2Q79A

Crystal structure of single chain e2c from hpv16 with a 12aa linker for monomerization.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
74
Chain Sequence
b'TTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein E2
molecule tags Dna binding protein
source organism Human papillomavirus type 16
publication title Increased Stability and DNA Site Discrimination of "Single Chain" Variants of the Dimeric beta-Barrel DNA Binding Domain of the Human Papillomavirus E2 Transcriptional Regulator.
pubmed doi rcsb
total genus 20
structure length 74
sequence length 80
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q79A00
4U67Q 1WEZA 2AYEA 3UE2A 4PRFA 5JVHQ 3CCJS 2FY1A 4FXWA 1YJNS 2HZCA 2F9DA 2DO4A 3UCUP 1K73T 2LECA 2ZJRQ 5CYJA 3CCES 1VC5A 2CPEA 3PIPQ 2CQCA 2E5IA 3CCRS 2LMIA 1WHWA 5IQQA 3MDFA 2M70A 3FEYB 4WF9Q 2A3JA 3S6EA 1X4AA 2MKHA 2BZ2A 3MUMP 3MI7X 2CQ2A 2G0CA 3CTRA 3US5A 1VQ5S 1U1KA 2CQBA 3NS5A 1N52B 4Z2XA 2E44A 2KYXA 2DGTA 3THTA 2CPJA 1D8ZA 5DM7Q 1OIAA 2KM8B 1ZZFA 2ADCA 1WI8A 2KRBA 5ITHA 2ADBA 1Q86T 1CVJA 1WG5A 1VBYA 1PO6A 3CC4S 1HD0A 2YH1A 2DH9A 2OSQA 1W2BR 2RUGA 2YWKA 2QA4S 3SMZA 3CD6S 2KFYA 1X5OA 1VQ7S 4WKRA 2DNHA 1WWHA 2CPYA 4LIRA 3BS9A 1RKJA 3HI9A 2LQ5A 5FJ4A 2UP1A 1WHVA 1WF2A 1H2TZ 2FC9A 5LJ5Y 1M1KT 2GHPA 1R8PA 1YJ9S 5D77A 1VQPS 2J8AA 1ZH5A 2EK6A 1YITS 1U2FA 2CQHA 4WIIA 2MMYA 3UCGA 2YKAA 2L9WA 3N9UC 2BOPA 2CQ0A 2KHCA 2MJUA 1U6BA 2B0GA 1JMTA 1F9FA 2ZJQQ 2OIHA 2ZJPQ 2RS8A 2MZ1A 3G6ES 1VC6A 1U1OA 1ZZNA 3MD1A 2HVZA 1H2VZ 2J0SD 1M5KC 2CJKA 4V19X 1P1TA 5GADU 4IO9Q 5IM0A 3OW2R 2M0GB 1VQLS 2LXUA 1VBZA 2DHXA 4WFNQ 2J0QD 5LXYA 3P5TL 2DNQA 4UQTA 1YIJS 3VAKA 2AD9A 1M5OC 1DZ5A 2E5JA 1WHXA 3NNHA 2LA4A 5DDQC 2PEHA 3SDEB 3MUVP 3VAMA 1JJ4A 4QU6A 2KVIA 2D9PA 1UFWA 2XB2D 2DH7A 3ZZYA 3R27A 1S79A 2DK2A 1WELA 2AYBA 4P6QA 2CPFA 1IQTA 1DBDA 3CMAS 1WTBA 3R1LA 4UY8T 2OSRA 4C0OC 2MKSA 4F02A 3HHNB 1D9AA 2DB1A 2DITA 2XS7A 4CQ1A 5GAEU 4WFAQ 3Q2TC 1WEYA 2M2BA 1U1NA 2QFJA 2DGSA 3U1LA 5DM6Q 3MURP 4F25A 2LA6A 5DDOC 2QEXS 5LJ3Y 4W92B 1URNA 2E5HA 1FO1A 2KH9A 4ED5A 4C7QA 2OJ3A 5JVGQ 2M4MA 2MZJA 3MXHP 3MOJB 1X4EA 4LJMA 1X4HA 2MQOA 4F26A 3PIOQ 3LQVA 2MHNA 1SJ3P 1M5PC 2N7CA 4TU9A 2DNNA 1KOHA 2LEAA 3VAFA 4TU7A 4OZ1A 1U1MA 2M8HA 1X4GA 2DH8A 2I38A 2J76E 2DGXA 2O3DA 3VAIA 3MUTP 4Y00A 4EGLA 2KG0A 1UW4A 2JVRA 2F3JA 4CH0S 3VAJA 3RW6A 1KOOA 2CPIA 1U1PA 1VQ8S 3G71S 2AYMA 3S7RA 4M5DB 2K3KA 3V4MA 2DGOA 2YTCA 3NNAA 3S8SA 1FT8A 1K8AT 1A9NB 2K8GA 1O0PA 1QVGR 2D9OA 4YB1P 3G4SS 2MZRA 3BO3A 3BEGB 2JWNA 2GO9A 2DGVA 3G8SA 4OZ0A 4TU8A 1H6KX 1X5PA 2D3OR 4PKDB 4LMZA 5DDRC 2LKZA 3CCSS 2LEBA 1FJ7A 3SXLA 5GMKa 3VAGA 1S72S 5MLCV 4YUDA 2CPHA 1HD1A 1YTYA 4WCEQ 1WG4A 3VALA 2KXFA 2XSFA 2MKIA 3SDEA 3BO4A 3EGZA 2RRAA 2CPZA 1VQKS 2YH0A 2XS5A 3I55S 3P6YC 3CCVS 2MZQA 3G96A 3CCQS 1AUDA 1UP1A 2RS2A 2SXLA 3CCMS 1B7FA 1WF1A 2CQIA 2DHAA 3BO2A 2MSSA 2XNRA 1BY9A 3VAHA 2JRSA 1OWXA 5DETA 2MQPA 1L3KA 4ZKAA 2NZ4A 3NS6A 2RQ4A 1VC0A 3IWNC 2M88A 5BJRA 1VQ9S 1SJFA 2F9JA 1N8RT 1KQSR 2MKKA 1Q82T 5GAGU 2X1GA 2U1AA 3ULHA 3P49B 5GAHU 2MQLA 3H2UB 2DNRA 1WEXA 1FJCA 2JX2A 2I2YA 2M7SA 2HGNA 5LSLA 1X4DA 2N82B 3EX7B 1JJHA 2XNQA 3UWTA 1QVFR 5HL7Q 2DIVA 3DLLQ 2G1DA 1PGZA 2DHGA 5DDPC 5GVQA 3B4MA 3R1HA 3THPA 3LPYA 1M5VC 3RW7A 2ERRA 3CXCR 5HO4A 1NO8A 1RK8A 2RU3A 2CQ1A 1X5TA 2AYGA 5LSOA 1N88A 1UAWA 1WG1A 1X5SA 2DNGA 2NLWA 3CCLS 2MQMA 1OPIA 4A8XA 5LXRA 3DXBA 3P3DA 1WHYA 1R8HA 4WFBQ 2MB0B 3TP2A 1KD1T 4IUFA 2VONA 2KG1A 1M90T 2HGLA 3JB9k 2DNLA 1U6FA 3J7YU 1FXLA 1U1LA 2LCWA 2DO0A 2RRBA 2M8DB 3EGNA 1H2UX 2MY8A 2DGWA 2FPHX 3CCUS 3CC2S 2MGZA 3UD4P 2OTLS 2X1FA 1YJWS 2CQPA 2DNPA 1YWXA 2DNOA 1VQMS 1SJQA 2RVJA 2MZSA 2MSTA 4PR6A 2CQ3A 3L3CA 2HYIB 4QU7A 3CC7S 2E5GA 2DNYA 1NJIT 2DGQA 3FEXB 2KT5A 2DISA 1YHQS 4IOCQ 2MJNA 1Q81T 2MKJA 1DRZA 3NMRA 4QPTA 1X4CA 3B4DA 3IRWP 4RU2A 2DIUA 3Q2SC 1N54B 1VBXA 2EK1A 1X0FA 2N3LA 2PE8A 3H2VE 2LXIA 1FNXH 1KC8T 2MQQA 3MD3A 2CQDA 3NNCA 4CH1A 4QQBA 3TYTA 2KXNB 4W90B 3G8TA 2L08A 2JVOA 1HL6A 2KM8C 2V94A 3CPWR 3UD3P 1XN9A 5CA5A 1G2EA 2FHOB 2RNEA 1VQNS 1YI2S 1SJ4P 2Q79A 4TLQA 2EVZA 1U1QA 1VQ4S 2OTJS 2DNZA 1WF0A 2KXHA 5EN1A 3VF0B 2RT3A 2G4BA 2DGUA 2MY7A 1K9MT 3TO8A 1VQOS 1FHTA 2DNKA 1P27B 2MYFA 1SXLA 5D78A 5CXTA 3U1MA 3ZZZA 1JJ2R 1OO0B 1Q7YT 1X4FA 2MZTA 1QM9A 2CQ4A 2VOPA 2RQCA 4CIOA 2M9KA 3CF5Q 2N3OA 2KN4A 4C4WA 2CPXA 2WBRA 1WI6A 2HGMA 4FXVA 2KU7A 3K0JA 2KRRA 2MXYA 5IFMA 3G9CA 3I56S 3UCZP 2VOOA 2DNMA 2VODA 4YOEA 1X4BA 5H1SV 3S01A 1NU4A 4Y0FA 2M52A 1U1RA 2X1AA 3J7ZT 2U2FA 1FJEB 2CPDA 1DHMA 2CQGA 2LYVA 2X1BA 2L41A 2XS2A 1SJRA 2MKCA 2FC8A 4ERDA 3CULA 3D2WA 1A7GE 3CMES 2DHSA 3CUNA 1HA1A 2MQNA 4BS2A 4IOAQ 2KI2A 1VQ6S 5IM0B 2MPUA 4J5OA 2MGZB
chains in the Genus database with same CATH superfamily
4M5LA 2VFSA 4NLRA 1WEZA 4P10A 2VICA 2AYEA 3TRGA 2IBOA 3PRVA 4XPCA 2FB0A 5K5MA 3OSNA 4Q8EA 1VQYA 2Q6CA 3CT9A 1Q95G 3QGHA 4OYIA 3KDNA 3CJ4A 3Q0AA 2HS4A 4TYBA 5DZ7A 1NDLA 2FY1A 3QFWA 4FXWA 3E01A 1TTHB 1DTTB 2HZCA 4TNOA 2XCPA 2DO4A 3PEHA 2VQFF 1VCTA 5C2GA 3V2UC 3QT8A 3DLJA 4P7TA 3KG0A 1T3OA 2D74B 1NPKA 5JMNA 1RTJA 2HFZA 3V5RA 3DDKA 3I5AA 5HROB 2OPSA 1YQHA 2XYPB 3KJNB 3MFIA 2YNIA 1D0EA 4I2QB 1RT5A 1R8CA 1QSLA 1KN6A 1KVIA 3R7NB 1N32F 2Z2YB 2AF6A 2LMIA 1TVRB 1TU0B 1ROFA 3FEYB 3U27A 1UVIA 1RT5B 1TR0A 2A3JA 3D1OA 5EHHA 4RWXA 1XC9A 2B43A 2CJQA 2HURA 2QO3A 5B0EA 1RCOB 3S6EA 3WQPA 2C42A 1RT1A 2V8VA 2BZ2A 5KOWA 2CQ2A 3NRBA 3I82A 5ETLA 2A2CA 5ETNA 3US5A 1U1KA 1M5HA 1L3SA 3NS5A 1N52B 2B7CB 1YZ6A 2E44A 2KYXA 4QR0A 5CYQB 5DM7Q 2GMHA 3OBIA 5HVGA 2OMLA 1TL7A 3C6TA 5LT5A 4PG5A 3LP2B 4KY3A 1WG5A 1I3OB 3AB2B 4OX8A 5DQHA 3C6TB 3HZEA 1KQFB 1PO6A 3CC4S 2YKMB 4GO7X 2J9DE 3W2VA 2OSQA 5IWAJ 4C8KA 4KKOA 1P9YA 1F2GA 2JZ5A 3BBFA 2Q43A 3ETOA 5F0WA 1RT2B 5KG7A 1FKAF 1LW0B 1X5OA 3VCDA 1QJHA 4BC7A 4H4MB 1RT3A 1NDCA 2AEFA 2AV5A 4A8MP 4DBQA 3UPFA 3AY0A 1RKJA 2VG5A 2LQ5A 4LR8A 4R8UA 3WC0A 3ZTPA 4CT8A 5AJ3F 3AJDA 4KO0B 4N56A 1B64A 3H90A 3Q8VA 2BEFA 2IAJB 3OXLA 4NXMJ 1SL1A 1TELA 3CJKB 2C2OB 2YQ0A 4IOBA 3BM7A 2IAJA 4P52A 1M1KT 4JV2A 1EZZB 3AOAA 1Q8LA 1TKXB 1C0UB 1YDLA 3CW2C 2QL5B 3LANA 1YJ9S 3PKYA 4YR2A 1Y10A 3CJKA 4ZVFA 1ZH5A 1JLEB 3OR1B 4ANDA 3OTOF 2RD5C 2CRLA 5HATA 1SQGA 2GX8A 3NGKA 3TX0A 5K8OA 2PMZD 4QWEA 3JXOA 5ETSA 1SI9A 1LW2B 3CD7A 2L9WA 3IS9A 3UN3A 4X66F 1E6YA 2EFPA 4JBCA 3N9UC 3SEOA 4NYZA 4M5JA 5E33A 3IM8A 3VGVA 4ZHRA 3RRHA 5HBMA 1HKAA 1AROP 4CLUA 3QRPA 2Z2MA 3KK3B 2J6TA 1JMTA 3N79A 3CWJA 1RWXB 2H3EB 2VPXB 2LVWA 2OIHA 3PJXA 1T02A 2B7BB 5HLFB 2JSXA 1JLBA 3GTYX 4DPXA 1U1OA 1IUJA 1CC8A 2ZOFA 3AOBA 3TUIC 1C0TA 1ZYQA 1L3VA 4ATNA 1H2VZ 1WKLA 4R25A 2J8SA 2X3GA 4PQUA 4U8YA 4OZJA 3RU0A 3O1LA 4ECSA 2Q3PA 3KG1A 5J2NB 3W7BA 2YVSA 2M0GB 1TMJA 3OW2R 4ECUA 3KLIA 1L3TA 2NYIA 1LWCA 2LXUA 3IWXA 5KFDA 2WTFA 2Z8QA 1FFGB 3OXGA 3HJVA 2DHXA 2NZCA 2ZVIA 3TUZC 5LXYA 3GIKA 3KNAA 3DMJB 5F9LA 1IQZA 1UJ6A 2D1CA 2IJFA 4USTA 3EDRB 4CM0A 3VAKA 3UDCA 4F8RA 2ZBPA 3PW0A 4F2RA 5B0GA 2XLKA 1O8BA 5F3TA 2AIRB 3AQOA 1T03A 2ZKTA 4IG0B 3PVXA 2LA4A 4WXOA 5ETQA 2P2CB 2RKIB 3MM8A 3C15A 3DLEB 3MTKA 4OX7A 5CH7B 3PW5A 2BACA 4ZPWR 2ZH1A 2FGOA 5I3PA 4JB8B 4FBTA 1JLQB 4Y2MA 2A6MA 3VTIA 5AXKA 3E01B 4Y6IA 2DH7A 2UU9J 4N5SA 1S6PA 3DU6A 3IR7B 5KT6A 2N7YA 3FRZA 3TVZA 2KT2A 1WELA 1SH0A 2AJ2A 2Z56B 2V9KA 3DI6B 4X65F 3LP1A 5IWAF 3H5YA 4AT1B 2V34A 3CVKA 3MMCA 2ZHBA 2AYBA 3UFCX 3R8YA 4QWBA 3PO4A 3TARA 2UUWA 3D6TB 1IKWA 4LSNA 1S99A 5A2QY 3CMAS 4KIAA 1WTBA 2GA7A 4UY8T 2HFUA 3NGTA 3BGFA 4C0OC 4C8MA 2MKSA 4ZJQA 1Y9OA 4PWDA 3BPSP 4OI1A 1D9AA 3HMJG 5CAAA 2HRTA 3CDEA 4I6AA 5DG8A 3PJ9A 4WFAQ 1QE1A 1RYSA 3MPYA 2O66A 1HNXJ 2C3MA 4KFBB 1YBUA 1NBEB 3DYAB 1U2RA 3F0NA 4WP8A 5K14A 4ED3A 4B3RJ 2GW8A 3P8BB 1S4FA 4F25A 1T8EA 4B3MJ 4HTJA 2BVZA 1NMEB 2B9WA 3G2XA 2VPZB 3T6JA 3K59A 2HK3A 2IM0A 1Q16B 3CD5A 2IIHA 1UVLA 4ZK7M 2OH2A 1S7IA 2FJWA 2JC1A 2WVCA 4OI0A 3NGRA 4USWA 4ED7A 1YJUA 2W2NP 3T1YJ 2AEJA 2W2QP 5D3GB 3KTQA 1S0MA 3QSIA 1RT7B 3I6PA 4ZLPA 4F4ZA 3PW7A 3MXHP 2Y0BB 1CLFA 3I9V9 4NMLA 3GB0A 2ROGA 3VV2B 3VVTA 4V19J 2CDRB 1NRKA 2RRNA 3D66A 3FK4A 2K1RA 1RTDB 4D3HA 3MMJA 3PYGA 5KFYA 3TA1A 5A8WA 2V4QA 4ECWA 4DFJA 1S0VA 1RAJA 2MHNA 1S4EA 3U1NA 3ISZA 1KOHA 3PHTA 4RW9B 2B9YA 3FCVA 2DY9A 3HHLD 4OZ1A 2FIUA 4TQRA 1U1MA 1YJRA 2CKWA 4MIBA 3DDIA 1Q5YA 3OVSA 2DYAA 3EPGA 1RAGB 2X51A 9RUBA 2V4RA 2J6SA 2AX1A 4ELUA 2HBZB 3P4UB 4KHMA 3IRXA 2KG0A 1UW4A 1VYAA 2JVRA 2A2DA 3MM9A 2JL9A 3W1YC 2ZM6F 3VAJA 1KOOA 2CPIA 3F56A 5E3CA 5D6GA 1IJEB 1HW8A 4NRUA 4AFFA 4DV7J 1VQ8S 3HZGA 3SYZA 1CJVA 2I9SA 5HQLA 3NOCA 5CD4H 4YP3A 4HKQA 4G1IA 2IPOB 2V2QA 2MQ8A 2QN6B 4PYAA 1HNVB 2BQRA 1RSCA 4YB7A 1T9UA 4A46A 5L38A 1F9EB 4ILRA 1A9NB 3D3CJ 1QVGR 5AE3A 3DRSB 2E5LJ 3Q23A 1RA6A 1CJUA 1JLCB 1Y3JA 3GYXB 4NYPA 3GJTB 3ENWA 1F3FA 2ZDOA 4ZLJA 1WD6A 3TQ1A 1R31A 4ZVUB 5IS2A 2MZRA 1NLKL 3JS9A 4LQ9A 4OMFG 2XY7A 2E7XA 2WVBA 3BEGB 5H9EK 2BKOA 3LW5C 2JWNA 4PXCA 2IRYA 1EKSA 5LOQA 1Q8IA 2OEKA 2PMWA 3OR2A 1H6KX 3QLHA 4ZPBA 1V9OA 2AW0A 2JC0A 3FVYA 1TK0A 2R8HA 3MECB 1U8WA 1GT8A 2BDPA 4M5KA 3AH6A 3BBCA 4MIAA 3ET6B 2LKZA 5GAGI 4DQQA 4LF2A 3NCPA 3MECA 2VB6A 3KK1A 1ZS6A 4CLKA 4DJBA 5F9NA 1HD1A 2UXBJ 1Z4UA 1WG4A 2FHJA 3HX9A 2XZTB 5L9NA 3TAQA 2FJVA 3B78A 5A0YA 1SB6A 4YFUA 3SDEA 2MKIA 4ZPAA 1B0TA 1VQKS 1QY7A 2YH0A 1TKTA 3NY0A 3P6YC 4PXEA 1RAHB 3ENQA 4ECZA 2XLIA 1UKUA 4MH8A 4DL6A 5K8PA 4ECQA 4DR4F 4QIVA 3CCMS 2CQIA 1JNZB 3FSXA 1N34J 2YNIB 1D9DA 1BY9A 2OHDA 5JXSA 3OUYA 4U6PA 4J9VA 3ZC4A 2VC0A 1R3NA 2P6TA 2W7AA 1CQNA 4TQSA 3D28A 4ZKAA 4RW7A 4OLOA 1RI7A 3W61A 1DARA 2ZE2B 3EYZA 3IWNC 1X8DA 3W5YA 1F1BB 1SUQA 5KG6A 1I6JA 4G1QB 3KJVA 1L5UA 1D8YA 1Q82T 3W3SA 1JNRB 1GXUA 3M7VA 1H73A 4Z7YA 1R89A 2XMKA 3JAMU 4WFXA 2FDNA 2U1AA 5HP1A 2GHWA 4NXMF 4FZVA 4OJGA 2YX4A 4W4MA 2B4PA 4ZIVA 2CA9A 1RWUA 1CPZA 2DNRA 4Q2LA 5LMNF 2R7WA 1XMOJ 3IFEA 5BYSA 4B3SJ 1N5QA 1Z2LA 4H4MA 1OQ3A 4K4YA 5F41A 1ZA1B 2R4FA 3PXGa 1XMBA 4FKXA 4KKOB 4NZ6A 1T05A 4DV0F 3TJ9A 4NXNF 5F8JA 3R5DA 1PGZA 1RWPB 4O3QA 4YS2A 1HBOA 4OX6A 2OEMA 4A8SA 3IG1B 1M5VC 3MOZA 1KP6A 2W24A 3PZPA 2OPQA 4BC9A 4CT9A 1P6TA 3MM5A 1BC6A 1M0SA 1UFKA 3CMQA 2W9AA 1FX2A 4ZVHA 2AJ4A 4XDDA 1YLXA 5A76A 1NK4A 2EXUA 1NKBA 3H7HB 3TZZA 3T1HJ 2NLWA 5F8NA 2W2MP 1FWPA 3CCLS 1OPIA 5C25A 3SI8A 4NA3A 2FLOA 1GQEA 2JHEA 4FYWB 5IC6B 5KOXA 4Q7AA 5LXRA 5I3UB 1C4CA 1S59A 3P3DA 1R8HA 4WFBQ 3HVTA 1XR5A 1NDPA 3U7JA 1CS4A 2RDDA 2WONB 4I7FB 3TP2A 4F0KA 2XLJA 2C28A 1H7XA 4ED0A 3K5NA 5CD4A 4X4SA 4CLZA 3RUBL 3MPUB 1Q53A 1T05B 2HGLA 1FRKA 1M90T 1ZM9A 2YNHA 5L1KA 2CZ4A 4C6AA 4FP9A 5ETKA 3DLKB 1TFYA 1BQMB 1S9EA 4O44B 2XMAA 4URGA 3GU0A 4DCPB 2W7PA 2LCWA 2WOMA 2DO0A 1S1UA 4I64A 4F50A 2RRBA 4ZCMA 4C97A 4RNMA 1HHSA 5KT7A 2KZZA 1K47A 2M8DB 3W8GA 1HLWA 3CO9A 1C2PA 2C2DA 2JOQA 1H2UX 2UVVA 1S1VA 2DGWA 1Y11A 2VV5A 2YKPA 3FCHA 2C3OA 2R9LA 3RBEA 4H4OB 3CSKA 3DMJA 3FEZA 4NZ0A 3J7Z5 4P9SA 3MR6A 3CC2S 3UD4P 4HT7A 1YJWS 2OTLS 3JAMY 2CQPA 3KLGB 4GKJF 2KJWA 1AFJA 3GP9A 2OELA 2DNOA 4ED4A 2ZOMA 3T1YF 2PA8D 3BYPA 1KVJA 4KQZA 5KFAA 3DLEA 3HFKA 2EEYA 5FDLB 4DOZA 4N76A 3W2WB 1F5CA 2YNFA 1NJIT 3OT9A 1EHWA 2GIFA 2QT7A 3VWSA 1B0PA 4ZP8A 1QDUB 2RUSA 5G0RB 4IOCQ 2ASYA 2ZWPA 4OHWA 2MKJA 2XWXA 5BR8J 1WORA 1TVRA 2EWHA 3OTDA 3B4DA 3T3FA 5D0EA 3GMGA 3MWBA 1RDRA 2AGPA 3QT7A 2E1CA 2XM3A 1N32J 5AXMA 3H5XA 3EGVA 5GMEA 1OS5A 2VQEF 1N54B 2EK1A 3DI6A 4GC6A 3KDOA 4RW7B 4CLYA 4BWJA 3GIRA 4EZ9A 1HMVB 2UXDJ 1FNXH 3FQKA 5H9FK 2E7WA 1Q78A 1TL4A 2HNDB 2Z0GA 4TKTA 1FXDA 2CNLB 2FHJD 3NNCA 4CH1A 2AQ4A 1IJFB 1P9QC 4LF7F 1BWEA 3NGSA 5HI7A 4RR5A 1SQEA 2YX1A 2L08A 2JVOA 1HL6A 1LNQA 1RBOB 4DV1F 3M9OB 4UZBA 1XK8A 1EP4A 4X4NA 4QW8A 2HQ3A 3TOQA 2RNEA 4EYIB 4NLTA 2VG7B 4KJIA 1YI2S 3RGIA 1LW0A 1R27B 3FRYA 1IBMF 1VQ4S 2DNZA 3GG0A 5IT4A 4C8LA 2QGFB 4Q43A 2RT3A 4DXLA 4K2JA 4NEZA 3QIPB 5LMNJ 1BHNA 4HDHA 4OI4A 1S9GB 1Y3KA 1NJZA 2L3MA 3BGRB 3GZ7A 4IH7A 2K1RB 5D0HA 1FEHA 1RWWB 5M2PA 3V6JA 1YRTA 3JQMA 4LFBF 1IBKJ 1LWEA 3KHHA 1VOMA 4OJHA 5F3ZA 4FDFA 4DLEA 4EBCA 4O3SA 2E9RX 1U8SA 4X64F 3D3BJ 2FGCA 3JSMB 4DPTA 1IR1A 1Q7YT 1X4FA 4TYAA 1NHUA 1QM9A 3QT5A 2R8IA 1K44A 4FF1A 3O44A 5KFMA 4JI8F 2AEMA 3TW0A 1F3VA 1TKZA 4C4WA 1R0AB 2GVZA 1PBAA 2HMIB 4G6VB 1RAEB 2CPXA 1HBNB 3GSDA 3OFGA 3ITHB 1CS4B 2WONA 1WI6A 2UP1A 3TEGA 1RXOB 1E6YB 2OD4A 4NX9A 1FJCA 2OI2A 4WYLA 5FD1A 2H9ZA 4EEYA 2PO4A 2ZZNA 4L76A 1CJVB 2HAIA 2KRRA 2MXYA 3R5GA 3J81U 4LFAF 2HFSA 1Q1KA 2PEBA 2BKPA 1B7YB 1C1CB 3S01A 1NU4A 4ZHRB 2HHTA 2IM3A 4Y0FA 1KQGB 3GJRB 1QUPA 2HLUA 3HFZB 4IG3A 4NA2A 2Z57B 1VK3A 3KKFA 5KFBA 3QIDA 1FJEB 3TJ8A 2XO6A 1PJ7A 1J5EJ 2F63A 5HQMA 3KMSA 2UXBF 2HQDA 3PHEA 5IT0A 3KLFA 2IRUA 4NLYA 4D3GA 2DRAA 5KFHA 1LWCB 2BUNA 3J7AN 4DR7F 3M05A 5HK4A 3CUNA 1Q5VA 1V3RA 4Q0BB 2HVEA 1BE4A 2YNGA 3ZTQA 4DPOA 4IOAQ 1X9SA 4UOGA 1VQ6S 3M2VA 3R5CA 2E1MC 2MPUA 5CZXA 4ED1A 1HBUB 1WC6A 4DSKA 1FTCA 1B99A 2V8GA 1RWNB 1CBKA 1WOPA 3RRKA 4F7VA 5CCLA 3FC9A 4USMA 2V69A 4M5IA 4PRFA 2XEXA 2Y1JA 2UXCJ 1RT4B 4EWTA 3IBWA 1LXNA 4DF8A 1FDNA 1OY6A 2E5LF 3VGTA 2MEWA 2F9DA 3AODA 4ES1A 4K8RA 3HVRA 4KPYA 1K0VA 5AE2A 1K73T 3LF0A 3RR7A 1Q4RA 1LOUA 2GNKA 2IDLA 2ZBQA 1VC5A 1YBAA 3QFHA 2Z2LA 4IH6A 5CCMA 4USKA 3PIPQ 1NJWA 3OUYB 2MLZA 2ZNZA 3PG9A 2UUAF 1WHWA 5SZTA 1HMVA 2RQKA 2M70A 3M2RB 4JV5F 1GXTA 5K8MA 3ICLA 3TANA 4KHPF 4PWDB 2QTWA 2MTLA 4ZVSB 2MKHA 3SQGA 4AL5A 1IKWB 1T7PA 2GAHC 3MI7X 1RHRB 2DEIA 3MUMP 4YR3A 3SFGA 4ECYA 2CQBA 3FNNA 3THVA 5KFXA 5CQGA 3AFGA 3CGIA 2VBYA 3FKBA 2DGTA 2MLXA 2CPJA 3D67A 4ZJLA 3THTA 2QLFB 4KR0B 1OIAA 4B9TA 4FF2A 3PYEA 2BJ7A 3T1HF 1WTFA 2PD1A 4MJKA 3KUGA 2CNKB 4ZS6A 2ADBA 3KLEA 3V6DB 2XULA 3BKUA 4FS2A 1CEZA 2B3TB 2YBVA 3S1TA 2DXFA 4UOCA 2JNJA 2QX0A 2FVPA 3IMQJ 2XI2A 3T5HA 4O4GB 3IN5A 1YZ7A 2XMVA 4L73A 1W2BR 4K4SA 3IXQA 3BGRA 2XCAA 2YWKA 3G87A 2F1FA 1ZPVA 1UA0A 2QA4S 1NK0A 4KTQA 4C11B 1EB0A 1ZAXA 1FK9B 2IVYA 1TQLA 1VJWA 4V1Ak 3SBMA 4FF3A 3QNWB 4OJ1A 2XI3A 1WWHA 1X60A 1PJ5A 2CPYA 4LIRA 1RLCL 2ACMA 2HBQB 3HI9A 3IGVA 1FDAA 1S9GA 3VQTA 4RNOA 2HHHJ 3M2UB 3I5CA 3CB4A 3SZ2A 2H4YB 1PYTA 4B9MA 3G82B 3FFIB 2LDIA 3JSRA 2ABYA 5E3RA 3MM6A 2O5DA 3QZ8A 2JH3A 2FC9A 4DG1A 1AT1B 2GHPA 2XMUA 1MWYA 1PJ6A 4Q45A 1RUSA 3K2YA 3SCIE 1I5OB 4FYYB 3QMQA 1RT6A 3RJMB 3NOGA 3LGNA 1DURA 4WIIA 1F60B 4DQIA 3IC1A 3QGPA 3R5BA 1BXNA 3TQEA 2WCXA 3K5MA 4JI2J 2IBKA 3C3LA 2R7XA 4PG6A 4Y65A 3K5LA 5IZHA 1VHIA 4DR5J 1G3OA 1OY8A 2CQ0A 3M8QB 4ENOA 2HQCA 3E3XA 2KHCA 4LF6F 5MAOA 3BDEA 1RABB 2B0GA 2Q6BA 3KUHA 4DR1J 4DS4A 4B9LA 3D6FB 1KBRA 2EFQA 2GAGC 4HVZA 2ZJPQ 2MZ1A 1HNXF 3N5BA 1RBAA 1TV6B 4C8NA 3T6BA 1VC6A 3EVOA 2NQPA 1S6QA 2PIIA 5A8RB 1N33F 4LBPA 2JLFA 4DQRA 1ZZNA 2D3O1 5DQIA 5B08A 1P1TA 5JJBA 4F0MA 3QQCD 1U0HB 4DUTA 1K0TA 1Y5LB 3D6MB 4BHQA 4X4TA 4DV5F 1N48A 1VRTA 3FBEA 1NNDA 4DV7F 1VBZA 4JI6J 3P5TL 4UQTA 1D3WA 1LEOA 4CO2A 5HMWA 1HIYA 3Q8QB 3OR2B 2J5AA 2PC6A 3BGUA 3C2PA 4ZN1A 2AD9A 5KFZA 1U25A 2FUG9 3WX8A 1U6ZA 5B0AA 2E5JA 2G13A 3SIPB 1JLAA 1MN7A 1WHXA 3PEJA 2H5IB 3OVAA 2W8KA 2PEHA 3MUVP 3OL6A 1HNWJ 4KPCA 4O23A 1ZPWX 1H72C 1JLAB 4GRSA 2KVIA 3PFEA 5J1EA 4ZVRB 2D9PA 2D7SA 4LF9F 4FF4A 5KFQA 1UFWA 4DUZF 4HI2A 2ZH4A 4KHRA 1N36J 3ZZYA 3BGOP 3ZNJ1 1KSPA 1XNQJ 2GIRA 3KLHA 4MTPA 4I56A 1S79A 4LRBA 2G1HA 3MMAB 1IKVA 3KK2B 2E9TA 4I67A 3D0IE 4RW8A 1HI8A 2ROPA 3I9ZA 2CPFA 4KH0B 4P6QA 4DR3J 2NR0A 1DBDA 4Q2MA 4JI0F 1CG2A 2FY8A 4RZRA 2BJEA 2CG8A 2XZDB 3HHLB 4G65A 4HI1A 2R2TA 4WE1A 2CJBA 3R1LA 4J37A 1TK5A 4LF8F 1MMNA 1U09A 2X3DA 4ZA1A 1IBMJ 2CNNB 3BREA 4Z37A 4ZVQB 3PY8A 1LWFA 4ZN3A 1XNRF 4URQU 4F02A 1VBKA 2Q66A 3T9ZA 2XMJA 1WDDA 3AAWB 3HD1A 3MZIA 4FYVB 2DB1A 3GLJA 2DR9A 1S0NA 2HFNA 2JEGA 2XS7A 1D09B 1VHFA 5GAEU 2J9EA 1IM6A 3PX0A 2WVDA 3Q2TC 2M2BA 1N4LA 4HR2A 2QFJA 2DGSA 1HNIB 1RHQB 2E9ZA 3MURP 3MM7B 1SKRA 5DDOC 1N34F 3QJLA 2QEXS 2ZH6A 2IMWP 1S12A 4OZ3A 1URNA 1HYSB 3QO9A 3X1LB 2OPRA 3I4PA 5D3GA 4C7QA 4ED5A 1RT3B 5L8RC 5HVHA 1S48A 2FJAB 4WIQA 1U2CA 3OHAA 2OJ3A 3DM2B 1VLOA 4DV0J 3ZZOA 1LWXA 2O67A 1LWEB 4UZCA 5RUBA 1XMQJ 4BDPA 2V8HA 2MZJA 4H4KC 3DM2A 2VG6B 5E7OB 4EYHB 1NJXA 2CDQA 4OV6A 4MFBB 4LJMA 4F4XA 1KHWA 1WSVA 1X4HA 4HDGA 2C2RA 4NI2A 2MQOA 2IJRA 3H5SA 3PIOQ 3LQVA 2GV1A 2FJDB 4MFBA 3J7YI 4F4KA 1FF2A 2OEJA 3N6MA 1UEUA 1LFWA 1YJ7A 3MPDA 4NI2B 3G82A 3HT3A 1FRIA 1NB2A 3ZTSA 1N5YB 4B3RF 1NSKL 2GO8A 2NYHA 3CJRA 1Q7LB 4ZCIA 4DG1B 2E29A 4M8LA 4DV3J 2F4VJ 1NPRA 1LW2A 5KFLA 1KDNA 2DH8A 3AT1B 3MCSA 4F3MA 2GQQA 4LSZB 3J7A1 2RJZA 4JOUA 3VAIA 3C19A 3MUTP 4GVLA 2EPIA 2JEFA 2UUBF 4EGLA 4RW6B 2CJXB 3CE8A 3W9IA 3RW6A 3D9BA 2YNHB 3RB4A 3Q24A 1VMBA 4X4PA 5J2MA 1NPPA 1RCXB 1UW9A 2MHEA 3M8PA 2LXFA 2ZKUA 2K3KA 4M5DB 2QYGA 1ZAVA 4ED8A 1S1UB 2GC8A 1RWOB 4CLSA 1IWGA 4IRKA 1FRJA 3NNAA 3TI0A 2HBRB 1DQ9A 1U45A 4M5DA 3UI3A 2YX7A 5KFSA 3KLFB 3KOAA 1C1CA 1P8GA 4R0JA 3CO0P 4YB1P 1HNVA 1SV5A 4ZPVR 4NL5A 2I5JB 2VFTA 3HSGA 4AQYF 3DCAA 3BN7A 1JLGB 1UPPA 2YKNA 4EUVA 5I42B 3V6HA 1K1QA 1TV6A 1LKZA 1U7LA 2UZAA 1DLOA 2GJ2A 3CJQA 4FN5A 1AUSL 3BO3A 4IRDA 2BW7A 2F7VA 3KFWX 5KFKA 1JLGA 2YKNB 1O5JA 3OHBA 3GR0A 1RA7A 2CXEA 2RF2B 2B4VA 5FLXU 4DUYJ 3P45B 4DUYF 2D3OR 3NBPB 3H5UA 3GV8B 1TMMA 1S57A 3TJAA 4DDFA 5AE1A 2A6OA 3FCWA 3CCSS 2LEBA 3SCKE 1C1BB 1B0VA 5KFUA 4CWBA 3SXLA 3NAHA 3VAGA 1FJ7A 4IQXA 5KT4A 4YUDA 5MLCV 2CPHA 3C66A 5IV4A 1NK5A 4H54A 4ES2A 2F5GA 3H40A 1Z1ZA 2AJ1A 2KYZA 5KFCA 3NG8A 1H0HB 4F3OA 1S1TB 2KXFA 2RRAA 4DL2A 1RTIB 1VJQA 3A12A 5A6WA 3E8OA 3I55S 3CCVS 2ZOGA 4B9NA 3LTOA 1BLUA 2KO1A 4KGVB 1UP1A 2RS2A 4ILMA 2XSJB 4I6YA 2BANB 2V63A 3DRRB 5BYQA 4J9QA 1WF1A 2QA2A 3BO2A 4B3MF 2XNRA 3K89A 3VAHA 1NEEA 5DG9A 2XGQA 1W2IA 3EMTA 3JQJA 4PABA 3AA9A 1X0PA 3RZAA 4DFKA 2CVEA 2XO7A 2R8JA 4XIUA 1FKOA 2E1AA 1HWUA 3MEDA 3QYYA 3R7SB 3AQPA 1E6VA 4RL1A 4X66J 1L3KA 2BE9B 2RE1A 2NZ4A 5IOLA 4WBFA 3NS6A 3NXZA 1QE1B 1HHTP 3AA8A 2C2ZB 2M88A 2CWXA 2IRXA 1LWFB 1SJFA 1VQ9S 1XNRJ 1RHJB 3NMAA 1LXJA 1L3UA 3CJ3A 1S9FA 3TA2A 1KQSR 2IA6A 1MSWD 3FZ2A 3HHLC 5C7PA 2H4WB 3ADAC 1SUQB 1D9FA 2ATCB 2JJ4D 3PRBA 4KC5A 1RHUB 3OXFA 4DFMA 4HLBA 1GX6A 2IHR1 3UQSA 2KL8A 4M5HA 3B54A 2IFXA 3DDNA 3V81A 4NLXA 2QC3A 4ZITA 2KZMA 2FVCA 1JQGA 3GCWP 5LSLA 1HI0P 1X4DA 1PBUA 3EX7B 2DY1A 4TY9A 3KJFB 1UWAA 5DLFA 5HL7Q 2DIVA 4KO0A 1Q0NA 3PO5A 3B4MA 3J81j 3R2DJ 2R7RA 1R0CB 1GMWD 3FBBA 3LPYA 3QIPA 4ES3A 2NUUG 3ETMA 3DRYA 4IFVA 4CLPA 4F4AA 1TKZB 3UW1A 3JQKA 1ZETA 3EXCX 2CQ1A 4DL5A 2RHSB 3M2UA 4QYRA 3AXKA 1SL0A 1N88A 1RT6B 1WG1A 2AYGA 1DFDA 3AD9C 3HD2A 1BMQB 2EFNA 3A13A 4J91A 2DNGA 4AYBD 3IO1A 2J6UA 5J1NA 1IN0A 1VISA 4A8XA 2R8KA 3A3OB 2AHOB 2AT1B 4OYMA 1GH8A 2BM1A 4ETXA 5F8MA 4RNFA 1TL3B 3W5XA 2IM1A 2PSZA 1HWKA 2IVFB 1KD1T 4PXDA 3K5OA 3FDSA 3KK3A 3O8WA 2IC3B 1O51A 2C22A 3OJSA 1U48A 3KXDA 3HT0A 1XERA 4Y2AA 4OX9F 2HG4A 4CLLA 1UPMB 3TX8A 2V0NA 2J7UA 1VK8A 1V3ZA 3I31A 4YEAA 5ETPA 2BKNA 1FESA 1FE0A 2VBXA 2VFVA 1C4AA 4Y2KA 2B5JA 2CAJA 1JJCB 3EGNA 3BQ1A 2HHVA 2MY8A 1N0VC 2KB2A 4B08A 2H1YA 3J80Y 2W9CA 5B09A 1I51B 4KGKA 3H42A 4EI2A 4EBDA 1TUGB 2X1FA 3EZ5A 3DRPB 2PMHA 3M30B 4LF1A 5A8KA 3N0VA 1XJWB 2C3PA 4WPAA 4C8OA 2QV6A 4C98A 2K3IA 2RVJA 2Z30B 4QIWD 2D41A 5B0DA 3W2WA 1HBUA 4K2XA 1KLNA 3NKYA 5L1LA 4J9UE 3ILJA 2OP5A 3OTEA 1Y5NB 3PACA 2BMBA 5M2RA 1AZSB 3M32B 1ZM2A 3PRDA 2KKHA 2DISA 3GCXP 3U02A 4C0HA 2D3UA 3LWMA 2VJUA 1NK8A 4PUOB 5SUHA 3P96A 3DGPB 3TWZA 2IYIA 2MJNA 3KWMA 2XC9A 2XGPA 4DS5A 3L4BC 3MEKA 2J7KA 2V6AA 1X4CA 2W9BA 4A8YA 4JV1A 3QATA 2KHDA 4RU9A 2K06A 4RU2A 1S97A 2E7VA 3OV7A 2XMMA 2EBEA 2P9GA 3Q2SC 3KHLA 5J2QA 4JI3J 2E66A 2G2ZA 1UEKA 4EBEA 4NA1A 3QSYB 4RW4B 2PE8A 1WOSA 2OGUA 2VU5A 2LXIA 4TLRA 2VQEJ 2RB7A 2VA3A 1QLNA 2HVIA 4A8WA 1KC8T 2A0FB 2MKYA 3WIVA 1FFWB 3TAMA 2BYCA 4KV8B 4HHUA 1RT1B 3LH2S 3TYTA 2KXNB 3LAKA 1VDHA 5EWGA 3MMBB 5EUHA 3T41A 4B9SA 4DPYA 4ILLA 2XY6A 3TAMB 1VGYA 1WC4A 2UV8A 1MU2A 2KM8C 3AJ1A 2V94A 2YXLA 5GMDA 4DV2J 3PFOA 4TY8A 2R7TA 2BOAA 3DHXA 4MKVA 1UETA 2GJIA 4ID8A 1NSPA 1XN9A 4RLEA 4ZVEA 4O3NA 1ULRA 3W63A 2K7KA 4PG8A 2MDAA 3RAXA 3POTB 2JDJA 4DV6J 2Q79A 2EVZA 1U1QA 2UVUA 3FGVA 1YX2A 3UN5A 2ASLA 1SC1B 4U7UK 5EN1A 2R2SA 1OQ6A 2AWZA 4RBUA 5EGYA 5L1JA 3CJ0A 1GTEA 2LLZA 4DSJA 3C16B 5KT2A 2QSWA 1V6HA 3TZYA 3O2IA 1RT2A 1DTQB 1MNEA 4AXIA 5EX0A 4DPUA 2OPQB 2DNKA 2NSBA 3IP0A 1ZA2B 5A8WB 2MYFA 3A3NB 2JFKA 4XAKA 3GV5B 4WFYA 3T5KA 5D78A 3GIJA 4ZCLA 4U7UD 3IR6B 3O6QA 4FPRA 2O1PA 1HBOB 3A8IA 1FWKA 5KFTA 4A47A 4U95A 2VG5B 1RKIA 3IG1A 4U7CA 3A1YG 4UT4A 4DSFA 1X9MA 2CQ4A 4YDDB 4X62J 3F41A 4N8OA 4CIOA 3CDAA 2M9KA 3MM5B 3CF5Q 2O01C 4WFZA 4ITSA 2A1BA 2LQ9A 4DI6A 4ZPCA 2Y8WA 1N0UA 1FD8A 3OFEA 4LSLB 4PPDA 2IA0A 2WVFA 5LMUJ 1XR6A 2YY3A 2HGMA 1FFSB 2LQBA 4C3MA 2LU2A 4WTYA 2BV3A 4CLTA 4J9PA 4PAAA 3HCXA 4HACB 2OLWA 2WW4A 5AT1B 1NKEA 2HHXA 3UD3P 3G9CA 3TEHB 1TL1B 1QTMA 3ILIA 4AUKA 3LP0A 1LK5A 9ATCB 5H1SV 5KFPA 1S49A 1UWBA 2VODA 1JIHA 3R2CJ 1RAOA 1JLBB 1JK9B 1S6UA 3MAAB 1SV5B 2P8IA 1U1RA 3J7ZT 3C46A 4OX9J 3GG1A 3W65A 1NHKL 2G2YA 2CVIA 1AA1B 4PG4A 2FLNA 2AMCB 1BQMA 1PAEX 1IKXA 1H7WA 1S9EB 3I0SA 1S6OA 3L9ZA 2WOMB 2FC8A 2AZ1A 1S1XA 1UJ4A 4N7TA 4WXWA 1RAFB 4JI2F 2LQJA 2I5JA 2N4CA 5E3PA 5F8HA 3CMES 3CULA 4HEA9 3KUEA 3MAHA 7FD1A 1S1WB 2P5VA 3BKFA 1PYSB 1DLOB 1F5AA 2KFNA 1U0HA 3R6LB 1UZDA 2IYGA 5IM0B 4F4YA 3IGNA 1HARA 5ADZA 8AT1B 4U67Q 2MGZB 3KK1B 1T03B 1CJTA 4KE5A 4CTAA 4ELVA 1RT4A 3I87A 4WZMA 3K7RA 2BBEA 2B4OA 1DTTA 4P73A 2EW9A 3CCJS 2C2NA 1AB8A 2E1PA 3ZZRA 2W2PP 2G9OA 1YJNS 2BQUA 3MHYA 1HW9A 4PCQA 4LF9J 4CO4A 2HQFA 2LECA 1PILA 1RB0A 1ZM3A 2YNFB 1GTHA 3PYFA 3CCES 2FQQB 3JTOA 3ZO7A 4GO5X 1H98A 2RHQB 4WP3A 2CPEA 1HQEA 1TP7A 2CQCA 4K0KJ 3BN4A 3RBZA 2ZC4A 4OFZA 3CCRS 3HO1A 2FZKB 1M1GA 1EX8A 4KRWA 4EU0A 2MB0B 1OPZA 1JKHA 4DSIA 2ZC3A 2DVIA 1UZHA 1NH7A 1IR0A 5K8NA 2BXJA 5DRKA 1HWIA 2FLPA 2HQIA 3CEDA 2AJFE 3EJMA 1ELOA 2WW8A 5ETMA 5C42A 1RTZA 1W26A 2V50A 2K7JA 3N5FA 4Z2XA 1QAJA 3TR5A 4YHHF 1AW0A 2HWHA 3RYLA 2HNDA 1D8ZA 1NH8A 1SC6A 2FZCB 4TY8B 2OUGA 1N5TA 1WI8A 2KRBA 1Q86T 2VG7A 3MR3A 3MMBA 1CVJA 3O5TB 1VBYA 2HNYB 3ZZPA 1HYSA 4JI0J 1HD0A 2XYHB 3NEKA 2YH1A 4L6V3 5F8GA 1NHVA 2X7IA 1T0TV 1JB0C 1JLFB 2RUGA 3B8HA 3IBCB 3EWGA 2KJVA 4AL6A 4DR5F 2EG2A 4ANEA 3QJPA 2ZD1B 2QLXA 2HHSA 1FNMA 2HLTA 3C8YA 4CYUA 3AHPA 1BQNA 4DR3F 4LBIA 4X4UA 2DNHA 3KMQA 5ETTA 3D1QA 1RTDA 2CZVC 2C1EB 3BS9A 3DOKA 4BBYA 3M4XA 3MM6B 3VGUA 5FJ4A 4ZVTB 5IC4B 4DN9A 2G0JA 4ZLLA 1SQFA 4HHJA 2ZBCA 4KAIA 4RW9A 3R9LA 1P1LA 1MW7A 2QL7B 2ZNYA 1YJTA 4F2SA 5LSRA 2W1BA 2DRBA 3OJUA 1R8PA 2JEJA 3BV8A 1EKRA 4YN3B 4BWMA 3R97A 1VQPS 2LQ8A 5C24B 3M9MB 1YITS 2FZGB 2GMLA 1NUEA 1U2FA 2CQHA 2V5HG 2DEJA 2ZZMA 4MKAA 2MMYA 1IKYB 2B51A 3ISND 3UCGA 4WK1A 5C24A 1GFWB 1WC0A 1YBTA 1ZTWA 2WZ1A 2ZFHA 3AJ2A 2QLWA 1HQUB 4IQMA 2BOPA 4P75A 1HI1A 3LAMA 3DLHA 3FBFA 1DQ8A 4IG3B 4O44A 3R5AA 3BR8A 3NGUA 1WNEA 1ITPA 1S6QB 5A8RA 5HVFA 1TK8A 4M5NA 1F9FA 2ZJQQ 2H5JB 1OSDA 5EWFA 1GMVA 1KR4A 1RU2A 3G6ES 1XTZA 2DPIA 4X4RA 2R7OA 3M8RA 3G6XA 3HKWA 1UVJA 2MLYA 4N77A 4OZ5A 3DLKA 4ANCA 3MD1A 2HVZA 3QJJA 1APSA 3RBDA 2CJKA 4V19X 4CP5A 5GADU 3HM9A 2RQMA 4IH5A 4ZVGA 2EC0A 2IY5B 5IM0A 4X2BA 4HHHA 2FJBB 3NBPA 4QOTA 4P7VA 3KHGA 4LF4J 2VKRA 2I1RA 2GQCA 1JWWA 4WFNQ 3ZNUA 4OI6A 1FKPA 4M5MA 1WC5A 3MF5A 3K8VA 4XDCA 4RNNA 1YK9A 5KT3A 1T9TA 1U0SA 1MMDA 2WHOA 3M6UA 5FDLA 1M5OC 1VIXA 4LRFA 4X64J 3QAEA 1ZBTA 4C3LA 4ETZA 3NNHA 3T9NA 5DDQC 3SDEB 3VAMA 1PAUB 3F44A 4ZLNA 4RUAA 4EZ6A 1JJ4A 4QU6A 2CIMA 3AB4B 2ZEJA 4QYZK 4R0EA 3BF4A 3WX4A 5DGAA 1WSRA 4L3NA 2QRRA 4RJVA 3WC2A 2HBYB 1U24A 4AD6A 4L74A 4LVOP 4QIEA 2H48B 3R27A 5J1EB 1CC7A 4MMOA 3SV3A 2HFVA 2R42A 3DGPA 3MGJA 3TUJC 2BJ1A 5KFJA 2JEIA 1N36F 4ECTA 1IM4A 1YRXA 5D8HB 3SQOP 2AP6A 1NDKA 1RADB 1IQTA 2ZVSA 1JXVA 1S77D 1HQEB 2JFDA 2J0WA 1Y5IB 1T9XA 3JYTA 2DJWA 4YQWA 4DR2J 1IBCB 2M3DA 1EETB 4ECRA 4NRTA 4QIGA 3CDWA 2W01A 5DGBA 1HHQA 1FDBA 1T11A 1TUWA 4L72B 3NAIA 4OZNA 3H59A 5J2PA 1UL3A 4QYZJ 1VR6A 4OLPA 1RTHA 1SKWA 1U49A 4CQ1A 4X84A 3HHKA 4NZ7A 1FJGJ 4J90A 4F0HA 1ZOTA 2UV8G 1WEYA 1AYEA 4AL7A 2DCLA 4K5SA 3POTA 3TZWA 4E98A 2W8LA 1U1NA 4YB6A 2HRYA 3U1LA 5DM6Q 4JI8J 4O3RA 3OSPA 2QZ8A 1MU2B 1VIOA 2B56A 2QYCA 2F65A 4W92B 4NXNJ 3GR1A 3NP5A 2KH9A 3M6VA 2Y1IA 5THWA 2BA9A 1KRPA 2GQ2A 5L9XA 2M4MA 5B0FA 2FHMA 3UVJB 3N28A 2HK2A 5DJBA 4KSEB 3HVWA 1VRUB 4OYPA 4FKYA 5HMZA 2FVQA 3J80U 2RDIA 4NLUA 3MR2A 1X4EA 2L48A 3BPDA 3ZZ0A 2J7WA 2IJNA 1KLMB 2AX0A 4IYQA 3SFUA 4R8UB 3HKZD 1PSDA 3BKTA 3NCRA 3K8WA 2N7CA 1KS2A 4TU9A 4K4WA 1SJ3P 2QIFA 1M5PC 2DNNA 3NGDA 1M1HA 2LEAA 2NUHA 3CIZA 4TU7A 2RDJA 3VAFA 3OQ2A 4NOHA 2UUBJ 8ATCB 1TAQA 2LDYA 1X4GA 2VIHA 2I38A 1R0AA 1SH3A 2J76E 2NREA 1RACB 4FXDA 2O3DA 5HQ8A 2VDHA 1YVFA 1KWMA 1BGXT 3DGVA 2V4JA 2F3JA 3M1VA 1NK9A 2FJXA 1SKSA 4B3TJ 5ETVA 1U1PA 2B6AB 2OKQA 2UUCF 3G71S 2AYMA 3S7RA 1FDDA 5LL6d 3GV7B 4DR1F 4N41A 2WSEC 3H20A 2NXUA 3S8SA 1FT8A 1K8AT 1KTVA 3B82A 2EKYA 2K8GA 1O0PA 4FPIA 3PYDA 1LK7A 1BUXA 1I94F 2XHWA 5HJYA 2VC1A 4K4XA 3DC2A 2ZH2A 2DXEA 2CADA 3Q8RB 3GWCA 2VHGA 2NXJA 2JLGA 4NCBA 3VZHA 3N4WA 4K5RA 5I42A 1IKXB 2GO9A 3I0SB 2DGVA 3K17A 4TU8A 5LMUF 3PW4A 5HSPA 4N47A 3PTWA 2YQ3A 4CTAB 3H0PA 1A6LA 1OY9A 5DDRC 4LMZA 1JXLA 3MR7A 2DD8S 5KFWA 5T41A 8RUCA 3MM8B 1SIWB 4I68A 5GMKa 3H2LA 3MEEB 1S72S 3PKMA 5A0YB 2CJ9A 1YTYA 2VFRA 3ET6A 4EO8A 5FIIA 3OVBA 4C8ZA 4R5PA 1IVZA 3VALA 5E41A 4M1KA 4CM2A 4MK7A 1FXRA 2CPZA 4K50A 2XSJA 4B9UA 1AZSA 3M32A 1S1TA 2YPZA 2XS5A 2ROEA 1WKKA 1RAAB 4YY3J 1BD6A 4Y34A 3N01A 2APOA 1RTIA 5E2QA 1QAIA 3CCZA 3KLHB 1MWQA 2EFOA 2DHAA 4NYOA 5E5NA 2W9BB 5DQGA 2MSSA 1FKOB 1UFLA 2YWEA 3D5MA 3MEDB 3TVKA 2XQCA 3GE9A 4QWCA 3RBXA 4B9VA 5L39A 2PN6A 4USJC 2UXCF 5J2QB 3JTPA 4W98A 4P2MA 2EBGA 2FJEB 5EDWA 2GVDA 3GSIA 4LIWA 1GNKA 4J9KA 4ECXA 3GYNA 6FD1A 3RB0A 4QBUA 2F9JA 1N8RT 4CO5A 4GVBB 2B8QA 3A4TA 3E51A 1XQIA 2A10A 5EX3A 2QJ3A 2ZE2A 3CCWA 4AXJA 4LR7A 2MKKA 4QZVB 5CYQA 5KFEA 1NK6A 4LF5J 2R7QA 3T19A 4O4GA 4ZPDA 4O3PA 1ZM4A 3ULHA 4DR7J 4JI6F 4P71A 4J9NA 5GAHU 2QFIA 2AU0A 2GCFA 3P49B 1RHMB 4K0KF 1CULA 3H2UB 1R8BA 3A8EA 4LF4F 4XK8C 2ZD1A 5JUMA 3C16A 2JX2A 4JYAJ 1F9HA 2M7SA 1T9YA 2RU9A 1VFJA 4PWUA 4URSA 1CULB 1JJHA 4QIFA 3V81B 3UWTA 1X9WA 1CSJA 4NEYA 4C0BA 4TVAB 2G1DA 4ZVPB 5F8IA 5FLXY 3CJTA 1KLMA 2BJDA 1R0BG 4NCGA 3TA0A 5DG7A 3R1HA 3BH7B 5CZVA 2BRLA 2W25A 4LRAA 4DZ6A 3DLGB 2V67A 4P2SA 3AXMA 3RW7A 1RT7A 3CXCR 3HDSA 2IM2A 2WVEA 1NO8A 4B3OB 4OHYA 1IR2A 1RK8A 3LOUA 4IDKA 4QJVA 1PCAA 3BZQA 4BLGA 1SCJB 3N6LA 5AXLA 1UAWA 1X5SA 5C2CA 3ILOA 3QT6A 1IXKA 5KG2A 3G6YA 2DCUB 4CDIA 4F36A 1OYDA 2Y1RI 2MQMA 3ZZUA 3IAS9 3PR4A 1N5YA 2D3ZA 5IT9Y 2HNZB 2CNOB 4NLPA 4A8QA 4UTGA 1WHYA 2BJ3A 3BSAA 4HL9A 4ECVA 3I0RA 4C8YA 5T14A 2HNZA 1OYEA 1CQMA 2GFFA 4IUFA 1M5SA 1EIYB 5AXNA 1TL3A 2W4DA 5KG0A 4ID5A 3QGGA 4YHHJ 3V4IA 2HSEB 1QAYA 2ZH9A 2KDOA 3TAPA 2ALYB 4ZJOA 3RB6A 4DQPA 1AFIA 1WC3A 1CJUB 1JLCA 1C0TB 5KAKA 1DJ0A 1U1LA 1XBWA 1U26A 2EI5A 2GGPB 1RBLA 1SPBP 3J81Y 2HVDA 2W9CB 4PG7A 1EJ7L 1K1SA 1ICEB 1Q8KA 3DN9A 3CJ8A 3FJ2A 4DN0A 2FPHX 4P72A 4UOFA 5CABA 4UOHA 5KG1A 5KFFA 3CCUS 4E2FB 2OAUA 2MGZA 5D4PA 1CJTB 3ZXWA 1N5SA 3QRRA 1YWXA 2P9CA 4OYAA 4PZVA 3KG4A 3OL8A 1VQMS 5KTQA 2MZSA 2MSTA 4PR6A 4NCAA 2CQ3A 4XPEA 2HYIB 3IA0A 2OPPA 3CNQP 3CC7S 2DRDA 2F8HA 1UVMA 2HQGA 3FEXB 3DOMA 4A48A 3BBBA 1YSJA 5A2QU 5IXUA 2GMJA 3C15B 3MMAA 3KK2A 4H4KA 1G4CA 3PR5B 1PIEA 1PKUA 3NMRA 1Y7PA 1F5BA 1JLQA 2CJYB 4QPTA 5J1PA 2CZ9A 2PA3A 4MYUA 2OFGX 4BCAA 4DL7A 2R7UA 3Q8SB 2XHCA 4CLFA 3M2RA 2RMLA 4DFPA 1MWZA 3TZXA 2DIUA 2QMXA 1VBXA 1MG7A 3LWLA 5J2PB 1X7VA 4EK2A 3I96A 1RJJA 2N3LA 4K4UA 2VH7A 3M6XA 2KVQE 4Y3CA 2NS1B 1SKUB 1FE4A 3L95X 2R3VA 1HNZJ 3LA0A 2MQQA 2POKA 4GMKA 3MD3A 5H9EJ 2CQDA 2KTQA 4QQBA 1HBMB 3R5JB 4F4WA 4W90B 4P2XA 1VQSA 3V6DA 1YJVA 4JUZA 1WJ9A 3C14A 1J5OB 2FD2A 6AT1B 5HP1B 1N33J 3C6UA 4ZVOB 1TL5A 2YWWA 2VKZG 2PT0A 3CJ2A 4G1QA 3KJVB 3CPWR 4DV4J 1GK8A 5CA5A 1G2EA 4IRCA 3HXMA 3DYAA 1VQNS 1QTNB 5D0RA 3Q89A 1TZ0A 3WZ0A 4DL3A 4DL4A 3ZTRA 3SV4A 3EZOA 2J9CA 1IWAA 1RLDA 2HNYA 2LP4A 2RSQA 4KGXB 3VR1A 1DAXA 3WHIA 4CO3A 1WF0A 4DLGA 2UVWA 4OZLA 2OTJS 3CJ5A 4RX6A 2DKOB 2XMTA 2DGUA 3DOKB 2G0IA 5U47A 1JLFA 2MY7A 1O6XA 3TO8A 2Y8YA 2B9EA 1XR7A 1T9VA 1REVB 4LFBJ 1EAYC 3G8QA 4OJ3A 5CXTA 1NSQA 3U1MA 5KG3A 2ZHOA 2EC2A 1JJ2R 4I1TA 5HROA 1OO0B 1R43A 2BE2A 3HLUA 4NLOA 2XG8A 4PQAA 4CI0B 3BGLA 2MZTA 2WRMA 5KFGA 2YWGA 3GJQB 4Q5VA 1CJKA 1KFDA 2RQCA 2DT9A 3ITHA 5DDPC 3FFIA 1W25A 3KJQB 2KN4A 2W4PA 2VF3A 2VDIA 2XTJP 3JTNA 2DR7A 1F0XA 3I0RB 3I32A 4MK9A 4MKYA 2GVZB 4OI3A 3GYGA 1XMQF 5KFOA 3MCMA 4RBVA 4ID5B 2KU7A 3K0JA 1BWVA 3UD5A 4NLWA 2VZ9A 5IFMA 4C9DA 2ALZA 2VOOA 1FCAA 1FVQA 4ICLB 2DNMA 4ZMMA 4YOEA 2EG1A 2B4UA 3HP6A 5I4MA 1TAUA 2F8MA 1V3SA 3SCLE 2M52A 4ICLA 2DHHA 1BQXA 4M5GA 1UMJA 2CPDA 3EE3A 2CQGA 2C3UA 2LYVA 2X1BA 4WJBA 3LGHA 3PJWA 2L41A 4DV2F 1TUVA 2Y3YA 2HHWA 1SJRA 1X31C 4HT5A 1VS3A 3DRSA 1S76D 4ERDA 1A7GE 1REGX 2AKWB 2KT3A 2B8PA 5HAOA 4XO0A 4LFCJ 2VD3A 1PG5B 1UVNA 2D69A 2KI2A 4RWWA 4FNIA 4FS1A 2BX6A 2AZ3A 3K57A 2XY5A 2B9XA 1S1WA 4J7CA 5GAEI 2FVSA 2HVHA 4IR1A 2OMOA 3KLVA 1WKJA 2VUGA 2GIQA 2BM0A 3DRPA 3HSJA 3M30A 5A8KB 3H4DA 5HANA 2RH3A 2FTRA 3PNIA 3UE2A 1G6BA 2W4CA 4ALZA 4LRDA 4DCJB 3L7UA 1HNZF 3KHRA 3EM1A 4DR6F 5JVHQ 4DR6J 5AJ3J 3GPAA 4G1PA 3T5LA 5E3QA 3BYRA 3EICA 5HJXA 2PFFB 2EKNA 4DR2F 2HW3A 2YWFA 1QAXA 2HRUA 4IG0A 3UCUP 3QZ7A 3VGSA 2OPSB 2RKIA 3T1AA 5DZ6A 1QSYA 2CUYA 1JXEA 2ZJRQ 5CYJA 3MMCB 3I4HX 1HQ2A 5B7WA 4B3SF 2QA1A 4JI1J 2VFUA 1FX4A 1WUUA 1NAQA 1DY3A 1FVSA 1NJYA 3BH6B 2DXDA 3SSSA 2E5IA 4DPWA 1NZAA 3P5BP 3R6GB 5IQQA 3D0GE 3MDFA 3BDPA 4OV1A 3SQGB 1IKVB 3PX4A 2DPJA 4WF9Q 4UW2A 4NPOA 4JV5J 2GHVC 2A18A 2ZDPA 4LBHA 2UVRA 4C3KA 4JYAF 1X4AA 4ED6A 1VQ5S 4OYWA 5HMYA 1RTHB 4TN2A 2CJAA 1OMSA 2G0CA 3JYTB 3CTRA 4J9RA 1N6QB 2ZITA 1J5OA 1TL7B 3EZUA 1VRQC 1KKHA 3GFXA 2IMOA 2KM8B 1ZZFA 4DWIA 2ADCA 2R7VA 3LUYA 1TFWA 2F8EX 5ITHA 1B4SA 4AQYJ 4MKBA 1GMWA 3HFVA 1QD1A 1Y4ZB 4U8VA 3AOCA 1RQ0A 3CDUA 4KFBA 4IO1A 5K14B 2W7OA 4Y2IA 2V2VA 4DR4J 1NM2A 2DH9A 1EP4B 7AT1B 4DX6A 2HKEA 2HS0A 4LREA 2CFXA 4OYZA 3SMZA 3MPVA 2KFYA 3CD6S 4IFYA 1KFSA 1VQ7S 3LO3A 4NLGA 4WKRA 4DSLA 4KBIA 5DO2A 2HWIA 4UUXA 3DFEA 2LU1A 2C2MB 4FVCA 2ZH7A 1WHVA 1SVDA 1VRUA 2L9DA 4QR2A 1TKDA 2HIQA 1WF2A 4DX5A 4X4VA 1H2TZ 5LM7E 4TXSA 1URRA 3A3PB 2P9EA 4YMEA 2BQ3A 5LJ5Y 3MPWA 3HF5A 1RHKB 4HTIA 4OYBA 5C25B 3OTOJ 4HH1A 3H4BA 1Q8BA 3IBFB 1IBLJ 1NCLA 3FSYA 5D77A 3HPOA 1RGVA 2J8AA 5H9FJ 2EK6A 2V4JB 3M1VB 4I7FA 4ZCKA 1TKXA 5HN0A 1GAOA 3CJSA 1T95A 4DQSA 3GJSB 1U02A 5J2MB 5D4LA 2PFDA 1N56A 3CIMA 3QBCA 2YKAA 3JSYA 4LSLA 4C2MA 3LP0B 4E8UA 4B17A 1SC4B 4A8KA 4FBUA 2ILYA 3IWLA 4HACA 2MJUA 4I4BA 4U96A 2RAQA 1U6BA 4ZP7A 4M95A 2HPUA 2V9WA 4A8OA 3QGIA 2BR0A 4PXBA 3SCJE 4NASA 2RS8A 2ZH3A 1F6TA 3AD7C 3B6BA 2DR5A 3GQCA 2JLEA 5T7LA 5CYMB 4F3QA 1NB7A 2J0SD 1M5KC 4Q0BA 3FBCA 3Q86A 4IO9Q 2QLBB 3DXSX 2AGOA 4GKKJ 3EVMA 1FERA 3L7PA 4CO1A 2HWTA 3OLBA 3KLGA 4K4TA 1VQLS 1UJ5A 1S1XB 2Z2ZA 1R6VA 1FA0A 4FNHA 2J0QD 3PW2A 2LEPA 3W64A 4KHPJ 2DNQA 1YIJS 3M8SA 2RF2A 4DX7A 2HHPA 1MROB 1FKPB 4P2FA 4OQJA 3FZBA 1DZ5A 1RYRA 1HNWF 4Q8FA 3HK2A 4Q44A 3OL7A 4QR1A 2Z58B 4RUHA 1S6PB 3RAMA 5BXIA 2ZUAA 1WOOA 2CG4A 3EDQB 3MCNA 3UDLA 2VQFJ 4DUZJ 3Q83A 1HPZA 1R6YA 2XB2D 3D0HE 1R8AA 1HWLA 2DK2A 4NWBA 4DU8A 4Y28C 1HPZB 1S0OA 4LVNP 2GJFA 1JKHB 3G6VA 4ZDNA 5K20B 1IBKF 4JI4J 1MN9A 2ASDA 1RWVB 4QCLA 3BB5A 1KNZA 3RB3A 4K4VA 4KGMA 1LV5A 3DRRA 2HHQA 2ZWOA 5F8LA 4QW9A 2OSRA 4NE9C 3IR5B 1ACMB 4KB7A 5ETOA 4J9SA 4I2PB 3BSOA 1XWLA 4RW4A 3W66A 3HHNB 3ENVA 3NLCA 4FYXB 4HYKA 2YKQA 2DITA 4CLWA 1S5ZA 5KFIA 3Q22A 1EQMA 1NSAA 1FEEA 1I94J 3M8WA 3MAQA 3CCTA 2Y0SD 2OPRB 2LA6A 4O3OA 1G1XA 5KFRA 1T9WA 1RE1B 3KLEB 5LJ3Y 5D4OA 3RR8A 3ISNC 2E5HA 1FO1A 5D15A 1FK9A 3M9NB 3FUYA 2ZUGA 3MM7A 3UVJA 1BQNB 2E1RA 2BABA 3EUNA 3PX6A 1SL2A 4RUBA 3X3UA 1OJ4A 1I1GA 3N6NA 5JVGQ 2VG6A 1REVA 2WSFC 4OYOA 2KFZA 3QWUA 3LALA 2WAQD 1U47A 2BE2B 3MOJB 1J27A 4IFYB 4FYDA 3MEGA 3PV8A 2ASJA 4WKYA 3BR9A 2BRKA 3H25A 2QLJB 3CD0A 3Q8YA 4F26A 1FWLA 2ZZTA 1C0UA 2OD6A 2VASA 2V2KA 4QPXA 1KONA 4WWSA 1JX4A 4NLDA 4ZPTR 3JSMA 2J9DA 1JLEA 3OR1A 5CHCB 4CNYA 2HZVA 3HHEA 5C5JA 1KQKA 2EFVA 2M8HA 4MT1A 3WIUA 3MM9B 4Y2CA 2BJ9A 2DGXA 3H8YA 3M8QA 2HFOA 5EWEA 3DRXA 5F0UA 4Y00A 1LFPA 4CH0S 4ELTA 3IAM9 1S7HA 3GILA 1UWBB 1YRUA 4O0IA 1EQ0A 2XYGB 3BSNA 3HVAA 3V4MA 4WTOB 1SJ1A 3DNCA 3GFZA 5I3QA 4WU3A 2DGOA 2YTCA 4IKAA 2FYXA 1UEVA 2PI4A 3QPIA 1Q79A 3MTJA 1N5VA 4USIA 3RTVA 2D9OA 4KYZA 4CO0A 4UY85 2NXEA 3M8ZA 3G4SS 4UQGA 1KHVA 2QMWA 3OD2A 4ER8A 5HLFA 1AXQA 4CZCA 4QWAA 2HZAA 1W7WA 3M2VB 1VLYA 7FDRA 2FVRA 3KNGA 3G8SA 3JSBA 4OZ0A 1RU1A 4J9MA 2CYYA 3SSQA 4DV6F 2UU9F 1V5IB 3DKDA 3TNVA 4F04B 4X4QA 1X5PA 2ZBIA 3PCOB 4PKDB 3VZIA 5KFNA 4H4OA 4LT6A 1PYOB 2AJ0A 3HHDA 3GIIA 3W9HA 1RISA 1WDTA 5GAHI 3GFYA 4DF4A 1GEHA 3DOMB 3F73A 2HHHF 1UCNA 4DU7A 2Z4PA 2W2OP 1C1BA 1RZMA 1ZAWA 5G0RA 4WCEQ 1TKTB 3MEEA 1RTJB 2XSFA 3BO4A 3VHQA 4N8NA 3EGZA 2NSCA 2H51B 5A6PA 3OL9A 4PEOA 3OTCA 3FQLA 4M63A 4O0NA 4ZOSA 3EPIA 1OSCA 2M5YA 1UA1A 2MZQA 4X4OA 3G96A 3CCQS 1AUDA 4JI3F 3FMBA 3R3TA 4YDXA 2SXLA 4Z7CA 2I6WA 1RWMB 1SBRA 4GKJJ 4WE1B 1B7FA 3UNYA 4MK8A 3WBZA 1EETA 2LFVA 3OFHA 3H98A 3M6WA 1FRXA 1E6VB 2JRSA 1OWXA 4ED2A 1U4BA 5BYRA 2ZH5A 3QRQA 5C42B 5DETA 1YKWA 1ZTTA 4KH1B 2MQPA 2I0XA 3HHLA 3MR5A 2RQ4A 1KVKA 4ZP9A 1VC0A 2YQ1A 4U9RA 2WK4A 4I2PA 3C6UB 5BJRA 3RRGA 4LF5F 4K59A 5DS7A 4OL8A 2YPYA 4WK3A 5GAGU 1SIZA 4OYXA 1XMOF 2X1GA 3QO9B 2QE5A 1H38A 1XIQA 2K2PA 2VPWB 3D1HA 2F4VF 5L46A 2MQLA 4CCHA 2IDEA 1WEXA 4YB5A 4C11A 3NCQA 2EFGA 3OPKA 4EFAC 2I2YA 1NKCA 2HGNA 1J2VA 2N82B 3ONQA 5GADI 4JI7J 3VQSA 2XNQA 3W60A 1QVFR 2RILA 3AD8C 2PDAA 3TUPA 1Y00A 2C2KB 4ZP6A 4LUBA 3DLLQ 4RNHA 4CNZA 2DHGA 2HIYA 2WB1D 3Q8UA 4IFVB 4MAKA 3UR3C 5GVQA 3D68A 4F67A 3R7BB 4IDKB 3GONA 3THPA 3UDEA 3FMWA 4C48A 1A0OB 1NZ8A 2Q1LA 3UNGC 3GFHA 4B3TF 2ERRA 2FLLA 5M2UA 2HAFA 2I8EA 5HO4A 2RU3A 2VA2A 3DLGA 4OHZA 1X5TA 5IQ6A 4DSEA 5LSOA 2P6SA 4JV0A 3PM9A 5DLGA 4LF7J 3UO0A 4K4ZA 3EGWB 2F40A 5I3UA 2N4DA 5KG5A 3WDOA 3A8KA 3HVTB 3LGMA 4USUA 2ZHAA 4UF4A 4PYDA 3DXBA 3ELHA 2HMIA 4UUWA 3V6KA 5KT5A 1VI7A 4O4RA 1HBNA 3IM9A 1TL1A 4GKKF 2V68A 3M8PB 1YGYA 1UTAA 3OLAA 4DL0C 5E3AA 2ZM6J 2G2OA 4LF8J 2VONA 2KG1A 1PC4A 3IRXB 4QWDA 4LRCA 3JB9k 2H65B 4JI5J 2DNLA 2NPFA 1U6FA 4I69A 1HR0J 4L3KA 1HQUA 2ACYA 3D4JA 2B6AA 1YG0A 4PWWA 3J7YU 2QA4G 5CYMA 1FXLA 4I0WA 4OHXA 5G4DA 1RWKB 4YY3F 1H3DA 3DOLB 4DV1J 2HEKA 3KLIB 3DOLA 3GIMA 4NLSA 4RBTA 2BW2A 1H74A 4PQUB 2OO4A 2NXCA 3W5ZA 1Z2ZA 4EMDA 1FRLA 4PUOA 4L75A 2DBBA 2DNPA 3EXYA 4G3IA 1HFEL 2OPPB 2DR6A 1SJQA 2H5EA 4YR0A 2FHKA 2BE7D 2VL1A 3KYLA 2WB4A 1WACA 1EARA 3BQ2A 2COLA 2F4FA 3Q8PB 3D54A 3OFFA 3L3CA 4LQ3A 1FI4A 3NL0A 4QU7A 1KTQA 1MLAA 1MROA 2E5GA 2QG9B 2DNYA 2R8GA 2DGQA 3K5PA 2KT5A 4DX8H 4EO6A 5IV3A 1YHQS 2XMWA 4MYTA 1FNOA 1MMLA 1LQ9A 1GXLA 4I2QA 1Q81T 3MCOA 4NLVA 4AE5A 4R5PB 4A8FA 4MIWA 1DRZA 1FD2A 2PGCA 5D4NA 4NLQA 3HSZA 4DEZA 5HMXA 2Y1LB 3O3LA 4LSNB 1SH2A 2R2RA 4DV3F 4DV5J 3T5JA 3IRWP 4WYWA 3VVUA 5D0GA 1UVKA 2UUAJ 3BQ0A 4XTTA 5ETRA 4JI7F 1GMUA 3I5BA 3LP1B 3DHWC 2GZOA 4A4JA 2BANA 1X0FA 4RO0A 4RW8B 1T94A 1NXIA 5B0BA 2AJQA 3ENAA 3H2VE 5B0CA 2VPYB 1HBMA 2L9NA 4CH7A 2H54B 4OI2A 4RPFA 4GVBA 1FRHA 5KFVA 5IT9U 4OZ2A 2UUCJ 4LF6J 1HWJA 3W8PA 1N6QA 1DQAA 2GVDB 4OHVA 3G8TA 1Y0HA 2V8DA 1D1UA 3QWPA 1SC3B 4KV8A 4ZIWA 1J5EF 2QSFA 2XZWA 3DLBA 1FRMA 2V2ZA 2R2UA 4OIXA 3C14B 3D6HB 3W2VB 2VBZA 2ZBRA 2FHOB 6FDRA 2NXNA 4JP8A 1SJ4P 3LP2A 2WBMA 1HNIA 3D7SB 4TLQA 2QMUB 1PC5A 4RKUC 4DV4F 4IR9A 4JI1F 2KXHA 4S0MA 2YKMA 3VF0B 1DTQA 3MFHA 4LFAJ 4KT0C 2DR8A 2G4BA 2RIJA 5KG4A 4DZDA 2QL9B 2XWYA 1K9MT 2ILZA 2IVMA 1VQOS 1HR0F 4I6WA 1P27B 4JI5F 4B3OA 2HS3A 4JI4F 1FHTA 4CYUB 1SXLA 3ZZZA 2OFHX 3W9JA 2Y9HA 4NCGB 2YWHA 2VJVA 4DHVA 2C2EA 3MEGB 3SSRA 2C3YA 4X62F 3NS7B 2UUTA 3M8YA 3NWRA 4CRJA 2VOPA 2DTJA 4FVMA 4J9OA 3PDNA 2YKOA 2N3OA 4GC7A 2R7SA 3TVYA 1G7CB 1R7IA 3ZTOA 4E0DA 1FJGF 3RG6A 1CJKB 2WBRA 2BJ8A 4USHA 2GS8A 4B02A 3IS9B 3ILLA 4K7QA 5K9FA 3A8JA 3OTBA 4WU2A 4X65J 2AGQA 4LFCF 1XNQF 4USVA 3G86A 2J0XA 4FXVA 3EVWA 4NMXA 3HULA 4WP9A 5HBMB 1S10A 1RP5A 3HSDA 2HHUA 1FTRA 2PI5A 1IKYA 3UN2A 3I56S 5L1IA 3UCZP 2ATLA 1T3NA 1QSSA 4WZQA 4RW6A 1V5VA 1X4BA 3QAUA 2CWKA 5E0OA 2NPIA 3UDVA 1B70B 4PPZA 2V8PA 2IC3A 2XBPA 4HH0A 3ZZTA 2B5JB 1RAIB 5T7LB 2X1AA 3V4IB 1KEKA 2U2FA 2WSCC 2ZH8A 3CDBA 1F2HA 5BR8F 3MAAA 1DHMA 4KGZB 3K58A 2VBWA 4LR9A 3ZFVA 4DMZA 2XS2A 1GX5A 2MKCA 4P74A 2GGPA 2NCKL 3BJYA 1VRTB 3D2WA 3E2EA 1XEZA 2DHSA 1WC1A 3QLHB 3W62A 3RAQA 1HA1A 1QUVA 2MQNA 3DU5A 3L09A 1NK7A 4BS2A 3HJFA 3NWGA 3UR0A 1B3TA 3FSIA 3LPEA 1S1VB 3L7OA 1IBLF 4M94A 2UXDF 3BSCA 4DCOB 5J2NA 4J5OA 2YNGB 4RUCA 4J9LA
chains in the Genus database with same CATH topology
2VFSA 4NLRA 1WEZA 2AYEA 3TRGA 2IBOA 4XPCA 2FB0A 5K5MA 3OSNA 4Q8EA 1VQYA 2Q6CA 3CT9A 3QGHA 3CJ4A 3Q0AA 2HS4A 4TYBA 2FY1A 4FXWA 3E01A 1DTTB 2HZCA 4TNOA 2XCPA 2DO4A 3PEHA 2VQFF 3V2UC 4P7TA 3DLJA 3KG0A 1T3OA 2D74B 1RTJA 2HFZA 3V5RA 3DDKA 3I5AA 2OPSA 1YQHA 3MFIA 2YNIA 1D0EA 4I2QB 1RT5A 1R8CA 1QSLA 1KN6A 1KVIA 1N32F 2AF6A 2LMIA 1TVRB 1ROFA 3FEYB 3U27A 1UVIA 1RT5B 1TR0A 2A3JA 3D1OA 5EHHA 4RWXA 1XC9A 2B43A 2CJQA 3S6EA 2QO3A 5B0EA 2C42A 1RT1A 2V8VA 2BZ2A 5KOWA 2CQ2A 3NRBA 3I82A 3US5A 2A2CA 1L3SA 1U1KA 1M5HA 3NS5A 1N52B 2B7CB 2E44A 2KYXA 4QR0A 5CYQB 5DM7Q 2GMHA 3OBIA 2OMLA 3C6TA 5LT5A 4PG5A 3LP2B 1WG5A 3AB2B 4OX8A 5DQHA 3C6TB 3HZEA 1KQFB 1PO6A 3CC4S 2YKMB 4GO7X 2J9DE 3W2VA 2OSQA 4C8KA 4KKOA 1F2GA 2JZ5A 2Q43A 3ETOA 5F0WA 1RT2B 5KG7A 1FKAF 1LW0B 1X5OA 3VCDA 1QJHA 4BC7A 4H4MB 1RT3A 2AV5A 4A8MP 4DBQA 3UPFA 3AY0A 1RKJA 2VG5A 2LQ5A 3WC0A 4R8UA 5AJ3F 1T05B 4CT8A 4N56A 4KO0B 1B64A 2IAJB 3OXLA 3CJKB 4IOBA 3BM7A 2IAJA 1M1KT 4JV2A 1Q8LA 1TKXB 1C0UB 1YJ9S 3LANA 3PKYA 4YR2A 3CJKA 4ZVFA 1ZH5A 1JLEB 3OR1B 3OTOF 2RD5C 2CRLA 2GX8A 5K8OA 3NGKA 4QWEA 2PMZD 4X66F 1SI9A 1LW2B 3CD7A 2L9WA 3IS9A 2ZZMA 2DVIA 1E6YA 2EFPA 4JBCA 3N9UC 3SEOA 4NYZA 5E33A 4ZHRA 3RRHA 5HBMA 1AROP 2Z2MA 3KK3B 2J6TA 1JMTA 3N79A 3CWJA 2VPXB 2LVWA 2OIHA 3PJXA 1T02A 2B7BB 5HLFB 2JSXA 1JLBA 1U1OA 1IUJA 1CC8A 2ZOFA 3TUIC 1ZYQA 1C0TA 1L3VA 4ATNA 1H2VZ 4R25A 2X3GA 4PQUA 4OZJA 3RU0A 3O1LA 4ECSA 2Q3PA 3KG1A 5J2NB 3W7BA 2YVSA 2M0GB 3OW2R 4ECUA 3KLIA 1L3TA 2NYIA 1LWCA 2LXUA 3IWXA 5KFDA 2WTFA 2Z8QA 3OXGA 3TUZC 2DHXA 5LXYA 3GIKA 3KNAA 3DMJB 5F9LA 1IQZA 1UJ6A 2D1CA 2IJFA 4F8RA 3VAKA 3UDCA 3PW0A 4F2RA 5B0GA 2XLKA 1O8BA 5F3TA 3AQOA 1T03A 2ZKTA 4IG0B 3PVXA 2LA4A 4WXOA 2RKIB 3MM8A 3DLEB 3MTKA 4OX7A 5CH7B 3PW5A 2BACA 4ZPWR 2ZH1A 2FGOA 5I3PA 4FBTA 1JLQB 4Y2MA 3VTIA 5AXKA 3E01B 4Y6IA 2DH7A 4N5SA 1S6PA 3DU6A 3IR7B 5KT6A 2N7YA 3FRZA 3TVZA 2KT2A 1WELA 1SH0A 4X65F 3H5YA 2V9KA 3DI6B 2AGOA 3LP1A 5IWAF 2HHQA 2AYBA 3CVKA 3MMCA 2ZHBA 3UFCX 4QWBA 3PO4A 3TARA 2UUWA 5A2QY 1IKWA 4LSNA 1S99A 3CMAS 1WTBA 4KIAA 4UY8T 2GA7A 3BGFA 4C0OC 4C8MA 2MKSA 1Y9OA 4PWDA 4OI1A 1D9AA 3HMJG 4I6AA 3CDEA 5DG8A 4WFAQ 1QE1A 1RYSA 3MPYA 2O66A 1HNXF 2C3MA 4KFBB 5K14A 3DYAB 1U2RA 4ED3A 2GW8A 1S4FA 4F25A 1T8EA 4KPYA 4HTJA 2BVZA 2B9WA 3T6JA 2VPZB 3K59A 2IM0A 3CD5A 1Q16B 1UVLA 4ZK7M 2OH2A 2FJWA 2JC1A 4OI0A 4ED7A 1YJUA 5D3GB 3KTQA 1S0MA 1RT7B 3I6PA 4ZLPA 4F4ZA 3PW7A 3MXHP 1CLFA 3I9V9 4NMLA 3GB0A 2ROGA 4V19J 1NRKA 2RRNA 2K1RA 1RTDB 4D3HA 3MMJA 5KFYA 5A8WA 3TA1A 2V4QA 4ECWA 4DFJA 1S0VA 1RAJA 2MHNA 3U1NA 3ISZA 1KOHA 4RW9B 2B9YA 3HHLD 4OZ1A 2FIUA 4TQRA 1U1MA 1YJRA 2CKWA 4MIBA 3OVSA 3EPGA 2X51A 4ELUA 2V4RA 2AX1A 4KHMA 3IRXA 2KG0A 1UW4A 2JVRA 2A2DA 3MM9A 2JL9A 2ZM6F 3VAJA 1KOOA 2CPIA 3F56A 5E3CA 5D6GA 1IJEB 1HW8A 4NRUA 4AFFA 1VQ8S 3HZGA 3SYZA 4HKQA 2I9SA 4YP3A 5CD4H 4G1IA 2BQRA 1HNVB 4YB7A 4A46A 5L38A 4ILRA 1A9NB 1QVGR 5AE3A 3DRSB 3Q23A 1RA6A 1JLCB 1Y3JA 3GYXB 4NYPA 3ENWA 2ZDOA 3TQ1A 1WD6A 1R31A 5IS2A 4JI4F 2MZRA 4LQ9A 4OMFG 2XY7A 2E7XA 3BEGB 3LW5C 2JWNA 4PXCA 2IRYA 1Q8IA 3OR2A 1H6KX 3QLHA 4ZPBA 1V9OA 2AW0A 2JC0A 3FVYA 1TK0A 2R8HA 3MECB 1GT8A 2BDPA 3AH6A 4DQQA 4MIAA 5GAGI 2LKZA 3NCPA 3MECA 2VB6A 3KK1A 4DJBA 1HD1A 5F9NA 1Z4UA 1WG4A 2FHJA 3HX9A 5L9NA 3TAQA 2FJVA 3B78A 5A0YA 1SB6A 4YFUA 3SDEA 2MKIA 4ZPAA 1B0TA 1VQKS 1QY7A 2YH0A 1TKTA 3P6YC 4PXEA 3ENQA 4ECZA 2XLIA 1UKUA 4MH8A 4DR4F 5K8PA 4ECQA 4QIVA 3CCMS 2CQIA 1JNZB 3FSXA 2YNIB 1D9DA 1BY9A 5JXSA 3OUYA 4U6PA 3ZC4A 2VC0A 1R3NA 2P6TA 2W7AA 1CQNA 4TQSA 3D28A 4ZKAA 4RW7A 4OLOA 1RI7A 1DARA 2ZE2B 3EYZA 3IWNC 1X8DA 1SUQA 1D8YA 5KG6A 1I6JA 4G1QB 3KJVA 1L5UA 1Q82T 3W3SA 1JNRB 1GXUA 1R89A 2XMKA 4WFXA 2FDNA 2U1AA 5HP1A 2GHWA 4NXMF 4FZVA 4OJGA 2YX4A 1CPZA 2B4PA 1RWUA 2DNRA 4Q2LA 5LMNF 2R7WA 3IFEA 5BYSA 1N5QA 1Z2LA 4H4MA 1OQ3A 4K4YA 5F41A 2R4FA 3PXGa 1XMBA 4KKOB 4NZ6A 4NXNF 1T05A 4DV0F 5F8JA 3R5DA 1PGZA 4O3QA 1HBOA 4OX6A 4A8SA 3IG1B 1M5VC 3MOZA 2W24A 3PZPA 2OPQA 4BC9A 4CT9A 1P6TA 3MM5A 1BC6A 1M0SA 2W9AA 4ZVHA 2AJ4A 4XDDA 1NK4A 1NKBA 2NLWA 5F8NA 3CCLS 1OPIA 5C25A 3SI8A 4NA3A 2FLOA 1GQEA 2JHEA 5KOXA 4Q7AA 5LXRA 5I3UB 1C4CA 3P3DA 1R8HA 4WFBQ 3HVTA 1XR5A 3U7JA 2MB0B 2WONB 3TP2A 4I7FB 2XLJA 2C28A 1H7XA 4ED0A 3K5NA 4X4SA 1Q53A 1M90T 2HGLA 1FRKA 1ZM9A 2YNHA 5L1KA 2CZ4A 4FP9A 3DLKB 1TFYA 1BQMB 1S9EA 4O44B 4URGA 2W7PA 2LCWA 2WOMA 2DO0A 1S1UA 4I64A 4F50A 2RRBA 4ZCMA 4C97A 4RNMA 1HHSA 5KT7A 2KZZA 2M8DB 3CO9A 1C2PA 2C2DA 2JOQA 1H2UX 2UVVA 1S1VA 2DGWA 2VV5A 2YKPA 3FCHA 2C3OA 2R9LA 3RBEA 4H4OB 3CSKA 3DMJA 3FEZA 4NZ0A 3J7Z5 3MR6A 3CC2S 3UD4P 2OTLS 4HT7A 1YJWS 3KOAA 3JAMY 2CQPA 3KLGB 4GKJF 2KJWA 1AFJA 3T1YF 2DNOA 2ZOMA 2PA8D 1KVJA 4KQZA 5KFAA 3DLEA 3HFKA 5FDLB 4DOZA 4N76A 3W2WB 1F5CA 2YNFA 1NJIT 2QT7A 3VWSA 1B0PA 4ZP8A 4IOCQ 5G0RB 2ASYA 4OHWA 2MKJA 2XWXA