98B 2I5YH 4J23A 4XVTL 2QQLL 3WN5C 1WCBB 4HUVA 2VXSL 4R96B 5EUKA 2H1PH 4WHYH 4E41D 5AWNH 2AJZB 3FAXA 5FYJD 2G5RA 3FQXA 1IC1A 4ZYKB 4X6FB 4TUJB 3O9WC 4Q6IA 5DJCB 1FPTH 3P9MA 4JAMA 1NGZA 2OX5A 4FTVA 4LARL 2IQ9L 3BEVA 2YWZA 3C5ZB 1RZFL 1DBAL 3QUZA 4Z7WB 4YE4H 4PRBA 4YHOL 5L2JB 2PTTA 4TYUA 4KTYA 5IB4B 4N8CH 4ZUUB 1N2RB 5TQ0H 4BQ8A 3RVUD 5DQ9B 2ZG1A 1CDGA 1YZZA 4H26B 5CP3H 3QCTH 2A2QT 2HT3C 1UB6A 5C08D 3BHBA 4W81A 5JHLH 5F9AC 2OMBA 2C3WA 2CLZA 1LGVA 1PAMA 1I7ZB 3G5YB 2UVFA 1U3HB 1IL1A 2UWEA 4GXUM 5GXBB 3V5HA 3GRWL 3PL6A 1QRND 2IFFL 3OKDB 3T65A 4IRSB 1JL8A 5TDOA 3RGVA 4R2GD 3SO3B 1A1MB 1XMWA 3GSUB 1J5OH 4HHAA 4P57A 3CSYB 1F8TL 3L3IA 1D3CA 3UEZA 2OYPA 4KRNA 1REIA 1UFUA 4GMTH 1DDHB 2EYSB 3CX5K 4WWID 4ISVA 1UZ8B 3RI5K 3QT2A 3A67H 5F6IC 1V7NL 4FFVD 4PJ8C 4WFFE 2EE3A 1UCTA 4I18A 4Q9CA 2ATKB 4U1SA 2G2RB 1MHPH 3KPRE 5HGGS 4X5XB 2WBJD 2IH1A 3CX5J 4HIIB 5TDPA 4WUKH 1ZWIA 4P9HC 1X3DA 5C0CA 3C6SB 1BAFH 4LVOC 3T0DA 5F9JB 3WDHA 3VXNA 3HCVB 1SEQH 3C09C 4NFCA 1KJMB 3WSQL 5D7JD 5I6XC 3KHOA 3WEXA 4LSSL 5LKNA 2H26B 3GMOA 3TO4A 2ICWJ 1CDHA 4K3DL 3NH7H 3AUVA 3FB8B 3QHZH 1P6AB 4NNYA 4Y4KA 5JPNA 5C09B 4XPGL 4RIRB 1YQVL 1MFEL 1I1YB 3IDNB 4H25A 2MCPL 4WCYL 1L7TH 3SDDA 1HKLH 3UTSE 4XBGB 3SGKA 5DEGA 4M3JA 4ZQKA 1FE8L 1R3IL 4GG6A 3RTQA 4L8SC 5C09A 3GBML 1D5BB 2EXYD 5BZWA 1O7SA 3BP7B 3FFDA 4ODSH 5ACMA 4G6KH 4OFVA 4HH8A 4ODVL 4DN3H 1ZKAA 1CGWA 5KVDL 4ODUB 2APFA 4W6YB 5DUPL 5BS0E 3TJEL 5F9JA 1X5IA 1HH9A 4ETQB 5EWIH 2ICES 1VESA 4YGVA 3FOMB 1JPTL 4N9GB 1TZHA 5ACLA 4X5XA 4AEHH 5I66A 2X1QA 5HGAA 2B39A 2AV7B 4CKVX 5TF1H 3UPCA 3DUSA 2R1XA 3MGOB 1W8OA 4M61A 2HVJA 1ZHNB 3RU8H 1OLLA 1LO3H 3UYRL 5F9OH 5T5NG 3HMWH 4JO4L 3T1WA 1TMCB 1A9BA 1ZEAH 5FUOL 4MA1C 5FYKU 5JW3H 4PJHB 3FQNA 3GMPA 4EN3C 4O2FB 1VFUA 1NC2D 5C0NC 4OZ4B 4EXPX 4MNGE 1P84J 4JKPL 2ZG3A 4FQXB 4CADB 2L0DA 3MXVL 3ARDD 2E6QA 4PRHB 3SGDH 5I16B 4PJXA 3RNKA 5IROC 5C0EA 1JV5B 3NIFE 4XI5C 2JCCF 2EDOA 4NGHH 4MA3B 1NFDB 3V5HB 4Z7VE 3ARQA 4Y4FC 3V52L 5HHXH 1KIRA 4Y2DC 1DBJH 1CFQB 5H37H 2X6MA 1JNJA 3HRZA 4XNZB 4Y5VA 5KTEH 3I6KA 3RKDC 2OZ4H 5E1AB 1A7NL 1J1PH 3WUZA 3IB4A 1FVCB 1IVLA 5EULV 2WBJA 3EYUH 4L3CB 5SV3A 3UO1H 3DMMC 1WEJH 4XWOC 1OWWA 2A6DA 2DJ4A 4OD3H 4N0UE 5IF0B 2COQA 3UDWA 2DI8A 3IETB 1JUFA 1AY1L 1J1XH 1ES0B 1G6RA 4KJQC 3O8XD 4HX1A 1JYVA 1J8HD 2YKLL 4LLMA 4WI7A 3IRPX 4YDIL 3IFNL 5IB1A 5I30H 5EU5A 4JFEE 3S36X 2CRIA 4TUJA 4DN3L 5CZVL 3BQUB 2C4FT 4ZO9A 5FHBL 3UTTB 4JGJA 1A6AA 5CEYB 1W0WA 1JGEA 4KUCF 4GQ9H 3STLA 4AH2B 1BQHA 4B50A 3TBSA 4D0BB 3JWOC 1RV6X 3UTPD 3B43A 2F19L 4PRHA 1BLNB 3HC4H 5E9DA 2BNQD 3I50L 1ZT4A 2ESVA 2XKNB 1TCRB 2I07A 3HNSH 3P73B 3UPRA 4ERSL 1SMOA 2VLLA 5HHNB 3LHPH 5SX4H 1GGCL 3C9NB 4NKQB 4XP6H 3G6JB 3E1F1 1G7JA 5C0DB 1MQKH 4HXBH 4R26H 3Q3GA 4QRUB 3BKJL 4NQTA 2CKBB 5DA4A 4QRUA 5IMOA 5DLMH 1QFWM 3AXLA 1H3TA 4PRIB 3W0WD 2DTML 2YKLH 4BQ9A 4MDIA 3QXUA 3FFCB 3P30H 4KKLC 4LF3A 1BVLB 1ORQB 1H8SA 1B0WA 1NEZA 1S7TB 1INDL 4NQVB 4L8BB 5ADPL 3O3DA 4JDVB 2K1MA 2OJEA 4R90H 3O11B 4KHXH 3ULSA 4KROC 5DMJB 5KOMC 4UDUB 4K94H 4NKOA 1CGXA 3S35L 2E5EA 1NGQL 3GK8L 2QSCL 1MCWM 3QCUH 4UIMB 3ZTNH 1BFVL 2IG2L 4NCC1 5FYKL 2F15A 3FZUD 2I27N 4IRSD 1FE8H 1SM3L 3L7FA 1NDGB 3MRLA 3SBWA 5DJDB 5IBLD 5KAQG 5DVKA 4UT9H 4UQ2A 4IRJB 2HJLB 4JEGB 4OIBA 2BNUB 3AS2A 4OCMC 4F8QA 2IH3B 1QA9B 5D9SB 3ARFA 5FEBA 1I7TA 4LHJB 4M00A 1I85A 3JVGC 3TJEH 4JFFA 4JFQB 3BX7C 1I7RB 2JCCB 1ZEAL 3P2TA 4A6YA 5FYJU 1CR9L 1OAKL 4K3JH 1HXYB 4MLIA 3FB5B 1BZQK 3DUUB 1RMFH 1QR4A 3RNKB 5C0EB 3U2SB 1G7QB 1AKJA 1OGAA 1R6VA 4XWOD 5GGRY 1I1AB 5FV2A 3O2VL 5H94A 4OI7A 1KCKA 5HJ3A 3VWKA 4LIQL 1MRFL 4YXLH 1NLBL 1AXSB 3QUXB 3NH7L 3CCHA 4E41B 1PKOA 2HH0H 2OR9H 4Y2DD 4O4YH 4YPJA 5BS0B 3HA0A 3MA9H 4M9PA 2R0LH 1YQ2A 2J88H 4X9BA 1HZHH 1MJUH 2PYFB 1U92B 2E6JA 1EEZB 1WV7T 4LEOB 2WP3T 4H20H 4X4YA 1OCWH 5I74C 3CCHB 4E41A 4C83A 2AQ1A 1F58L 4JFOB 3VRLE 3ORJA 2ICWA 1OSPH 4JRYE 1S7VB 2D7QA 5GS2D 2ERJC 4PJXF 2AV7A 4FQQA 1UQSA 4P49A 1OTSC 3ZKXC 1BZ9B 3VG0H 4YHNB 3H0TA 4I2XB 4Y4FB 3O3EA 4RFEB 2NTFA 4P5TB 5IB5A 4PY7A 3P77A 3CVHB 1GJIA 5F96L 2C26A 1KIUA 1ZHKA 4ZO8A 5DEZA 2WK2A 3AAZB 1DBJL 5E6IA 4JY6B 3QIBA 4M1CC 2FYYA 2VR4A 3KS0H 3WFDL 3W82A 3DXAA 4Z7UE 3HUJB 4J3OC 1GXEA 3C60D 5GZNC 4BZ2L 4S10A 5ALCH 2Z8WC 5D9SA 1QR1B 1KYOJ 1QSED 1GGBH 5I75B 1U36A 5IB4A 3EDDA 3I85A 4YWGL 1P7QB 2JJTA 1NKRA 3DGGB 2AK1L 2P4AB 4OQTL 3QJHA 2DQJL 2XWJB 5MEND 2OTPA 1JPFA 3V6OA 1KLGA 1IM9A 3I9GL 1I9IL 3R06A 5MEQA 5CINH 3FO2A 4XNYH 4TNWF 2NW2B 3ARUA 5D8JH 4ELMA 1RIVH 4AL8H 5SWQB 1A22B 4DEPB 3C6SA 4M6OH 4XPBL 2NXYB 1P6FA 4U05A 2WAHA 2KQNA 3DMMD 3F6IA 1I4FB 4X98A 3SJVB 1RZKH 4JHWH 3WIIH 2X4SB 1RY7B 1BFOB 1FQ9C 1B2WH 2AI0L 5T1MB 2H8PA 3TBTB 4HGWA 3MLRL 1UYWL 4JZOA 4S1DD 4QKXB 3OJ2C 5FGCE 2R0ZL 1OAZL 5C86A 4XPHL 2X4NA 5M94B 4AEFA 3MRQB 5LJYH 5EO9B 1EEQA 5GRUL 1WFOA 3VFVA 3VXTB 3MMEB 2IAMB 3GBMH 4XRCA 4C4KO 4RX4A 1EUTA 1LO0H 2ITCA 3JUZA 3IXTA 4NC1C 1T0MA 3QPQD 1ZT4B 2ESVB 2DQFB 4P57B 1OAQL 5HHME 3THML 4ODWB 3BIKB 1N5YL 3MZTA 3EIFA 4ZAKB 3OBAA 3WFBL 4AH2A 3QUKA 5B4MD 2P48B 1WC7A 4NKIH 5AUMB 5GSRB 4WI8A 5DD5L 3S5LB 3PJSB 5EZIL 3WSQH 2RIKA 5DDHA 3FCTB 1D6EB 1Y6KR 1FL5B 1OP5H 1CL7I 3EYQD 4EXKA 3FQWB 3E6HB 1FVEA 5HPOA 1AO7B 2VDPL 1Q0YH 2RJMA 3IETA 4F7MA 4JANA 1UXSB 4UUJB 4PBXA 35C8L 1N2RA 3OAYH 1G7LA 5JO5A 2EDHA 1CFSA 4NWTH 4LSVL 4TVPH 3UTSA 3DROB 5K9KA 1K4CB 3OB8A 4I2XA 3OKMB 2AXGA 1I3UA 4PD4K 3RI5F 3U6RA 4CNIB 4M8QA 5T1DH 3G6JE 3IU3B 4ZUTB 4RSVA 3QI9D 4XP1H 1IC4L 5CCKH 1CDUA 1EZVY 1MVFA 5IGXH 1IAII 4D8PA 1XR9A 1KJ2H 4KMLB 4PJXB 3D3VE 1XF5B 1QOKA 4I3GA 1T04A 4JM2B 2D7MA 1VCAA 5J13C 1G7IB 3ESVF 4JQXA 5I1KH 2XNAA 1XGPB 1MAKA 3EFDH 3TH2T 2XKSA 3UJIL 4PG2C 5IV2B 2YS4A 4HWZA 4XCEA 4E0RA 3LB6D 1S9XB 1AC6A 3MREA 2YD8A 3T77A 5I71C 3LKPA 4CVZA 2OTWA 3NCEB 1CDIA 4U1MB 3CGTA 3BEWB 4D9RE 1RPQA 2ZOLA 4M7ZB 2Q1EA 4M7KL 2GCYA 1FYTA 4M7LH 3IDYB 4OF6A 3QDJE 4GS7C 4NJAH 1IGIL 2LAAA 1MNUH 4ZMAT 5I8KH 3IJHB 4YH6A 5MP6H 3WIHH 1CF8H 4A6YB 4ODWA 1R0AL 4WY7L 2X44D 4PREB 1BFSA 5IIEB 5F97E 2VITA 5KS9B 1VA9A 2XWTA 4HFUL 4ZOBA 3LN5B 2EKJA 1XGRB 3WMSA 1FNSH 4PJBF 5ABDE 4M6OL 2XI9A 3NZ8B 4XNQA 4RAHA 4F57L 4F9LC 5H35A 4UV4L 2X70A 3QPXL 3L5IA 4CVWA 3QH3A 5E2JA 4LQ1A 4PB0H 2NY4C 4QHKI 5EUOB 5D2LF 5JA8B 3DX9B 4J6RL 4EN3A 4PTUB 1C5CL 1FO0L 5TE7L 1U0QA 2A6IB 2R23B 2UWEF 2MSPA 5TE6H 2EXWD 2JJWA 3G6DH 2EZ0C 4WW1B 2C7UB 5D1XB 5J6HB 1T89C 4FFZH 4MAYC 5KW9L 3WFCL 1AGDA 4LVNB 5KSBE 1J0HA 1Q8MA 3L5WA 1EJ6A 1DP0A 1ZT7B 2UWEE 5CGYD 5C0CB 1KENH 1OSZA 5FCUL 4CMMB 2ZCHH 4PV9A 1TZIA 1E4WH 3QDJA 1IC7L 4HIIA 1V5JA 5DI8B 2BVOA 3MJGX 4TSBH 5A43C 2XPGB 4P23C 3MX0A 4K2UL 1ZGLA 1FNLA 4GKZB 5GS1C 4WENB 4B41A 3IDMA 2YBRA 5FIEA 4ZUWB 4DCQB 3LHPL 4PV9B 4YFEA 2AJVH 3W2DL 4DUVA 5D1ZD 4KVCL 3V0VA 1FG2B 5IVZA 3PDDA 1KN4H 3DARA 3UPRB 4PS4L 3I6LE 2DLFH 3OAUH 3GSNH 3VFMB 3ZHKA 5HYSA 3LY6A 3MRNB 3W11C 5GHWH 2YPVL 2J2ZA 3FO1B 3OMZA 1NPUA 4R2GB 3OGCB 1BP3B 1A7PL 1NUDA 3QAZC 1CN4A 3G04A 1YEJH 1YC7A 4EVNB 2MNUA 2VZVA 5DJ2A 5I1CL 5I1JL 4ZS7L 4JE4B 3RGVB 3O6KH 3PHOA 3DX8B 3S3JA 2YOCA 2DQHL 3C6LC 2X4RA 3VFPB 4XNMB 5TFSL 2EH7L 3GM0A 3MRBA 5KSUB 2J7LA 3HR5B 3IDYC 3L95A 2L7UA 1U8HA 3OL2A 4F7PA 5I1AB 1VB9A 2WNGA 3SDXA 4QRPA 5JW4R 3KPRA 3P0GB 4MNHB 5GS0H 4NCC2 4X7SH 5LGJB 2ORBL 1ND0B 2GK0A 1N4XH 3IDUA 2OL3A 3PWUB 4NO2A 7FABL 4H0IA 4UV4H 1OARH 4RX4D 5I76A 4DKEH 2X2YA 1C1EL 2XQYK 3BKMH 2DIBA 4DKAA 4ZUUA 1D5IH 1HHIB 1KIRB 4EUPH 5GS0L 5C0AB 3HE7A 4RGNB 5JXEC 1MIMH 4OLWL 3LCYA 4CAGA 4LCWE 5E99H 5JDJA 3LIZH 4O2EA 2C1PA 3BZ4B 1NCDL 4JFDE 5JW5B 3NTCL 4S2SA 2CKNA 3O6KL 4FQXA 2DTMH 3RGVC 2ZPKL 3HI6H 1DQLH 3BPLB 1YNLH 4DVRH 3RZCB 5FOJA 4IM8A 5F3BA 3SDAA 2D4DA 5E6YA 1N4XL 4MNHA 3KWWA 1FL3A 2O5ZH 2H45A 2OM5A 4JFDD 3GIVA 3PGFH 4Y4FD 4NT6B 3MRBB 4LHUA 1QSEB 4U6YA 5I8CA 1BGXL 4UILH 2APWA 3PHOB 4FZ8H 5D5ME 4OGYH 3WLBB 2ZUUA 4PJ5D 1I8MB 2H2PD 2VLJA 5IMLA 5DJYB 5DUPH 3OGCA 5CBAA 3S37H 5A2LH 5IQ9B 4UDUA 1GC1H 2FLBT 4H5SB 5C0RH 5F6IB 3VH8G 4HGKC 3ZT5A 1HILA 3QIBD 4NQVA 1G9MC 4G8IA 3OB0K 1EFQA 1RZJL 3S96A 4BSJA 2QTEA 2N7AA 1K8IA 1FL6A 4LDLB 3ULUC 1JYNA 4G9FA 4LGSB 1KCSH 3VMOA 3PHQA 3CFBB 2AGJL 4UIKL 4RCAA 1RUPL 3W9EA 1AGCB 2YRPA 4RIRA 4NNYB 1KTLA 4QOKE 5EU6D 2AXJA 4TSBL 2DM7A 5FHBH 4N1EA 4QHMB 4QRSA 3WKML 5TGBA 2EE6A 5J11B 1T20A 4HWNA 1XEDA 5J1AA 1ZANH 1K8DA 3MPCA 3QG6A 4WWKC 2NCMA 1CDJA 4XRCB 2YSSA 5L2KA 4Y7MA 3R0MA 4P23A 2MPAH 4MVBC 3B9KC 4XVUD 1GIGH 5BCAA 2CKBL 2ATKA 5ID1B 2X1WL 2DQUH 4OLYL 2R2HA 1MCBA 4TVPL 3OKEB 5EZOL 3ZKQD 4JFPA 3DX7A 5H35B 2PR4L 1T1WB 4Z77A 4QO1A 4MAYB 4HPYH 3C87A 3RWEB 5C07B 3KR3H 3AS1A 1Y18B 1ZHLA 5DRXA 3ULVE 1BAFL 3ARRA 1DDHA 4M62H 4OBRA 2ED9A 4M48L 1DE4B 3O4LA 2AQ2A 3D9AL 4PIRF 2DBLL 4LMQI 3HS0B 5EZJA 4LBEB 2CD0A 4ELMB 1IBGL 3PHSA 3VXME 3H3PL 3VXUA 1QYGH 1YECH 1Q38A 1P9MA 3GMQB 5JR1L 2Q8BH 4HEPG 1F11B 1BBJA 2R1YB 2HFFB 3ARED 3PL6B 5D2LB 4IMLA 2B4CC 4NQEB 3PABA 1KJ2L 4YHPB 1I7ZA 3MNZB 4LSPL 1L4IA 1G9ML 4C55A 2DKSA 4Q2ZA 2A9ML 2VDRH 4X7EC 1FNSL 3KAAA 4PJEA 4KQ4H 1RUML 3VD7A 1JBJA 1WF5A 3IYLW 4OZ4A 4Q58C 2BCKA 1IGYA 1A4KB 4JPWL 1VADA 2NY2B 1NCTA 3QG7H 5ICXB 4JN2A 2XN9D 3FT4A 3QYCA 3D2UA 3QRGL 1A7RL 4KUCD 4MJIE 1F3DJ 1KC5H 1X7QB 1MI5A 2XG4A 1FZOA 2EDWA 4MA8L 1XF5A 2VJXA 1HHKA 2F53B 1SVZA 2I24N 1U8OB 3BIAX 4O5LH 1HHHA 2JK5B 4LKXB 1S7VA 4AJ0A 2OI9C 2ICWB 5GGSB 3NFSL 4WFED 2XTJC 3DETD 3NBNA 1C5BL 3LS4H 1CQYA 2CDGB 2VDKL 4JFFD 3WFZA 2DOCA 4LEOA 3ARZA 4U6HA 1OVZA 1K4CA 1WFNA 1HK6A 3IAGC 3K81A 4LGPB 4G8FA 3ARDA 3WO3B 3ETBF 3S97C 5HVGB 1Q9WA 3L3GB 4R3SA 3QULB 3CXHJ 5AYUL 2UVEA 1VADB 2XY1A 1KB9J 2GTZB 2H3NA 2NNAA 1HYSD 1H5BB 2R29H 3LV3A 3TVMC 1S9VB 3NPSC 4GH7B 3QDME 1MJ8H 4N1CA 5DEGB 1D6EA 1U8QB 3HZMB 4LOUD 2HVKB 4MD4A 2YPKA 4OFYA 1HN1A 4K9EL 4HIXL 3BGFB 3PABB 1GGTA 1UVQA 1L7IH 5J8OA 1JWUA 1MCDA 6FABL 1A6PA 2ATPB 2R1YA 5I8OL 3SPVB 4GAJH 3MO1B 4F3FA 4IIQA 4UTBH 4N5UA 3VFUB 2CR3A 2L4OA 3ARXA 2EDKA 3ILPA 4R4BB 4GAFB 4JFQA 4YDLC 3THMH 5C0BB 4FA8A 3HC3H 2XTJB 4NKDA 1EFXA 3HHRB 5DMGC 4RISH 1RZJH 2IAMA 2VDOH 3GHBH 3GMNA 1ZWIB 5JOEA 4PJFB 1IAIL 4X5WA 1AQDB 2IALA 3TN0D 3RL1B 5FB8A 4AL8L 5FUZL 3QNZA 3W0WA 5HBBA 4GAGH 1MJ8L 3L3KB 3RUGF 3QUZC 1AC0A 5TH2A 1JTTA 3HTLX 3OB0H 2J4WH 3NFPB 1A1NA 1DVFD 2H2SD 4P99A 1MH5A 1JHTA 4JO3H 5EIVA 3NCCB 4NN5B 4WWKD 1ITCA 3KHQA 4X4XA 3GO1H 1WIPA 4XPFH 5B39G 3ZYJA 4K7FA 3TBYA 3CH1A 5JZ7D 1S5IH 4MZ2A 3HUJE 4J3XA 4BUGA 4KJYB 4P4KD 2DAVA 2GUOA 1DQQB 2FGWH 4OZIA 5J1SC 1M05B 2NLJA 1MEXH 2VUOA 1UENA 3PE9A 3IU4L 8CGTA 4LP4A 1KPUB 1T7XA 4MQXD 3WLWC 1A8JH 4PJHE 1YY9D 4R8WL 1NAKH 4WI2A 4UOW1 3X14A 4NQDA 4DVRL 3RWFB 4MB3A 3OQ3B 2YRZA 5D7LA 5C07D 3GSWB 4RGMB 3U9UA 1AP2B 3RIAK 3SGDI 3BE1L 4K55A 3RP1A 5C2BL 4ZFGL 4R7DA 1QQDA 2R4RL 3P9LB 4LSTL 4EI5D 3QUYB 4RDQF 5IVXA 1IGCH 1D5IL 4E42A 1EH9A 4N0FB 3CVHA 1D9KA 2CUMA 2X4UB 5L2JA 3ZTNL 3NCYP 3BESR 1JPGA 2VIRB 4Y4KC 5C3LD 5EZOH 2A1WH 2YXFA 4IHOB 4IHOA 4WNQB 2IMNA 2AKRB 2DQDL 1I1AC 1Z3GL 3KXFD 4NZTH 3WJJA 4D0DB 5EBMB 1LO5B 4OZIF 4WFFD 3NACL 5K93A 1PKQB 2CIKB 3QUYD 3GMLB 1ZE3C 3SO5A 5CIPH 4P5TC 1Q9KB 4S1QL 4N5EC 5ALBL 3OZ9L 3WUWG 3MUGA 5IVXE 2VDMH 5SWSA 3SDAB 2P8LA 5IBTH 4TULH 3RA7H 5AAWA 5IB3B 2DBJA 4FQHB 1U8LA 2HH0L 2Y06H 5ACZA 1KT2A 4WDIA 1PZUB 3V5DA 3LKRA 4EBQH 2QL1A 2YA2A 1A2YB 5TPWL 3S36L 4BFIA 3EYSH 1HSBA 1XH3B 3MV11 1CFVL 3IXAA 3NIDE 3RNQA 5KVGL 4JFEA 4DZBA 9CGTA 2GITB 1J0JA 3CXDH 1NDMA 4M8VA 5IUSA 3RWIA 3VXRB 1EEYB 4NM4H 4H88L 3BPNB 3MV01 4HZLB 1J8HE 2R1WA 4YK4C 3Q5TA 3IDIB 4POUB 5ITBL 2ZCHL 4NSKA 1OAUH 5EFIB 4JFED 1F02I 3S3PA 3UJTH 5KSVA 4XMKH 4ZUVA 1CCZA 2FH6A 4X4XB 1AJ7L 3U82B 2SEBB 1YEDA 3A6OA 5FF6A 4XNMA 1FIGH 5CD5C 1NGYA 2NY5C 1FIEA 2EDDA 3ILQD 1FO0H 2VDLL 3IKCA 4WNQA 3ZE1F 5C0GB 2B4CH 5HPMB 3D0LA 4I3SH 3FKUS 3LH2L 4J4PD 3FOMA 5L7XL 4PUBL 2Z35B 2KUTA 1P4LB 5IFJA 3O2WL 5D1QD 4I9WD 3X12A 1P4LA 5IFJB 1SY6L 3BT2H 3P11L 4Z7UA 2DM3A 2YRLA 2IPKB 1L9MA 2B4CL 1HWGB 4O2CA 2A6KA 2P5ED 4ONHA 1NGWA 4ZUSB 2CK2A 1MY7A 2GAZA 3SCMA 2WUBL 2YWYA 2RGSA 1T66C 4PLNC 3BP7A 3FFDB 1NEZB 5I6XB 3OHXA 2BP3A 3REWB 1NFIB 2EDQA 4CBPA 5LCVH 4PRIA 4GUPB 4XGZB 3B8SA 3UJTL 4F80A 3U9UB 1A7QL 1JWMB 4YXHL 4GJTB 4MQXC 3WLWD 5DC9B 5EFIA 3QRFM 3Q6GH 3TBVA 4NSKB 1OW0A 1MF2L 3T2NL 1ZSDB 3F58H 4WUUE 4R9HA 1MIEL 3VI3E 5E2UH 1LE9B 2WM0A 1TCRA 1MREH 3ARDB 3JWNC 5L6YH 3LS5L 2RFXA 1SY6A 2AEIT 4P3DA 3U0TA 5KJRL 5F7UA 4P23D 4HIHA 2VZSA 3BGFC 4LEXL 1YNTB 3J7HA 5DRWA 3VCLB 4RGOH 4PV8B 5C3TA 4KY1H 5B8CC 2OLDA 4PLOB 1KN2L 3QA3B 2F53A 3MLWH 3SO3C 3KYKH 3MRPB 1ZGLM 4LCUB 3JTTB 4JLRB 5SWSB 1ZLUH 1YY8A 5F6HJ 2GFBA 2VABB 5I30L 4P4KC 3C5SB 4BH8B 1NL0H 4BKLB 3SN6N 2UY6A 4L5FL 4M1GL 4X5WB 3HMXH 2D31B 2WWKO 2Y07H 3S3SA 3ULUH 4TQEH 1KN4L 4BK4A 1YUHA 4ZNEA 1M6OB 1YC8A 1NMBH 1SYVB 1FNGA 2UV3A 5IIEA 4BSWB 1WT5C 3D3VA 2FX7H 2Z31C 4MJ5A 1M7DB 2FJGA 5E5MB 3N85L 1MFAL 3MBXH 1YEJL 5IVOA 1JPGB 12E8H 1HI6B 1ZT1A 1IZJA 5IB2A 4P9ML 3GSQB 5IW1B 5FO7A 1DQLL 1KGCE 5DK0B 2AS5M 1J1OL 1Z5LB 5IG7A 3V4PL 5IVXB 5DZLA 1K2DB 3P40A 4N0UB 4LQFH 2NY2C 5J7CC 1DVFC 2VMFA 3V4UL 2HRPH 4RGNE 3BP5B 1YUHB 5I1DA 2YD4A 4HXAL 4POZC 1CT8A 2BOCA 3MCLH 4A2LA 2VDNH 5ID0B 3LQZB 2FIKB 1AP2A 3KYOB 4GKNB 3PWPD 5C9JB 4KKLD 4JJ5B 4QRTB 4NQSA 5IHBA 2R56H 1W72H 4LCCA 5B3JE 1FFNA 3VJ6B 4KTEL 4OD2A 1JHKL 1RK0B 4HBCL 2BVTA 4WO4A 1NSNL 5A2IH 3FTGB 3W5NA 4XCFH 1QLRA 1HIMH 4R96A 1NBVH 2YEZB 3GSOA 1JN6B 1GGUA 4P2RD 3DV6A 1TVBA 1FVDA 5EG6C 1RU9L 4XPFL 4G6ML 4P48A 5JOPE 4NN5C 4UT6H 5CLTA 5MI0B 3DYMA 4IDJH 1TTFA 1EGJH 4QOKA 5GS0C 4M6NL 2HWZH 3QIUD 1G6RH 1D5BA 2CJUH 1KTLB 4HCRL 3TBVB 4JPKL 3CDGB 3JV5A 3H7BB 4HS3B 4ODXB 5LAXB 5FB8B 5F1IB 3WIHA 1AQDA 4XVTH 3SDDB 3ZTJG 3KPSB 4FTVE 1WAAF 3NMEA 1MFBH 3WXWH 1HNFA 1YN7B 2R8SL 4AIZA 3TZVA 3U0PB 5HI4C 3TT1H 1AE6H 2XZQH 4JM2C 1WWCA 5E6IC 5F70A 5GGRB 3HCVA 3X12B 2DKUA 4X9HA 4ZOCA 2Z91A 2OJZL 5CEXB 3VFSA 5HY9B 4JN1L 4HLJA 4MQTB 5F89B 2EDTA 32C2A 3MMEA 4DGYL 3HNVH 4ODSL 2XFXA 4FZEH 1WQVT 1KCUH 3KLSA<