2Q6WB

The structure of hla-dra, drb3*0101 (dr52a) with bound platelet integrin peptide associated with fetal and neonatal alloimmune thrombocytopenia
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
188
Chain Sequence
TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystallographic Structure of the Human Leukocyte Antigen DRA, DRB3*0101: Models of a Directional Alloimmune Response and Autoimmunity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q6wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2q6wB01
4DWHA 3SPVB 3SKJH 3W39A 3BPOB 1T0MB 1ZA3B 2DLEA 2ZSWA 1WZLA 5MEOA 5C86A 3FL7A 1I85C 1H3WM 2NXYD 2VDQH 4TUKH 2P47B 3LPWA 4WEBL 1QFOA 3OB8A 1LO4H 2DF3A 3KYOA 5J3HC 1DLFL 1J0HA 4HWBL 2IF7A 2V6HA 4JFOB 2MPAL 2XRAH 5HVHB 1ZOXA 5CFHA 3MRCB 4OCNC 4KKLC 2VOTA 1I3RB 32C2A 3GI8H 4W68A 5IOPB 1Q0YL 4M6MH 5F7EH 2WMPA 2YN3A 3SN6N 2EDDA 3LVEA 4U1HB 3ULVF 3KPQB 4LVEA 1JN6A 3REVB 3SQOL 1NLDL 4GAYB 4UT6H 4Y5VA 1NMCB 2XQYG 4YXKL 3X14B 4Q6IA 5DUBA 2PW1A 2NX5B 4DZBA 3QXUA 3V52H 5T5FL 3TH4T 1VFBA 5LGJB 3ARBB 3RUGA 2PYEB 1KT2B 2V9TA 1RZJC 4JKKA 5EZLB 4NZRH 5ANME 3JTSA 3BKJL 3TA3B 5GGRB 1S7XB 1NCAH 3BP6A 3QIBA 4GRMA 3WIHH 3CH1B 1NGZB 5CIPA 4JN1H 4B7IA 2VLJE 1S7SA 3VH8A 2VDKH 2VZTA 2VN7A 3HE7C 3MRFB 5LXGL 1NL0H 4KJQD 2RBLA 2YD7A 4UTBL 3BYTA 43CAB 2WUBL 5T3XH 3GMOA 4NKDB 1AQKH 2R2EA 1CDJA 5BCAA 5CEXA 4WV1B 5E24E 5C6WH 4ZXBD 3DVNA 3MOQA 3HMWH 2V2TA 4R97C 4Z8FH 5T1LD 1XR8B 1B6UA 4O02L 1UXSB 3G04B 1FPTL 3X12A 3HLAB 2FYYA 4TUOB 4NQDE 4XVJL 3DMMB 1WQVT 2QQNL 4MZ2A 5EFIA 1OWWA 4OCRL 1YMME 4UDUA 1ZHLA 1WSST 4KK9D 4HWZB 2EKJA 5IF0A 3T0AA 1I8LA 1A7RL 3D3VA 3A0OA 3NIFE 4OLZH 4YX2H 2IADA 3ARVA 4XCYA 2OL3L 4JG1H 3V0VB 4FQCH 5DYOB 4OTXH 4GXVH 4WVRA 1VEPA 1FYTB 1FLTX 3P2TA 5IR1B 1JPTH 2V17H 3B4NA 1FDLH 3CMOL 4KKCC 4PV9B 2MHAA 4JR9H 4AEHH 1MFDH 2V5MA 3WD5H 5LVEA 1JNNL 1NUNB 1U3YA 4JRYE 3DX7A 4JM2C 1IC5L 5TFSL 4FQHA 3FJTA 1S9VA 4KAQL 5F70A 4WFGE 4XRCA 1RIHL 3IKCB 4YPGA 1E4WL 4MAYA 1R3LB 1HXMB 5JHDB 3CDCA 2J7LA 2VO5A 2VNCA 2AQ3A 3EW3B 1JZ8A 1CT8A 1S9XA 4J4PA 1NCWL 2QSQA 5TE7H 5HPMA 1AO7D 4GXUN 5DRXB 1FFNB 4R26H 1FZKA 2CDGB 3BO8A 4IRJB 4Y19D 3T0VA 1I7TB 1SJHB 1MHPH 3AXLB 1NBVH 1D5BB 1A1MA 4N0YL 3G6JF 3TC9A 2A6IA 2XZQL 3NFSH 2VXUL 5JOFB 4FRWA 3KJ6L 2FBJL 3DPBA 5D2NC 4MA3B 2X70A 3I85A 2FJFB 5J1AA 3MLUH 1P9MC 4MXWH 5HHOE 3OR7A 1GGYA 5DO2D 3HG1D 5J12B 2WQ8A 4TPRL 3OJDB 1BREA 2EECA 3P4OA 4S1QH 2RAMA 5KN5B 4OZ4A 1OF2A 3X3FL 5C0JB 4NWTL 3DETD 3DXAB 3UAJD 4OD3H 1KNOA 3ZDXF 2NY3B 5K59E 2UWEB 5IFJB 2RQ8A 4JZNA 2VIRA 2NY1C 3NVQA 4PGCA 2A2QT 1A3RH 2WWMD 3BISA 5I1HL 1BIIA 1T0NA 1QSEA 3N1MC 5E94A 5ICZA 5CSBA 1MCKA 5IMLB 4F7CB 1JUFA 4MS8C 4L1DA 3U6RB 4UQ3B 1T66C 3G6DH 2FHFA 5HVGB 3U9PL 3GFUA 4PJ7F 3CVHH 3WNNA 1MCPH 4XAKE 5DEFB 1SMOA 2CLVB 4PB9L 3EGSB 2IAMD 1F2QA 1NANH 4YDKH 1CQKA 2AK4B 1FO0A 1HK6A 1JZ3A 2OMBA 3SGEH 1RZJL 2AAVA 1LE5A 2Q6WB 3ZZ1A 3DO3A 3QAZB 4GUPB 2ZOLA 2AABH 2ADJB 3MMEB 4U2ZA 4AY0A 1F45A 4K94H 4X99A 2EDQA 3T8XB 3LKOB 4C56D 2ZUWA 4LSTL 2EEBA 3HZYA 5GXBB 1EUTA 3VDAA 1U9KA 4Z7OE 2A9ML 1G9EA 1DDHB 3MJ8A 4P2QB 4HC1H 1TVBB 3WNMA 4QXGL 4DUWA 3FOLA 3UTSE 1TZGH 1U3HA 2A38A 3SDDB 3ESUF 3C6LB 2P49B 3PL6B 1I8MA 1UACL 5GGQH 1P1ZB 3IDGA 3RTQB 4XP6H 3MRJB 5I75B 4EIGB 4BFIA 3B9KD 4O51B 4Y16C 3HPLB 5HHVL 5A16B 4HT1H 2GCYA 2DD8H 3DYMA 4O58L 5FUZH 2R2BA 3BGMA 3HI1B 1D5ZB 4M1GH 3X17A 4HIXL 4KI5E 1J5OH 1PBYA 1CD8A 5HDOA 3FRUB 4UAOB 5JA8B 5IROC 4U7SA 3I6LE 5GISH 1UJ3C 4KKBC 2XTLA 4M7LT 1AGDA 3HFML 1S9YB 5I15L 5CD5C 1KOAA 1FNSH 3VE0A 1BGXL 2B4CC 4H5SB 3RY5A 4YLQT 3QDMA 4X6BB 2PYEE 4P2YA 4WFFD 1T5XA 3MSPA 1BFVH 4NKMB 1A7OH 1OAKH 4WU5A 2IQ9H 4OD1H 3WS3B 4QRTB 2MCPL 3A6OA 1KLFA 1RJYB 2DIAA 4OQTL 2Z31D 5DMIL 2DTSA 2NY0B 4IIQC 2BOBA 4X4ME 1MF2H 3PDDA 4PJHE 4JFED 1UADC 5LJYH 2R2CA 1CG9B 2F19L 4QTIH 2AJZB 3MRLA 2BRQA 5FECB 3BPNC 4MGXA 1U91B 5I1CH 4HWBA 5AYQA 4Q9RL 1BVLB 4M7ZB 2JB5L 1HQ4A 5D7LA 4G43A 3LQAH 2DKSA 3ROLB 4JZOB 1INEL 3O45A 3O2VL 1IARB 5J06A 1NAKL 3RL2B 4GRLD 3TJEL 4HPOL 1O7VA 2NW2B 4PP2B 5ICYB 5DJDB 4JFPA 1WWCA 4XBPB 4AH2B 1GGIL 1YJDH 3MV8A 3GBMH 5D9SA 2SEBA 4Y4HD 4CJ1A 5D5MA 5HHPB 4H26A 3QT2A 4XGZA 1SYVA 3O4OB 4GRWB 5GRZA 3RHWK 1BAFH 3ZO0A 1VADA 4R2GB 3PWUA 4MMXC 5SX4I 3BVNA 3NAAL 5DDHA 4LOUC 2DBJA 3D69B 1C12A 3FFCB 3T3MF 3EBAA 1FFPB 1YNLH 3QDJD 4IMKC 5CGYC 3NZHH 5GRXG 3CFCH 1J88A 4OCWL 3S35L 1RIVH 4GG8A 1V5JA 5IBTH 1IAKA 1MCNA 3MUZ1 5E5MB 1PX3A 3EYQD 3S88L 4N5ED 1GJIA 5GGSA 2DQJH 4P3WA 4PLKD 43C9A 3MV7D 2GK0A 4PRBB 2CGRH 4P5TA 3QI9C 2F8VA 3CLFL 1FL5A 1K6QH 1RZIB 3ARYA 1RZ7L 2CKNA 4MJIE 2C3VA 1LK2A 2X4QA 3OG6B 1QLEH 3MNWB 4X6DA 3RU8L 3DUUB 2CUHA 3LEXA 3PIQB 5D6DC 4UIMB 3QWRD 2FNBA 3OAYK 1MRDL 1RJLB 2CDEB 4FXGA 2P45B 5A1AA 2OR8A 2AP2A 5HD8C 3IRZA 4OFKA 3IGAB 2WUCL 2ZUUA 5IB5A 4M62L 1Z0MA 5HYJA 3DJ9A 3LV3B 1RUKL 4YDLB 1EAPA 4LEXL 2ZUTA 1FZOA 1EXUA 3IDYB 4OF3A 4PJXF 2BY0A 4K3DL 4LLWA 4NC0B 2DQGL 3BPLC 5FYJU 2MFNA 3SOBH 5KSAA 1U8MB 4PJBF 2AJ3B 5FO8A 2X4NA 4CUCA 3FT3A 4KDTC 1T7ZA 1M71B 4MQTB 2NZ9C 4NHCH 4R0LC 1VGEH 1LDPH 7CGTA 1S7WB 5IMOB 2E7LC 1U41A 2A0LD 4RISL 3LRGA 4I2XA 2HJKA 4NBXB 2B4CL 5DD6A 5SWZD 1I1AA 3BRFA 4MJ5A 3U36B 1ONQB 1A7NL 2HA1A 3GSRB 3HZMA 3KPPA 4HCRA 4NQCB 4A6YA 1T03L 3ARUA 5C2BH 3V5DB 4KZEL 1E28B 1CXIA 3HC4H 3V0AC 3EYVB 3OZ9L 2GEEA 3FRPA 3O6ML 3BOVA 4KTDH 5HHXL 3DSNA 2BOCB 1GVIA 1NFIB 3ILQC 3BN9D 3E6FA 1MCSA 3KPMA 3L7EB 1TTUA 1N64H 1MLCB 4MQ7B 3K2MC 1KELL 5FB8A 3DURB 5IG7A 2AJUL 2GITA 2Z35B 1KPRA 5JUEL 1I85A 2QR0A 3KR3H 5C9JB 2XY2A 1L0XA 1QRNB 3CK0H 4RWHA 3VD3A 4X7TB 2OR9L 1C08B 4G8EA 1G7JB 2QHRH 4OGYL 2CH8A 3FQWA 5AZEL 1H3XA 1S7TB 3W9EB 4HFWA 4K8RH 5DJ6B 1HH9B 1RK0B 3FO2A 2V7HA 2DBLL 1A21A 1QBBA 4GKZA 4N5UA 5EBLB 3QO0A 1MJ7H 4Y1AE 1DN2A 1HH6B 1ZA6B 2R29H 5F7KC 5F9DC 4QRUB 1V7NL 3UTPE 1GGBH 1T7YA 4PTTA 3TIDA 2H26B 5BQ7B 5C08A 4F3FB 1VSCA 2P8MB 4AYFA 3SJVD 4YK4C 5K9KB 4XNQA 4U1IA 5E6ZA 1LP9F 1VFMA 4GKNA 1TENA 3HZKA 4KRPC 1H5BC 2ZCKL 3TN0D 4PRIB 3FB6A 3SKMA 1B4JL 5MI0C 5DRZA 5J6HB 2FSEB 4P2RE 3CU1A 2ZKHH 5FHAH 3IFLL 1Q94A 4MLSA 4JFXA 2BSTB 3MRGA 1IGJA 3BP5B 4OLUH 3IU4H 5F7MC 3OGOE 3F62A 3DX6A 4LCCB 2OZ4A 4YGVB 5FUCE 1YMHB 1JGEB 1PG7X 1JWMB 5F96L 2E6PA 3T1WA 2DQFB 3H3BC 3B6SA 5ALCH 4FTVB 4PLJC 5EC1A 2DAVA 4G80A 2X7LA 4NFCA 1OD7A 4QRPB 5EUOB 5H37G 4FFYH 4P4KD 4OQ1A 4IOIA 3G5YA 2ZP0T 4L4TE 5FHBH 4Y5YA 1NUGA 3RWDB 1AXSB 1H0DA 2YD9A 3MA7A 1DCLA 2CK0H 1OP9A 2V5SA 1R24B 3WV0A 3GSXB 1HKLL 4UMGA 1WAAA 4Y4KB 3U2SB 1U8JB 4R96B 1WBZB 4ERSL 4YNYA 3O4LE 5GGVH 1VPOL 1ACYH 4HV8B 2IGFH 2OXHA 3M17B 4AM0B 2KKQA 2VZSA 1QEWB 3TJHD 1Q38A 4GRWE 3EOTH 3NPZB 2J8OA 2FJGA 4CU8A 4LL9A 5I73B 4X6FA 5KBNC 1U6AL 3PGCB 2JKXA 1BD2E 1CICD 3C5ZB 3LKNA 4N8CH 4PFEA 1NBQA 4JM2A 4NP4H 4K3EL 3V6OE 3W11C 3KPRB 5IMMB 2HT3D 2JELL 3TT1L 1UVQB 4X7SH 3U7WH 5E7BA 3S36X 3OJ2C 5JW4N 5HHME 4KUZH 5EU6A 3HRPA 2GJ6D 4Z9KB 5BVJB 4O5LH 4PJIB 4GKOA 4E5XB 4WEMB 1TDQA 3MJ6A 2P1YA 4CMHB 3TV3H 4NRYB 4ELME 3HE6D 5JIHA 2FEDD 4XPFH 4KK5C 2YSSA 1XGUA 2QHLA 4F37K 3UC0L 2YWYA 2PR4H 5IEKB 5D2NA 1PAMA 3CSBA 1P9MA 3RVVC 3ZYIA 4WDIB 5JXAL 4LGSB 4N8VB 3HCVB 5ISZB 4GQPH 4I48B 1WBYA 4YBQC 3OHXA 2GJJA 4BFGA 2R56L 3L95A 3RBGA 2X89D 2YA0A 2A6DA 1XGQA 1ZVYA 4JN2B 4YO0B 4KJWD 4ODTL 2F54B 5KVEL 1FJ1B 1KJ2L 3HNSL 2HT2C 3GK8L 4PGZA 1JP5A 5CD3B 1CR9H 1N4XL 4NQVA 5E8DH 1C7TA 1RUAH 4KJPC 4ODWA 1JRHL 2PNDA 3VFTA 1KEGH 3L3GB 2C1OB 2AKRA 4GFTB 1AP2A 3SKUD 4OZIF 3GB7A 1QHPA 3BHBA 3DRTB 4UIKL 4HDIB 4AENB 4G8IB 4Q74A 3QG6A 4OFYD 4RGMB 3LSOB 2IANB 1G7IA 3JV6B 5C2UB 1YEIH 2I9TA 3BX7C 5EWIH 5IB2B 1NBYA 3MOBL 1ZSDB 2JLLA 4ODSL 5L2KA 2RCSL 2B1HH 1IGFL 4ZUSA 4YXLL 1FFRA 1K9TA 4J12A 4HBQA 2P48B 3O11B 3EFDL 4NQDD 2O5ZL 3QRGL 1Z5LB 2ZCLL 5CS7A 4I0CC 3G6JB 1XMWA 2E27H 1HXYA 4BSWA 4HFUH 4GS7C 1YMMD 4JPIB 1DUZB 1M7IB 4K94C 5BZDA 1CFSA 1WC7A 2R39A 3BP7B 3KLDA 4Y16A 4ALAH 3FO9B 3B5GA 3D25A 4DKEL 2R69L 2DM7A 4ZPVB 3TCXA 3DNKA 1OARH 1Q0XH 4OZGB 2YD1A 5KVFL 5IP4A 4POZC 5IROA 1IC4L 1ZANL 4L9DA 3BW9B 1CLOH 3P40A 3JWNC 1HOCA 2C7UA 5T1DL 4JRYD 5EO0B 3L3JB 4WW2A 4WTZA 1NCBH 3KJ4C 4NO0D 2OJEB 3V6ZA 4XCFH 1IGCL 4WFGD 3QQ4A 3QDGA 1FBIH 4OFIA 2EDFA 4PRIE 3LMJL 5T3ZE 4W6WB 5F21B 4U3XA 1QSFE 1P6FA 4X9FA 1XF3B 4PJ7B 4P9HC 3PWPB 3IU3B 5INCA 5DR5H 1VACB 5B8CC 1B0RA 4ONFL 4RBPK 3Q5TA 5JW5A 3C2AL 4IIQA 4PJ9D 3RVTD 5BO1H 1KIQA 5GPRA 2KQNA 4DEPB 3DSFL 4LCWA 4Z7VA 3KXFA 3DX9A 4ZOBA 2XZAL 1L7TH 4GW4A 1AXIB 2F53B 4JJ5B 3J8F7 4G6JL 4FTVE 5HHOD 4XNYH 1CFQB 2BNQB 4HGWB 4UV7H 2E5EA 4NJAL 1ZEAL 2X10A 4KK6D 2NMSA 3L7FB 1AIFA 1K2DB 2XZCL 12E8H 1NSNH 1SYSA 4OD2B 1V3LA 4JDVA 4L3AA 4FQJL 2WINB 4R3SB 2LTQC 3FQXA 3O2DA 4GW1A 4JFQA 4YFLI 5IIEA 1RZ8B 3T0EC 5I66B 1TETL 4O2EB 2ZCHL 1BEYL 4QXWA 5H35A 3HNTH 4FQQB 3AB0B 4EVNB 1WEJH 1CE1H 4MX7A 3V0WL 2F5AL 3EO1A 5C0GA 3FB7B 5EIQA 3ZKSD 4W70A 4I5BA 1DLHA 5CJOL 2AS5M 5I76B 4WWID 5JW4R 3WLBA 4WNQA 2JIXD 4DN3H 3C9NB 5I8EB 4BQ9A 1B9ZA 9CGTA 3E8UL 3BKML 4XAKD 3UTZA 1QQDA 2EDNA 4LHUB 3RUGF 3KPSB 5GJSH 4ZTPL 4YXHL 2O61B 1WZ1H 3QQ9C 4KHXH 4IMLA 4ZFOA 5F3HA 4XWOD 1YJDC 4LVOB 5DURB 3GMLB 4ZS6C 4S1RL 3H9SB 2BRRH 1CQYA 4KY1L 1NDGB 3G5VB 4IMKA 2R9HC 4KGLA 5D96B 1A3LL 3VWKD 1P4LA 4I18B 3OAZK 4HMCA 5GGVY 3U48A 2XWJA 1ZTXH 2NPLX 4EBQL 1BJ1J 4PJIE 1A5FL 2VXQL 1UM4H 2EEDA 5CKAA 4ZSOB 3TO4B 1OAQL 3CDFA 3HA0A 5IBLC 1JRHI 4E41A 3BQUB 8FABA 1IFHH 3VXSB 1OM3L 4WWKB 2YOCA 4UINH 4HUWA 1E6OH 3UTSD 1MQKH 1UYWL 4M43L 1RUQL 3IFNL 3QI9A 5H94A 1Q72H 5FEBA 3MXVH 3IS0X 3DBXB 1HHIB 5B3JE 4YHYB 2E7BA 1OAXH 4ELMF 3VD9A 5D6DA 2NY5C 1UA6H 1MNUL 2HTLD 4UU9A 4DUVA 3ARXA 2JK5A 2E8YA 4DAGH 2BJMH 3RWEA 4KI5D 4KQ4H 3Q5OA 4ELKB 1UZ6F 3H8NA 1IGMH 2I5YH 1N6QH 5CILL 3I6LD 5AWNH 4Z95H 5TQ2H 3FN0H 4M6NL 4M9OA 1FSKC 1F4XL 1L0QA 4HHAA 1BQHB 3CC5A 5CBEA 4JVPA 5F9JB 4CN6A 1TVHA 3BDYH 2FX8H 2NX5D 4HF5H 4I4WB 1XF4A 2QV2A 1JWSB 1WWAX 4X9HA 4KDTA 2FL5A 3AU1A 3BRGC 2FR4B 4IOFD 4R0LA 5DA4A 1IQWL 1JHKL 2PYED 5TGBB 1ACZA 4TSAL 3MYJB 2VH5H 3GNML 4MNGE 2E7LA 4PGEA 1UCBL 1UT9A 4X8XA 2Z91B 2EDRA 3TM6A 3LN5B 3KPNB 4UILL 4XAWH 4JFDA 1IM9B 2B2XL 4GLRH 4L3CA 3I3DA 5JOPE 5BV7B 2CKBA 2IANE 2W0KA 4P9HL 4OFPA 3RIFF 4CNIA 4LASH 4WFHE 4HX1A 5CGTA 3FO0H 3IDNA 3NMEA 1PVHA 1R5VB 5A3ID 3SDYL 3ULVH 5GHWL 1JFQH 1I8KB 3U9UB 2R23A 3T08A 5FKPA 5IUSA 3EO9H 2VDPL 1M7DA 4I9WE 4OCXL 2VQ1B 1FIGH 1G0YR 4QYOB 1G9NH 3IXAB 5D71H 2RIKA 1CGXA 4TSCL 2MOVA 3SY0B 5IV2B 1A8JH 5M94B 1HN1A 4H0HB 3KNBB 5D1ZC 5H37H 4ZOEA 1H15B 4PLNC 2YRPA 3G08B 2OX5A 4MJ2A 1RQ5A 5D7JB 5JW3L 4OZGE 1CCZA 5DVNA 1N3NB 3WO3B 4KKAD 5F9OH 2XNAB 5IGXL 1J7VR 2EH7L 4ISVA 1CFTB 4E0RA 1Z9LA 5J6GA 4G8FA 1D6VH 3GHBH 4K23L 4LKCB 5GGUA 1YN6B 3ALPA 4PJXB 3PUCA 1HYSC 3OB0H 5HGDB 1WJ3A 4K8RC 4NRXB 5E2VH 3HS0A 4P46D 4PJBB 1U8NB 5B38B 2YMXH 5LKNA 1VGKA 2H9GA 1NFDF 4CVWA 2BY3A 5CLTA 3VFNB 4EOWL 4QHUB 4Y2DC 4OV5A 4YDVA 5TE4L 4NWUH 3QFDB 4HIEB 4EUPA 4IRJD 4HS3B 3W9DA 1VDGA 1LO2L 3VRJA 4P2OD 3EFFA 3HB3C 2A6JB 2DQHL 3AY4C 2DMBA 4WTWA 4XZUA 1CL7H 4XP4L 1C5CL 2F53E 4MJID 3VI4F 4RQQA 4PJDF 2BNQE 5DF0A 2FECL 3MCKB 4J23A 4NZUH 1MJ8L 1NAMB 1EVUA 5H2BB 3DXAD 1AI1H 1XGYL 4L5FH 1K4CA 5FYKU 4YDJB 2NXYC 2NY3D 4L3EB 4PRPB 1RIUH 1JZ7A 4L9LC 2NY5L 1JGUH 3OR6B 1YEFL 3VFPA 4U1MA 1A6ZA 3WXWH 4G9DB 1P7HL 2XG4A 1MI5E 3IDJA 1FVCA 1RJZB 3GMMA 4JAMA 1U58A 4DVRH 2GFBB 5TH2B 3RI5F 3P4NB 1YEEL 3LKRA 4LCIH 5L8JB 2YKLL 3T2OA 2IPKB 4RGOL 4OBRA 3SCMD 2NXZB 1K5NB 3PWVA 1KPVA 7FABH 5E70A 1QLRA 5C0CE 3RZCB 3OXRA 2P8LA 1ZT1A 3U79A 1X4ZA 2VL5B 1QLFA 4R4FH 4HG4J 3K8MA 1Q9LA 4XP1H 1N0LA 3KLAB 1S7RB 3FFDA 1EZVX 3FQNB 4NNPL 3EOAA 3BDXA 3FONB 4V2BA 1C1EL 2EKSA 3OX8A 5DTFA 4NO2A 4XH2B 4I0PD 4X8JB 1BHGA 4MXVF 4TVPL 4OCSH 1L6XA 4PBXA 4G8GB 1J1XL 4X0KB 3U0PB 1KJMA 3SDDD 4WI5A 3C6LD 1CK0L 1DBKL 3EDDA 2EYSB 1IM3A 5TF1L 1BFSA 1MFNA 5IEHB 3PL6D 4ZODA 3S96B 5I30L 5D1QA 4KXZI 3VFMA 5I1KH 5B21A 1FL6B 4KJQC 3RTQD 5E4IA 1M4KA 3BD5A 1UKSA 1GL4B 2CO6B 1DBBL 2YUWA 5CEZL 4LSQH 4NUJB 3WS6A 4J8RA 4HUUB 4ZXBC 4IHOA 1X7QA 5IQ7L 2ID5A 3C5JB 4GQ9H 1CDHA 4LSSL 3UTPD 5IMKA 3OKOB 3OKDB 5EU7E 4YWGL 2BC4A 2A73A 1WTGT 1FNFA 4RZCA 2Z0BA 4HKZA 4YZFE 2W91A 2ZJSH 4KK9C 4PJAF 4L4VA 3WIFB 5A2KH 2W9DL 4S2SA 1CBVH 4EDXA 1CLZL 2BMKB 5E2WH 2BZDA 3GSNH 4YHPA 5FOBB 4NO3B 4OZFA 5A2IH 2RFXA 4N9GA 5IM7B 4P2RD 2ZUVA 1EFQA 2FWOB 1ODAA 2G9HA 4PR5A 2QKIB 2NY0D 1HE7A 3AROA 4JFYA 2YPLB 4RFOL 1JPFA 1N7ML 3I3EA 3PDOB 3BWAA 3I50H 3CX2A 5KG9B 4O9HL 2DQEH 4GMTL 1OAUL 3QEGH 5ACZA 2Z4QB 2X1QA 2BVOA 1QO3B 1B90A 3NACL 5EN2B 4MXQD 5IHLB 2B5IC 5TPWL 4EN3B 5IT2H 4J1UA 3L5WA 3D39E 4HS8H 1CF8H 1GAFH 3VXOB 5I1DB 4P59L 5I6XB 1RVFL 3IDMA 2DM3A 1U0QA 4JFFE 2YA1A 3C09C 3BZDA 3F7VA 2ICEA 5GZND 1YEHH 4NNYB 4LQFL 3MOAL 4IJ3B 4RA0C 2XQBH 2XT1B 2MNUA 3HPJB 4QOKB 2XTJE 3GSVB 2DTMH 4LNRB 1G6RH 2FECI 4NN6C 4G9FE 1W0WB 2IG2H 1IC7H 5JO5B 4OM1H 4HC1A 3L3DB 1FG9C 5KANG 2PN5A 3V5HA 3DETC 2V7NB 3LS4H 1PYWA 3HI5L 4LSRH 5TDNA 4JO1H 3B9DA 3VDCA 1BD2D 1O7SA 3MACH 4FQIH 5EOQH 3OPZL 2ZOKA 3BKYH 5IQ9B 4X6EB 4HH8A 3MNZA 3QIUD 5KW9H 5J8OA 4UQ2B 1JVKA 3L1OL 4ONGL 4OIBA 4XP9H 4CBPA 2QL1A 3LZFH 4LPXA 3HR5B 2DS4A 2HT4C 2Z92A 1DVFB 2KDGA 3UYOD 2AQ1A 4UTAL 2QADB 2FD6L 4EKXA 4OSUL 4P4RB 1MIML 3QIWB 5EUKA 3D18B 1J11A 2PXYB 4WO4B 2HLFD 2IAMC 1XF5B 4ODBD 4OZIB 5JDSA 3K80A 1TCMA 3UXFA 4OJFL 3PNWA 4MAUL 1ADQH 2OXGA 1QFWH 4LMQE 3QCTL 4K71C 3RNQA 1F97A 1A6AA 2R0KL 3MRNA 3QRFM 3UPRA 1JHLL 2NY4B 2DWDA 1T1WB 1UEMA 1YPZA 1U92A 2GUOA 5C0AA 1JZ2A 4HJ0C 4P3CL 4S0TD 3VU2A 2WBJC 4F15B 4RSVA 4X9IA 3GMQB 4Z78B 1MJJA 4P5KB 3TFKD 1N59B 1XZ0A 4P23D 5BV7H 1ERNA 1CN4A 1TQBC 1U95A 1TJGL 1VENA 1WCBB 5DWUH 3GMRA 4RMTA 1WFUA 4PTUA 5HBBA 3N9GL 1NUFA 1A14L 3B9KC 5C0RL 1TPXB 3DYOA 3O9WD 4EI5D 5CGMA 4L1HA 5IHZB 2VLKA 1YDPB 4XMLH 5HGHA 4M1DL 2IH1B 1MFEH 2YC1A 3GRWH 1W72B 2WM0A 3BWUC 3U0WH 1QFUL 1J9CT 3LB6D 4G6KH 2X05A 1RURL 3X3GL 4BSVA 3U82B 4YHMH 4K3JL 2BDNL 4J3SA 3DARA 4MHHG 4OCMC 4MNHA 4FZ8H 4XVSH 1YQVL 1Y18B 1MVFA 4I3RL 2XA8H 5A40E 2XQYK 2R1YB 2UY7A 3GJFB 1IEAB 3NCYP 1JNLL 3D0VB 2R2HA 3TBTB 1N5YH 4ZFGL 4G8GE 1KV3A 1YECH 4O2CA 1F02I 1QRND 4I3SL 2Z31C 4B5EA 1A02N 5J1TC 2UUDK 2D9QB 3JSSA 1GZPA 1MH5A 4AEIH 3QEUB 2IJ0C 1RUPL 2ZSWB 5MEOB 5EB9A 5J13C 4PD4K 4LKXA 1X5GA 4HMDA 1D9KA 3S6CA 1OGAE 3VH8G 3KYOB 1IGIH 5HYSA 1WAAF 5AYUH 3D85A 5GGTH 4XPBL 2WW8A 4GAJL 1MUJA 4GRLC 32C2B 4NN7C 2X4PA 3CDYA 3QG7L 3EKCA 1NCCL 4JFHD 3ARBA 3TWCH 1I9JH 3LEVH 2VKWA 2J3SA 2UYLA 4PJGE 4WCYH 4PS4L 4PJCA 1Q9KA 3L3KA 1JN6B 1QBLL 4JM2F 4PRID 4TRPL 1NAMH 1H3PH 5T3ZD 4Y5VB 3HNVH 3MLVL 4Q6IB 1A0QH 1SEQL 2PW1B 5DUBB 4ZYKA 3VGGA 4DZBB 5C07E 3MRFA 1OSZA 3PABA 4IDJH 1SY6L 5FYLL 3RUGB 4FA8A 2B0SL 3W0WA 3UJIL 1YQ2A 3HMXA 2YPLE 3JTSB 1CDUA 4BZYA 2NCMA 1CD0A 2F58L 2AQ2A 3BP6B 3QIBB 3BH9A 4GRMB 3WIIL 1FAIH 1F4WL 5CIPB 3PGDA 2MJWA 1S7SB 3G04A 3VH8B 3RX8A 1OHQA 4M7KL 3HLAA 1Q1JL 4PG9A 4FTVD 4Y88A 1R3HA 3DMMA 2XICA 4GAGL 3F5WA 3ZKXC 3MUGA 1BBDH 4XHJC 4GO6B 5CZVH 1E27A 3TYGH 2R2EB 3F58H 5CEXB 3I84A 3DVNB 2VL4A 1CD9B 2V2TB 3VG0H 1PKQA 2YEZA 4NM8L 4OT1L 4OFVA 4JQXC 4QOKE 1OSPL 3X12B 3FMGL 2FYYB 1CXLA 2FEEL 3V8CA 4LU5H 1PQZA 5D1ZA 3FT2A 4MCZA 4DQOH 2P24A 4U1JB 5EFIB 3KPTA 5CP3H 4UDUB 1ZHLB 1QKZH 4N1HB 1EHLH 1DBML 4A2MA 1F90L 2VWEE 4O2FA 5IF0B 3EOYG 5CJQL 3D3VB 4KH2A 1A7BA 1KTLA 4Z7UA 2IADB 1AE6L 1F8TH 3NA9H 4XCYB 1E4XH 3BZ4A 4KHTH 3LD8C 3JWOL 4DW2L 1QBMH 5CSGA 2MHAB 4H0GA 4J2XA 3LEYH 4OI8A 2A83A 3MBXH 1YNKL 3DX7B 1F42A 4FQHB 1S9VB 2LU7A 2X6MA 2OS7A 4XRCB 4Y2DA 4LLYA 3B2UD 5GRVL 2A0LC 2CLZA 3WUWA 4YPGB 1L9NA 4MAYB 3CX5J 1BMGA 1BX2A 35C8H 4GJTB 5IKCA 1RUMH 2P44B 1CT8B 1S9XB 5HPMB 3BKCL 1FZKB 3AY4A 1OLZA 4JKPH 3BO8B 4RFNB 3ZHDA 5C0JA 1FORH 1A1MB 4BM7A 3P4LA 5CUSH 2A6IB 2EDYA 3BN9C 3QCVH 5DS8A 1S9KC 4PV8B 2DQUH 4D9QE 2X70B 3MA9H 3QUZC 3SO3B 5J1AB 3UJJL 4PLOB 1OGTB 3OR7B 4WEUD 1CE6A 4MA8H 2UZIH 4L9LA 3P4OB 3V6BR 3MXWH 3A6BL 4OZ4B 1OF2B 3NTCL 3OKMA 1KNOB 5IFHL 5BS0E 1JF1A 1A1NA 5MEQA 1EMTL 1G7MA 4XP5H 3GBNH 2GYSA 1QACA 1QD0A 3WDIA 3Q0HA 2VIRB 4JZNB 2UVFA 2DI7A 1J1PL 1BIIB 1T0NB 1QSEB 5E94B 5ICZB 3ZL4H 3TESA 1JUFB 2QLVB 5ENWA 2HP4A 5GRUL 3LKOA 5JOPD 4TQEL 5C0BE 3UX9B 4LLDA 3KGRA 5I71B 1FL3A 4KVNH 1GPOH 3QO1A 4HULB 2IAND 4JCMA 4M7JH 5KJRH 4A2LA 1FO0B 3L5IA 1OPGL 4WFHD 4YIQA 3TN0C 4WUUE 3VFWA 1LE5B 5DUML 1X4YA 2ZOLB 3V95A 2BXZA 4X99B 3HI6L 4I9WD 4TN9A 3C8KA 4IRSC 4ZO8A 3THML 3HZYB 3JWDL 3O81A 5F9WC 3IDUA 1MCBA 3MJ8B 2J88L 1A7PH 1R0AH 2X1XR 1N0XL 4PY8J 5E08L 3FOLB 1JHTA 4WIQA 5JPMA 2B1AH 1SBSL 3H6JA 2FGWH 3UYRH 5BW7C 4N0UA 4Z77A 1I8MB 1KTDA 4PUBL 4ZXBA 3C2SA 2WIIA 1C7SA 3IDGB 4CAGA 5T1LA 3B2VH 2HRPH 2MQ0A 4BFIB 1QZ1A 4P4KC 1P7KA 3QEQE 2GCYB 4RIRA 2R2BB 3BGMB 3ZE1F 3TYFA 1FVDA 1CVSC 4JZJA 1A6TA 2ADFL 2CJUL 3NPSB 3WFDH 4Y2OA 3RNKA 1G7LA 1AGDB 1C5BL 4LIQL 1EEYA 1XGPA 4YGAB 1KXTB 5E6YA 2YXMA 1F6FB 3VE0B 5EBMA 4F58H 3RA7H 2E9IA 3QDMB 3NH7L 1T5XB 5DJXA 2V5TA 1PGRB 4XX1E 4WU5B 5F88A 3B3IA 5B3NA 4HXAH 4X7CC 1FIEA 2HT3C 3V4VH 3VG9C 2D0GA 3SGKC 5D93C 3EAKA 3LHPL 2F53D 3EYUL 1W72H 3N1QC 3L3OA 2VDOL 5TDPA 2BNQD 3UPCA 4DGYH 1FE8H 5DMGD 2APTA 5GSRA 1JJUA 5D2LA 5F1OB 3WFHA 4FP8L 1T2JA 2AXHA 1AO7A 3ME0A 1KC5H 3MRLB 2K1MA 2YZ8A 3HE6C 1H3VA 2FEDC 1IGTA 2GAZA 2NY2C 1BECA 1HQ4B 3TEUA 5D7LB 4G43B 4M8QA 3ARFD 1TQCB 1GYAA 3O45B 2YPVL 4U6VL 3NGBB 2YRZA 4BUGA 1CVRA 3UBXI 3DI2B 1MY5A 1MIEL 3MV8B 3D69A 4ONOA 5D9SB 4LHUD 2SEBB 2VDNL 3KPSD 4NT6A 3SBWC 5D7IA 3MRIA 1XIWC 3MZTA 2BVQA 5C0CD 1WLHA 2OP4L 4F80A 4LFHD 4K07A 5DURD 4YHOH 4XGZB 1SYVB 4WJ5A 2FX9L 4KJWC 1VADB 3PWUB 1SY6A 1UGNA 4FQ2L 4Z7QE 3BVNB 3S37H 4F9LC 1FV1B 5DDHB 1C12B 3CLEH 4JQIH 4GG6A 1YYML 3O0RH 4MMZC 4YFLF 3VXSD 4KU1A 4GG8B 2HH0H 3TVMD 1TMCB 1LO4L 1BM3H 1IAKB 2VXVL 5GS0D 1KBGH 2IAMA 4DCQA 3LS5H 4H1LG 2VLMD 4FG6D 4G6MH 1MCOH 2CUIA 5GGSB 4KZDH 3CSGA 4ONHB 43C9B 4D0DA 5IVXA 2GK0B 4EIZC 4P5TB 4K7PH 6FABH 4R4BA 1FL5B 3GI8L 3RJDA 4C56A 1LK2B 2X4QB 4X6DB 1F2XK 4Z0BH 4GAFB 3LEXB 3TPUA 2WBJA 4LPYA 4OB5H 3MGTA 4MQXD 4Z18A 3RVXD 4YQXL 1GGUA 4YE4H 3IFPA 3IAQA 4FXGB 1OB1A 1M71A 3GKZA 5I1IL 5IB5B 2C9AA 4I3GA 1Y6KR 3T04D 5HYJB 1BQSA 3V52L 2PUQT 4OZHA 1OY3B 1EAPB 4KROB 1FZOB 1EXUB 1F4YH 2R0LH 4YEFA 3P0YH 1G1YA 4LLWB 1JZ6A 3B9KA 3WO4B 4XPGH 5KSAB 3ZTNL 1KCSL 4MA1B 5FO8B 1DUYA 5DZNA 2X4NB 3KYKH 3FT3B 1W8NA 1NCTA 1DQQA 1B2WL 5FK9A 3C60C 3V4UH 1IM9D 1KB9J 4IEFB 4JM4H 5ADPL 3JV4A 4FFWD 5DMKA 5E2JA 4I2XB 2HJKB 5BVPL 1FGVH 3H2WA 5DD6B 3VI3F 1JPSH 4RAVA 1I1AB 4MJ5B 2VZUA 3HZMB 3ULUE 1P2CA 3KPPB 4A6YB 4Z8FL 1G9MH 1CGSH 1T5WA 1FN4A 2I07A 4D3CH 3D39D 5J57B 1KTKE 1NMAL 3QFJA 3K2UL 3E6FB 3KPMB 5FXCH 5KSVA 4JFFD 4RDQF 1QFHA 4PJ9C 3QULA 1CS6A 5FB8B 3PP3K 5IG7B 4M48H 1KPRB 4TNWF 3TCLA 2QR0B 3D0LA 1CDCA 5DJYA 2LU4A 2IPTH 2XTJD 3O2WH 4X5XA 4G8EB 4NBYB 5CINL 4G42A 5D7JD 5HYIA 2AEWA 2Y6SD 3FQWB 4YBHA 5FYJE 1HSBA 5GS2D 3FZUC 4HFWB 3ARPA 3FO2B 4AG4L 2V7HB 4GKZB 4AEHL 3WD5L 4XNZC 5L88L 4Z7NF 3QO0B 4U49A 4KPHL 4GRLA 1HIMH 5KVGL 2XN9A 5I18L 2O93L 4DKFH 4APQD 4G6FD 4I8DA 1JV5A 2A1WL 4KRLB 4PTTB 4EXKA 4RX4A 3UZEA 2ICWI 3TIDB 2A9NL 5C08B 5EORH 4WI7A 1SJVA 4U05A 4Q97A 5HDQH 4XNQB 3WFEL 4AQ1B 5FCUL 4U1IB 5EZJA 3T4AB 1DQDH 4GKNB 5ICXA 3HZKB 4TTDD 1CL7I 4L8BB 1RMFH 4QRRE 2DLFL 3FB6B 3M8OH 3SKMB 4KMTL 1NBVL 2APXA 5FM8A 3DVFA 3NABH 3QNYA 3LN9A 5DRZB 5DVLA 3NFSL 5CJXC 1JTPA 3GIZH 1DQMH 3H3PH 4HUXA 4QRQA 1Q94B 4JFXB 4UZGA 3MRGB 1MFCL 3JV5A 1F6AA 1MCDA 1R3KA 3VWKC 1IGJB 3GHEH 5D4QA 1DSFH 3HE7B 3PWLA 5IW3A 1VCAA 4S1QL 2IBBA 3BPOC 5E8NA 1IKFH 3B6SB 1WBZA 3GSOA 5EC1B 3MV7A 4CADA 4G80B 2X7LB 1A9BA 4IOIB 4JQXA 2BNRE 3G5YB 4EJ1C 1JGLH 5C8JA 2FH6A 4HQQL 1H0DB 5I1EH 3V7AG 3MA7B 5I74C 4P99A 3UTOA 1VFOA 4R8WL 2HTLC 3BEVA 4CMMA 3CNKA 2OK0L 4JDZA 3KPRA 3RWGA 5C0ND 4KI5C 3DIFA 4YNYB 2UY6A 5E6ID 4FFVD 5DHYA 4N90D 1TJIH 3SGJC 4AEEA 2ED8A 3EOBA 4RGNE 2VQUA 5D5ME 5DUPH 4XC1H 2Y23A 2FJGB 5C6PB 3IDXL 4X6FB 5KOVC 1SVCP 2AABL 1I9RH 3LKNB 4JM2B 3DRQA 4IOFC 1AY1L 5CBAA 3VFVA 3S4SA 3SDCD 5CEZE 3VCLA 1KTRL 1TZGL 3PDGA 4G8GD 3S97C 5EU6B 4UV4H 3FQUA 2HMID 2FX7L 3B83A 3U7YH 3OAUH 2XA3A 5GGQL 4OKDA 1FNLA 4WY7L 4HT1L 2YSSB 1OGAD 1XGUB 4QGYA 5A3IC 2D7NA 4NC1C 1HINH 4X6DE 5C71A 1RZKL 4RWYH 5D2NB 5C70A 3QUZA 1IT9H 2AK1H 4Y0GA 5FM5M 3VDBA 1MWAL 1T6WA 1TZHA 4D0BA 5HYJE 1FNSL 1KYOJ 4JKWA 3VFGL 1U8IB 5ACLA 2BVEA 1WBYB 3WCYA 3OHXB 2HN7A 4LCYA 4BQ8A 2IPUK 3I6KA 3SDXA 1NPUA 3KG5A 4L8DA 3L95B 4WEBH 4K7PY 2A6DB 3NZ8A 3L3GA 1G7HA 1XGQB 2NY1B 1DLFH 1T3FA 2YK1L 4HWBH 1DEEA 2MPAH 4N0CD 5C07D 4KKAC 5DD5L 5D1XD 4HGKC 3HRZA 3E6HA 4NQVB 2YPLD 4ODWB 2VERN 2F9BT 1Q0YH 1I3VA 2JCCF 1NGYA 1DR9A 3VFTB 4P46C 2DDQL 4XPTL 3S5LG 3MUHL 2AKRB 4C57C 1AP2B 3V4PL 3GB7B 3BHBB 1GCFA 4WI8A 3TN0A 3ABZA 3SQOH 1NLDH 4WTZG 3QG6B 3KAAA 4YXKH 1G7IB 3QPQD 1ORQA 2KBGA 3RPKA 4JPIA 4PJFE 4NBZB 2ZPKH 4UDTA 2I9TB 2ARJQ 4OGAC 1NBYB 1JMZA 4IRSA 4P2OC 1YPZF 4PJ5E 1A6WL 1C16A 5L2KB 5DI8B 4ZUSB 3BKJH 2LE9A 4QOKD 1BP3B 4D0CA 1CDGA 5BW7A 2RR3A 1HXYB 2OI9C 4BSWB 3MLPA 2VN4A 1EX0A 5BZDB 1BAFL 1CFSB 1I3GH 1WC7B 4UTBH 4P4KA 2WUBH 4Y16B 2DJUA 3PJSA 1KFAL 5DJ0A 3D25B 3MO1A 2ORBH 3TIEB 2CUMA 1FPTH 1QVOB 2Q86A 1HOCB 2C7UB 3ESVF 3PQYE 5ELIA 2HG5A 2X4TA 3WSQL 2QQNH 4WW2B 3ES6A 3V6ZB 4DK6A 1CLCA 4OCRH 1DVFD 1MPAL 3QQ4B 3QDGB 3MLYL 3DHJA 1IAIL 3SCMC 3QIWD 1QFWI 2F5BL 3KYMA 1ZLUK 1JYWA 4Z6AT 1Z9MA 1MEXL 1HYRC 4WO4D 2NW3B 1MCRA 4BKLA 1K6QL 2OL3H 5INCB 2HFTA 2DQIH 2ZUYA 1MJUL 1QLEL 5FO9A 1B0RB 3SGKA 1EFXA 2W0PA 3CMOH 5JW5B 3PE9A 4H25A 3GSNA 1TNNA 4IIQB 1KIQB 1JNNH 4KTEL 4LCWB 4Z7VB 1IC5H 3KXFB 5TFSH 3E0GA 4I0PC 1RZ8A 1A4KA 4AZ8A 1BLNA 3TNNA 3OKKA 2GJ6A 4H1LH 4KAQH 3QUXC 5EZIL 4GW4B 5TQ0L 2VDLL 1RIHH 4Q58C 5DSCA 3BPNB 1E4WH 3UP1A 3G6AB 4M5YL 1W0VA 4Y5XC 4AMKL 1AIFB 2AV7A 3QEHA 1JWUA 5GQBA 1NCWH 4NQXA 1G84A 4A6YH 4LLAA 5KZCB 1SYSB 1U8HA 4JDVB 5I8EA 3RTQC 3ARGC 5BS0D 5IIEB 3FQXB 3FO1A 4GW1B 4NHCL 3VXTA 3LPFA 5H35B 1XT5A 2XZQH 4MX7B 2VXUH 3KJ6H 2FBJH 3EO1B 1NDGA 5C0GB 3E2HC 3R4DA 4QT5A 1CLYH 3SBWA 4JO3L 4I5BB 1DLHB 1XIWA 2DQCL 4NYLA 4I18A 2AGJL 3ZKND 3WLBB 4WNQB 4TPRH 1ZLWK 3S3SA 2IH3A 2WWKO 3ZT5A 5C0BD 1QQDB 3UTZB 3X3FH 5J11C 4NWTH 4HMEA 2FRGP 1G6RA 4F9LA 4ZFOB 4IMLB 5SX4H 4PY7A 5F3HB 1XGTA 4HK3N 1N64L 2B39A 4HS6A 4WUUD 3GMNA 1V8HA 1UWXK 5I1HH 2WANA 4Y19E 4C55A 2XWJB 3NCBB 4S11A 2VLJA 3BJ91 3CSPA 2LVEA 4LGRB 4KMLB 3U9PH 2CR3A 2VSCA 4E41B 8FABB 1WBXA 2W1NA 4HUWB 4OFYA 1M05A 1DJSA 5FUCC 4PB9H 3HG1E 3QI9B 5H94B 3RAJL 4MXQC 5D2NE 2MKWA 1RZJH 4X6CE 3RX7A 4OFDA 4OKVA 4DJMA 1KF9B 3MPCA 4UU9B 2JK5B 4LSTH 3RWEB 2JJTC 5GZNC 5TGBA 2HWZL 2A9MH 5FYLE 1ADQA 1MCIA 1FQ9C 3QA3A 1XH3A 4Z7UF 4QXGH 1AKJA 5K33A 4HHAB 3BPLB 3CC5B 4JHAL 4XMPL 5CBEB 4KWUA 1TVHB 2BHUA 1X5KA 2D03L 1XF4B 1UACH 2ICES 3VWJD 2FL5B 3AU1B 3O4OC 4M6OH 4S0SD 4R0LB 3JVGC 3C60A 1ZAGA 2DLHA 5HDBE 4J3UA 4LPCA 4O58H 4PGEB 4CVXA 4JRYA 1CXHA 3QIBD 3V6OC 5F93C 4U7KA 4JFDB 1VKXA 3M07A 3QIUC 4L3CB 4XVUD 4L8SC 2BSRB 3HFMH 5GRJH 2EH8L 3DX8A 2DIJA 5I15H 5JHLL 2CKBB 4R9HA 5EIIA 1JPGA 4YDIL 1BGXH 1KB5L 4CNIB 4OF5A 3O6KL 3PG2A 4HX1B 3IDNB 4NFBA 3T0XA 2C4FT 2HLFC 1QUNA 1XR9A 2R23B 4PJ9A 4JY5L 1T4KA 3EZJB 5IW6B 3J7HA 1OP5H 2MCPH 4EUPG 5FDWA 2Y07L 1MWAA 4OQTH 5GGVL 5DMIH 2IGFL 2YXFA 5LCVL 5ETUA 1BQLL 4XNMA 4PJBA 4YDLC 4P23C 2OTPA 4N8CL 4FABL 5CKGA 4PJ8C 2VXSL 5L9DL 4RDQG 4Q9RH 1DBJL 1ITCA 2JB5H 3VA2C 3UCRA 4ISVB 3MLTA 4E0RB 5CEYB 4ODHH 3VXME 5J6GB 4G8FB 1NAKH 5EBGA 5GGUB 2YUVA 4TSBL 3TJEH 3FOMA 4YK4B 4HPOH 4U1SA 3O9WC 4EI5C 3WBDA 3HS0B 1GGCL 2IMMA 1BZ9A 2ICCA 3EJZD 1LVEA 1GGIH 4XPHL 5I9QC 3VW3L 4KRPB 1VGKB 1MAML 2H9GB 2W59A 1Z9OA 5GGSY 4QLRA 5MI0B 3QQ3A 4OV5B 4YDVB 1EAJA 1S5IL 5CJXA 4PJEF 4EUPB 4FN0A 2PCPA 1DANU 1TFHA 3W9DB 3VRJB 4ZTOH 3EFFB 3VWKA 1LO3L 3NAAH 2AXJA 4Z7VE 4K2UL 1G1CA 3KXFE 4XZUB 2PO6D 3VJ6A 2I25N 2ZUQC 5DD1H 5L0QC 5J89A 4RQQB 3IJHA 3L6FA 3JUZA 1INDL 3S35H 1HI6A 2HKFL 3ZE2E 3W82A 3UTSA 2X2YA 1IKNC 5IB3A 1K4CB 2EIZB 5F71A 1HZHH 3U1SL 1J8KA 4BZ2L 3RZCA 4X4ZA 3VFPB 4U1MB 1A6ZB 1ETZA 5L2JA 2DICA 3CLFH 4R90L 1QSED 1RUAL 3HUJE 5FFLA 1RZ7H 1FVCB 3GMMB 3U46B 2H2PD 4JAMB 3BSZL 3RU8H 1KCUH 1LP9A 2FCBA 1L7IL 3LKRB 3SGJA 1MRDH 3OF6A 3BEWA 2WUCH 3PWVB 1KPVB 4MD4A 1QLRB 3OXRB 2P8LB 3PGFL 1ZT1B 3NCFB 3C87A 1QLFB 4LEXH 2R8SL 1Q9LB 5CP3A 4K3DH 3U0PA 3ULUD 5EO1A 1D5IL 1T1YA 4DTGL 3RKDD 3K46A 3FFDB 5HVWA 3WNLA 2WQRA 4P57A 5BOPA 2EKSB 3OX8B 3VXPA 5DTFB 4NO2B 1A6VL 4OZFG 5D2LF 3RY4A 4HFUL 4X4MA 4RISH 4PJHA 3ZDYE 1U3HD 1KJMB 2B4CH 5FYKE 2BFVL 1ZHBA 5LBSL 1G7QA 1IM3B 3K8LA 1B3JA 1YEKL 1A7NH 5D1QB 1VB9A 4S1SL 5FYJD 1T03H 2JJWA 1TIUA 1A1OA 3BT2L 3OZ9H 2O5YH 3P9WB 4MNQE 3O6MH 5HHXH 4J8RB 3LOWA 3EHBD 4EZMA 1V3MA 4IHOB 4PPTA 3BE1L 5DHVH 1X7QB 1MFAL 2DKUA 4Q9QL 3BIKA 3FB8A 1KELH 5IMKB 3ZDZE 4NPYA 5D7IF 1INQA 1VA9A 2AJUH 5JOEA 5IM7A 2ATPA 1R3IL 5JUEH 3OXSA 2YN5A 3BN3B 3MRQB 1TTFA 1T6VN 4RZCB 2OR9H 4HKZB 5EZOL 5T5NF 2XACC 4L4VB 5AZEH 4S2SB 4Z5RA 3QDMD 4KV5F 4EDXB 5M7QA 2XG5A 2IALB 2Q76A 2Z93A 2DBLH 4QRRD 4YHPB 4QHMA 5LGHL 4OZFB 2RFXB 4AL8H 3GGWA 2OTUA 3NCCB 4N9GB 2G9HB 4PR5B 3MJGX 1V7NH 3IAPA 4P46A 4JFDE 4JFYB 3ZE0F 5I1DA 4NOBA 4XNYL 1MCEA 3P9MA 3QNXB 3RWHA 1P6AB 1BWWA 1JPFB 2HJFA 4JRXE 1FGNL 3BWAB 5D8JL 2Q7YA 5IVXF 12E8L 3B2UC 4CMHC 5ACZB 2ADIA 2BVOB 1D3CA 3KDMA 2ZCKH 3GSVA 3SDAA 5HYQA 4WENB 4P2OA 4J1UB 3L5WB 4PRDA 4XBEL 1UENA 3HNTL 4QRSB 1TTGA 4PRNA 3TNMA 3IDMB 1Q9OA 4MJIA 1V3KA 2XXMB 3QUML 2ICEB 4DOHB 3CUPA 5B39G 4ZO6A 4GS7B 3ECBA 3IYLW 3I3BA 1RHHA 4OZHF 4F7EA 2FATL 1AGCA 3O8XD 4WI6A 4D2NA 1CZ8L 1PKOA 2X09A 1TZIA 2MWCA 2PYFA 5F96H 5BRZA 3GJFK 4RGND 2XWTA 1Z2KA 5DGQA 3QB7C 2MKLC 4F37F 4Z7WE 3V5HB 3MZGB 1FNGA 3P0VL 1PYWB 5EU5A 4MHHI 2W9EL 5TDNB 2BNUA 1P4IL 3RKPA 5DJAA 2ZOKB 3FQTB 3KJ4B 4IM8A 1IC1A 3NCJL 3FT4A 1HKLH 3MNZB 1YEJL 1EA9C 3MTRA 3SCMA 4C54A 4XT1C 4ERSH 1DN0A 1MQKL 1OLLA 1X5FA 3BDBA 2EE6A 1VPOH 4XCNA 1YNTA 2Z92B 2WZPD 3UTQA 5T3ZL 1KB5A 5EUKB 3VGHA 5JW4M 5ACMA 5TE6H 1U6AH 5B39B 5JDSB 2BJML 4DZ8A 4K3EH 4UT7L 1H8SA 2JELH 3PNWB 3VD7A 4Q9BA 3RNQB 3QUXA 1A6AB 1N6QL 1F5WA 3MRNB 2JJSC 3UPRB 5HI5D 5HPOA 5KS9F 4PGBA 1K4DA 2DWDB 2EDWA 2OM5A 4Y5XA 1YPZB 1U92B 2GUOB 5C0AB 3KHQA 1YDPA 5HYJD 2FX8L 3IETB 3P11L 1MJJB 4R4ND 1XZ0B 2CKBH 3ARGA 3BZFA 1U95B 5F7YC 3GMRB 1EDQA 5KSAD 3IS1X 3F7PC 5T3XE 4PTUB 3R0MA 4Y1AA 3UC0H 2MSPA 4G5ZL 4NKOA 1QTYT 2GKIA 2EXYD 5C0FA 4M8VA 4ZQKA 3AREC 2AXGA 2VLKB 1UB6A 5HGHB 4M1CD 1RFDL 2YC1B 5JXAH 5SWSA 4OLYL 4JCLA 5IW1A 5C09E 3RFZC 3O41A 2X1PA 2YHGA 4BK4A 4MSWA 5E8PA 4LASL 5HY9B 3FO0L 5T33L 3MRKA 1GC1L 4LAJH 2R56H 2C3HA 3RVUC 4FZEL 4MNHB 1BFOA 3EO9L 1X9QA 3QEUA 3VRLE 3T2NL 4P2RA 4D9LH 5KVEH 1KJ2H 4LPTA 1MCQA 1FIGL 3HNSH 4LF3A 1CYGA 1G9NL 3GK8H 3WNOA 1BBJA 2IMNA 4BFEA 2R1WA 2R2HB 4PJ5D 3E3QE 1FCGA 2HFGH 4O2CB 1TLKA 1JRHH 3MJ9L 4MA7H 1GZPB 1MQ8A 3FQRA 2Y9RT 1MH5B 1EGJL 1NH6A 3SE3C 4LPVA 5DMGC 1QR4A 4LKXB 1NC2D 2NR6D 1D9KB 5HYSB 1T2QL 4EUPH 1VFAA 1G0XA 4KKLD 4L4TA 1EERB 3D85B 1DE4A 3MJ7A 2JJTA 3ARFC 4HLJA 3MOBH 4ODSH 4U6HA 3MNVA 2HJLA 5C08D 1FNHA 1IGFH 1AGFA 5BMFL 4MYWB 1MUJB 1RU9L 1H8OA 2BERA 2X4PB 5FGSA 2LAGB 4OM0L 1I1FA 3EFDH 5GS1C 3F7YA 1N6VA 3O4LA 4M03A 3QRGH 1IL1A 3PQYD 3L3IA 2UYLB 2ZCLH 3TBVA 1NC4A 3MGOA 2H41A 2AJVL 4PJCB 1Q9KB 3L3KB 5I19L 3RIFK 1MFBL 1U3ZA 3WFZA 1JF6A 3RP1A 4GSDL 3JVGA 4ZYKB 5E5RB 5ITFB 1BD2A 4DKEH 2R69H 1OSZB 3PABB 3V6OA 5E9DE 3GBLA 1IEBA 5FGRA 5KVFH 4KJYA 1WV7T 4H20H 4WI2A 4WU7A 1IC4H 3W0WB 1ZANH 4MB3A 1D5MA 3QIUA 1X3DA 1MCWM 4NUGL 1A2YA 4L8SA 3S37X 3G5XA 2VC2L 4OLXL 5T1DH 3BH9B 4YHKL 1LNUA 1I4FA 3PGDB 4NM4L 4U6XA 4M7LL 1IGCH 4UB0L 3TVMC 2X41A 4PG9B 5EOCJ 1UKQA 4C4KO 1R3HB 1JGUL 4ELMA 5L6YL 5GS0C 2C4XA 1CWVA 3F5WB 5I8KL 2ITDA 4U1JA 3MUGB 1J10A 4LHJB 2EE9A 3WUWG 1E27B 1N26A 4ONFH 1PKQB 4NZTL 2YEZB 3C2AH 5CLWA 4DK3A 2G5BA 3RGHA 3DSFH 4K7PX 1HHJA 4G3YH 3SDXF 3FN9A 2F8OA 2XZAH 2LQRA 1PQZB 5D1ZB 3I9GL 4KI1A 3FT2B 4MCZB 2P24B 4MQXC 4I77H 4P23A 3RVXC 3UTTE 4MVBC 4XP1L 5EU7C 1EO7A 2CDFA 4PJ8A 4O2FB 3DTXA 1NGWA 1ZEAH 1KTLB 1TITA 3HC3L 4QNPE 2XZCH 3VFSA 4Z7UB 2IFGA 2J8UF 1U36A 1ZK9A 3BZ4B 4FQJH 1U8PA 3CDGA 3O9WA 4IOSD 5EU4A 4EI5A 4HIIA 1QYGH 1TETH 3BJLA 1Z3GL 2ZCHH 5KSBF 4HH9A 1T7VA 4LAQL 5F1SA 2P5WA 1G6VK 2A83B 6CGTA 25C8H 3V8OA 2F5AH 1CFVL 5L7XL 2NY6D 1OP3K 4TULL 5CJOH 4Y2DB 4LLYB 2CLZB 3WUWB 5I1KL 1EUUA 3DV6A 1BX2B 4PV8A 2FJHA 4CW1A 3E8UH 1RHFA 3BKMH 3WYRA 5SX5H 5IKCB 3S9DB 1OGTA 3MFFA 3DI3B 4U1GC 4ZTPH 4YXHH 4XWGL 2R1XA 4P49A 3F7QA 1UXWA 4MLIA 3G9VA 1E4JA 3RPIB 4S1RH 1GOFA 2PKDA 5EOTA 4KY1H 1JNHB 4OZFH 1KIPA 1NLBL 4XNXL 1A3LH 3QUMA 4DUXA 2FHBA 4LQ1A 3LQZA 3G9AB 1L4IA 5DS8B 4LGPB 1LE9A 4HUVA 5DQJA 3QXDA 1IKNA 4OV6F 4EBQH 4X80L 1A5FH 1IAOB 3BXNA 1OAQH 5FYLD 4XCCL 1CE6B 2DOCA 1EEZA 1OM3H 4XTRD 3R1GL 4L9LB 4MZ3A 2XTJC 3EZ8A 2XXCB 5MEPA 4WHYG 1UYWH 2NY1D 4QTHA 5DT1L 5JW4Q 1RUQH 2Y6SC 3IFNH 1HHKA 3OKMB 4UOJA 1JF1B 2ESVA 1A1NB 4JRWA 5MEQB 2VR5A 3MCG1 4MS8D 1G7MB 2VLKE 2VRAA 1WFOA 5F72S 1MNUH 2P5EA 2JE8A 1QPXA 2IBGA 5AAMA 1NFDA 3CZJA 5F7UA 4APQC 4HZLA 4LSPL 5ID1B 1TCRA 5CILH 2AI0L 5ENWB 5C3LD 3U4EA 4M6NH 1F4XH 2RHEA 4LLDB 2GT9A 3QP3A 1FL3B 1GAFL 3QO1B 1AGBA 1QSFA 1LEIA 3T3PE 4YIQB 3VFWB 3ZHLA 1IQWH 1JHKH 5J9PA 4TSAH 4PJDA 3GNMH 1UCBH 1BWMA 5C7XL 3C8KB 4UILH 4JREC 2IEPA 1P53A 2L0DA 5IHUL 2IG2L 2B2XH 3INUL 5GS0L 4YBLC 1JHTB 3PHQA 5JPMB 4KXZH 1P4BL 2W92A 4P9HH 3LS4L 4Y16D 1J0IA 2Q8BH 2Y5TA 4N0UB 1H8NA 4Z77B 1KTDB 4JJHA 4ZXBB 4HPYL 3SDYH 2WIIB 4U6TA 2WK2A 4ZS7L 3PV7A 5GHWH 3MROA 5T1LB 3RGVC 3N06B 4FMKA 2NX5E 5B22A 5F1NB 1P7KB 4RIRB 2VDPH 4KKBD 1L0YA 3VXMD 4OCXH 1U3JA 4HAGA 1NEUA 3TYFB 1I7RB 5FF6A 4L8CA 1FVDB 4JZJB 4ETQA 1A6TB 2YS4A 3CSYA 4TSCH 3I75A 4PJCE 1KLUA 2EICA 3RNKB 5ID0A 3BIAX 3QDGD 1G7LB 1EEYB 1XGPB 4M6AA 5E6IC 1SJEA 4YHZL 1FG2A 3OBAA 5CCKL 3H7LA 5EBMB 4Q0XL 1REIA 1EZVY 5DJXB 5IGXH 2EH7H 5F88B 2Q3ZA 3B3IB 2APBA 4K23H 2WSKA 4LSUL 3QUKA 4LCWD 4OGXL 3KXFD 4YFDB 3L5JA 5T5NG 4ORGA 3SDCC 3BESR 3CFBA 3CIQA 5BV7L 1RK1A 3L3OB 5DVOA 3H9YA 1SM3L 2WP3T 5TDPB 4LLVA 5E8OA 2B5IB 1MCWW 5GSRB 5D2LB 3WFHB 4EOWH 3GKWH 4ZUUA 1AO7B 4PRHA 3RVWD 5KZCD 5TE4H 3O6FD 3C09B 1PKQE 1IGTB 1X5IA 2GAZB 3BPCA 1LO2H 4OF0A 4M8QB 1YY9D 1X5YA 1MFEL 2Z8SA 1XF1A 5DMYA 2DQHH 1FYTE 3U0WL 1WT5C 4XP4H 1MHHA 1C5CH 5INDA 3NIFF 3C5SA 4PJAA 3TZVC 4XI5D 4NN6B 1FV1A 2VXTL 2YPKA 3WLWD 3M45A 4FZ8L 1MRFH 2CRMA 4NT6B 1MJ8H 2NTFA 4UBDD 3MRIB 5D7IB 1XGYH 2BVQB 5C0IA 3FKUS 5ESVA 5JHDE 4JDTL 2NY5H 4L4JA 1YEFH 2ZG2A 4WJ5B 5C0DA 1N5YL 1CTNA 4ODUA 4MNGA 1CXFA 5D1XC 4GG6B 4ONHA 3MBEC 3KYNA 4ZUTA 1JMXA 1YEEH 3IB4A 2YKLH 5E2UL 4RGOH 1FRGL 1T20A 1CU4L 1LEGA 2IAMB 5CHNA 5FYKD 4DCQB 3CFKA 4NQEA 1MRCL 5AYUL 3S34L 3L3HA 3GDBA 3RWFA 5CJ5A 4JHWL 5FUOL 3I02B 4XPAL 4D0DB 5IVXB 2B20A 3DXAE 4K71B 4HEME 4NNPH 2W0LA 4MNQD 4R4BB 4WUKL 2UWEE 4C56B 1C1EH 3ARDC 2OL3A 4PGDB 1GOGA 5D6CA 3PV6A 3HMXH 3TPUB 2WBJB 5FM4A 4TVPH 5DFVD 2DLTA 3MGTB 3UBXG 3IFPB 2ZNWA 1OB1B 4G6AC 3N85L 1NAML 2PF6A 1J1XH 1H3PL 2ATKA 2X4OA 5K59F 1ZVHA 1CK0H 4F7MA 4F7TB 5TF1H 4CU6A 1DANT 4H1LA 4OZHB 3TBYB 4NSKA 5I30H 4IDJL 2E7MA 2VWEC 5GZOD 4Y89A 3B9KB 5IK3A 5DEZA 5LWYL 3AREA 1KCRL 5CEZH 2B8OT 2AK4E 3RY6C 5I16A 1DUYB 5IQ7H 1YY8A 1DQQB 5FK9B 4LSSH 1OL0A 5ILTL 1UJTA 4JFDD 1WK0A 4YWGH 2WP3O 3JV4B 2GJZA 1VERA 5DMKB 1U2HA 4K3GA 3N1GC 4JRXD 4RAVB 4P2QE 2W38A 2W9DH 3QIWC 4U0RC 1IAIM 1JK8A 1P2CB 1F6LL 1CLZH 4WO4C 1T5WB 5K9JL 1FN4B 2I07B 1N5AA 4Z7OF 3KYAA 4U7MA 3QFJB 2UV3A 3ARRA 5KSVB 1CGUA 2EC9T 4DQOL 1KIRA 3QULB 5CWSA 4POUB 2WBWB 3SE3A 3TCLB 4RFOH 5J13B 1N7MH 3D0LB 4DKDC 5DJYB 1NCUA 3K7UA 4O9HH 3MRMA 4X5XB 1OAUH 1F8TL 1OP5K 3NIDE 4G42B 1ES0A 1HSBB 2E3VA 3NACH 3CXHJ 2FDBP 1WGOA 3OJMB 1PY9A 1QBML 4KI5F 1JZ5A 4OLWL 4M93C 3T4AA 3LEYL 4M02A 1LO0L 5T1KD 1RVFH 2QJDA 3ARZA 4GRLB 4L8BA 4NN7B 1MI5A 1ZGLA 3QXAA 4ZUVA 2XN9B 4JGUA 5GS1A 2B7DT 3Q6FA 1AD0A 1JV5B 5DK2A 4M3JA 3MOAH 3GSWA 4MWFA 4LLQA 1UWEL 3BIBX 5I0ZA 5C0CA 5EZJB 4U3HA 4NC2B 3CGTA 5ICXB 3ZKNC 3HE7A 3VMNA 1NGPL 3BP4A 3GI9L 3K81A 4N0FA 5T1MA 5GIRA 2NNAA 2CSPA 3HI5H 3QNYB 4RAUA 5CUSL 5F7WC 2EE2A 3OPZH 4V1DA 2ZWLT 4HJGA 4HUXB 4QRQB 4PJHF 3QDJB 2JTDA 4ENED 5JXEC 4IRZL 3PF2A 1F6AB 1R3KB 2IFFL 3TVMA 3N1FC 1U2CA 4ONGH 4PLJD 3PHSA 3PWLB 1EHAA 1F00I 2V2XA 3I2CH 3S4SG 5E8NB 5DC0A 4UTAH 2FD6H 3MODL 3K0WA 1MIMH 3GSOB 3MV7B 4CADB 1AR2A 2D0FA 1A9BB 4RAHA 2FH8A 5T3XD 3ZL4L 5C8JB 3EJJX 4HIJA 1E6JL 3WKML 4MAUH 3WNPA 2R0KH 3BEVB 3FFCE 4CMMB 4LMQI 4MJ4A 4JDZB 1QOKA 4M00A 3RWGB 4WHYH 1J05A 3DIFB 4KVNL 1GPOL 2J2ZA 4P3CH 5DHYB 5C09D 4OQTA 5KJRL 2FLRT 3EOBB 1X44A 4UT9L 1XGRA 5JORA 3LD8B 3QSKB 3LKQA 3W11D 4QCIA 3MLXL 1TJGH 4MDIA 4NIKB 5F3BA 2COQA 2YR3A 4NZJA 5MP6L 3VWJC 4CVZA 4GG6E 3DRQB 5JNYA 2VABA 5AG8A 4Y4FD 1A14H 5C0RH 3MLRL 3O3EA 5CBAB 3VFVB 3S4SB 5LQBL 1X5AA 4M1DH 5C6TL 3VCLB 4PIRF 5D72L 2QQLL 2B1AL 3DVGA 1QFUH 5KSUA 3UYRL 3FQUB 5ITBL 3KLSA 5ESAA 4KK5D 2XKNA 3RBSA 4XVUC 4GBXD 5D70L 2RB8A 4JB9H 1QR1A 3X3GH 1RURH 5D1QD 1LHZA 4K3JH 2BDNH 3H0TA 5SWQA 3DWTA 3P30L 5KOMC 2YRLA 2ENYA 1U8IA 1BOGA 1YQVH 3D39A 4F2MA 4OAWA 4I3RH 5A2LH 3RDTC 2V2WA 3NIGE 4JFFA 5FKAA 1OTTC 3N1PC 3QUZB 1JNLH 2P8PA 4OI9A 4ZFGH 5C0EA 4I3SH 4X4YA 3SGDI 1TZHB 4D0BB 1SJXA 4JKMA 4L29A 5I17A 1LILA 4G9FA 2HN7B 4LCYB 3I6KB 2Z9TA 3SDXB 2E7HA 3OKLA 2FB4H 4KKNA 4L8DB 3QWQB 3NZ8B 2GY5A 1G7HB 3A6CL 4HXAL 1T3FB 2X44D 4FNLL 1DEEB 4NQCE 1C5DA 1JBJA 3MCLL 5F1KC 4KJPD 4XPBH 4APQA 1N8ZA 1J1OL 2G2RA 1GSMA 5E9DD 1YN7A 3HRZB 3E6HB 3H9ZA 4YC2C 3QG7H 2KZ1B 1NCCH 4ZAKC 1NGYB 3WJJC 1DBAH 5KSBB 1ZHKA 3HHRB 3O3AA 2FLBT 5DI8A 1QRNE 2A74A 4HUNB 1YEGL 3EYFA 3TN0B 1QBLH 1IMHC 3PP4L 4TRPH 1MREL 2QSTA 3F7RA 3MLVH 2UZXB 4KDWA 1SEQH 1IZJA 3QFJE 1YYLH 1ORQB 2QSCH 2J5LC 4O4YL 4UDTB 1MHEA 1I1CA 4IRSB 2K9UA 1SY6H 5DRWA 1T04A 2B0SH 5F9WB 1D5XA 4PREA 3SE8L 3UJIH 4YAQA 1C16B 3D5OF 1NEZG 4FQXC 2F58H 1MOEA 1UZ8A 2PO6C 3TIEA 5K9OA 3WIIH 2BVYA 1F4WH 5DLMH 3EIFA 4D0CB 3S5LA 1QVOA 2BHZA 1UJ3A 1Y6NR 2GTWA 3UTTD 4JFHE 3ZYJA 3S35X 5JLZA 1XEDA 3RGVA 4KVCL 4JLRA 5HI3D 4POZD 2VISA 4P4KB 5IJVA 2J4WL 3PJSB 1FH5L 5DJ0B 3DGCR 3FAWA 2XN9E 3AM8C 3CLEL 3MO1B 1HHHA 3FHAA 1PLGL 2NW3A 2EYTA 1R5IA 4NM8H 1Q9WA 4OT1H 1OSPH 2Q86B 2BSED 3FMGH 2H2PC 3LDBC 3QUYC 5E6IA 3T1FA 1BM3L 3KVQA 2D7MA 2HG5B 2X4TB 5DHVA 3TBSA 3LS5L 1EJOL 3ES6B 4N1CA 3Q6GH 2WIMA 5DD3L 1M1SA 3V2AR 3KYMB 5CJQH 3EDEA 1PSKL 4ZD3L 3TO2A 1T2XA 3MRDA 1AE6H 4X4XA 5CJBA 3T4YA 4BKLB 3G6AA 3JWOH 4YHLL 4HXBL 3ULUC 5DD0H 5FO9B 4JPKL 4QRPE 5EUOE 1EFXB 3RKDC 4WW1A 5D93B 3SDCA 5GJTH 1QPPA 4H25B 3GSNB 3AS3A 1JYVA 2GK2A 2VITB 1YNKH 3WHXA 2NYYD 4HG4K 1A4KB 1BLNB 3TNNB 3OKKB 3WFBL 2GJ6B 3SE9L 1GIGL 2EZ0C 3MLSL 5DSCB 1U3HC 3HE6B 1W0VB 2NY2B 5BOZG 1WF5A 4M4RA 1GHFH 4BH7A 1OGAA 3GSQA 2AV7B 3QEHB 1JWUB 4NDMA 1A4JA 4BK5A 4NQXB 2GI7A 3BKCH 1U8HB 2VZOA 2YD8A 1FNEA 1S3KL 1WT5A 3FO1B 3ULVE 2ILLA 3V4UL 3VXTB 2VLKD 3TZVA 2ZG1A 3KPRE 1UB5A 4QXUL 4EDWH 4GRWF 5MENA 4QT5B 3UJJH 2K3TA 1XIWB 4PJGA 3X13A 4NYLB 3QPXL 4NKQB 4ZS6D 1G9ML 2IH3B 3A6BH 3NTCH 3AVEA 4PP1D 4U0QB 1V3JA 1G6RB 4NOFA 5KTEL 5IFHH 4TNVK 5C07A 4FXKA 4PY7B 1XGTB 5D1XA 1ZHNA 1AR1C 3MBEA 1EMTH 3GO1L 4HS6B 1U8QA 3GMNB 3LIZL 1J1PH 4YUEL 2CPCA 5IBLD 2YD5A 2P7TA 2VLJB 1LO5A 1PY4A 4OF8A 1WWWX 1WVZA 4Z0XA 5GRUH 2CO7B 4TQEH 1WBXB 5ISZE 3CH8A 1D9KD 1FZMA 1M05B 4XNUL 4LDLB 4RMUA 1HIML 1OPGH 3ARDA 4B41A 1T1XA 1TQCC 1GGTA 2F54E 1BVKA 4LLMA 3QNZA 5HHQA 4OKVB 3NBNA 3HI6H 4ZO7A 4KTYA 2D2OA 1P5VA 1A6UH 4NCC2 3ARBD 3THMH 1XCTA 3JWDH 5HI4C 3DECA 2ITCA 2AW2A 3QA3B 2J88H 1XH3B 3TA3D 3O8XC 1N0XH 5E08H 1RMFL 4H8WL 5TJWK 3QH3A 1AKJB 4ZMAT 1SBSH 3UO1L 4AT6A 1R6VA 1JTOA 4ZFZA 4CVUA 3RY6A 1KUMA 4RGNC 4PUBH 2BSRA 3VXRA 1DQML 3NFPA 3C60B 3IDIA 2W65A 3HC0A 3MQIA 4DFHA 1DSFL 4QWWD 4CVXB 3TT3H 4ZNEE 1Y0LA 3HZVA 4JRYB 2R0ZH 1QSVA 1LEKB 1UM6L 2ADFH 3O6LL 1VKXB 5IW6A 2OJZL 1S9WA 5D7SL 3WXVH 2OTWA 1C5BH 4LIQH 4OCYL 2GSIA 5IVNA 3G5ZA 4B0MM 3DMMD 3DX8B 4XBGA 1S5HA 5EIIB 3G6JE 1JPGB 1FO0L 2I26N 3ULUL 5FO7A 4UUJB 2DQTL 3Q48A 4G7YH 3NH7H 1XR9B 4PJ9B 1CD1B 1OAYL 1X6NA 1T4KB 5F7NC 3MR9A 1A47A 2VJXA 4PB0H 1U8OB 4UNUA 4UOW0 1FYTD 1DQLH 1KJ2A 5FDWB 1MWAB 3LHPH 5CEYA 3ZDXE 4K9EL 3EYUH 5ETUB 2VDOH 1DQJA 4KRNA 4XNMB 2EC8A 4FP8H 5FYJL 4R4NC 1M6OA 4XNZB 4JG0L 3DUSA 1H5BA 4KUCD 4P0DA 5BS0A 5HSFA 4X83A 5JHDD 5EO9A 1J0JA 4K8RD 4PJ7E 4XXDA 3T09A 3PWPE 3MLTB 1P7QA 1WWBX 2YPVH 4XMKL 1WUNT 5DFWH 3W2DL 4FQLL 1P84J 1UWGL 1RZGA 1NGQL 3FOMB 2EXYC 4U1SB 3ZKMD 1WIOA 4NHUA 4M1CC 1BZ9B 2VTFA 3L9RA 4Y2DD 5LAXA 3TP4A 2P4AB 1MVUA 2JIXB 2GSGA 4NGHH 3RWIA 1A22B 5C0BA 2VDNH 1JPST 4HK0A 3QQ3B 4IS6A 2OP4H 1TVDA 2OSLA 3GMPA 5E7FA 2G60L 4WUUA 2UVEA 2PCPB 4MCYA 4BH8A 2FX9H 5JXEA 1KENL 4M5ZL 4FQ2H 2EIZA 3VWKB 2ARJA 1RULL 1YYMH 5SX5K 3VJ6B 3V79C 1ZT7A 5EUOF 2Q8AL 2AEQL 1VFUA 3IJHB 2NZIA 3L6FB 4WGWB 1AH1A 4FFZL 3U46A 1HI6B 4OCLC 3UTSB 2CMRL 4FQ1L 1F3DJ 3F12A 5IB3B 2VXVH 4KK8D 3UJTL 1EIBA 5EA0L 3VD5A 4ODXA 5IB1B 1D6EA 4R7DA 4NCC1 2NR6C 1QRKA 1A9EA 3KPSE 5I74B 1NMBL 1S7QA 2APVA 4NN5C 3QEQA 1ETZB 3U4AA 4AJ0A 5L2JB 2AK4D 3H9SE 1NGXA 1I9EA 3OQ3B 3U30C 1LP9B 1ZLSL 4YQXH 3VFRA 3NFNA 3DO7A 3BEWB 5I1IH 5DHXB 1LK3L 1Z0NA 4MD4B 2BVUA 4PG2C 4ZSOE 1CDIA 2VDML 1CIUA 3VXSE 4P2QD 3VWJA 2ZPKL 1IBGL 5AUMA 5EO1B 2VLME 3ZYOA 1T1YB 4F33A 5LGKA 1QG3A 4PJIF 3ZTNH 1KCSH 4P57B 4RMWA 1G7PA 2QQKL 2H2SD 2VLRA 1ZWIB 3VXPB 1B2WH 4RMRA 4TOYL 4LVNC 4S10A 2H6PA 4ODVH 5ADPH 1LDSA 3AC0A 3WN5C 1AHWC 1I3GL 4PJHB 4TTGA 5BVPH 5L8LB 1BOYA 1QSZA 1ZHBB 4U6YA 5B3JF 4HJJL 1G7QB 3L5XL 2ZNXA 5CP7A 2ZSVA 4EQ3A 2ORBL 3RDTA 3MRQA 5ABDE 3P4MA 2R4RH 3EDKA 1A1OB 5E4EC 1HCVA 1A64A 5HHNA 3H7BA 2H3NA 2D9CA 3S3PA 3ZMRA 3P77A 4Y5YC 1NMAH 1OW0C 3AAZA 3K2UH 4JFZL 5MERA 3BIKB 3FB8B 2IALA 3LH2H 4NPYB 1INQB 4CDHA 4KQ3L 2ATPB 3OXSB 1DL7H 2FO4A 5AEAA 5CINH 3T3ME 2DQIL 3QNXA 3WFCL 1FLRL 3R8QA 4Z5RB 3UZQA 2XI9A 3STBA 2Y5EA 3K1DA 3NN8A 2CD0A 1GZQA 2Q76B 2Z93B 4AG4H 4QHMB 1ED3A 5L88H 4RRPG 4KPHH 2F15A 3GGWB 2OTUB 5KVGH 5I18H 4ZAKA 3WJJA 2A1WH 4P46B 3WHE0 4QRSA 2A9NH 1ROWA 3CAFA 4TVSa 2AEPH 3P9MB 3RWHB 1ND0A 3B8YA 5F7DA 2HJFB 2NY6C 5E00A 3WFEH 5FCUH 1KCVH 2Q7YB 4HCRL 4A6YL 3LN4A 2X4SA 2ADIB 3KDMB 1FVEA 1NDMA 3SDAB 4DGIL 5HYQB 2DLFH 2DQDL 2H32A 4P2OB 4KMTH 4CL7A 2C3WA 4PRDB 1F11A 5DO2C 3DVIA 2ED9A 4PRNB 3TNMB 3MLZL 4FQXA 3RIAF 2PO6A 2H8PA 1Q9OB 1P5UA 2QSVA 4MJIB 3CX5K 1CLYL 1T21A 3DLQR 4UNTA 4NKIL 4R2GD 1KJ3L 3UAJC 1MFCH 3VMPA 1QA9A 4LSVL 3CUPB 4PJXE 1MCFA 2OI9B 5DJ8A 5I8OL 3BZEA 3ECBB 1I9IL 3FFCD 1RHHB 4F7EB 1AGCB 4X5WA 4OZGF 1A7QL 1PG7L 3FQTA 4PJBE 4LEOA 4J6RH 2WWMC 1FAKT 1TZIB 2PYFB 5E8EA 3PHOA 5BRZB 2Y36L 3AM8A 4XTRC 1PW3A 1HNFA 2XWTB 4LVHC 3BUYA 4JPWH 1NCNA 4LLUB 1FNGB 2HVJA 5EU5B 1YZZA 5DZOA 2X4RA 3C8HA 2BNUB 5B8CA 2JCCA 4DN4L 4HQQH 5C1MB 5CAYB 3QUYA 5DJAB 2R0WL 1R5WA 1U8LA 4XC3H 4R8WH 2ERJC 4GW5A 5B4MD 5F1IA 2HT4D 3FT4B 5B39A 4RCAA 1V7ML 2OK0H 2VE6A 3F8UB 3SCMB 1DN0B 3T65A 3WDJA 4LDOB 3QHTC 5EG6C 5ADOH 2CXGA 4XCNB 1YNTB 1FNAA 2MMXA 3UTQB 4AEFA 1KB5B 3T0DA 5JR1L 2AV1A 2VB5A 4JVUA 3IDXH 4LRNL 2D4DA 3IETA 3OKEA 4S1DD 4L3EE 4PRPE 2IBZY 4DZ8B 3VGEA 5E2TL 3MRBA 4I0PB 15C8L 4QHNA 1AY1H 2CK2A 3T0EA 4HJ0D 3S36L 2WBJD 2C3GA 3QUXB 3CFDA 1IQDA 2OZ4L 1CDYA 3HAEA 1CI5A 2ADGA 4PGBB 1K4DB 4Y5XB 2L4OA 3JWOC 4X7FC 3MRPA 2FX7H 4Z76A 2Y7QA 2DYPA 4BZ1H 5IB4A 1XF2A 3GM8A 1CXEA 4M6OL 3ARGB 1W2KT 3R8BB 3BZFB 4WY7H 4N90E 2AJXL 1KGCE 5E99L 5HY9A 2BY1A 4FXLA 1QFPA 2DWEA 1EK3A 4Y1AB 4NQCD 4JHZA 1RZKH 1LP9E 4NKOB 1IGYA 3E2HB 5C0FB 4ZQKB 1JE6A 3ARTA 3OL2A 2AXGB 1UM5H 1UB6B 4LBEA 2HVKA 1J8HA 1RZFL 1MWAH 5GRJL 5SWSB 3REWA 2VZ1A 5IW1B 5E1AA 4WW2C 5J11B 3O41B 3IKKA 1CXKA 5HJ3A 3VFGH 4MSWB 5E8PB 3V5KA 4KMQA 3MRKB 1K8IA 5ESQA 4QRRA 3U83A 1AJ7L 1EVTC 3IFOA 4JPVH 5CZXD 5HYFA 3Q3GA 3U4BL 4D9RD 1PZUB 2YK1H 1BFOB 3VXUA 4LDEB 4P2RB 3QFJD 3UPAA 4LF3B 5DD5H 4P48A 1QFWM 1CTOA 1BBJB 5ALBL 2R1WB 3D1MC 4MJ6A 5FA3A 5BJTA 4U1KA 2DDQH 4XPTH 3FQRB 4OLVL 4OUUA 3V4PH 3IJYA 4NC1E 2EDLA 5AZ2L 1MLBA 4HWEL 3MV9A 3RVWC 3CPLA 4ODHL 2VQTA 3CFEA 4HKJA 1VFAB 4HZAA 2BNRA 4L4TB 3O6FC 1K8DB 1AC6A 2XN9D 1F58L 1DE4B 4Y4HC 3RQ3A 3ARQA 3MJ7B 3T2QA 1YY9C 1A6WH 4RX4D 4U6HB 5E5UB 4YZFF 3MNVB 2HJLB 5ITFA 4Y8AA 3VGDA 1AGFB 4M9PA 4WFEE 3O8XA 3BH8A 4LCUA 1I1FB 3F7YB 3SKOA 3O4LB 4XI5C 4H0IA 1IL1B 3L3IB 4HWUA 1V05A 3TBVB 1NC4B 2W0FA 3MGOB 3WLWC 2AXFA 1J0ZA 3F6IA 3GSUA 3IF1A 1KLGA 4ZTOL 4UBDC 4XHQA 1WIUA 1KFAH 3JWDC 1RPQA 1BPVA 1BD2B 3ARSA 1DFBL 1KN4L 3QHZL 1ZT4A 1B0GA 1IEBB 5DD1L 4KJYB 4WU7B 1OAZL 2D7OA 4QRPD 3EYQC 3O3DA 1D5MB 3QIUB 4N5EC 1A2YB 5ERWA 3PWJA 4L8SB 2I9LA 4N9OB 4XVTL 4PLKC 4J7RA 3G5XB 5HHMB 5IWLC 2FZ3A 3WSQH 1LNUB 1I4FB 2KPNA 5BZWA 4U6XB 4XHJD 1HZHL 4Y4KD 1MPAH 4QY8A 3FTGA 3MLYH 1IAIH 4QEGA 2F5BH 2V9QA 1AC0A 4ELMB 1YUHA 1MEXH 2ITDB 4X9GA 5HGGS 2O5XL 2W9LA 1AFVL 1QHOA 1MJUH 1U8KA 1JF5A 1EBAA 4M61A 1KCUL 4DGVL 3ULVD 4Q2ZA 3EYSL 4QF1A 3C5ZD 2Q20A 2G5BB 3MV01 4KTEH 1HHJB 3KPRD 2V9RA 2IQAA 4F57L 5DFVC 2MCG1 1LD9A 5EZIH 5BRZE 5TQ0H 2VDLH 3IAGC 4P23B 2CDFB 1S7VA 4M5YH 4PJ8B 3QCUL 3DTXB 1NGWB 2QBWA 4AMKH 1T80A 2AJYL 3VFSB 3LKPA 5A2JH 5GZOC 1U8PB 2Y4SA 3CDGB 5TDOA 3O9WB 5EU4B 4EI5B 4HIIB 2I60L 4OZIE 4HH9B 5I9QB 2P5WB 3H9HA 3RPIA 1I8IA 5FGCB 1I7UA 1JNHA 4Q6YA 3CZFA 3IJSB 3K4ZA 1X5JA 4JO3H 3BAEH 4PYGA 3VGAB 2ZUSA 2DQCH 3D2UA 2AGJH 3DV6B 1AXTL 4P3DA 1T7XA 4AQOA