2Q79A

Crystal structure of single chain e2c from hpv16 with a 12aa linker for monomerization.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
80
structure length
74
Chain Sequence
TTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Increased Stability and DNA Site Discrimination of "Single Chain" Variants of the Dimeric beta-Barrel DNA Binding Domain of the Human Papillomavirus E2 Transcriptional Regulator.
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Dna binding protein
molecule keywords Regulatory protein E2
total genus 20
structure length 74
sequence length 80
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2q79A00
1M5VC 4YOEA 2X1AA 1DRZA 2ADBA 3NNHA 1O0PA 3DXBA 5ITHA 2XS5A 5CYJA 5IM0B 1SJ3P 1H2UX 1ZZFA 2YKAA 1WF0A 4YUDA 2AD9A 1K73T 4BS2A 4C4WA 5DDOC 2VOOA 4CQ1A 2DIUA 4PRFA 3SDEA 3ZZZA 1R8HA 4ZKAA 2EK1A 1X4BA 3CXCR 5CXTA 2LYVA 3HI9A 5IM0A 2KXFA 2E5JA 4M5DB 5H1SV 3VAMA 2MQOA 4FXWA 2MZJA 3P5TL 4FXVA 1DZ5A 2RRBA 5GMKa 1WHVA 1BY9A 2MHNA 2CQGA 1YI2S 3MD3A 3G4SS 2KVIA 3VAIA 3B4DA 1PGZA 2AYMA 2CQ2A 2DNMA 3UCUP 1FNXH 1KD1T 2DO4A 1YTYA 5IQQA 2M7SA 2DGQA 2DGWA 3R1LA 2KRBA 2M0GB 3Q2SC 1KC8T 3J7YU 2HGLA 1WEZA 2LXUA 3P6YC 1JJ4A 4RU2A 1N8RT 4IUFA 2N7CA 1WHXA 2DNPA 3D2WA 1VBZA 1VBYA 1VQNS 3MOJB 1A9NB 2RVJA 3UD4P 2G4BA 1U1OA 2DNZA 2LCWA 2RS8A 2MQQA 2GO9A 3PIPQ 3S6EA 2V94A 3CCVS 3CCRS 2BOPA 3CUNA 2MKSA 3CCSS 5LXYA 3U1LA 2CPXA 2MJUA 1QVFR 3RW6A 4J5OA 2DNNA 5GAGU 2RU3A 1VQ8S 2DGXA 1WG4A 2LA4A 3G8SA 4YB1P 1OO0B 2KHCA 1WHYA 1W2BR 3ULHA 2DITA 2AYGA 1SXLA 2LXIA 1HD0A 2CPFA 1YWXA 1VQKS 2KM8B 5JVGQ 5GAEU 1VBXA 2CQ0A 1X4FA 2FY1A 2QFJA 4PR6A 1YJ9S 1SJQA 3SXLA 3VF0B 1X5PA 5JVHQ 2U2FA 2OIHA 1U1NA 2CPIA 5D77A 1DHMA 2QEXS 2MY8A 1VQLS 2ADCA 2DO0A 3CCLS 4OZ1A 1UP1A 2CPDA 3CCMS 2ERRA 2MGZA 1HL6A 1VQ4S 3VALA 2XS2A 2DGOA 2DHAA 2DHXA 2HGNA 2D9OA 1WI6A 1VQOS 5LSLA 2M8HA 5DDPC 1HD1A 5LSOA 4WCEQ 1JJHA 1M5OC 2YTCA 2I38A 2MKJA 3ZZYA 3CCJS 1U1PA 2LA6A 4U67Q 2CPJA 2E5HA 2JVRA 2OTLS 2MGZB 3VAFA 3EGZA 5CA5A 4P6QA 2K8GA 2KN4A 2D3OR 2KI2A 3LQVA 1URNA 2CQIA 2N82B 2YH0A 2D9PA 3LPYA 2RT3A 2SXLA 2BZ2A 1VC6A 1WEXA 2LEBA 1H6KX 4CH1A 1H2VZ 3CMES 1UW4A 2CPYA 5DDRC 3BO2A 1S72S 1K8AT 3MUTP 2MKKA 2RUGA 2X1FA 1JJ2R 4TU8A 1WF2A 3R27A 4WFNQ 2CPZA 1H2TZ 2E5IA 2FHOB 2XSFA 1A7GE 5EN1A 2KG1A 1U2FA 2CQ4A 1B7FA 4UQTA 2M52A 1HA1A 2MB0B 1ZH5A 4A8XA 2JWNA 2MKIA 4ERDA 2MMYA 2X1BA 3CPWR 1X5SA 1XN9A 3IWNC 1FXLA 2N3OA 1QM9A 2FC9A 1WHWA 2LQ5A 2MQMA 3VAHA 1IQTA 3TO8A 3CCUS 2VONA 4TLQA 2MZRA 1JMTA 2LEAA 4IO9Q 1KOHA 2MQNA 2MZ1A 2CQ1A 1X4EA 1VQPS 1WWHA 2N3LA 4C7QA 4Z2XA 4ED5A 2JRSA 3H2VE 3CTRA 1G2EA 5GADU 1VQ5S 3EGNA 3UWTA 3BO4A 2KYXA 2DH7A 3FEXB 2DNGA 2XNQA 3R1HA 3UCZP 1VC0A 1M5PC 1WTBA 1SJFA 3NNAA 2M88A 2JVOA 3G71S 4WFBQ 3N9UC 1WI8A 4W92B 3CC7S 1FHTA 2CQPA 1Q86T 2DGVA 4Y00A 3H2UB 2O3DA 3G6ES 1VQMS 1YJNS 2XNRA 2DNYA 1X4DA 5LJ3Y 1P1TA 1WELA 2HGMA 4TU9A 1UAWA 5MLCV 3NMRA 2CQDA 1K9MT 1N54B 2OJ3A 3CD6S 2KFYA 1YHQS 3HHNB 2CQBA 2X1GA 2DNLA 2RQCA 2MY7A 2I2YA 2M9KA 1SJ4P 2MYFA 3UCGA 2DNOA 1NU4A 3S8SA 4QU7A 1WEYA 1SJRA 2DHSA 5FJ4A 1OPIA 3FEYB 4OZ0A 4EGLA 1N88A 3VAGA 4LIRA 2DNKA 2U1AA 4UY8T 1UFWA 1NO8A 2WBRA 1X4CA 3VAJA 3G96A 3US5A 3J7ZT 1FT8A 2F3JA 4WIIA 2HZCA 2MZTA 2MZQA 1RKJA 3CCQS 5D78A 2KXNB 2DH9A 2L08A 1U6BA 3BO3A 1VQ7S 1FO1A 3THTA 2MQPA 2XB2D 2J0SD 4TU7A 2ZJPQ 4WF9Q 2M8DB 1YIJS 2M70A 4QQBA 1OIAA 2CQHA 1M90T 5LJ5Y 3PIOQ 2DH8A 2CJKA 2DGTA 2J0QD 4IOCQ 1YJWS 1M5KC 2E44A 2MXYA 4CIOA 1U1RA 2NZ4A 2M4MA 2CPHA 2B0GA 2MKCA 5GAHU 2E5GA 2PEHA 2EK6A 5IFMA 3V4MA 2KG0A 3UE2A 2RNEA 2FPHX 3BS9A 2J8AA 3MURP 2HVZA 2DHGA 1X4GA 2HYIB 3L3CA 3B4MA 1VC5A 2UP1A 1X4HA 2XS7A 3S01A 3BEGB 3MD1A 2ZJQQ 3G9CA 4QPTA 5LXRA 2DNRA 2QA4S 2EVZA 3EX7B 3VAKA 2ZJRQ 2DK2A 4W90B 2DNHA 1L3KA 1NJIT 2M2BA 1WG5A 4QU6A 1U1KA 3THPA 2VOPA 2CQCA 3TYTA 4F25A 3G8TA 1S79A 5DM7Q 3JB9k 4LJMA 4PKDB 1VQ9S 2L9WA 2DB1A 3MUVP 1CVJA 2MJNA 1DBDA 3I56S 1N52B 1F9FA 2KM8C 2LECA 2LKZA 2CQ3A 2FC8A 4CH0S 2OSQA 2RRAA 2L41A 3IRWP 2PE8A 2VODA 1WF1A 5GVQA 3U1MA 2AYBA 2G1DA 2MPUA 2K3KA 3TP2A 5DDQC 4C0OC 1U1MA 1Q82T 3CC2S 5HL7Q 1Q7YT 2AYEA 2KXHA 3NS5A 1AUDA 1M1KT 2MSTA 4F26A 2RQ4A 2YH1A 1U1LA 1VQ6S 2MQLA 1R8PA 4WFAQ 2RS2A 1YITS 3CCES 5BJRA 2LMIA 2Q79A 2KT5A 3CC4S 1D9AA 4F02A 1OWXA 1FJCA 2KRRA 1Q81T 3CF5Q 4V19X 2G0CA 3P49B 2DIVA 1RK8A 5DETA 3K0JA 4IOAQ 4WKRA 3CMAS 2KH9A 2KU7A 1D8ZA 2DGUA 2DISA 3NNCA 2DNQA 3RW7A 2MKHA 2JX2A 1KOOA 4LMZA 3MDFA 1PO6A 1QVGR 3Q2TC 2NLWA 1KQSR 1X5TA 1ZZNA 4Y0FA 1U1QA 2F9JA 3P3DA 2YWKA 3CULA 2J76E 1X0FA 3UD3P 3OW2R 3MXHP 2OTJS 1X4AA 3MI7X 1WG1A 1FJ7A 3NS6A 2F9DA 3DLLQ 1P27B 1FJEB 5HO4A 2MZSA 3S7RA 3I55S 3SDEB 2CPEA 1X5OA 2GHPA 2OSRA 2DGSA 2MSSA 2A3JA 3SMZA 3MUMP 1U6FA 5DM6Q
chains in the Genus database with same CATH superfamily
1EQMA 3M2UA 2R8GA 3T9NA 3EM1A 2R42A 4C9DA 2ZBCA 1ZM2A 4X4UA 2YNHA 1NMEB 3FMBA 1XNRF 4LSNA 4ZJQA 3WIVA 4ZJOA 1U47A 1WKLA 3NNHA 3SEOA 5ITHA 4U9RA 5E7OB 2XBPA 1GMVA 4CWBA 5HK4A 5CYJA 1UVNA 1SJ3P 2V8HA 1U0SA 1VK8A 4PPZA 4O23A 4F3QA 2OMLA 4ED6A 2HMIA 4JV5J 1RT4A 2E1AA 1WF0A 2AD9A 3TAMA 2VBWA 3LP1A 3JQJA 4IG3B 2YWWA 5KG3A 1LNQA 1SL0A 2CZVC 3EZOA 3PHTA 4HVZA 2DIUA 2JEGA 2NZCA 1CG2A 3DN9A 1FJGF 1R8HA 2RSQA 4DN9A 4X65F 4DL6A 2YKNB 2HWIA 4DUYF 1P6TA 4J90A 2MLXA 3CDBA 4P7VA 1F9EB 4OI1A 3GV8B 2BJDA 2LYVA 1ZAXA 2XHWA 2YNFA 3LF0A 3OLBA 3OVAA 4DV3J 3RB3A 3FBBA 4DFJA 4F2RA 4M94A 4DV6J 4V19J 2V2QA 2CUYA 2E5JA 1LWFA 6AT1B 2AX0A 4NCGB 4TXSA 5H1SV 3VAMA 4DPOA 2MQOA 4FXWA 2MZJA 3P5TL 3WBZA 5LMNF 3PHEA 3D66A 3LGNA 3OXFA 4HTIA 1DZ5A 3DRRA 1BY9A 4FYWB 4KFBB 1RHQB 2VDIA 2C3YA 1YI2S 3R2CJ 3MD3A 2FHMA 3CDUA 2W4PA 3D0GE 2NS1B 2HHWA 3AAWB 1HIYA 4KHMA 4WU2A 4YDXA 3MEEA 1N0UA 3K2YA 5C24A 4RW4B 2B9YA 2DO4A 3LP2A 5FIIA 1LW0A 3AB2B 3NWGA 4NLYA 5IQQA 3AQOA 4LT6A 3RYLA 3DGPA 1TL7B 4Y28C 2ACMA 1JLGB 2HBYB 2DGWA 4PQAA 1IKYA 3BSCA 3LP0A 4CLLA 3OUYB 1L3TA 4LF9J 2QLBB 3DRSB 3HKWA 2XSJB 1S9GA 3I5AA 4R8UB 5DLFA 1KC8T 1F5CA 3W2WB 4DDFA 3J7YU 3R5GA 1NSKL 1NPKA 1WEZA 2LXUA 1JJ4A 3C14B 3IBWA 2G0JA 3HT3A 2HHXA 1JLFB 3FSYA 2N7CA 2C22A 1WHXA 3CEDA 4ZITA 3DRPB 5DZ7A 1NDCA 2ZFHA 3Q89A 1NLKL 1VJQA 3MOJB 1QUVA 3MCSA 3PYEA 4R5PA 4A8SA 2ILZA 2W4CA 3QIPA 4EWTA 4ZN1A 1SKRA 3IGNA 1WKJA 4LQ3A 2ZZTA 4MT1A 2MQQA 3M30A 3OUYA 1N5YA 1JLGA 2O01C 2PMHA 2Y0BB 3HD2A 1FD8A 4CLSA 4RW9B 5K8NA 4ZP7A 4ANCA 3JSMA 4IKAA 1RYRA 1IR2A 5J2PB 3VQSA 8RUCA 1RGVA 4LSZB 4WE1B 4KYZA 3Q24A 1S9FA 4QIVA 2GQCA 4RPFA 3UFCX 1RSCA 3U1LA 1KVKA 1OPZA 3JXOA 4CH7A 5J2QA 1DLOB 2MJUA 3DLKA 3DYAB 3HX9A 4J9PA 1XERA 3UN2A 5GAGU 3E3XA 1FNMA 3P96A 4M95A 3TARA 2UXDJ 4WFYA 1WG4A 4TLRA 3AJDA 4O3QA 3UW1A 4YB1P 1HBUA 3BPSP 3FK4A 4Q2MA 3OR1A 4G1PA 4ZS6A 3ULHA 1SXLA 1QY7A 1HHQA 2OEJA 1WSVA 1VQKS 1SC3B 1U2RA 1Q8LA 2AP6A 3GIKA 1QJHA 2CQ0A 1EP4B 2BM0A 1X4FA 3QT5A 4GVBB 4K7QA 2YNGA 4CLFA 2ZM6J 4ZJLA 3CO0P 3EWGA 2BJ8A 1CJKB 4PR6A 3W5XA 2UXBJ 4GKJF 4EYIB 1Y10A 3VF0B 4OV6A 1X5PA 1Z2LA 4RX6A 4LBPA 5KFQA 4FDFA 1NK7A 1RTZA 2RKIB 3NAIA 4GKKJ 1KP6A 4JBCA 2QLFB 3R7BB 5I4MA 3AT1B 3H42A 4K4WA 5IC4B 3AODA 4LVOP 3UVJB 2FJDB 5T7LA 3T5JA 2ZZMA 3O6QA 3OTOJ 2ADCA 3VV2B 4OZ1A 2VJVA 1UP1A 2CPDA 3HLUA 3G6VA 2CZ9A 2EG2A 1TKTA 2JFKA 4KHRA 1J5OA 2BKOA 3NXZA 3D5MA 4ZLJA 4DV5J 4ECWA 1OYDA 1V5VA 1VIXA 2YNHB 3VALA 2XS2A 2HGNA 1RT2A 2IRUA 3R5CA 4DL2A 1UZHA 4LIWA 4LUBA 2M8HA 3NS7B 5F8LA 5AJ3J 2E1RA 2VA3A 1VQYA 1PKUA 2B56A 2LA6A 2EBEA 4PXBA 1FFSB 3LALA 3L7OA 3H5SA 1MMLA 1RAOA 3WZ0A 5C7PA 4ECXA 3TX0A 1DRZA 3OD2A 1ACMB 2E9TA 2DXDA 1TKXB 2WSEC 3IRXA 1Q4RA 1YJRA 2VV5A 3WX4A 3MCOA 4KKOB 4B08A 4ZN3A 1N36F 1DFDA 2IDEA 3IM8A 4MFBB 1RTDB 3VQTA 2IYGA 1ROFA 1VRUA 4JYAF 2KTQA 3H20A 2LDIA 4L76A 4UW2A 1IBMJ 5D0HA 1TUVA 5CAAA 2N82B 2R8KA 2YH0A 1ELOA 2WVFA 4ECQA 3HXMA 3V6JA 1VMBA 3LA0A 3LPYA 3CT9A 1F60B 3ZZRA 1RE1B 2J7KA 1VC6A 4ED1A 5CZVA 1HBMA 1U02A 2RKIA 2VL1A 1TVRA 3IR7B 2ZWOA 4R25A 3BF4A 5HROA 3WC2A 4CO3A 1TR0A 5BR8F 5B0FA 1NZAA 5IQ6A 3BO2A 4NMXA 4TNOA 4AQYJ 1AXQA 1SBRA 3CIMA 4M5LA 3U7JA 2MKKA 3TVKA 1HNVA 1VRQC 2W9CB 1NK4A 1TUGB 2P2CB 4OMFG 2NPFA 1Q8KA 1HBNA 3VGSA 5AJ3F 4DSKA 4QR1A 4QBUA 2UUBJ 4QIWD 1I6JA 1Y0HA 2MHEA 1E6VA 1H2TZ 2ZDOA 1NSQA 4QZVB 4HACB 3HZGA 3UDLA 1Y5LB 3M8PB 2XSFA 1A7GE 3JAMU 4QWBA 2G1HA 2YNIB 5E2QA 1TV6A 3G2XA 1DLOA 5HROB 1HWJA 4B3OA 2CAJA 1TQLA 2VF3A 5HJXA 2MKIA 5KFDA 2BV3A 2KL8A 1H0HB 3J7A1 4PXDA 2PMZD 2J8SA 3T5LA 3JYTB 3V4IA 2IRXA 3IWNC 4KTQA 4IR1A 4C8OA 4WP3A 4U8VA 1QM9A 1WNEA 5E3CA 3M30B 1N5YB 3TVZA 3VAHA 3LTOA 1IQTA 3TO8A 4J7CA 4DFKA 2MZRA 5CYMA 3HP6A 1UJ4A 2E66A 2HK2A 1QTNB 4OZ3A 5M2UA 3D1QA 2XI2A 2ZBPA 2FZKB 3EDQB 2GGPA 3OT9A 4IO9Q 1P9YA 4N77A 4IH5A 4G1QB 2OPPA 1T7PA 4Z2XA 5A2QU 1MU2B 4BBYA 2JRSA 3CTRA 1KS2A 5HATA 3I87A 4DLEA 1NK6A 3R8YA 4YR0A 4B3SF 3KUEA 5EWGA 5F9NA 3BR9A 4UY85 2MQ8A 1FKPA 4HL9A 5IT0A 1RT1B 3DRSA 3EXCX 2RDJA 4MKAA 4FXDA 1UJ6A 2ATCB 2BA9A 2NXCA 1YVFA 3U27A 4J9SA 2H5EA 4UOHA 1CQNA 4HR2A 4EO6A 1WTBA 2XYPB 2CADA 3H2LA 1S1TA 4YDDB 3G71S 3UPFA 1NRKA 1DTTA 2VB6A 1JLCA 2G13A 3C66A 4F7VA 4WFBQ 2IA0A 3DOLA 3KJQB 4RUCA 4PUOB 4W92B 1FHTA 2QX0A 4MYUA 1RAHB 3KTQA 2L9DA 3MPDA 4OLPA 4OZ2A 4WPAA 4WJBA 3H4DA 2JC0A 4DUYJ 1H74A 1NSAA 4I7FB 1CQMA 1DARA 4USJC 3JAMY 1WELA 5KFJA 2HGMA 1QAJA 1FRMA 3GV5B 5HLFA 2FY8A 2OI2A 5BYQA 3NMRA 2JNJA 2YY3A 3FUYA 3HF5A 4YY3F 4C8ZA 4HI2A 4OLOA 5K14B 2A1BA 2B7CB 1LW2B 4L73A 5KT6A 2R2RA 1T03A 3CD6S 4B17A 4DX8H 2RAQA 2R2SA 1UEVA 4DV4F 2UXCJ 2YKNA 2C3MA 3CO9A 1HQUA 5DZ6A 1F2GA 4ZMMA 1FERA 3QLHA 1XNRJ 5LOQA 4FVMA 2P8IA 3BZQA 2C2EA 2BQ3A 3J80Y 2XULA 3M8QB 2F8EX 2VFSA 2CJXB 3GJQB 4L3KA 3JSYA 2JEJA 4WTOB 2DYAA 2V69A 3BQ1A 1X9WA 4QU7A 1M1HA 1S1VA 1WEYA 2JLFA 4UZBA 4F8RA 3FEYB 4ITSA 4EGLA 3CJSA 4IH6A 2BW2A 1BMQB 4Z37A 1B64A 2BE2A 2GFFA 1ULRA 2IJNA 4USKA 1RT1A 3BDEA 2AWZA 2G9OA 4I2QB 4CYUB 1DTQA 2AZ1A 3KLHA 4IRDA 1X4CA 2B5JB 3HHDA 1IBLF 3AD7C 4NRTA 3PW5A 3J7ZT 4K4VA 1UVJA 4C0BA 2HZCA 1M5SA 3WQPA 2D1CA 1SC4B 1U25A 2FJEB 2MZQA 3KLGB 4DV6F 3T9ZA 1RKJA 1WSRA 2HQIA 4L6V3 2QIFA 3BBCA 1KKHA 3CWJA 3FDSA 3BBBA 4B02A 2E29A 3DRXA 3OL6A 3CJKA 2L08A 1ZAWA 5CYMB 5AE2A 2VKZG 2P9GA 1S4FA 2N4CA 3J81U 1NSPA 2I1RA 2VFRA 5IV3A 3BH7B 4X4OA 3OHAA 1ZPVA 2XYGB 3DLJA 1PJ7A 3GE9A 4NXMF 2CJ9A 2HQCA 3F0NA 2RU9A 1NPRA 4ZPDA 4QQBA 5KOXA 1OIAA 2W7PA 4DUTA 4Q0BA 2X3DA 5LJ5Y 1MN9A 2PMWA 2ABYA 4RNMA 4ELVA 2CJKA 2J0QD 4DS5A 1YJWS 2W8LA 2E44A 1NCLA 1TV6B 1UJ5A 2VG6A 4CIOA 4NXNF 5ETKA 3V5RA 3TANA 2M4MA 1ZA2B 2CPHA 3G82B 4PYDA 2UUBF 5GAHU 2EKYA 1CC7A 3PW2A 2PSZA 1S6QB 3EMTA 3CVKA 4OX7A 3Q23A 2KG0A 3N4WA 4KV8A 4K0KJ 3BGUA 2FJXA 1NUEA 1X8DA 2FPHX 1F1BB 1RDRA 1Y3JA 4NYPA 3NLCA 4CT9A 3EPGA 4R0JA 3TRGA 2CJAA 2EFNA 4M5NA 4BC7A 2CVIA 3M8ZA 4WWSA 3HSJA 5A6WA 4K5RA 3W64A 4BLGA 4CLTA 3M9MB 4FS1A 3FQLA 5HSPA 2GHWA 3MMAB 2HW3A 3BR8A 2HK3A 1YGYA 4LQ9A 5F3TA 5I42A 4OYMA 1S1XB 1MMDA 1TL3A 4DV1J 3MECA 3KJFB 3KLGA 2RDDA 3PKMA 2XS7A 1FK9B 2V67A 3S01A 4XO0A 3K5NA 4OZNA 3ENVA 3UCUP 3MD1A 2ZJQQ 4Y65A 2VA2A 4PAAA 4QPTA 3D68A 3O8WA 7FDRA 3ZZPA 2DNRA 3OLAA 3QATA 4FYDA 4EUVA 2QMWA 3M2UB 3AFGA 3FRYA 5IZHA 1NEEA 3MHYA 1Y00A 3OQ2A 4TYAA 4IFVB 3VAKA 1HBOB 2AZ3A 3BREA 2Z58B 4F50A 2I5JB 1U1KA 2KJVA 1P1LA 3THPA 1VRTB 3QQCD 4LF7F 1FK9A 2CQCA 2R9LA 2IA6A 1U8WA 4JI3J 4QW8A 3M8WA 4OHXA 4OHZA 2ATLA 1KQKA 1BQXA 2IHR1 4DQQA 4CT8A 5KT4A 2KB2A 1VHFA 1D8YA 1RTIB 2C2OB 2L9WA 1RT2B 5A8RB 4ID8A 2MJNA 5DJBA 2HNZB 1DBDA 2K1RA 3C2PA 1TAQA 2XMVA 3FBCA 4YS2A 1UMJA 3QGHA 3W8PA 3QT8A 4ZCLA 2AGQA 1S5ZA 2LKZA 3HHLC 4DR1J 1XEZA 2WB4A 4YR2A 1LW2A 1KLNA 2XMTA 4CH0S 2OSQA 4NCBA 3W2VA 4DWIA 4NXMJ 3MMCB 4RL1A 3KJVA 2YQ1A 4DJBA 2AEFA 5E33A 2JHEA 3R6LB 2OPSA 4DR4F 2F4VJ 3DLGB 2YWEA 3D6FB 4I0WA 8AT1B 3AD8C 4M63A 2WW4A 3BKUA 4X62F 3H25A 3IR5B 4I2PB 3NS5A 4LRFA 2YQ0A 2V8PA 3V81A 1U48A 2IMWP 1CLFA 4YB6A 2C3UA 4NLSA 3TA2A 2ZH6A 2E1MC 3NGTA 4MIBA 4X84A 3OR1B 2L3MA 5CQGA 4QJVA 1J2VA 5CYQB 1YRUA 4USWA 3GIRA 2KKHA 1VQ6S 4DZDA 1SUQA 2UU9J 4H4KC 2HS4A 5SZTA 2J9CA 2F63A 2ASDA 1FKPB 3FKBA 2BOAA 5DS7A 1HQEB 2ZEJA 3MM6B 1D9AA 5F8IA 3RAMA 4EBDA 4K2XA 1H3DA 1FJCA 2G0IA 1U4BA 2HURA 2DY1A 3SCJE 1HWIA 7FD1A 4OX9F 4ZPBA 4CLKA 4DBQA 3CF5Q 1KVJA 1V3RA 2G0CA 1WOSA 4R0EA 4CTAA 3KLEB 1O6XA 1AB8A 1M1GA 2DIVA 5DETA 3P49B 4IOAQ 4WKRA 3CMAS 3ADAC 3I0RA 2KH9A 2ZNZA 2KU7A 5KFLA 2HNDA 4B9SA 3NCQA 2DNQA 4RNNA 1UEUA 3M7VA 1HKAA 5K8OA 2XLJA 4NLUA 4DX5A 2GV1A 4F4KA 2B3TB 3PW0A 2W7AA 1FRXA 2G2OA 1R0BG 1G3OA 5L38A 4DUZJ 1MSWD 2BR0A 3MM7A 1FTRA 3C16B 3DRPA 2JH3A 1HW9A 1PO6A 2VFUA 1S77D 1KQSR 4P2XA 4UOGA 1ZZNA 3FFIA 4Y0FA 2BUNA 4UQGA 5K20B 1U1QA 1T9UA 2GIRA 2YWKA 5CH7B 3CULA 1SKSA 1IR1A 2ZD1A 4ZDNA 1EKSA 1NM2A 4HH0A 1T3OA 1C0TB 1PIEA 2R7TA 4NWBA 3GCXP 1Q8BA 1RWVB 3MR3A 3OVBA 4JI6J 1XQIA 3GSIA 2DR5A 1RKIA 2R8JA 3PX4A 4JUZA 1S1UA 2BKNA 2BJ3A 2HS3A 2PN6A 2RRNA 4MMOA 1FVSA 1T05B 2DEIA 2VC0A 2CKWA 4YFUA 2W9BB 1TKZA 1XR5A 1X7VA 3A8JA 3Q8YA 3GG1A 4UZCA 3TZZA 2DGSA 2MSSA 4FPRA 4EZ9A 2HHSA 5B0GA 4I7FA 2R7WA 1U6FA 1AROP 2G2ZA 3BYPA 3DOKA 3PR4A 4DF4A 4O44A 4C8MA 2E9RX 4DR7F 1HHSA 2OD4A 1P9QC 4JI2J 3K8VA 2X1AA 2HIYA 1BQNB 2BKPA 2AMCB 3DOLB 1YKWA 3MMBA 4OI4A 4EK2A 1DTTB 1S0VA 4WK1A 1O0PA 3QJLA 2R2TA 3IWXA 3DXBA 4USUA 2YWGA 5D0RA 5KFWA 5KT7A 5IM0B 2OUGA 4RW7A 4JV5F 4ZPWR 2LQJA 1ZZFA 1QDUB 1URRA 2DTJA 1NK8A 1K73T 1RTJA 3I96A 1VCTA 5KFZA 4ED3A 3TZXA 4GKJJ 1TL1B 1Y11A 3VZHA 3HMJG 3KLIA 3QZ8A 2H65B 3O44A 4MH8A 2UZAA 1NBEB 1VS3A 1CJVA 4NA3A 3ZZZA 2E5LJ 2PI5A 1TU0B 4ECSA 2EK1A 3I6PA 4Q7AA 4ANDA 4DR5J 1X4BA 2BQRA 4B3MF 4WZQA 5IT9Y 2BEFA 2RB7A 4WXOA 3W1YC 5CXTA 4OYXA 1HQ2A 2CYYA 4OFZA 2KO1A 3PRVA 3SSSA 2BQUA 3TA0A 8ATCB 5IM0A 3RU0A 2VG5B 4RW8B 2ASLA 2KFNA 3N6NA 4FXVA 1WTFA 3KDOA 2CNOB 4E98A 2IIHA 5GMKa 5JUMA 3HVAA 3DOMB 3FRZA 3PYFA 3RBEA 2WOMA 2Z30B 2AKWB 1WJ9A 4LR7A 1F9HA 4OI3A 3D3BJ 4RKUC 3ZZYA 2KVIA 3OL8A 4DLGA 3T6JA 1U1PA 2GX8A 2ALYB 2R7QA 2MDAA 2YVSA 1PGZA 4Q8EA 1LWCA 3M2RA 5M2RA 3VWSA 5ETPA 1AA1B 3GONA 1CS4A 2GJ2A 2XLIA 2YWFA 1TKZB 1S0MA 4KRWA 1Q5YA 2Z2YB 4L3NA 4NLOA 2M7SA 3D67A 1I94J 2DGQA 4NCAA 2KRBA 1N32F 4P10A 1AT1B 2M0GB 2NUHA 1YJUA 4O3PA 2Q1LA 5IV4A 1JLEB 3DDKA 1E6VB 2EFVA 3TUIC 3AQPA 4K4UA 4K50A 1FE0A 3D4JA 1JXLA 4DCOB 3TUZC 3ITHB 2NXUA 5HMYA 2R8IA 1N8RT 4B3RF 4DPWA 4KJIA 3VHQA 1ZTWA 4KGXB 1J5EF 3A8KA 1R6VA 4M5KA 4RUHA 5BXIA 1SH0A 4Q45A 3OFHA 1VQNS 1B0PA 3GFHA 4CRJA 1OSCA 4NLVA 2HWHA 1KHWA 4OQJA 2XGPA 3MR2A 3G87A 3R5DA 1OQ3A 2KYZA 2V9KA 2Z2ZA 3G86A 3SQGB 3ZZUA 4A46A 2DXFA 3DRYA 4KGMA 2K3IA 4C11A 4JI7F 5AE1A 4JI2F 2BX6A 2GO9A 1Y7PA 3OXGA 3GWCA 4DR6J 2H4YB 2QC3A 3W66A 1FCAA 3QRQA 2BOPA 2HBZB 2HFZA 2C2ZB 2EEYA 1W7WA 4USHA 4A8OA 4DX7A 3FBEA 1JK9B 3OTCA 2EXUA 3F73A 2UUCF 4DV1F 4H4KA 2XY5A 3SYZA 3CDEA 3DXSX 2R2UA 3RW6A 3AOBA 1QAYA 1Q78A 1V3SA 1GH8A 1NK0A 1RAEB 1DAXA 4I1TA 3D7SB 3ZZ0A 5HMZA 1LV5A 5L1JA 2BXJA 2RMLA 4F3MA 1ZPWX 2KHCA 4LRBA 2DITA 3I4PA 3KK2B 2JSXA 2HFSA 1O5JA 1Q8IA 4LR8A 3W2WA 1YRTA 2ZOMA 5JVGQ 1C4CA 5GAEU 4K4XA 1UEKA 2QFJA 1W2IA 1YJ9S 1XMQJ 3RRGA 3DGPB 4OZ5A 2EG1A 4ZPAA 3M05A 5LMNJ 2OPQB 3ZFVA 2DR9A 4U95A 2OIHA 1IQZA 1UVKA 5HMXA 4Y2MA 4ZCIA 2EFGA 1VJWA 2APOA 4JI8J 1BQMA 3HVTB 3EGWB 1DHMA 5I3UB 3EYZA 3BV8A 1LK7A 4EBEA 1UA0A 1L3UA 2MY8A 5HP1A 4O3SA 3DI6A 1C0UA 3QAUA 3CCLS 3EXYA 5F8GA 1HPZA 1N5VA 1AFJA 1NKEA 2ERRA 2MGZA 1RA7A 2I5JA 3OJSA 4DV5F 1K0TA 3JTNA 4DCPB 4QR0A 2JLEA 3FCVA 2CFXA 3R97A 1GAOA 4OX9J 3OFFA 4IG0A 4XIUA 1IKVB 5J1EB 4GVBA 2EKNA 1VQOS 2Y8YA 3DM2A 2J6UA 1M5OC 3MAAA 4PQUA 2AHOB 2AJ1A 2YTCA 1XMOJ 3O5TB 2CJQA 5E3AA 2MKJA 4P7TA 2HQFA 2WSFC 3MMJA 4DPTA 2HNZA 4PG5A 5KFPA 2JVRA 5A8RA 4ENOA 4Q8FA 1TL4A 2MGZB 1TL3B 4MKVA 5D4OA 1PBUA 4IG3A 3NGUA 3RTVA 5DG7A 2PC6A 1L5UA 1HPZB 2F8MA 4ZPVR 5ETVA 2KN4A 1SQEA 2KJWA 5BYSA 2R8HA 3DLKB 3DYAA 2KI2A 4IDKA 4A48A 1HNIA 2RDIA 3LH2S 2Y1JA 3PX0A 3J7AN 1KN6A 1Q0NA 2ASYA 2GMLA 3V6DB 4ZHRB 5EUHA 3K57A 3GYXB 2OPQA 3MZIA 1NKCA 2D9PA 2KT3A 2W2QP 3K5PA 4IFVA 1K0VA 5T41A 3RZAA 2XM3A 3Q83A 1N5TA 2J5AA 2RT3A 3D3CJ 1GX6A 3CCZA 2XMJA 3WIUA 1H6KX 1H2VZ 2RUSA 1T02A 2VU5A 3D9BA 3ETMA 2B8PA 2J9DE 2ZH9A 3QIPB 2RF2A 1H7XA 3EVWA 1QTMA 4ZVPB 4F04B 5DDRC 1XNQJ 1XR7A 3L7UA 4DSFA 3IM9A 3K7RA 3PEJA 3MECB 2HKEA 3ET6B 1S1XA 4NI2B 4IQXA 3J7YI 2RUGA 1FF2A 2X1FA 2VH7A 4TU8A 1WF2A 2LXFA 1B0TA 2VBZA 3R27A 1NHVA 3UR3C 5KOWA 4X62J 4PZVA 3NGDA 1FNXH 4R8UA 5LL6d 2GO8A 2E5IA 1S76D 4X4RA 3N6LA 1TELA 2KG1A 3OL9A 4NLWA 2CQ4A 2FGOA 4P75A 1ZH5A 3RB0A 1EIYB 4AE5A 4A8XA 4ER8A 1JXVA 4C11B 2AJ0A 1Y5NB 2PD1A 3GSDA 3I4HX 3MEGA 5KFGA 3TOQA 5B0BA 4DR1F 3T5KA 5HQLA 2KVQE 1AUSL 2ROEA 1KRPA 3DRRB 2QE5A 4V1Ak 1RAFB 2N3OA 2AGOA 3KXDA 2R7RA 2GNKA 4ED7A 4HACA 4Y2IA 5CCMA 4NCGA 2HWTA 3AY0A 3TVYA 2B4OA 3UI3A 1NDKA 4NLDA 1ZTTA 1HR0F 4NRUA 4TLQA 2QGFB 4CNZA 2LEAA 4C97A 1RABB 4L75A 4NZ7A 5GMDA 3F56A 1XNQF 1NPPA 2B51A 1X4EA 4P72A 4ELUA 4ZHRA 4EYHB 1PAUB 1FFGB 1CJUB 4C7QA 4ED5A 3OFEA 4WYWA 3VGTA 3H2VE 4ZVQB 1QSLA 3UWTA 2GVDB 1TVRB 2O1PA 3O2IA 3O1LA 4ID5B 1TP7A 1RT7B 2CA9A 2RHSB 2K2PA 3C15A 3E01B 3IGVA 3PACA 4OJGA 3TWZA 4CZCA 3R9LA 2DNGA 2VG7A 3QO9B 5KFIA 4B9UA 4NLGA 3KMSA 2BABA 5HVFA 2C2KB 4USVA 3CDWA 1SJFA 3A3OB 3PCOB 2JVOA 3GTYX 3NNAA 1XMBA 3VTIA 2HBRB 5H9FK 3T6BA 2C28A 5F8JA 1S6OA 2QYGA 1NJWA 5K14A 2PFDA 1Y4ZB 1VRUB 4DSIA 1NH7A 5A6PA 1Q86T 2R7XA 2W24A 3M6WA 4NLTA 4Y00A 2YX7A 4EU0A 2DNYA 4ETXA 3HVWA 3PZPA 1X4DA 1TKXA 1C1BA 5LJ3Y 5SUHA 1D9DA 3HHLB 3LAKA 3KJNB 2ZM6F 2BJ9A 1LK5A 5MLCV 2CQDA 5HAOA 1IBCB 4YHHJ 4LF6F 2MLYA 2HEKA 4PUOA 1YJVA 4OJ1A 1N54B 5CZXA 2VHGA 1RTJB 1JLCB 3UN3A 2XEXA 2QRRA 4TY9A 1FFWB 1S1TB 3U1NA 2X1GA 2DHHA 2FVPA 3DHWC 4JV0A 3RB4A 3HJFA 4LREA 3GCWP 1TMJA 4EEYA 1IM6A 2DNLA 1H72C 4KPCA 4DF8A 1MW7A 3GG0A 1WC3A 3RBDA 4DU7A 1RLDA 4IOBA 2Y1IA 1LWEA 3HSZA 4U7UD 2A0FB 3QGGA 4UUXA 4O44B 6FD1A 1RUSA 2MYFA 3DGVA 3DOKB 4FBTA 1ITPA 3DKDA 3C8YA 2HRTA 2AGPA 3C6TB 4G65A 1YRXA 4OHWA 4KGKA 3SFGA 1VK3A 2DPIA 2OPRB 4EBCA 3VAGA 2P9CA 2NQPA 1KTVA 1S7HA 2U1AA 2RILA 2HBQB 4O0NA 3SSQA 4UY8T 2XLKA 1G1XA 4HH1A 1UFWA 2WB1D 1Q79A 1R31A 1HNWJ 3X1LB 3VAJA 4DR5F 2DKOB 4DR2F 5DGAA 1FT8A 2F3JA 3RAXA 2IMOA 1NB2A 1KDNA 5H9FJ 3M6VA 1TK0A 4ILRA 4HTJA 3PRBA 5K8MA 2HAIA 2ZHBA 5RUBA 1TTHB 2KXNB 3HSDA 1U6BA 2XG8A 4O3NA 1N6QB 5L46A 2VQEJ 1SH2A 1VQ7S 1YG0A 2I8EA 2WAQD 3THTA 1KSPA 1RACB 1S6UA 2PT0A 4OZJA 1GQEA 4PG7A 2ZH1A 2LEPA 4GRSA 1DQAA 3LW5C 2WTFA 2ZJPQ 1HNZF 2M8DB 2J0SD 5I3PA 4WF9Q 2M70A 1T94A 2CQHA 3SIPB 1M90T 4B3TF 5IC6B 3H59A 1EZZB 2V2VA 1SIZA 3PIOQ 3V2UC 2NSBA 2H48B 3CJ3A 3VZIA 2W2OP 5K5MA 2HHHF 2HQDA 3C3LA 1RJJA 2IVYA 2B6AA 3HCXA 4ICLA 5F8MA 4B3OB 1T11A 2NZ4A 1GMWA 2AQ4A 2B0GA 1HBMB 2CJBA 3G8QA 3ZXWA 3EZ5A 1QAXA 1RAGB 2E5GA 3RAQA 3Q8QB 1KR4A 3Q8SB 3HM9A 1UZDA 4NA2A 5IFMA 2WONA 3V4MA 3D6TB 4E8UA 4ES1A 2RNEA 2DR6A 2FJWA 3BS9A 1LOUA 2J0XA 4J91A 5ETRA 4L74A 5F9LA 3KLFB 4F2SA 2GIQA 2M3DA 1VBKA 4BC9A 2I0XA 2KDOA 1RT5A 4WU3A 4JI7J 3VVUA 2X51A 3O3LA 4AFFA 5CD4H 2NR0A 4LF2A 2HVZA 4AXJA 1FRJA 2L9NA 4HHUA 1X4GA 2AF6A 4I64A 3K8WA 4RO0A 3RRKA 2HYIB 3B54A 5HBMA 3ENQA 2QG9B 3GR1A 3GR0A 2H5JB 2VKRA 4KFBA 4I67A 3FJ2A 4OJHA 1VC5A 4LSLA 3DLGA 1N34F 2CG8A 2WHOA 4Y3CA 2DRAA 3G9CA 2AV5A 2YKOA 3ISZA 1L3KA 1S49A 4JB8B 4OYOA 1AFIA 3PJWA 4QU6A 2LU1A 5LMUF 2V68A 5F0WA 2H5IB 2O67A 2HRUA 2IAJA 3KHRA 2F4VF 2LQBA 3FNNA 1RLCL 2FGCA 4F36A 3MWBA 5ETSA 1S1WB 4F25A 1ZAVA 5CCLA 5L39A 1S79A 1Z4UA 4Y6IA 1XJWB 2FLOA 1IBMF 4NLXA 4NA1A 3JB9k 3CJ5A 3TAMB 4LJMA 4DZ6A 2HVHA 3TEGA 1RCOB 4NOHA 4P9SA 1CVJA 2GZOA 2V2KA 3CJQA 3VR1A 4WYLA 1DY3A 4I6WA 2KM8C 5JMNA 4A4JA 4O0IA 5BR8J 4LSNB 1YSJA 1HBOA 4TKTA 1N5QA 1HW8A 1YQHA 3OTDA 1XK8A 3ETOA 1HMVB 2RRAA 1TMMA 2OH2A 4LFBF 3WC0A 1LFPA 4DV7F 1WF1A 1FNOA 1JLAB 3ELHA 4ZLNA 2VQFJ 4DL5A 2P6TA 5A8WB 1YX2A 2VFVA 2DR8A 2G1DA 4X66J 2V9WA 4LF7J 1UPPA 4M1KA 4DR4J 2FJVA 3MGJA 5HL7Q 1KWMA 2P6SA 4AL7A 5F8HA 2W7OA 1L3SA 4W4MA 3M6UA 4ED4A 1KFDA 5I42B 3OSPA 4K0KF 4KHPF 3M2VB 1M5HA 5E41A 2EBGA 1U1LA 5KT3A 1PG5B 1FEHA 4ILMA 1AZSB 1T9XA 3BGRA 3L4BC 7AT1B 3H0PA 1SKWA 1WKKA 5BJRA 4P74A 4C3KA 4NX9A 1FKAF 3T3FA 3EE3A 4MK7A 3CD5A 1HNXJ 3D0HE 4PXCA 1UL3A 4DPXA 2NXNA 4EO8A 1IKXA 1NJZA 1JLBA 1S12A 2GS8A 2YWHA 3ISNC 3H40A 2WCXA 4M5GA 2YX1A 1SL1A 1N6QA 5FDLB 1KTQA 1RADB 3FCHA 3IR6B 1D8ZA 1HQEA 2DGUA 2DISA 2QL7B 2YQ3A 3MEGB 3MM6A 4PG6A 2AW0A 4ETZA 1S9GB 2OFGX 1V3ZA 1U45A 2M5YA 3PO5A 4B3SJ 3NNCA 1BUXA 4C8YA 2UVVA 4DQPA 1TL7A 1X31C 2A10A 3NCRA 3BGLA 1JKHA 2JFDA 4DUZF 3E2EA 3K5LA 2NLWA 2MTLA 4GO5X 2CNKB 1CULB 1W26A 5K8PA 2XMAA 1KQGB 2DRDA 2HZAA 4K4SA 3P3DA 1NDLA 5HQMA 5BYRA 4DL0C 3KHHA 1XIQA 3ET6A 2JLGA 4RBVA 4J37A 2OTJS 4XDDA 1GX5A 1X4AA 2FQQB 5EWEA 3MI7X 2A6MA 2BANB 1BD6A 1WG1A 1Y3KA 1F3VA 2KT2A 2ZKUA 4IO1A 1H7WA 4LVNP 5IWAF 4WK3A 5IWAJ 4PWDB 1FJ7A 2XWXA 4KQZA 5G0RB 2F5GA 4NYZA 3DLLQ 3BYRA 5HMWA 3M9NB 1PAEX 3MF5A 1AZSA 4CO4A 3EVOA 3S1TA 2QLXA 2XZWA 2DEJA 3MPVA 5KFKA 1X5OA 2UVRA 2Z8QA 3MUMP 1WACA 2J0WA 2OSRA 2J7UA 4KC5A 2UVWA 3EVMA 3A13A 4URSA 2V8VA 3TEHB 4DR2J 4TN2A 2HMIB 3M8QA 4KY3A 2XGQA 3VAFA 2HQGA 5HP1B 4JI4F 1LKZA 2A2CA 4E2FB 3N01A 5HVGA 2XO7A 1M5VC 4YOEA 4NZ6A 3KK3A 1S99A 1B4SA 2QLJB 3I0SB 3M1VB 3PG9A 1R27B 1LWFB 1WOPA 3SQOP 3FZBA 3AB4B 3P4UB 5A76A 4QPXA 2XQCA 3TAPA 4KIAA 3QGIA 1H2UX 2YKAA 4HT7A 1KLMB 1H73A 3U02A 4BS2A 3KUGA 5DDOC 2ZH3A 2VOOA 4CQ1A 2WVCA 2VPWB 4NLPA 1XC9A 1IUJA 1EX8A 1J5EJ 2CNLB 2CNNB 4ZVFA 4X2BA 2JZ5A 5IOLA 4LF9F 1R8BA 2YBVA 2BBEA 3AXMA 3CXCR 3M32A 4DV2F 4U6PA 4K4ZA 1NXIA 2GVDA 3N5BA 3DI6B 3OR2A 4I6AA 1R6YA 3HI9A 2HAFA 4OZLA 1TL5A 4O3RA 1I1GA 1SV5B 4YY3J 4ECUA 1UA1A 2B4VA 4DCJB 4DPUA 4YHHF 4LF6J 1RWOB 2DCLA 2H4WB 3KG0A 4HEA9 4LRAA 1N33F 4DS4A 1PYTA 3PDNA 4HHJA 4GVLA 3UDVA 2ZH4A 1GEHA 1OY9A 1REVA 3I9V9 2MHNA 3PVXA 1JNZB 3G4SS 4JI4J 1FDDA 3B4DA 5KFBA 2A2DA 1Y5IB 2CQ2A 2P5VA 3LANA 4DEZA 5LT5A 1RCXB 4KE5A 1RP5A 4ZP9A 3SQGA 1KD1T 2XWYA 2C2DA 1HFEL 1ZS6A 4UF4A 4ZLPA 3HHEA 1MU2A 5KG7A 4KT0C 1N32J 1IKWA 3R1LA 3PJXA 2B8QA 3T1HJ 2NXJA 3D6HB 1VDHA 3P6YC 3KG1A 4NEZA 4RU2A 1RT5B 4IUFA 3GQCA 3M8YA 5L1LA 2ZOFA 2ZWPA 5E3QA 2DNPA 2IBOA 3HHKA 4DFPA 5GADI 1FWLA 2V4JA 3CD7A 3KWMA 4D3HA 4IR9A 2RVJA 1PJ5A 2C42A 3V4IB 1A9NB 2EFQA 1LWCB 3M2RB 4H4OA 4DV3F 2OGUA 2XZTB 4YEAA 2NYIA 2LCWA 4ALZA 4HHHA 3SFUA 4C6AA 4E0DA 2RS8A 3T41A 3SCKE 1S59A 1D1UA 3PIPQ 3S6EA 4K2JA 3R5BA 4KGVB 1WOOA 4H4MA 2RF2B 3CUNA 4A8MP 4A8YA 1KONA 5EHHA 3BQ2A 3HFVA 3KLHB 5B0AA 3CCSS 3JSBA 2VG5A 4RW8A 3T1YF 1WC0A 5LXYA 4J9RA 3EZUA 2BE2B 1YLXA 3OXLA 4N8NA 2CRLA 3UDEA 4DR3F 1QVFR 1O8BA 1QUPA 1SKUB 4FP9A 2OHDA 2EPIA 1SCJB 2LA4A 5DRKA 4CM0A 2J6SA 3HT0A 1HWUA 1A6LA 1FDBA 2XMWA 1WHYA 4ZVSB 5C2CA 1W2BR 2AYGA 5AE3A 5D8HB 1RU2A 2CPFA 1YWXA 4YR3A 1VBXA 4B9MA 2B7BB 3DLBA 1CJTB 3HK2A 3FQKA 1PILA 1RAAB 3SXLA 2E7VA 2F7VA 3GFZA 4RUBA 3OL7A 4FNHA 3CE8A 5JVHQ 2D74B 2Z2LA 3K17A 3OPKA 4XK8C 1U1NA 2CPIA 3RJMB 1D3WA 1FA0A 2R4FA 3FMWA 3HKZD 2B9WA 4FF1A 3HFKA 1IKVA 4IG0B 4WBFA 2QEXS 1T8EA 4X4QA 4MFBA 1WC4A 3Q8VA 3TQEA 4X64J 3CCMS 2NREA 4RNHA 3M1VA 5F0UA 2YKMB 2R7UA 1VQ4S 3ZO7A 1TK8A 2IVMA 3W7BA 1KVIA 3JSRA 1OMSA 3K59A 2W2PP 4K59A 2QA4S 1DJ0A 5I3UA 5LSLA 4A8FA 2D3UA 3IG1A 4AYBD 5DDPC 1HD1A 1VOMA 2ZC4A 5LSOA 4WCEQ 3QJJA 1NH8A 2E7XA 2VZ9A 4ZCMA 4Q5VA 4B9VA 2HFUA 4KR0B 3MCNA 1Z2ZA 4QIFA 4TQSA 3LPEA 4Z7YA 5C42B 2LLZA 3HPOA 3SZ2A 2ZD1B 4USTA 5CA5A 5D3GB 2HHPA 3WHIA 4ZLLA 3CCWA 2D3OR 2KZMA 1VGYA 4J9VA 3LQVA 4QOTA 4Z7CA 2VBYA 5J2NA 2XZDB 4URQU 2FVSA 3FZ2A 2QA2A 1RYSA 2HFVA 2CQIA 2OPPB 4G1QA 3PRDA 3MM7B 1WUUA 3MEDA 4C98A 4CNYA 1U2CA 4DQSA 3H5UA 3P45B 1CJKA 5D4NA 1T05A 2YNGB 1HARA 1WEXA 2LEBA 5FLXY 2XMMA 4AUKA 4KPYA 3W9HA 1IM4A 4JV2A 3DU6A 2OEMA 1C0TA 1MROA 1S72S 1GTHA 2VG7B 2G2YA 3QO9A 2N4DA 4LF1A 3V6HA 1MWQA 3TJAA 1WDTA 3Q8RB 2IFXA 3MUTP 4DV7J 2FY1A 2PI4A 3J80U 3C15B 3M8SA 5D6GA 5KFFA 1MNEA 1JJ2R 5HI7A 2XTJP 1JLQA 5J2QB 5K9FA 4WFNQ 2V4RA 2CPZA 4HLBA 3PEHA 2ROGA 4JP8A 5HVHA 1IKXB 2NXEA 4RLEA 5EN1A 1G4CA 3PYDA 2IRYA 2XHCA 2OP5A 1MG7A 2DD8S 1HA1A 1HWKA 4X4NA 1KFSA 2QV6A 4CO5A 5IS2A 1FI4A 2WVDA 1U09A 3OJUA 1S0OA 3PY8A 3V81B 4OYZA 1NNDA 2ASJA 2YKQA 3CPWR 1BC6A 2HLUA 4O4RA 4RR5A 4H4MB 3GZ7A 2XI3A 1RWXB 4ZVGA 5U47A 3TA1A 1FXLA 4ECRA 1SC6A 1WHWA 2LQ5A 1Q5VA 3ENAA 4HYKA 4OI6A 3CCUS 2VPXB 3JS9A 4QW9A 1MWZA 1KOHA 1UW9A 3NAHA 5EX0A 2MZ1A 2GMJA 2QZ8A 1EHWA 2UVUA 2XSJA 1Q1KA 3CJ0A 1WWHA 4D3GA 3HVRA 3GMGA 3GJSB 2HRYA 4PXEA 3GYNA 3QPIA 3I82A 1Z1ZA 2GQ2A 2FYXA 5GADU 1OYEA 4DOZA 3TJ8A 3ZTPA 2QA1A 5B08A 1VQ5S 4ZVHA 2BYCA 2VC1A 2AJ4A 2C2NA 3FVYA 1EQ0A 3UN5A 3IG1B 3CW2C 2AU0A 2XNQA 2AEJA 3PTWA 1N48A 1R0AB 3UCZP 1VC0A 3QT6A 1BXNA 1IXKA 5F3ZA 3EPIA 4WZMA 1ZYQA 3IXQA 1EAYC 4F4WA 1ICEB 2OD6A 3FGVA 3HHLA 2WVEA 4P73A 5KFUA 4PABA 3PFOA 1WI8A 3G6YA 5KFTA 3J7Z5 5KAKA 1E6YA 3IN5A 2DGVA 4EZ6A 4G6VB 3G6ES 1VQMS 2Z2MA 3CJ4A 3ILOA 3EUNA 2J9EA 4NEYA 2KFZA 4OYPA 2I6WA 1P1TA 5FD1A 3V6DA 4EFAC 3TI0A 1YTYA 1WDDA 1J5OB 3BDPA 4N7TA 1U0HA 1NJXA 5AXMA 3TUJC 1RISA 1UAWA 1HI1A 3H90A 4OJ3A 5C42A 1K9MT 2UXBF 4ZP8A 3UVJA 1HNWF 2N7YA 2B4UA 1UTAA 4ZIWA 3LP1B 5KFVA 2KFYA 4DFMA 1YHQS 3H5XA 3GFYA 1RAJA 3DNCA 3W9JA 2ZH2A 4IFYA 3G6XA 2PEBA 1Q95G 2Z56B 1KHVA 2BW7A 1WC1A 1CJUA 1JJCB 3OTOF 4HI1A 1S1UB 1RHJB 2MY7A 2I2YA 3JTOA 2C1EB 1MMNA 2M9KA 4ED8A 1BWVA 5LM7E 3X3UA 3QZ7A 4ZVTB 1FRIA 2EW9A 4DL3A 5EGYA 2R7OA 3SV4A 1F2HA 5C2GA 1GXTA 2DNOA 2DVIA 3DCAA 1GMWD 5ETQA 4ZK7M 3KHLA 3FCWA 1FRHA 3GIMA 1SJRA 2DHSA 2E1CA 5FJ4A 1C0UB 1OPIA 4P2FA 5B0CA 1R0AA 4OYWA 4LIRA 1EETB 4CO1A 3KNAA 3WDOA 5ETNA 2LQ8A 2EC2A 2D3ZA 1NO8A 2WBRA 2FDNA 3MMAA 4LR9A 4WE1A 5HANA 3G96A 3US5A 3DLHA 2LP4A 3VGUA 1U26A 2A18A 1WD6A 1FDNA 4P52A 2AX1A 2B6AB 3BSAA 2J7WA 4K4YA 2MZTA 1PSDA 2Q6BA 3BBFA 1NKBA 4DL7A 1EKRA 4XPEA 1SI9A 4GO7X 5D78A 1SB6A 2RE1A 3MCMA 4PWDA 4ZVRB 4JI1J 2FJAB 1NB7A 3I0RB 2BANA 2GJIA 2V8GA 5GAEI 2Q3PA 1S6QA 2GCFA 3GFXA 3JQMA 4I69A 2MQPA 5A2QY 4DPYA 2DXEA 1YBTA 3QNWB 4JI0F 3N5FA 2ZUGA 1JLFA 4AL6A 1D0EA 1VISA 3M4XA 1MLAA 3MM5A 5A8KB 2JEIA 5A0YB 4N47A 1NHKL 5L8RC 5DQGA 4P71A 4MK8A 2QL5B 1DTQB 5THWA 4FF3A 3KLVA 2DH8A 2BE9B 3MM8B 4DG1A 4F4YA 2DGTA 1SUQB 3ENWA 2DJWA 1JKHB 2IM3A 2QSWA 3GJRB 3QAEA 4AT1B 4EI2A 4IOCQ 3LGHA 3NL0A 1U1RA 2AJFE 3DHXA 4RUAA 1N34J 2EI5A 4NXNJ 3BH6B 2BM1A 3QJPA 2MKCA 2NCKL 1VLOA 3NGKA 5D15A 5D0EA 5KFEA 2ZBRA 4ECTA 4KH0B 1XMQF 3OTBA 2FVCA 2RJZA 3IS9B 4NPOA 4Q0BB 4DV4J 5A8KA 2MEWA 1RT6A 2D3O1 1X60A 2IM0A 4TQRA 3C6TA 2OPSB 1N56A 2J8AA 2Z4PA 1MROB 5L9XA 5E3RA 1HNZJ 4OL8A 2W25A 4RNOA 3HSGA 2VIHA 1GT8A 4FZVA 1B0VA 3AOAA 3QRPA 2ZZNA 3MURP 1EARA 2DHGA 2IDLA 3SCIE 5GMEA 2V2ZA 2VQEF 3N6MA 3NOCA 3L3CA 1PBAA 4ES3A 3OBIA 1GXLA 3NMAA 1UWBA 5DLGA 3KDNA 5E5NA 1VYAA 1UFLA 4PG8A 2UUCJ 3ICLA 1TZ0A 1X4HA 1T95A 3V6KA 4X66F 5B09A 1DQ9A 1ZOTA 3ILLA 3JQKA 3E51A 1T3NA 4C8KA 4M5DA 3MPYA 4MIAA 5LXRA 3NGRA 3M9OB 2ROPA 3QGPA 1RBOB 4WP8A 5KFAA 3KKFA 4B9NA 3SSRA 4J9OA 3DOMA 2ZJRQ 5L9NA 1NJIT 1K1QA 2GVZA 4OYIA 1WG5A 2ZE2A 2R7VA 1RTHA 1C1BB 1IBKF 4ES2A 1BE4A 1JLAA 1BWEA 3EGZA 2AJQA 1PC5A 2VPYB 1HWLA 1T03B 2AJ2A 2CWXA 4PKDB 3D1OA 2DRBA 1VQ9S 3NKYA 4JI8F 4CLZA 2KZZA 1YZ7A 5AXLA 2DB1A 4LFCJ 2PIIA 3PV8A 5KG6A 2E9ZA 1MN7A 1RT3A 1YZ6A 2IJFA 4Y34A 1NJYA 2Q66A 5F8NA 4AXIA 1R8AA 4C8NA 1RHUB 4DSEA 2O66A 1VIOA 2AIRB 4FN5A 4ZVEA 4KBIA 2BJ1A 2Y1LB 1ZM9A 3CJTA 3IBFB 2L41A 1JXEA 1QE1B 1IWGA 1U7LA 3IRWP 4AQYF 4DQRA 2VODA 3A1YG 2GA7A 3U1MA 4KB7A 1FESA 2MPUA 3QWPA 4JOUA 2PDAA 1G7CB 4NMLA 3TP2A 3VVTA 4C0OC 3NBPB 5HQ8A 3UD5A 3ZTSA 3CC2S 2COLA 2AYEA 3K89A 1Q7YT 1Q82T 3FC9A 4RWXA 1L3VA 4JI3F 2F8HA 3TZYA 1AUDA 1M1KT 2HSEB 3MM8A 4LRDA 5D4PA 2D69A 4X4SA 1FXRA 2ZHAA 4HDGA 4YMEA 3N79A 3I31A 2RQ4A 4I4BA 2YH1A 5E0OA 3BJYA 3R7SB 3MM5B 4LSLB 2EWHA 3AJ1A 4WTYA 2QMUB 3CMQA 4Q2LA 3RBZA 3Q8PB 3MTJA 3LWMA 3D1HA 2W9BA 2MQLA 1R8PA 1YITS 4X4PA 2RS2A 3DLEA 2LMIA 1U6ZA 2Q79A 2V50A 4K5SA 1D09B 4BWMA 3FSIA 2KT5A 3RB6A 3CC4S 3NP5A 2Y0SD 3ITHA 3ZZTA 2Y1RI 2HNYB 4F02A 2FHKA 4IH7A 3CDAA 1OWXA 3GIIA 2KRRA 2E5LF 4V19X 3BGRB 2ZITA 3CJRA 5LSRA 3QRRA 5ETOA 4C2MA 3JYTA 1CS4B 3ZNUA 2LU2A 3CJKB 1WC6A 3KYLA 1HYSA 1JIHA 4ILLA 3F41A 1RZMA 4FS2A 4QYZJ 1YBAA 4JI5F 2BMBA 4J9MA 2MKHA 4P2MA 5LMUJ 1N36J 3AHPA 2E1PA 2BJ7A 1PYSB 1UVIA 5KFOA 2GAHC 4HDHA 4LMZA 4CYUA 3MDFA 3W61A 5A8WA 3PW7A 1BLUA 2RQKA 3KFWX 4NL5A 3Q2TC 4DR7J 2HNDB 2ZH5A 1RWWB 1RWNB 2FZGB 1TAUA 3NGSA 4DXLA 1ZETA 2YPZA 4QCLA 3CGIA 5ETLA 2Z57B 4ECYA 1S1VB 2CWKA 3CIZA 5M2PA 2IJRA 2KHDA 5C5JA 4N8OA 3RUBL 3KK1B 3UD3P 2GIFA 3OW2R 4A8QA 4HKQA 2HHVA 3QT7A 3PR5B 1FWPA 2FD2A 3L95X 2K7KA 1S9EA 2RD5C 4LF4F 2ZBIA 5KFSA 3NS6A 1F5BA 2ACYA 4DL4A 1F0XA 4L72B 1QSSA 4PWUA 3RGIA 3BSNA 3S7RA 3I55S 3TX8A 2HVEA 2F65A 2OO4A 1FE4A 3IA0A 2W2MP 3H7HB 4RW7B 3SDEB 4P2SA 2HQ3A 3F44A 4RJVA 4F4AA 2B9EA 3POTB 5B0EA 3PO4A 1OY6A 4QYRA 1TKTB 1QLNA 1RHRB 4UT4A 2QJ3A 1N4LA 1RWMB 2GHVC 1RQ0A 1R3NA 1QE1A 5DM6Q 4X4TA 1UVMA 2CVEA 2D7SA 5KT2A 3L9ZA 2FB0A 2DPJA 3M32B 2ADBA 3SV3A 1VLYA 2VUGA 4W98A 4BHQA 4Q43A 1IWAA 2XS5A 3I32A 3GU0A 4QIGA 5C25B 4M8LA 5J2MB 6FDRA 2ZH8A 2VDHA 4OV1A 1UFKA 1EP4A 4CLPA 4ATNA 1KQFB 4YUDA 4NLRA 4C4WA 1UKUA 1U49A 2AT1B 4UUWA 4PRFA 1ZM3A 3SDEA 3MAHA 4C8LA 4I68A 3OV7A 2K1RB 2GAGC 4U96A 2UXDF 2WVBA 1YJ7A 2V8DA 4ZKAA 4FNIA 1SQFA 2H51B 2AEMA 1FX4A 5HN0A 1APSA 2F40A 3J81Y 3KK3B 4ED0A 1I5OB 1C1CB 3K5MA 4USIA 2FVRA 5KFNA 4CLYA 1SH3A 5J2MA 2KXFA 2W01A 4IYQA 4G3IA 1ZA1B 4U7UK 2LDYA 4M5DB 2YKMA 2YKPA 2EFPA 1AYEA 2RRBA 2PA3A 2UXCF 1FD2A 2GGPB 1WHVA 2UV8G 4MAKA 4J9LA 2MKYA 3I5CA 2NSCA 2CQGA 2XY7A 3CCJS 2HLTA 4LBHA 1GTEA 3VAIA 5KFXA 2AYMA 3ISND 5G0RA 2IBKA 2W1BA 2DNMA 3DDNA 3BGFA 3BPDA 4J9KA 1NK9A 4NE9C 3HHLD 2HIQA 1XWLA 3BSOA 1MWYA 3MOZA 4DHVA 4XPCA 2VPZB 4MYTA 4R5PB 2WK4A 5KFCA 5GAGI 4X4VA 1JWWA 4IRKA 1HI8A 5KFHA 2WW8A 3Q2SC 1RT6B 2HGLA 3D28A 4PPDA 1GXUA 4YQWA 3GV7B 3Q8UA 3H5YA 4DR3J 4OI0A 1W25A 2Y9HA 1FTCA 2QMXA 3NEKA 5HJYA 3M8RA 1LXNA 2HZVA 4DQIA 4FF2A 2L48A 1FKOA 1VI7A 2QA4G 1FJGJ 3D2WA 3IFEA 1VBZA 3KK1A 1IKYB 3LP0B 3CNQP 1VBYA 4OYBA 2PFFB 4KHPJ 3PX6A 2HNYA 1LW0B 2WSCC 3UD4P 1NK5A 1PYOB 4KH1B 4RW4A 4UOFA 2DNZA 5ETTA 1U1OA 2G4BA 5G4DA 4K4TA 3VCDA 4DG1B 1JLEA 1RWPB 5H9EK 2FIUA 3HJVA 3HULA 1SQGA 4DI6A 3G82A 2V94A 2YPYA 2XMKA 2OPRA 5FDLA 3CCRS 3N28A 3CCVS 2MKSA 2FTRA 3SBMA 2V4QA 1R89A 2BVZA 4OIXA 3OHBA 1HNXF 4B9LA 4LF5F 3HO1A 3W8GA 1HYSB 4H4OB 1CBKA 2F4FA 2CPXA 2RHQB 3IP0A 3T1YJ 3IC1A 3R3TA 4ZVOB 4DN0A 5ADZA 5IXUA 1OS5A 4QWEA 4Y2CA 4J5OA 5KFRA 2DNNA 2RU3A 1VQ8S 1R43A 3MPWA 1I94F 4ELTA 1YK9A 2DGXA 3BM7A 1FVQA 3R7NB 1IJFB 3R5JB 4BWJA 4BCAA 3G8SA 3TQ1A 4JV1A 2R7SA 2EC0A 5DO2A 3A4TA 1OO0B 3BQ0A 1IBLJ 4RNFA 1F5AA 1K1SA 1RA6A 1RTIA 2LXIA 1HD0A 3M2VA 3MEEB 1ZBTA 4C48A 4ED2A 2KM8B 5KG5A 1RTDA 4B3RJ 1REGX 1Q53A 2FVQA 4DX6A 5DQHA 4F3OA 1EETA 3ONQA 3UR0A 2W9AA 1SJQA 1S10A 3IO1A 3KHGA 3GPAA 4OX8A 5JJBA 1N33J 2U2FA 2UUTA 2B5JA 4AD6A 3PKYA 3B6BA 3LWLA 2OEKA 1CPZA 5D77A 4CO2A 4QYZK 2QL9B 3C46A 3CD0A 4ANEA 4RBUA 1CC8A 4QIEA 1VQLS 4M5MA 2DO0A 2DCUB 2K06A 3A3PB 3KOAA 4LF4J 4XAKA 2OMOA 3ZNJ1 3MFIA 3QFWA 3AOCA 1GK8A 1O51A 4WFXA 1RTHB 4DSJA 1HL6A 3T1HF 2GVZB 3UO0A 2JJ4D 2DGOA 1SV5A 2XCPA 2DHAA 2DHXA 4IFYB 3K58A 4WIQA 2D9OA 4IDKB 1V6HA 1WI6A 3ZZOA 1CJTA 2V0NA 4A47A 5CABA 4CCHA 2WRMA 1RT7A 1BGXT 1JJHA 2XY6A 2I38A 5KG2A 3QLHB 4QWDA 2ZH7A 2HVIA 1S1WA 2Z0GA 1S6PB 1RT3B 1Y9OA 1HQUB 1R7IA 2CPJA 2CZ4A 4FYXB 3C19A 4U67Q 3PFEA 2E5HA 4DV0F 4ECZA 2OTLS 3MR5A 3HZEA 4AL5A 1T0TV 2QO3A 5J1NA 3I9ZA 5FLXU 1SPBP 4P6QA 1KLMA 1WC5A 2K8GA 5KG0A 5J1EA 4Y2KA 1E6YB 2GMHA 3K5OA 4WP9A 3GIJA 1HBUB 1S57A 4LBIA 3NY0A 4ZA1A 5HLFB 2UU9F 3R5AA 2XO6A 1URNA 3MTKA 3H98A 3W3SA 2HHQA 3RBXA 2ZE2B 4ZPTR 2R3VA 1FEEA 2NUUG 4O4GB 4N41A 3TNVA 2UUAF 3GP9A 4LF8F 1YBUA 3A3NB 2C2RA 3RR7A 3FFIB 4LFAF 2FLLA 2SXLA 1BQMB 2HPUA 1ZM4A 2BZ2A 3HVTA 2B4PA 2QYCA 4UOCA 4LFAJ 4CH1A 3CMES 1IN0A 3W60A 3AA9A 3C16A 2ZUAA 4U8YA 1T9YA 2VD3A 3R2DJ 1UW4A 2CPYA 1LXJA 4XTTA 1IR0A 1UETA 3IBCB 4S0MA 1S48A 2W8KA 4Y2AA 1S4EA 1FXDA 1K8AT 4FF4A 4WXWA 3H4BA 1XMOF 3QFHA 3BKTA 3KUHA 3ILIA 1T9WA 1DQ8A 4CTAB 1V9OA 4DV0J 4N56A 3GYGA 1IKWB 2QN6B 2FHOB 2JC1A 5CD4A 3MAQA 1U2FA 3B8HA 3NRBA 1B7FA 1RBLA 3C14A 2M52A 4ICLB 3MM9A 4UQTA 2MB0B 1TFWA 5EWFA 2LFVA 3NWRA 1J27A 4I2QA 9ATCB 2JWNA 3RG6A 3PXGa 2HG4A 1RHMB 4ERDA 2MMYA 2X1BA 2C3PA 4F67A 3SI8A 1X5SA 1RWUA 1REVB 1XN9A 4J9NA 1RB0A 1NAQA 3Q22A 2FC9A 3SCLE 2IM2A 2MQMA 4ZIVA 2P9EA 4FYYB 2FHJD 3W63A 3GLJA 2VQFF 3RRHA 3A8EA 3DC2A 4CLUA 2VONA 4I2PA 2NPIA 1HNIB 1JMTA 3I5BA 2ALZA 4MTPA 1VQSA 1HR0J 3MPUB 1KNZA 2FZCB 4O4GA 4O3OA 2ZBQA 3TZWA 2MQNA 1QAIA 2CQ1A 1PCAA 3M8PA 2WZ1A 4A8WA 1VQPS 2CDQA 1WORA 2J6TA 2N3LA 1UPMB 1YJTA 1CEZA 1G2EA 2HVDA 4JI5J 3P5BP 3EDRB 2QFIA 3EGNA 2YX4A 4C3MA 2OLWA 3BO4A 3W5YA 2KYXA 2DH7A 3ZTRA 2E7WA 3FEXB 3MAAB 3TR5A 4PQUB 2ILYA 3R6GB 4NASA 4DMZA 4RU9A 4BDPA 3W65A 4CO0A 4RBTA 4YB5A 1XR6A 5ETMA 4Q44A 4F4XA 5AT1B 3R1HA 2HFNA 4OYAA 3ZC4A 4M5JA 1S6PA 2PO4A 4YN3B 3CJ2A 4FPIA 3ZTQA 4QWAA 1K47A 1M5PC 2M88A 3AD9C 4FYVB 4ZP6A 4CI0B 3N9UC 3PNIA 3CC7S 2RH3A 2QTWA 5J2NB 4DU8A 4H54A 2WBMA 2CQPA 2WOMB 2GJFA 3L7PA 1LWEB 1YJNS 3H2UB 2O3DA 2VFTA 4JI6F 2XNRA 1RBAA 5KG1A 4B3MJ 2VASA 3H8YA 4PG4A 3UNYA 4GMKA 4UTGA 3OVSA 4TU9A 4IRCA 4GC7A 4WFZA 2CG4A 4KO0A 2FLNA 2F1FA 4LRCA 4NZ0A 2OJ3A 1RI7A 1NHUA 2NYHA 2H1YA 3HHNB 3THVA 3QBCA 1U8SA 3VGVA 4JI1F 2CQBA 4MIWA 1H98A 5IT9U 1CJVB 1BHNA 1GFWB 1TL1A 5DG9A 4TVAB 4USMA 2RQCA 1QSYA 2XMUA 2XC9A 2MLZA 3ILJA 4M5HA 4PEOA 4A8KA 1SJ4P 3QYYA 2H54B 1U0HB 1G6BA 3UCGA 1NU4A 3AXKA 4JI0J 4K8RA 3QSIA 3S8SA 2JDJA 1NZ8A 1PJ6A 5MAOA 2Y8WA 1BQNA 2ZVSA 4OZ0A 1N88A 3EJMA 5T7LB 1I3OB 2V5HG 1FRLA 2XCAA 3IAS9 2DNKA 4KSEB 3N0VA 4ZOSA 4CDIA 3D0IE 1UVLA 3W5ZA 3E01A 2IC3B 1FDAA 2IPOB 2ZOGA 2PA8D 1C4AA 1QD1A 1T9VA 2CIMA 2FLPA 1S9EB 2BE7D 4CLWA 3DU5A 3T1AA 4FKYA 4WIIA 1V5IB 3WX8A 2ZC3A 3DMJA 1C2PA 1JLBB 2LQ9A 4RW6A 3IWLA 5HBMB 4DR6F 1EB0A 3PJ9A 1OY8A 2UUWA 2HHTA 3CCQS 4B9TA 4KGZB 5D4LA 2DH9A 1HBNB 2Q43A 3Q0AA 3B82A 3BKFA 1HI0P 3L09A 3BO3A 1JQGA 1HNVB 2W9CA 1FO1A 2V63A 3TUPA 1VHIA 2XB2D 4F0KA 3DMJB 4RW6B 5KT5A 4CM2A 1FKOB 4EMDA 4TU7A 1YIJS 1JLQB 3BGOP 2WONB 5H9EJ 3FBFA 2BRLA 3AJ2A 2Q6CA 4N76A 1GNKA 4PWWA 4N5SA 1F3FA 4TY8A 2Y3YA 2H9ZA 4YB7A 2I9SA 1OQ6A 4J9UE 5J2PA 1M5KC 4I56A 2VICA 4DV2J 2ZDPA 5CHCB 5DQIA 2MXYA 2JEFA 4G1IA 3C6UB 3KMQA 4HT5A 2ZVIA 5T14A 9RUBA 2DR7A 5AXNA 2PEHA 5EDWA 3QMQA 2HS0A 5B7WA 1UCNA 3HD1A 2EK6A 3GJTB 1KBRA 2IY5B 1HMVA 3UE2A 4WKYA 5KG4A 2OAUA 1GMUA 2B43A 2ZHOA 4NI2A 5L1IA 4FBUA 1RAIB 2PGCA 4LFCF 2YXLA 2OELA 3CSKA 4NLQA 3GILA 3DFEA 3KLIB 1FWKA 1T9TA 2LVWA 4B3TJ 3BB5A 1C1CA 3EICA 1YDLA 4F0HA 2IC3A 5JXSA 4ECVA 5D3GA 1N0VC 3CCTA 3B4MA 5L1KA 1RXOB 2HHUA 4MK9A 5DG8A 4URGA 5CYQA 2UP1A 2GC8A 3NBPA 3UNGC 3BEGB 1Q16B 2IAJB 4U7CA 1FRKA 5C24B 4QWCA 3MMBB 3UQSA 1M0SA 3AA8A 1LWXA 4C3LA 2EVZA 5I3QA 3EX7B 3B78A 2QLWA 2DK2A 4I6YA 4MJKA 5B0DA 2DNHA 1VR6A 3T19A 5C25A 2HHHJ 2M2BA 3MEDB 4W90B 1H38A 3D6MB 4C0HA 4OHVA 2VOPA 5DGBA 1IBKJ 1F6TA 1I51B 1X0PA 3MMCA 3TYTA 2CXEA 3G8TA 2C2MB 2OFHX 1IVZA 5DM7Q 1X9SA 4YP3A 3OSNA 1SIWB 3DM2B 1X9MA 2UUAJ 3POTA 3J81j 3MR6A 3MUVP 4GKKF 3BN4A 2XYHB 3GB0A 4KO0B 3I56S 4F0MA 4IQMA 2V34A 3LO3A 1N52B 2JOQA 3KLFA 1F9FA 1AW0A 3I0SA 3PM9A 2LECA 5KTQA 1RU1A 3W62A 3CJ8A 2FC8A 1DURA 2CQ3A 4LFBJ 1B99A 1A0OB 2D41A 2IM1A 4M5IA 3NOGA 2PE8A 5EX3A 3NG8A 1S7IA 3JTPA 3P8BB 1K44A 5GVQA 3TW0A 5E3PA 1VRTA 2BJEA 3TJ9A 3UDCA 3T5HA 2AYBA 4GC6A 2K3KA 2CJYB 5DDQC 2GW8A 1U1MA 1TKDA 1S97A 4RW9A 2QSFA 1SJ1A 3JSMB 5KFMA 3W9IA 1D9FA 1UWBB 2KXHA 1SL2A 2MSTA 3HFZB 2H3EB 3MEKA 5F41A 2POKA 3IAM9 4CP5A 1U24A 4F26A 3KK2A 3LAMA 3C6UA 4MKBA 2QT7A 3RR8A 3QSYB 2BACA 3KLEA 4WFAQ 4XDCA 4TY8B 2GQQA 4DSLA 3CCES 4JYAJ 1R8CA 2FJBB 3FSXA 4ID5A 3HDSA 2OKQA 1TK5A 2FUG9 3CB4A 2BDPA 1TFYA 5D0GA 3IS9A 1VFJA 2IVFB 1CULA 2C3OA 2YNIA 1B70B 3D54A 2V4JB 4FVCA 4LF5J 3KNGA 5KFYA 5J1PA 1Q81T 1P8GA 1XTZA 3QWUA 1XBWA 4LF8J 3OTEA 1HLWA 4PCQA 1RK8A 3K0JA 2ZNYA 2X3GA 1LFWA 4KV8B 4RWWA 2ZKTA 3LP2B 1SC1B 2BRKA 4ZPCA 2O5DA 4RZRA 3EGVA 1IJEB 2DY9A 3DLEB 1N5SA 5AXKA 3RW7A 4J9QA 2EFOA 2RIJA 3MM9B 3PYGA 3NCPA 5A0YA 2JX2A 2VG6B 1KOOA 2VJUA 3TAQA 3OFGA 4QR2A 2VBXA 1FX2A 2K7JA 1PC4A 2DT9A 4ZCKA 5GAHI 3M6XA 3A8IA 1QVGR 3AH6A 1OJ4A 2UV8A 3KG4A 1X5TA 1R0CB 2J9DA 4TYBA 3KJVB 3PW4A 3W2VB 1HHTP 1RHKB 2F9JA 1SVDA 1JNRB 2YNFB 4PYAA 4ZVUB 1B3TA 1LEOA 2J76E 2JL9A 2V6AA 2W2NP 4FKXA 2IYIA 3MFHA 1EJ7L 1X0FA 1S0NA 3A12A 1B7YB 1LQ9A 3IMQJ 3MXHP 2A6OA 1UWAA 4KAIA 1NDPA 1TUWA 4OX6A 4X64F 3ZTOA 4NYOA 1CSJA 3QIDA 3OR2B 1OSDA 2F9DA 4KKOA 3DDIA 2FHJA 3LOUA 1P27B 3IRXB 1RT4B 3LUYA 5HO4A 2MZSA 2W4DA 2CDRB 3E8OA 4OI2A 1FJEB 4OHYA 3BN7A 3LGMA 1Q7LB 5IT4A 2X7IA 3Q86A 1KEKA 3MR7A 4X65J 4MKYA 2CPEA 1JB0C 2DBBA 2RQMA 2GHPA 3SMZA 2A3JA 2B9XA 4F4ZA 1JX4A 2HFOA 3FEZA 1RWKB
chains in the Genus database with same CATH topology
3M2UA 2R8GA 3T9NA 4C9DA 2ZBCA 1ZM2A 2YNHA 3FMBA 1XNRF 4LSNA 1U47A 3NNHA 3SEOA 5ITHA 4U9RA 5E7OB 2XBPA 5CYJA 1UVNA 1SJ3P 2V8HA 4F3QA 1VK8A 4PPZA 4O23A 2OMLA 4ED6A 2HMIA 1RT4A 2E1AA 1WF0A 2AD9A 3TAMA 2VBWA 3LP1A 4IG3B 5KG3A 1SL0A 2CZVC 4HVZA 2DIUA 2JEGA 1CG2A 3DN9A 1FJGF 1R8HA 2RSQA 4DN9A 4X65F 4DL6A 2YKNB 2HWIA 4DUYF 1P6TA 3CDBA 4P7VA 4OI1A 3GV8B 2BJDA 2LYVA 1ZAXA 2XHWA 2YNFA 3LF0A 3OLBA 3OVAA 3RB3A 4M94A 4DFJA 4V19J 4F2RA 2E5JA 1LWFA 2AX0A 4NCGB 4TXSA 5H1SV 3VAMA 4DPOA 2MQOA 4FXWA 2MZJA 3P5TL 3WBZA 5LMNF 3PHEA 3LGNA 3OXFA 4HTIA 1DZ5A 3DRRA 1BY9A 4KFBB 2C3YA 1YI2S 3MD3A 2FHMA 3CDUA 2W4PA 3D0GE 2NS1B 2HHWA 3AAWB 4KHMA 4WU2A 4YDXA 5C24A 3MEEA 1N0UA 3K2YA 3OL6A 4RW4B 2B9YA 2DO4A 3LP2A 5FIIA 1LW0A 3AB2B 3NWGA 4NLYA 5IQQA 3AQOA 4LT6A 3RYLA 3DGPA 3MAQA 4Y28C 4PQAA 1JLGB 1L3TA 2DGWA 1IKYA 3BSCA 3LP0A 3OUYB 3DRSB 3HKWA 2XSJB 1S9GA 3I5AA 4R8UB 5DLFA 1KC8T 1F5CA 3W2WB 4DDFA 3J7YU 1WEZA 2LXUA 1JJ4A 3IBWA 3HT3A 2HHXA 1JLFB 3FSYA 2N7CA 2C22A 1WHXA 3CEDA 3DRPB 2ZFHA 3MOJB 1QUVA 3MCSA 4R5PA 4A8SA 2ILZA 2W4CA 3QIPA 4EWTA 1SKRA 3IGNA 4LQ3A 2MQQA 3M30A 3OUYA 1N5YA 1JLGA 2O01C 2PMHA 1FD8A 4RW9B 5K8NA 4ZP7A 3JSMA 1RYRA 4IKAA 5J2PB 3VQSA 1RGVA 4WE1B 1S9FA 4QIVA 2GQCA 3UFCX 3U1LA 1OPZA 4CH7A 5J2QA 1DLOB 2MJUA 3DLKA 3DYAB 3HX9A 4J9PA 1XERA 5GAGU 3E3XA 1FNMA 3P96A 4M95A 3TARA 4WFYA 1WG4A 4TLRA 4O3QA 3UW1A 4YB1P 1HBUA 4ZS6A 4Q2MA 3OR1A 4G1PA 3ULHA 1SXLA 1QY7A 1VQKS 1U2RA 1Q8LA 2AP6A 3GIKA 1QJHA 2CQ0A 1EP4B 2BM0A 1X4FA 2FY1A 2YNGA 4X4UA 4PR6A 4GKJF 4EYIB 3VF0B 4RX6A 1X5PA 1Z2LA 5KFQA 1NK7A 2RKIB 3NAIA 4JBCA 5I4MA 4K4WA 4LVOP 2FJDB 5T7LA 3T5JA 2ZZMA 3O6QA 2ADCA 4OZ1A 1UP1A 2CPDA 3HLUA 3G6VA 2EG2A 2JFKA 1TKTA 4KHRA 1J5OA 3D5MA 2YNHB 1VIXA 3VALA 2XS2A 2HGNA 1RT2A 2IRUA 3R5CA 4DL2A 4LIWA 4LUBA 2M8HA 5F8LA 2E1RA 2VA3A 1VQYA 2B56A 3ZZYA 2LA6A 2EBEA 4PXBA 3LALA 3WZ0A 3L7OA 3H5SA 1MMLA 4ECXA 2E9TA 2WSEC 1TKXB 3IRXA 3WX4A 1Q4RA 1YJRA 2VV5A 4B08A 3EGZA 4KKOB 1N36F 1DFDA 4MFBB 1RTDB 3VQTA 2IYGA 1ROFA 1VRUA 4JYAF 2KTQA 3H20A 2LDIA 4UW2A 1TUVA 2N82B 2R8KA 2YH0A 1ELOA 4ECQA 3HXMA 3V6JA 1VMBA 3LPYA 3CT9A 1F60B 3ZZRA 2J7KA 1VC6A 4ED1A 5CZVA 1HBMA 2VL1A 2RKIA 1TVRA 3IR7B 4R25A 3BF4A 5HROA 3WC2A 4CO3A 1TR0A 5BR8F 5B0FA 1NZAA 5IQ6A 3BO2A 4TNOA 1AXQA 1SBRA 3CIMA 3U7JA 2MKKA 3TVKA 1HNVA 2W9CB 1NK4A 2NPFA 4OMFG 1HBNA 5AJ3F 4DSKA 4QR1A 4QBUA 4QIWD 1I6JA 1Y0HA 2MHEA 1E6VA 1H2TZ 2ZDOA 4QZVB 3UDLA 3HZGA 1Y5LB 3M8PB 2XSFA 1A7GE 4QWBA 2YNIB 5E2QA 1TV6A 5HROB 1DLOA 1HWJA 4B3OA 1TQLA 2MKIA 5KFDA 2BV3A 1H0HB 3J7A1 4PXDA 2PMZD 3T5LA 3JYTB 3V4IA 2IRXA 3IWNC 4KTQA 4IR1A 4C8OA 1WNEA 1QM9A 5E3CA 3M30B 1N5YB 3TVZA 3VAHA 1IQTA 3TO8A 4DFKA 2MZRA 5CYMA 3HP6A 1UJ4A 2E66A 5EWEA 5M2UA 3D1QA 2XI2A 4IO9Q 2GGPA 4N77A 4IH5A 4G1QB 2OPPA 1T7PA 4Z2XA 1MU2B 4BBYA 2JRSA 3CTRA 1KS2A 4DLEA 3I87A 1NK6A 4YR0A 4B3SF 5EWGA 5F9NA 3BR9A 4UY85 1FKPA 4HL9A 5IT0A 1RT1B 3DRSA 3EXCX 2RDJA 4MKAA 4FXDA 1UJ6A 2BA9A 1YVFA 3U27A 4J9SA 2H5EA 1CQNA 4EO6A 1WTBA 3H2LA 1S1TA 4YDDB 3G71S 3UPFA 1NRKA 1DTTA 2VB6A 1JLCA 2G13A 3C66A 4WFBQ 4RUCA 2IA0A 3DOLA 4PUOB 4W92B 1FHTA 4MYUA 3KTQA 2L9DA 4OLPA 3H4DA 4WJBA 2JC0A 4I7FB 1CQMA 1DARA 4USJC 3JAMY 1WELA 5KFJA 2HGMA 1QAJA 1FRMA 3GV5B 5HLFA 4C8ZA 5BYQA 3NMRA 2YY3A 3HF5A 4YY3F 4HI2A 4OLOA 5K14B 2A1BA 2B7CB 1LW2B 5KT6A 2R2RA 3CD6S 1T03A 4B17A 4DX8H 2R2SA 4DV4F 1UEVA 2YKNA 2C3MA 3CO9A 1HQUA 1F2GA 4ZMMA 1FERA 3QLHA 4FVMA 3BZQA 2C2EA 2BQ3A 3J80Y 2XULA 3M8QB 2F8EX 2VFSA 3JSYA 2JEJA 3BQ1A 1X9WA 4QU7A 1S1VA 1WEYA 2JLFA 4F8RA 3FEYB 4ITSA 4EGLA 4IH6A 2BW2A 4Z37A 1B64A 2BE2A 2GFFA 1ULRA 2IJNA 1RT1A 3BDEA 2AWZA 2G9OA 4I2QB 4IRDA 1DTQA 3KLHA 1X4CA 2B5JB 3HHDA 1IBLF 4NRTA 3PW5A 3J7ZT 4K4VA 1UVJA 4C0BA 1M5SA 2HZCA 1QAIA 2D1CA 1U25A 2FJEB 3KLGB 2MZQA 4DV6F 1RKJA 3T9ZA 2HQIA 4L6V3 2QIFA 3CWJA 3FDSA 4B02A 2E29A 3DRXA 3CJKA 2L08A 1ZAWA 5CYMB 5AE2A 2VKZG 2P9GA 1S4FA 2N4CA 2I1RA 2VFRA 3OHAA 1ZPVA 3DLJA 3GE9A 2CJ9A 4ZPDA 2RU9A 4QQBA 5KOXA 1OIAA 2W7PA 5LJ5Y 2ABYA 4RNMA 4ELVA 2CJKA 2J0QD 4DS5A 1YJWS 2W8LA 2E44A 1TV6B 1UJ5A 2VG6A 4CIOA 4NXNF 3V5RA 3TANA 2M4MA 2CPHA 2UUBF 5GAHU 2EKYA 1CC7A 3PW2A 2PSZA 1S6QB 3CVKA 4OX7A 3Q23A 2KG0A 3N4WA 4KV8A 3BGUA 2FJXA 1X8DA 2FPHX 1RDRA 1Y3JA 4NYPA 3NLCA 4CT9A 3EPGA 4R0JA 3TRGA 2CJAA 2EFNA 4BC7A 2CVIA 3M9MB 5A6WA 4FS1A 4K5RA 3FQLA 2GHWA 3MMAB 2HW3A 3BR8A 4LQ9A 1YGYA 5F3TA 5I42A 1S1XB 1MMDA 1TL3A 3MECA 3KLGA 3PKMA 2XS7A 1FK9B 3S01A 4XO0A 3K5NA 4OZNA 3ENVA 3UCUP 3MD1A 2ZJQQ 4Y65A 2VA2A 4QPTA 3O8WA 7FDRA 3ZZPA 2DNRA 3OLAA 4FYDA 4EUVA 2QMWA 3M2UB 5IZHA 3FRYA 2QA4S 1NEEA 3MHYA 1Y00A 3OQ2A 4TYAA 4IFVB 3VAKA 1HBOB 3BREA 4F50A 1U1KA 2I5JB 2KJVA 1P1LA 3THPA 1VRTB 4LF7F 1FK9A 2CQCA 2R9LA 2IA6A 4QW8A 4OHXA 4OHZA 1KQKA 1BQXA 2IHR1 4DQQA 4CT8A 5KT4A 2KB2A 1VHFA 1D8YA 1RTIB 2L9WA 5A8RB 1RT2B 4ID8A 2MJNA 5DJBA 2HNZ