2Q7BA

Crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
FQGMEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKMAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVLKKFFTYPKYRGNPVRLGRKLFERFMLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase (NP_689019.1) from Streptococcus agalactiae 2603 at 2.00 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q7bA00
1IYLA 3JVNA 3TOAA 4CRYB 4H6UA 3T90A 3IGRA 4ZBGA 3V8IA 4KOUA 2AE6A 1V0CA 2J8RA 3QAHA 2H5MA 5I0CA 4B5PA 4YGOA 2K5TA 1L0CA 2D4OA 2ZW7A 5HMNA 1PU9A 2Q44A 4UBRA 4PK2A 1WK4A 3PZJA 3TOBA 2D4PA 2O28A 1S7LA 5EBVA 2C27A 2FL4A 3SHPA 4KORA 3UY5A 1LRZA 1CM0A 3TFYA 3BLNA 3I9SA 5J8CA 1XMTA 3E0KA 4GS4A 5H86A 2QIRA 5EC4A 4YRHA 1YLEA 2FCKA 3DDDA 4R3KA 5KTDA 2HUZA 2CNTA 2J8NA 5IX3A 1QSOA 1XE4A 4CRZB 4EVYA 2RC4A 3FRMA 4OADA 4YFJA 2FIAA 4FD7A 3SXNA 1I21A 4RI1A 4AVCA 1MK4A 3H4QA 4HNXB 4XPDB 3EY5A 2GIVA 4CAVA 4E0AA 3GY9A 2I00A 1Y9KA 2NMTA 1M4GA 2Q04A 2Q0YA 4JD6A 1N71A 3P2HA 5ISVA 2B5GB 5J8FA 1BOBA 2Q7BA 5KTAA 2JEVA 2REFA 4QBJA 3T9YA 3R1KA 5FVJA 3PP9A 2REEA 2R1IA 3EO4A 5F49A 2BEIA 2QECA 1YVOA 3LD2A 3N7ZA 2PSWA 2ZW5A 3G8WA 2P6GA 1NE9A 2P0WA 3R96A 1MJBA 4IUSA 4XPKA 3VWEA 3S6KA 4JXQA 3FYNA 3FNCA 2P6EA 2VXKA 3F8KA 2FS5A 3S6GA 4KVME 3CXQA 1R57A 2ATRA 2VQYA 3W6SA 4MHDA 2FE7A 4NF1A 4CAWA 2B4DB 1XEBA 2PDOA 4KLWA 4U5YA 2GE3A 4KLVA 4Y49B 1M1DA 4DNCA 1UFHA 2PR1A 4XNHB 2VI7A 3I3GA 4HNYB 1YK3A 2Z0ZA 1I12A 5IB0A 4MY0A 2EVNA 4QVTA 3K9UA 2VZYA 1OZPA 3CXPA 4LX9A 1Y7RA 3IWGA 3GKRA 1KUYA 4XNHC 3MGDA 3DR8A 1S7NA 1XIXA 5F47A 3PGPA 2FT0A 4HKFA 4RS2A 5DWNA 1QSNA 5F46A 2KCWA 4QUSA 2WPXA 2PR8A 4XPLA 2BL1A 2BSWA 4ONUA 1IIDA 4KVOE 2JLMA 4R9MA 2G3AA 1IICA 2ZW6A 2I79A 1K4JA 1J4JA 2ZXVA 3D2PA 3SXOA 2R8VA 4KOYA 3P2FA 3R9FA 4KOWA 5H84A 4PK3A 1WWZA 4JWPA 4R87A 4PSWA 3DSBA 2Z11A 4MJ8A 4F0YA 2B4BA 4JJXA 3TTHA 2A4NA 4KZTA 4M85A 3CXSA 3FIXA 4H89A 4M3SA 4R57A 4B5OA 4UWIA 3TE4A 3NE7A 4NCZA 2DXQA 2HQYA 4AB7A 3EXNA 1YREA 3EC4A 2X7BA 4FD4A 4HNWB 4KOSA 2B5GA 3D3SA 5GCNA 4KOXA 4XPDC 2IL4A 1CJWA 1VHSA 4K30A 4U9ZA 1Q2YA 3W91A 3W6XA 5E96A 3TO6A 3BJ8A 1M44A 4MBUA 4FD5A 2EUIA 4J3GA 1RXTA 4BMHA 4AVAA 2VEZA 2R98A 2B3UA 3D2MA 3QB8A 2OB0A 4MY3A 1TIQA 2J8MA 4ORFA 3FB3A 4KOTA 3ZJ0A 3OWCA 3F0AA 3TCVA 2JDDA 2Z10A 2VZZA 4KVXA 3FBUA 5F48A 4E2AA 1IB1E 1U6MA 4LUAA 1MJAA 2BUEA 2G0BA 2P6FA 2B4DA 2Q4VA 4X5KA 2PRBA 3F5BA 3VWDA 1M4DA 1YR0A 2CY2A 2FSRA 2OZHA 1Z4RA 2CNSA 3KKWA 4B5PB 2F5IA 3DNSA 3EFAA 1YX0A 4Y49C 2QMLA 3R9GA 1S7FA 3FXTA 3G3SA 2ZW4A 5KTCA 2OZUA 4L89A 1Z4EA 2HV2A 1S60A 4KUBA 4KUAA 1NMTA 2FXFA 4R3LA 4AVBA 1BO4A 1VKCA 4I49A 1Q2DA 4CAXA 5JQ4A 4AG9A 3TT2A 4E8OA 5C82A 1YVKA 4KOVA 1KUXA 2R7HA 3BJ7A 5C88A 1QSMA 2WPWA 2PC1A 2FIWA 4UWJA 4QB9A 2OH1A 3C26A 2Q4YA 3S6HA 1P4NA 2GANA 2VBQA 1Q2CA 1PUAA 4PSXA 1IYKA 2OZGA 1B6BA 2ZPAA 5JPHA 2B3VA 3TO9A 4FD6A 4OAEA 4QC6A 1B87A 3S6FA 1QSRA 5HH1A 3R9EA 1MJ9A 4CS0B 4JXRA 3GYAA 1RO5A 4U9YA 1FY7A 1P0HA 1KUVA 1QSTA 1ON0A 1Z9UA 2G3TA 1I1DA 4UA3A 4IF5A 2JDCA 3DR6A 3B8GA 2ARHA 1NSLA 2PQ8A 4AG7A 2Y0MA 2AJ6A 4OLLA 1S7KA 3RYOA 1KZFA 1YGHA 4NSQA 4NXYA 3TO7A 5CNPA 4NEXA 2CNMA 4MI4A 1S3ZA 5DWMA 4F6AA 1XF8A 1Y9WA 1S5KA 5IV0A 1SQHA 4JLYA 3JUWA 3D8PA 2OU2A 1GHEA 3ZZIA 3LODA 3R95A 3WR7A 1M4IA 4H6ZA 2B58A 4II9A 4PV6A 4L8AA
chains in the Genus database with same CATH superfamily
1IYLA 3JVNA 3B3VA 4UEZA 2ZENA 1YW4A 2POKA 3TOAA 4CRYB 1CP7A 1ZLHA 4H6UA 3T90A 3IGRA 4EMEA 4ZBGA 4ONWA 5LRKA 2ZEHA 3V8IA 2VL1A 4X2TA 4KOUA 2AE6A 1V0CA 2J8RA 3QAHA 2H5MA 4R7MA 1NSAA 4C68A 5I0CA 4B5PA 4YGOA 2XEFA 3D7HA 4UFXA 4P45A 2PJ5A 2K5TA 1L0CA 2D4OA 4MFKA 2C1CA 2ZW7A 2AFWA 2PIYA 4TWEA 5HMNA 1XBUA 1PU9A 3WC5A 2Q44A 3KI9A 4PXCA 3MRUA 4UBRA 5K8PA 4JZ0A 5LYDA 2PJ4A 4MXUA 4PK2A 4UEEA 4C7HA 1WK4A 1ZO0A 3FMCA 3PZJA 4M6GA 3TOBA 2NSMA 1A2ZA 4OMEA 4P4IA 2D4PA 3NH5A 3S9MA 2V8DA 2O28A 3NH4A 1S7LA 5EBVA 2C27A 1VIXA 1CBXA 2FL4A 2ZOGA 3SHPA 3FX6A 4KORA 3UY5A 1LRZA 3NFZA 4F0XA 1CM0A 3TFYA 2Q43A 3BLNA 3I9SA 4A30A 1VHEA 5J8CA 5JGFA 1XMTA 2Q51A 3E0KA 5CBMA 3LMSA 2YNDA 4FWUA 4MCPA 5LYIA 4CGPA 4GS4A 3JTKA 5H86A 2QIRA 5EC4A 4UFVA 4YRHA 5D8NA 1YLEA 2YNCA 4BBHA 2FCKA 3DDDA 4YU9A 4R3KA 5KTDA 2HUZA 4FAIA 2CNTA 1VGYA 2J8NA 5IX3A 1QSOA 1XE4A 1XOVA 4CRZB 2RC4A 3FRMA 4EVYA 5F09A 2Z3KA 4OADA 4BINA 3V38A 2ZEDA 3FVLA 3JRUA 1YLOA 4YFJA 3IJ3A 2FIAA 2G9DA 4FD7A 4MFLA 3SXNA 4UFWA 1I21A 2YNCC 4MRIA 4RI1A 4AVCA 4A31A 1MK4A 3WC6A 1ARLA 3H4QA 4HNXB 5EMIA 4XPDB 3EY5A 3IWEA 4KS9A 2GIVA 3K9TA 4NFRA 1CPSA 4CAVA 4E0AA 3GY9A 8CPAA 2I00A 3DLJA 1UWYA 1Y9KA 2NMTA 1M4GA 2Q04A 4MCRA 2BO9A 2Q0YA 4JD6A 3A9LA 1N71A 3B3CA 3P2HA 4ZY1A 5ISVA 2B5GB 2WSAA 1FNOA 4C7IA 5K8MA 5J8FA 1BOBA 4RN7A 2Q7BA 5KTAA 2GREA 2BCOA 1Y7EA 2JEVA 2REFA 3S9LA 2CF4A 4QBJA 3KHXA 3GUXA 4GM5A 2PJ2A 3T9YA 3R1KA 4M6HA 4NGTA 3PP9A 2QYVA 1LANA 5FVJA 4C2XA 1BPMA 2REEA 4OP4A 4P4FA 4LQGA 2R1IA 3EO4A 3H8GA 4UEFA 3ISZA 5F49A 2DPTA 3SJGA 3KASA 3KQZA 2Q4ZA 2BEIA 1PYTB 1HEEA 1YVOA 1JQGA 2C6PA 2QECA 3LD2A 3N7ZA 2PSWA 2ZW5A 3G8WA 2P6GA 4H2KA 5D29A 4ZX9A 3B7IA 3NA6A 1NE9A 3HUVA 4IAVA 4B12A 2P0WA 4P4DA 3LACA 1MJBA 1Q7LA 2AFXA 3D68A 3FJUA 1AMPA 4IUSA 4XPKA 3R96A 3VWEA 2QVPA 4IHMA 1BLLE 3S6KA 3TC8A 3B3TA 2GLFA 4JXQA 3FYNA 3K2KA 1ELLP 3FNCA 4P44A 2CXAA 2P6EA 1IOIA 4P4BA 4P4EA 3SI0A 4OC3A 3NE8A 2VXKA 3F8KA 2FS5A 1XRYA 3S6GA 4KVME 3CXQA 5HVGA 2PJBA 1R57A 1ELMP 4CAEA 2ATRA 4MFPA 2VQYA 3W6SA 3CPAA 4MHDA 2DPSA 2PVWA 2FE7A 4CGLA 4NF1A 4CAWA 2B4DB 1XEBA 2PDOA 3HLPA 4RUHA 2RB7A 4ZI6A 4A37A 2ZEFA 3PEIA 4KLWA 3V7ZA 4U5YA 2I3CA 1M4LA 2GE3A 3PB8X 2F8HA 4KLVA 4Y49B 1M1DA 2GU2A 4DNCA 4NGPA 4A38A 1UFHA 2PR1A 4XNHB 1IOFA 2VI7A 1R43A 1F2PA 4NJRA 4WWVA 4UF4A 4OIDA 3I3GA 4CAFA 2AFZA 2PJ1A 4HNYB 1Y0YA 1YK3A 3FH4A 2Z0ZA 1RTQA 1I12A 4FBEA 5IB0A 4MY0A 2EVNA 4UIBA 4DYOA 1AUGA 3FEDA 4QVTA 1VHOA 2OR4A 3K9UA 2VZYA 3BHXA 1OZPA 4MHYA 3CXPA 4LX9A 1Y7RA 3DGVA 2PJ3A 3PFOA 2EK8A 3I1UA 3IWGA 1IY7A 1X12A 3GKRA 1KUYA 4XNHC 3MGDA 3DR8A 3QNVA 2DF5A 1S7NA 1XIXA 4MCSA 5F47A 3PGPA 2FT0A 3PRTA 4OC4A 2ZELA 1H8LA 4HKFA 2EWBA 4RS2A 3VATA 4P6YA 4UCNA 5DWNA 2J9AA 2AFMA 5CPAA 1QSNA 2ZEPA 4JYWA 5F46A 2KCWA 4QUSA 2WPXA 4R76A 1DTDA 3D7GA 2PR8A 3CDXA 3SJEA 4XPLA 1DE4C 2BL1A 5G1ZA 2RFHA 4UIAA 2BSWA 1LAPA 4ONUA 4TNUA 5BWAB 1IIDA 2NYQA 3L2NA 3FF3A 4KVOE 4MFJA 2JLMA 3CT9A 4R9MA 2G3AA 4NGMA 1IICA 2WZNA 4ZX8A 2ZW6A 2I79A 5LRJA 1K4JA 1J4JA 2ZXVA 3D2PA 4GXHA 1XJOA 2V8VA 2R8VA 1FT7A 3P2FA 4K3NA 4KOYA 4KOWA 5H84A 3R9FA 4ZYQA 5A27A 4PK3A 4HPSA 1WWZA 1ZG8A 1Z8LA 3GB0A 3KR5A 4JWPA 3KR4A 4R87A 2Z3NA 4PSWA 3DSBA 1YMEA 2IQ6A 2Z11A 3PBBA 4MJ8A 4MHPA 2B4BA 4NJQA 4UCMA 4A95A 4JJXA 1TF8A 4F0YA 2YGWA 3SXOA 1YSJA 3TTHA 2A4NA 2JEWA 4KZTA 1IU8A 4M85A 3CXSA 4MCQA 4Q36A 3PB7X 3SI2A 5JH9A 4CGNA 1ZG7A 3FIXA 4FUUA 4H89A 4NGRA 4PXBA 3SJFA 4OC1A 4M3SA 4NGQA 4R57A 4UWIA 2BOAA 1KWMA 1Z2LA 2PCUA 2PRQA 3FECA 3NE7A 5LYFA 4NCZA 2EK9A 2C6GA 1XFOA 2DXQA 1X10A 2HQYA 3VH9A 3BXMA 5AG5A 4F9UA 1PCAA 3IU2A 4AB7A 3EXNA 5A28A 2GLJA 1YREA 4OC5A 2HB6A 3EC4A 3KQXA 2X7BA 4FD4A 4HNWB 1F57A 3CPXA 2B5GA 3D3SA 4KOSA 1CG2A 5ELYA 5GCNA 4KOXA 4XPDC 2IL4A 1CJWA 4OIWA 1VHSA 4K30A 4U9ZA 1Q2YA 3W91A 3QAYA 3BI1A 3W6XA 3KHZA 3TE4A 3B35A 5E96A 7CPAA 5HVHA 4MHZA 3TO6A 3BJ8A 1M44A 4MBUA 4FD5A 4NGSA 2OOTA 2EUIA 1YQEA 4J3GA 4PPZA 2PJAA 2QJ8A 1BAVA 2CTCA 2EBJA 1Z5RA 1RXTA 2PVVA 4BMHA 4AVAA 4CYPA 3B2YA 2VEZA 2R98A 2B3UA 3B3WA 3GIUA 5DS0A 3T8WA 3D7FA 3D2MA 4BD9A 3QB8A 2OB0A 1LFWA 1TIQA 2J8MA 2ZOFA 4MY3A 1TF9A 4ORFA 3FB3A 4KOTA 4Q7AA 4CPAA 3IEHA 3ZJ0A 3OWCA 4WJBA 3F0AA 2IMOA 3N5FA 4X3RA 3TCVA 2JDDA 3GLJA 2Z10A 4R6TA 2VZZA 1R3NA 4KVXA 4G1PA 3FBUA 3IO1A 2JBKA 5F48A 1ZG9A 3SJXA 4PQAA 3H8FA 5THWA 4E2AA 1IB1E 1U6MA 3RO0A 2CIJA 3PB9X 4AXVA 3NH8A 1CX8A 1YW6A 4IK2A 2PJCA 4CYOA 4F9VA 1MJAA 2BUEA 1HDUA 2G0BA 2B4DA 2P6FA 2PJ8A 2Q4VA 2YNEA 4LUAA 4X5KA 4B11A 2CTBA 4CGOA 2PRBA 2Z3OA 1QMUA 3F5BA 2PIZA 5AG7A 4DUKA 3PB4X 3IC1A 3VWDA 1M4DA 1YR0A 2CY2A 2FSRA 2OZHA 2O53A 5AG4A 4O23A 1Z4RA 2CNSA 3KKWA 4B5PB 3D7DA 4R8FA 4B5OA 4W9YA 2F5IA 4OKOA 3WABA 3DNSA 3RBUA 3EFAA 1XMBA 1YX0A 4MHNA 5LYLA 4Y49C 2QMLA 3R9GA 2Z3PA 1S7FA 3FXTA 3G3SA 4Q38A 4CYNA 2ZW4A 5JM6A 5KTCA 2OZUA 4L89A 1LAMA 3IFEA 1Z4EA 3ISXA 2HV2A 2JBJA 1S60A 4KUBA 4KUAA 1OBRA 4MMOA 4C2YA 1NMTA 2FXFA 2V8GA 4OC0A 2ANPA 4R3LA 4AVBA 4A39A 1TKJA 1BO4A 1VKCA 3D4UA 2PJ0A 4I49A 4MFQA 1Q2DA 4LQ6A 4CAXA 6CPAA 1EE3P 1Z8TA 5JQ4A 4AG9A 3TT2A 4ZY2A 3S9NA 2DEAA 3LWUA 1AYEA 1HDQA 2PJ7A 1CPXA 2V77A 4E8OA 5K8OA 5C82A 2FVGA 1GYTA 2AFOA 2PJ6A 1YVKA 3H8EA 5G21A 4KOVA 1LCPA 3RNZA 4C2ZA 3PBEA 5HXDA 5K8NA 1KUXA 2Z3MA 2O4HA 2R7HA 3BJ7A 5C88A 1CP6A 1QSMA 3H5ZA 2WPWA 5J1QA 2PC1A 2FIWA 2ZEEA 4UWJA 4DJLA 4QB9A 2XEJA 1F2OA 2OH1A 2XEGA 3C26A 1TKHA 2Q4YA 5LRGA 3S6HA 1P4NA 4EWTA 1TXRA 2GANA 2VBQA 3CZXA 4PXDA 1Q2CA 2WYRA 3WC7A 4P10A 1ARMA 2Z3LA 4YWYA 1TKFA 1PUAA 4PSXA 4P4JA 1IYKA 2OZGA 5IB9A 1B6BA 4UCPA 2ZPAA 4EFDA 5JPHA 2B3VA 3TO9A 1Z8WA 3SI1A 4FD6A 4OAEA 2F7VA 3RAMA 4QC6A 3VARA 1B87A 3S6FA 2GFQA 1QSRA 2EO8A 4OC2A 5HH1A 3R9EA 4PXEA 5AGEA 1MJ9A 3IWWA 4KSAA 4B14A 2AFUA 3TX8A 1QQ9A 4CS0B 3KL9A 4JXRA 3GYAA 4KSFA 1RO5A 4U9YA 1FY7A 1LOKA 1P0HA 1Z8XA 1KUVA 1IGBA 3KZWA 1QSTA 3MN8A 5G22A 2PE3A 4ZGYB 4B13A 1ON0A 1Z9UA 4A33A 2G3TA 5HVFA 1I1DA 4UA3A 1ZLIA 4IF5A 2JDCA 2V8HA 3DR6A 4MFZA 2ODFA 3IIBA 3B8GA 2ARHA 1BPNA 1NSLA 4A32A 2PQ8A 4AG7A 2Y0MA 3PB6X 2AJ6A 2ABZA 4OLLA 3IU1A 1S7KA 3B3SA 2XEIA 3RYOA 4F8ZA 3PFEA 1KZFA 1YGHA 2HC9A 2ZEOA 2WUUA 4NSQA 4CGMA 2Q7SA 4A94A 4NXYA 3TO7A 4KSIA 5CNPA 4NEXA 2IJZA 3WT4A 1Y0RA 2ZEMA 4X8IA 3BI0A 2CNMA 4MI4A 1S3ZA 5DWMA 4B10A 4F6AA 1XF8A 1Y9WA 1S5KA 3D67A 4A2ZA 5IV0A 2ZEGA 5AG6A 2C6CA 5G20A 5I4MA 3RZAA 4CYQA 4B6ZA 4ZY0A 1SQHA 4JLYA 2AFSA 3JUWA 3D8PA 2OU2A 1GHEA 1JWQA 3ZZIA 4M6IA 3D66A 3LODA 4NGNA 3R95A 3FEEA 3WR7A 4Z65A 1M4IA 3KGQA 4H6ZA 2B58A 2PJ9A 4II9A 4PV6A 4L8AA
chains in the Genus database with same CATH topology
1IYLA 3JVNA 3TOAA 4CRYB 4H6UA 3T90A 3IGRA 4ZBGA 3V8IA 4KOUA 2AE6A 1V0CA 2J8RA 3QAHA 2H5MA 5I0CA 4C68A 4B5PA 4YGOA 4UFXA 2K5TA 1L0CA 2D4OA 4MFKA 2ZW7A 5HMNA 1PU9A 2Q44A 4UBRA 4PK2A 4C7HA 1WK4A 1ZO0A 3PZJA 3TOBA 2D4PA 2O28A 1S7LA 5EBVA 2C27A 2FL4A 3SHPA 4KORA 3UY5A 1LRZA 4F0XA 1CM0A 3TFYA 3BLNA 3I9SA 4A30A 5J8CA 1XMTA 3E0KA 2YNDA 4CGPA 4GS4A 3JTKA 5H86A 2QIRA 5EC4A 4UFVA 4YRHA 1YLEA 2YNCA 4BBHA 2FCKA 3DDDA 4R3KA 5KTDA 2HUZA 2CNTA 2J8NA 5IX3A 1QSOA 1XE4A 4CRZB 4EVYA 2RC4A 3FRMA 2Z3KA 4OADA 4YFJA 2FIAA 4FD7A 4MFLA 3SXNA 4UFWA 1I21A 2YNCC 4RI1A 4AVCA 4A31A 1MK4A 3H4QA 4HNXB 4XPDB 3EY5A 3IWEA 4KS9A 2GIVA 4CAVA 4E0AA 3GY9A 2I00A 1Y9KA 2NMTA 1M4GA 2Q04A 2Q0YA 4JD6A 3A9LA 1N71A 3P2HA 5ISVA 2B5GB 2WSAA 4C7IA 5J8FA 1BOBA 2Q7BA 5KTAA 2JEVA 2REFA 4QBJA 3T9YA 3R1KA 4C2XA 5FVJA 3PP9A 2REEA 2R1IA 3EO4A 5F49A 2DPTA 2BEIA 2QECA 1YVOA 3LD2A 3N7ZA 2PSWA 2ZW5A 3G8WA 2P6GA 4B12A 1NE9A 2P0WA 3R96A 1MJBA 4IUSA 4XPKA 3VWEA 3S6KA 4JXQA 3FYNA 3FNCA 2CXAA 2P6EA 2VXKA 3F8KA 2FS5A 3S6GA 4KVME 3CXQA 1R57A 4CAEA 2ATRA 4MFPA 2VQYA 3W6SA 4MHDA 2DPSA 2FE7A 4CGLA 4NF1A 4CAWA 2B4DB 1XEBA 2PDOA 4KLWA 4U5YA 2GE3A 4KLVA 4Y49B 1M1DA 4DNCA 1UFHA 2PR1A 4XNHB 2VI7A 4CAFA 3I3GA 4HNYB 1YK3A 2Z0ZA 1I12A 5IB0A 4MY0A 2EVNA 4QVTA 3K9UA 2VZYA 1OZPA 3CXPA 4LX9A 1Y7RA 3IWGA 3GKRA 1KUYA 4XNHC 3MGDA 3DR8A 1S7NA 1XIXA 5F47A 3PGPA 2FT0A 4HKFA 4RS2A 4UCNA 5DWNA 1QSNA 5F46A 2KCWA 4QUSA 2WPXA 2PR8A 4XPLA 5G1ZA 2BL1A 2BSWA 4ONUA 5BWAB 1IIDA 4MFJA 4KVOE 2JLMA 4R9MA 2G3AA 1IICA 2ZW6A 2I79A 1K4JA 1J4JA 2ZXVA 3D2PA 3SXOA 2R8VA 4KOYA 3P2FA 3R9FA 4KOWA 5H84A 5A27A 4PK3A 1WWZA 4JWPA 4R87A 2Z3NA 4PSWA 3DSBA 2Z11A 4MJ8A 4UCMA 4A95A 2B4BA 4F0YA 4JJXA 2YGWA 3TTHA 2A4NA 4KZTA 4M85A 3CXSA 4Q36A 4CGNA 3FIXA 4H89A 4M3SA 4R57A 4B5OA 4UWIA 3TE4A 3NE7A 4NCZA 2DXQA 2HQYA 5AG5A 5A28A 4AB7A 3IU2A 3EXNA 1YREA 3EC4A 2X7BA 4FD4A 4HNWB 4KOSA 2B5GA 3D3SA 5GCNA 4KOXA 4XPDC 2IL4A 1CJWA 1VHSA 4K30A 4U9ZA 1Q2YA 3W91A 3W6XA 5E96A 3TO6A 3BJ8A 1M44A 4MBUA 4FD5A 2EUIA 4J3GA 1RXTA 4BMHA 4AVAA 4CYPA 2VEZA 2R98A 2B3UA 3D2MA 3QB8A 2OB0A 4MY3A 1TIQA 2J8MA 4ORFA 3FB3A 4KOTA 3ZJ0A 3OWCA 3F0AA 3TCVA 2JDDA 2Z10A 2VZZA 4KVXA 3FBUA 5F48A 4E2AA 1IB1E 1U6MA 4CYOA 1MJAA 2BUEA 2G0BA 2P6FA 2B4DA 2Q4VA 2YNEA 4LUAA 4X5KA 4B11A 4CGOA 2PRBA 2Z3OA 3F5BA 5AG7A 3VWDA 1M4DA 1YR0A 2CY2A 2FSRA 2OZHA 5AG4A 1Z4RA 2CNSA 3KKWA 4B5PB 2F5IA 3DNSA 3EFAA 1YX0A 4Y49C 2QMLA 3R9GA 2Z3PA 1S7FA 3FXTA 3G3SA 4Q38A 4CYNA 2ZW4A 5KTCA 2OZUA 4L89A 1Z4EA 2HV2A 1S60A 4KUBA 4KUAA 4C2YA 1NMTA 2FXFA 4R3LA 4AVBA 1BO4A 1VKCA 4MFQA 4I49A 1Q2DA 4CAXA 5JQ4A 4AG9A 3TT2A 4E8OA 5C82A 1YVKA 5G21A 4KOVA 4C2ZA 1KUXA 2Z3MA 2R7HA 3BJ7A 5C88A 1QSMA 3H5ZA 2WPWA 2PC1A 2FIWA 4UWJA 4QB9A 2OH1A 3C26A 2Q4YA 3S6HA 1P4NA 2GANA 2VBQA 1Q2CA 2Z3LA 1PUAA 4PSXA 1IYKA 2OZGA 1B6BA 4UCPA 2ZPAA 5JPHA 2B3VA 3TO9A 4FD6A 4OAEA 4QC6A 1B87A 3S6FA 1QSRA 5HH1A 3R9EA 5AGEA 1MJ9A 4KSAA 4B14A 4CS0B 4JXRA 3GYAA 4KSFA 1RO5A 4U9YA 1FY7A 1P0HA 1KUVA 5G22A 1QSTA 4ZGYB 4B13A 1ON0A 1Z9UA 4A33A 2G3TA 1I1DA 4UA3A 4IF5A 2JDCA 3DR6A 4MFZA 3B8GA 2ARHA 1NSLA 4A32A 2PQ8A 4AG7A 2Y0MA 2AJ6A 4OLLA 3IU1A 1S7KA 3RYOA 1KZFA 1YGHA 2WUUA 4NSQA 4CGMA 4NXYA 3TO7A 5CNPA 4NEXA 2CNMA 4MI4A 1S3ZA 5DWMA 4B10A 4F6AA 1XF8A 1Y9WA 1S5KA 4A2ZA 5IV0A 5AG6A 5G20A 4CYQA 1SQHA 4JLYA 3JUWA 3D8PA 2OU2A 1GHEA 3ZZIA 3LODA 3R95A 3WR7A 1M4IA 4H6ZA 2B58A 4II9A 4PV6A 4L8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYL A;  3JVN A;  3TOA A;  4CRY B;  4H6U A;  3T90 A;  3IGR A;  4ZBG A;  3V8I A;  4KOU A;  2AE6 A;  1V0C A;  2J8R A;  3QAH A;  2H5M A;  5I0C A;  4B5P A;  4YGO A;  2K5T A;  1L0C A;  2D4O A;  2ZW7 A;  5HMN A;  1PU9 A;  2Q44 A;  4UBR A;  4PK2 A;  1WK4 A;  3PZJ A;  3TOB A;  2D4P A;  2O28 A;  1S7L A;  5EBV A;  2C27 A;  2FL4 A;  3SHP A;  4KOR A;  3UY5 A;  1LRZ A;  1CM0 A;  3TFY A;  3BLN A;  3I9S A;  5J8C A;  1XMT A;  3E0K A;  4GS4 A;  5H86 A;  2QIR A;  5EC4 A;  4YRH A;  1YLE A;  2FCK A;  3DDD A;  4R3K A;  5KTD A;  2HUZ A;  2CNT A;  2J8N A;  5IX3 A;  1QSO A;  1XE4 A;  4CRZ B;  4EVY A;  2RC4 A;  3FRM A;  4OAD A;  4YFJ A;  2FIA A;  4FD7 A;  3SXN A;  1I21 A;  4RI1 A;  4AVC A;  1MK4 A;  3H4Q A;  4HNX B;  4XPD B;  3EY5 A;  2GIV A;  4CAV A;  4E0A A;  3GY9 A;  2I00 A;  1Y9K A;  2NMT A;  1M4G A;  2Q04 A;  2Q0Y A;  4JD6 A;  1N71 A;  3P2H A;  5ISV A;  2B5G B;  5J8F A;  1BOB A;  2Q7B A;  5KTA A;  2JEV A;  2REF A;  4QBJ A;  3T9Y A;  3R1K A;  5FVJ A;  3PP9 A;  2REE A;  2R1I A;  3EO4 A;  5F49 A;  2BEI A;  2QEC A;  1YVO A;  3LD2 A;  3N7Z A;  2PSW A;  2ZW5 A;  3G8W A;  2P6G A;  1NE9 A;  2P0W A;  3R96 A;  1MJB A;  4IUS A;  4XPK A;  3VWE A;  3S6K A;  4JXQ A;  3FYN A;  3FNC A;  2P6E A;  2VXK A;  3F8K A;  2FS5 A;  3S6G A;  4KVM E;  3CXQ A;  1R57 A;  2ATR A;  2VQY A;  3W6S A;  4MHD A;  2FE7 A;  4NF1 A;  4CAW A;  2B4D B;  1XEB A;  2PDO A;  4KLW A;  4U5Y A;  2GE3 A;  4KLV A;  4Y49 B;  1M1D A;  4DNC A;  1UFH A;  2PR1 A;  4XNH B;  2VI7 A;  3I3G A;  4HNY B;  1YK3 A;  2Z0Z A;  1I12 A;  5IB0 A;  4MY0 A;  2EVN A;  4QVT A;  3K9U A;  2VZY A;  1OZP A;  3CXP A;  4LX9 A;  1Y7R A;  3IWG A;  3GKR A;  1KUY A;  4XNH C;  3MGD A;  3DR8 A;  1S7N A;  1XIX A;  5F47 A;  3PGP A;  2FT0 A;  4HKF A;  4RS2 A;  5DWN A;  1QSN A;  5F46 A;  2KCW A;  4QUS A;  2WPX A;  2PR8 A;  4XPL A;  2BL1 A;  2BSW A;  4ONU A;  1IID A;  4KVO E;  2JLM A;  4R9M A;  2G3A A;  1IIC A;  2ZW6 A;  2I79 A;  1K4J A;  1J4J A;  2ZXV A;  3D2P A;  3SXO A;  2R8V A;  4KOY A;  3P2F A;  3R9F A;  4KOW A;  5H84 A;  4PK3 A;  1WWZ A;  4JWP A;  4R87 A;  4PSW A;  3DSB A;  2Z11 A;  4MJ8 A;  4F0Y A;  2B4B A;  4JJX A;  3TTH A;  2A4N A;  4KZT A;  4M85 A;  3CXS A;  3FIX A;  4H89 A;  4M3S A;  4R57 A;  4B5O A;  4UWI A;  3TE4 A;  3NE7 A;  4NCZ A;  2DXQ A;  2HQY A;  4AB7 A;  3EXN A;  1YRE A;  3EC4 A;  2X7B A;  4FD4 A;  4HNW B;  4KOS A;  2B5G A;  3D3S A;  5GCN A;  4KOX A;  4XPD C;  2IL4 A;  1CJW A;  1VHS A;  4K30 A;  4U9Z A;  1Q2Y A;  3W91 A;  3W6X A;  5E96 A;  3TO6 A;  3BJ8 A;  1M44 A;  4MBU A;  4FD5 A;  2EUI A;  4J3G A;  1RXT A;  4BMH A;  4AVA A;  2VEZ A;  2R98 A;  2B3U A;  3D2M A;  3QB8 A;  2OB0 A;  4MY3 A;  1TIQ A;  2J8M A;  4ORF A;  3FB3 A;  4KOT A;  3ZJ0 A;  3OWC A;  3F0A A;  3TCV A;  2JDD A;  2Z10 A;  2VZZ A;  4KVX A;  3FBU A;  5F48 A;  4E2A A;  1IB1 E;  1U6M A;  4LUA A;  1MJA A;  2BUE A;  2G0B A;  2P6F A;  2B4D A;  2Q4V A;  4X5K A;  2PRB A;  3F5B A;  3VWD A;  1M4D A;  1YR0 A;  2CY2 A;  2FSR A;  2OZH A;  1Z4R A;  2CNS A;  3KKW A;  4B5P B;  2F5I A;  3DNS A;  3EFA A;  1YX0 A;  4Y49 C;  2QML A;  3R9G A;  1S7F A;  3FXT A;  3G3S A;  2ZW4 A;  5KTC A;  2OZU A;  4L89 A;  1Z4E A;  2HV2 A;  1S60 A;  4KUB A;  4KUA A;  1NMT A;  2FXF A;  4R3L A;  4AVB A;  1BO4 A;  1VKC A;  4I49 A;  1Q2D A;  4CAX A;  5JQ4 A;  4AG9 A;  3TT2 A;  4E8O A;  5C82 A;  1YVK A;  4KOV A;  1KUX A;  2R7H A;  3BJ7 A;  5C88 A;  1QSM A;  2WPW A;  2PC1 A;  2FIW A;  4UWJ A;  4QB9 A;  2OH1 A;  3C26 A;  2Q4Y A;  3S6H A;  1P4N A;  2GAN A;  2VBQ A;  1Q2C A;  1PUA A;  4PSX A;  1IYK A;  2OZG A;  1B6B A;  2ZPA A;  5JPH A;  2B3V A;  3TO9 A;  4FD6 A;  4OAE A;  4QC6 A;  1B87 A;  3S6F A;  1QSR A;  5HH1 A;  3R9E A;  1MJ9 A;  4CS0 B;  4JXR A;  3GYA A;  1RO5 A;  4U9Y A;  1FY7 A;  1P0H A;  1KUV A;  1QST A;  1ON0 A;  1Z9U A;  2G3T A;  1I1D A;  4UA3 A;  4IF5 A;  2JDC A;  3DR6 A;  3B8G A;  2ARH A;  1NSL A;  2PQ8 A;  4AG7 A;  2Y0M A;  2AJ6 A;  4OLL A;  1S7K A;  3RYO A;  1KZF A;  1YGH A;  4NSQ A;  4NXY A;  3TO7 A;  5CNP A;  4NEX A;  2CNM A;  4MI4 A;  1S3Z A;  5DWM A;  4F6A A;  1XF8 A;  1Y9W A;  1S5K A;  5IV0 A;  1SQH A;  4JLY A;  3JUW A;  3D8P A;  2OU2 A;  1GHE A;  3ZZI A;  3LOD A;  3R95 A;  3WR7 A;  1M4I A;  4H6Z A;  2B58 A;  4II9 A;  4PV6 A;  4L8A A; 
#chains in the Genus database with same CATH topology
 1IYL A;  3JVN A;  3B3V A;  4UEZ A;  2ZEN A;  1YW4 A;  2POK A;  3TOA A;  4CRY B;  1CP7 A;  1ZLH A;  4H6U A;  3T90 A;  3IGR A;  4EME A;  4ZBG A;  4ONW A;  5LRK A;  2ZEH A;  3V8I A;  2VL1 A;  4X2T A;  4KOU A;  2AE6 A;  1V0C A;  2J8R A;  3QAH A;  2H5M A;  4R7M A;  1NSA A;  4C68 A;  5I0C A;  4B5P A;  4YGO A;  2XEF A;  3D7H A;  4UFX A;  4P45 A;  2PJ5 A;  2K5T A;  1L0C A;  2D4O A;  4MFK A;  2C1C A;  2ZW7 A;  2AFW A;  2PIY A;  4TWE A;  5HMN A;  1XBU A;  1PU9 A;  3WC5 A;  2Q44 A;  3KI9 A;  4PXC A;  3MRU A;  4UBR A;  5K8P A;  4JZ0 A;  5LYD A;  2PJ4 A;  4MXU A;  4PK2 A;  4UEE A;  4C7H A;  1WK4 A;  1ZO0 A;  3FMC A;  3PZJ A;  4M6G A;  3TOB A;  2NSM A;  1A2Z A;  4OME A;  4P4I A;  2D4P A;  3NH5 A;  3S9M A;  2V8D A;  2O28 A;  3NH4 A;  1S7L A;  5EBV A;  2C27 A;  1VIX A;  1CBX A;  2FL4 A;  2ZOG A;  3SHP A;  3FX6 A;  4KOR A;  3UY5 A;  1LRZ A;  3NFZ A;  4F0X A;  1CM0 A;  3TFY A;  2Q43 A;  3BLN A;  3I9S A;  4A30 A;  1VHE A;  5J8C A;  5JGF A;  1XMT A;  2Q51 A;  3E0K A;  5CBM A;  3LMS A;  2YND A;  4FWU A;  4MCP A;  5LYI A;  4CGP A;  4GS4 A;  3JTK A;  5H86 A;  2QIR A;  5EC4 A;  4UFV A;  4YRH A;  5D8N A;  1YLE A;  2YNC A;  4BBH A;  2FCK A;  3DDD A;  4YU9 A;  4R3K A;  5KTD A;  2HUZ A;  4FAI A;  2CNT A;  1VGY A;  2J8N A;  5IX3 A;  1QSO A;  1XE4 A;  1XOV A;  4CRZ B;  2RC4 A;  3FRM A;  4EVY A;  5F09 A;  2Z3K A;  4OAD A;  4BIN A;  3V38 A;  2ZED A;  3FVL A;  3JRU A;  1YLO A;  4YFJ A;  3IJ3 A;  2FIA A;  2G9D A;  4FD7 A;  4MFL A;  3SXN A;  4UFW A;  1I21 A;  2YNC C;  4MRI A;  4RI1 A;  4AVC A;  4A31 A;  1MK4 A;  3WC6 A;  1ARL A;  3H4Q A;  4HNX B;  5EMI A;  4XPD B;  3EY5 A;  3IWE A;  4KS9 A;  2GIV A;  3K9T A;  4NFR A;  1CPS A;  4CAV A;  4E0A A;  3GY9 A;  8CPA A;  2I00 A;  3DLJ A;  1UWY A;  1Y9K A;  2NMT A;  1M4G A;  2Q04 A;  4MCR A;  2BO9 A;  2Q0Y A;  4JD6 A;  3A9L A;  1N71 A;  3B3C A;  3P2H A;  4ZY1 A;  5ISV A;  2B5G B;  2WSA A;  1FNO A;  4C7I A;  5K8M A;  5J8F A;  1BOB A;  4RN7 A;  2Q7B A;  5KTA A;  2GRE A;  2BCO A;  1Y7E A;  2JEV A;  2REF A;  3S9L A;  2CF4 A;  4QBJ A;  3KHX A;  3GUX A;  4GM5 A;  2PJ2 A;  3T9Y A;  3R1K A;  4M6H A;  4NGT A;  3PP9 A;  2QYV A;  1LAN A;  5FVJ A;  4C2X A;  1BPM A;  2REE A;  4OP4 A;  4P4F A;  4LQG A;  2R1I A;  3EO4 A;  3H8G A;  4UEF A;  3ISZ A;  5F49 A;  2DPT A;  3SJG A;  3KAS A;  3KQZ A;  2Q4Z A;  2BEI A;  1PYT B;  1HEE A;  1YVO A;  1JQG A;  2C6P A;  2QEC A;  3LD2 A;  3N7Z A;  2PSW A;  2ZW5 A;  3G8W A;  2P6G A;  4H2K A;  5D29 A;  4ZX9 A;  3B7I A;  3NA6 A;  1NE9 A;  3HUV A;  4IAV A;  4B12 A;  2P0W A;  4P4D A;  3LAC A;  1MJB A;  1Q7L A;  2AFX A;  3D68 A;  3FJU A;  1AMP A;  4IUS A;  4XPK A;  3R96 A;  3VWE A;  2QVP A;  4IHM A;  1BLL E;  3S6K A;  3TC8 A;  3B3T A;  2GLF A;  4JXQ A;  3FYN A;  3K2K A;  1ELL P;  3FNC A;  4P44 A;  2CXA A;  2P6E A;  1IOI A;  4P4B A;  4P4E A;  3SI0 A;  4OC3 A;  3NE8 A;  2VXK A;  3F8K A;  2FS5 A;  1XRY A;  3S6G A;  4KVM E;  3CXQ A;  5HVG A;  2PJB A;  1R57 A;  1ELM P;  4CAE A;  2ATR A;  4MFP A;  2VQY A;  3W6S A;  3CPA A;  4MHD A;  2DPS A;  2PVW A;  2FE7 A;  4CGL A;  4NF1 A;  4CAW A;  2B4D B;  1XEB A;  2PDO A;  3HLP A;  4RUH A;  2RB7 A;  4ZI6 A;  4A37 A;  2ZEF A;  3PEI A;  4KLW A;  3V7Z A;  4U5Y A;  2I3C A;  1M4L A;  2GE3 A;  3PB8 X;  2F8H A;  4KLV A;  4Y49 B;  1M1D A;  2GU2 A;  4DNC A;  4NGP A;  4A38 A;  1UFH A;  2PR1 A;  4XNH B;  1IOF A;  2VI7 A;  1R43 A;  1F2P A;  4NJR A;  4WWV A;  4UF4 A;  4OID A;  3I3G A;  4CAF A;  2AFZ A;  2PJ1 A;  4HNY B;  1Y0Y A;  1YK3 A;  3FH4 A;  2Z0Z A;  1RTQ A;  1I12 A;  4FBE A;  5IB0 A;  4MY0 A;  2EVN A;  4UIB A;  4DYO A;  1AUG A;  3FED A;  4QVT A;  1VHO A;  2OR4 A;  3K9U A;  2VZY A;  3BHX A;  1OZP A;  4MHY A;  3CXP A;  4LX9 A;  1Y7R A;  3DGV A;  2PJ3 A;  3PFO A;  2EK8 A;  3I1U A;  3IWG A;  1IY7 A;  1X12 A;  3GKR A;  1KUY A;  4XNH C;  3MGD A;  3DR8 A;  3QNV A;  2DF5 A;  1S7N A;  1XIX A;  4MCS A;  5F47 A;  3PGP A;  2FT0 A;  3PRT A;  4OC4 A;  2ZEL A;  1H8L A;  4HKF A;  2EWB A;  4RS2 A;  3VAT A;  4P6Y A;  4UCN A;  5DWN A;  2J9A A;  2AFM A;  5CPA A;  1QSN A;  2ZEP A;  4JYW A;  5F46 A;  2KCW A;  4QUS A;  2WPX A;  4R76 A;  1DTD A;  3D7G A;  2PR8 A;  3CDX A;  3SJE A;  4XPL A;  1DE4 C;  2BL1 A;  5G1Z A;  2RFH A;  4UIA A;  2BSW A;  1LAP A;  4ONU A;  4TNU A;  5BWA B;  1IID A;  2NYQ A;  3L2N A;  3FF3 A;  4KVO E;  4MFJ A;  2JLM A;  3CT9 A;  4R9M A;  2G3A A;  4NGM A;  1IIC A;  2WZN A;  4ZX8 A;  2ZW6 A;  2I79 A;  5LRJ A;  1K4J A;  1J4J A;  2ZXV A;  3D2P A;  4GXH A;  1XJO A;  2V8V A;  2R8V A;  1FT7 A;  3P2F A;  4K3N A;  4KOY A;  4KOW A;  5H84 A;  3R9F A;  4ZYQ A;  5A27 A;  4PK3 A;  4HPS A;  1WWZ A;  1ZG8 A;  1Z8L A;  3GB0 A;  3KR5 A;  4JWP A;  3KR4 A;  4R87 A;  2Z3N A;  4PSW A;  3DSB A;  1YME A;  2IQ6 A;  2Z11 A;  3PBB A;  4MJ8 A;  4MHP A;  2B4B A;  4NJQ A;  4UCM A;  4A95 A;  4JJX A;  1TF8 A;  4F0Y A;  2YGW A;  3SXO A;  1YSJ A;  3TTH A;  2A4N A;  2JEW A;  4KZT A;  1IU8 A;  4M85 A;  3CXS A;  4MCQ A;  4Q36 A;  3PB7 X;  3SI2 A;  5JH9 A;  4CGN A;  1ZG7 A;  3FIX A;  4FUU A;  4H89 A;  4NGR A;  4PXB A;  3SJF A;  4OC1 A;  4M3S A;  4NGQ A;  4R57 A;  4UWI A;  2BOA A;  1KWM A;  1Z2L A;  2PCU A;  2PRQ A;  3FEC A;  3NE7 A;  5LYF A;  4NCZ A;  2EK9 A;  2C6G A;  1XFO A;  2DXQ A;  1X10 A;  2HQY A;  3VH9 A;  3BXM A;  5AG5 A;  4F9U A;  1PCA A;  3IU2 A;  4AB7 A;  3EXN A;  5A28 A;  2GLJ A;  1YRE A;  4OC5 A;  2HB6 A;  3EC4 A;  3KQX A;  2X7B A;  4FD4 A;  4HNW B;  1F57 A;  3CPX A;  2B5G A;  3D3S A;  4KOS A;  1CG2 A;  5ELY A;  5GCN A;  4KOX A;  4XPD C;  2IL4 A;  1CJW A;  4OIW A;  1VHS A;  4K30 A;  4U9Z A;  1Q2Y A;  3W91 A;  3QAY A;  3BI1 A;  3W6X A;  3KHZ A;  3TE4 A;  3B35 A;  5E96 A;  7CPA A;  5HVH A;  4MHZ A;  3TO6 A;  3BJ8 A;  1M44 A;  4MBU A;  4FD5 A;  4NGS A;  2OOT A;  2EUI A;  1YQE A;  4J3G A;  4PPZ A;  2PJA A;  2QJ8 A;  1BAV A;  2CTC A;  2EBJ A;  1Z5R A;  1RXT A;  2PVV A;  4BMH A;  4AVA A;  4CYP A;  3B2Y A;  2VEZ A;  2R98 A;  2B3U A;  3B3W A;  3GIU A;  5DS0 A;  3T8W A;  3D7F A;  3D2M A;  4BD9 A;  3QB8 A;  2OB0 A;  1LFW A;  1TIQ A;  2J8M A;  2ZOF A;  4MY3 A;  1TF9 A;  4ORF A;  3FB3 A;  4KOT A;  4Q7A A;  4CPA A;  3IEH A;  3ZJ0 A;  3OWC A;  4WJB A;  3F0A A;  2IMO A;  3N5F A;  4X3R A;  3TCV A;  2JDD A;  3GLJ A;  2Z10 A;  4R6T A;  2VZZ A;  1R3N A;  4KVX A;  4G1P A;  3FBU A;  3IO1 A;  2JBK A;  5F48 A;  1ZG9 A;  3SJX A;  4PQA A;  3H8F A;  5THW A;  4E2A A;  1IB1 E;  1U6M A;  3RO0 A;  2CIJ A;  3PB9 X;  4AXV A;  3NH8 A;  1CX8 A;  1YW6 A;  4IK2 A;  2PJC A;  4CYO A;  4F9V A;  1MJA A;  2BUE A;  1HDU A;  2G0B A;  2B4D A;  2P6F A;  2PJ8 A;  2Q4V A;  2YNE A;  4LUA A;  4X5K A;  4B11 A;  2CTB A;  4CGO A;  2PRB A;  2Z3O A;  1QMU A;  3F5B A;  2PIZ A;  5AG7 A;  4DUK A;  3PB4 X;  3IC1 A;  3VWD A;  1M4D A;  1YR0 A;  2CY2 A;  2FSR A;  2OZH A;  2O53 A;  5AG4 A;  4O23 A;  1Z4R A;  2CNS A;  3KKW A;  4B5P B;  3D7D A;  4R8F A;  4B5O A;  4W9Y A;  2F5I A;  4OKO A;  3WAB A;  3DNS A;  3RBU A;  3EFA A;  1XMB A;  1YX0 A;  4MHN A;  5LYL A;  4Y49 C;  2QML A;  3R9G A;  2Z3P A;  1S7F A;  3FXT A;  3G3S A;  4Q38 A;  4CYN A;  2ZW4 A;  5JM6 A;  5KTC A;  2OZU A;  4L89 A;  1LAM A;  3IFE A;  1Z4E A;  3ISX A;  2HV2 A;  2JBJ A;  1S60 A;  4KUB A;  4KUA A;  1OBR A;  4MMO A;  4C2Y A;  1NMT A;  2FXF A;  2V8G A;  4OC0 A;  2ANP A;  4R3L A;  4AVB A;  4A39 A;  1TKJ A;  1BO4 A;  1VKC A;  3D4U A;  2PJ0 A;  4I49 A;  4MFQ A;  1Q2D A;  4LQ6 A;  4CAX A;  6CPA A;  1EE3 P;  1Z8T A;  5JQ4 A;  4AG9 A;  3TT2 A;  4ZY2 A;  3S9N A;  2DEA A;  3LWU A;  1AYE A;  1HDQ A;  2PJ7 A;  1CPX A;  2V77 A;  4E8O A;  5K8O A;  5C82 A;  2FVG A;  1GYT A;  2AFO A;  2PJ6 A;  1YVK A;  3H8E A;  5G21 A;  4KOV A;  1LCP A;  3RNZ A;  4C2Z A;  3PBE A;  5HXD A;  5K8N A;  1KUX A;  2Z3M A;  2O4H A;  2R7H A;  3BJ7 A;  5C88 A;  1CP6 A;  1QSM A;  3H5Z A;  2WPW A;  5J1Q A;  2PC1 A;  2FIW A;  2ZEE A;  4UWJ A;  4DJL A;  4QB9 A;  2XEJ A;  1F2O A;  2OH1 A;  2XEG A;  3C26 A;  1TKH A;  2Q4Y A;  5LRG A;  3S6H A;  1P4N A;  4EWT A;  1TXR A;  2GAN A;  2VBQ A;  3CZX A;  4PXD A;  1Q2C A;  2WYR A;  3WC7 A;  4P10 A;  1ARM A;  2Z3L A;  4YWY A;  1TKF A;  1PUA A;  4PSX A;  4P4J A;  1IYK A;  2OZG A;  5IB9 A;  1B6B A;  4UCP A;  2ZPA A;  4EFD A;  5JPH A;  2B3V A;  3TO9 A;  1Z8W A;  3SI1 A;  4FD6 A;  4OAE A;  2F7V A;  3RAM A;  4QC6 A;  3VAR A;  1B87 A;  3S6F A;  2GFQ A;  1QSR A;  2EO8 A;  4OC2 A;  5HH1 A;  3R9E A;  4PXE A;  5AGE A;  1MJ9 A;  3IWW A;  4KSA A;  4B14 A;  2AFU A;  3TX8 A;  1QQ9 A;  4CS0 B;  3KL9 A;  4JXR A;  3GYA A;  4KSF A;  1RO5 A;  4U9Y A;  1FY7 A;  1LOK A;  1P0H A;  1Z8X A;  1KUV A;  1IGB A;  3KZW A;  1QST A;  3MN8 A;  5G22 A;  2PE3 A;  4ZGY B;  4B13 A;  1ON0 A;  1Z9U A;  4A33 A;  2G3T A;  5HVF A;  1I1D A;  4UA3 A;  1ZLI A;  4IF5 A;  2JDC A;  2V8H A;  3DR6 A;  4MFZ A;  2ODF A;  3IIB A;  3B8G A;  2ARH A;  1BPN A;  1NSL A;  4A32 A;  2PQ8 A;  4AG7 A;  2Y0M A;  3PB6 X;  2AJ6 A;  2ABZ A;  4OLL A;  3IU1 A;  1S7K A;  3B3S A;  2XEI A;  3RYO A;  4F8Z A;  3PFE A;  1KZF A;  1YGH A;  2HC9 A;  2ZEO A;  2WUU A;  4NSQ A;  4CGM A;  2Q7S A;  4A94 A;  4NXY A;  3TO7 A;  4KSI A;  5CNP A;  4NEX A;  2IJZ A;  3WT4 A;  1Y0R A;  2ZEM A;  4X8I A;  3BI0 A;  2CNM A;  4MI4 A;  1S3Z A;  5DWM A;  4B10 A;  4F6A A;  1XF8 A;  1Y9W A;  1S5K A;  3D67 A;  4A2Z A;  5IV0 A;  2ZEG A;  5AG6 A;  2C6C A;  5G20 A;  5I4M A;  3RZA A;  4CYQ A;  4B6Z A;  4ZY0 A;  1SQH A;  4JLY A;  2AFS A;  3JUW A;  3D8P A;  2OU2 A;  1GHE A;  1JWQ A;  3ZZI A;  4M6I A;  3D66 A;  3LOD A;  4NGN A;  3R95 A;  3FEE A;  3WR7 A;  4Z65 A;  1M4I A;  3KGQ A;  4H6Z A;  2B58 A;  2PJ9 A;  4II9 A;  4PV6 A;  4L8A A; 
#chains in the Genus database with same CATH homology
 1IYL A;  3JVN A;  3TOA A;  4CRY B;  4H6U A;  3T90 A;  3IGR A;  4ZBG A;  3V8I A;  4KOU A;  2AE6 A;  1V0C A;  2J8R A;  3QAH A;  2H5M A;  5I0C A;  4C68 A;  4B5P A;  4YGO A;  4UFX A;  2K5T A;  1L0C A;  2D4O A;  4MFK A;  2ZW7 A;  5HMN A;  1PU9 A;  2Q44 A;  4UBR A;  4PK2 A;  4C7H A;  1WK4 A;  1ZO0 A;  3PZJ A;  3TOB A;  2D4P A;  2O28 A;  1S7L A;  5EBV A;  2C27 A;  2FL4 A;  3SHP A;  4KOR A;  3UY5 A;  1LRZ A;  4F0X A;  1CM0 A;  3TFY A;  3BLN A;  3I9S A;  4A30 A;  5J8C A;  1XMT A;  3E0K A;  2YND A;  4CGP A;  4GS4 A;  3JTK A;  5H86 A;  2QIR A;  5EC4 A;  4UFV A;  4YRH A;  1YLE A;  2YNC A;  4BBH A;  2FCK A;  3DDD A;  4R3K A;  5KTD A;  2HUZ A;  2CNT A;  2J8N A;  5IX3 A;  1QSO A;  1XE4 A;  4CRZ B;  4EVY A;  2RC4 A;  3FRM A;  2Z3K A;  4OAD A;  4YFJ A;  2FIA A;  4FD7 A;  4MFL A;  3SXN A;  4UFW A;  1I21 A;  2YNC C;  4RI1 A;  4AVC A;  4A31 A;  1MK4 A;  3H4Q A;  4HNX B;  4XPD B;  3EY5 A;  3IWE A;  4KS9 A;  2GIV A;  4CAV A;  4E0A A;  3GY9 A;  2I00 A;  1Y9K A;  2NMT A;  1M4G A;  2Q04 A;  2Q0Y A;  4JD6 A;  3A9L A;  1N71 A;  3P2H A;  5ISV A;  2B5G B;  2WSA A;  4C7I A;  5J8F A;  1BOB A;  2Q7B A;  5KTA A;  2JEV A;  2REF A;  4QBJ A;  3T9Y A;  3R1K A;  4C2X A;  5FVJ A;  3PP9 A;  2REE A;  2R1I A;  3EO4 A;  5F49 A;  2DPT A;  2BEI A;  2QEC A;  1YVO A;  3LD2 A;  3N7Z A;  2PSW A;  2ZW5 A;  3G8W A;  2P6G A;  4B12 A;  1NE9 A;  2P0W A;  3R96 A;  1MJB A;  4IUS A;  4XPK A;  3VWE A;  3S6K A;  4JXQ A;  3FYN A;  3FNC A;  2CXA A;  2P6E A;  2VXK A;  3F8K A;  2FS5 A;  3S6G A;  4KVM E;  3CXQ A;  1R57 A;  4CAE A;  2ATR A;  4MFP A;  2VQY A;  3W6S A;  4MHD A;  2DPS A;  2FE7 A;  4CGL A;  4NF1 A;  4CAW A;  2B4D B;  1XEB A;  2PDO A;  4KLW A;  4U5Y A;  2GE3 A;  4KLV A;  4Y49 B;  1M1D A;  4DNC A;  1UFH A;  2PR1 A;  4XNH B;  2VI7 A;  4CAF A;  3I3G A;  4HNY B;  1YK3 A;  2Z0Z A;  1I12 A;  5IB0 A;  4MY0 A;  2EVN A;  4QVT A;  3K9U A;  2VZY A;  1OZP A;  3CXP A;  4LX9 A;  1Y7R A;  3IWG A;  3GKR A;  1KUY A;  4XNH C;  3MGD A;  3DR8 A;  1S7N A;  1XIX A;  5F47 A;  3PGP A;  2FT0 A;  4HKF A;  4RS2 A;  4UCN A;  5DWN A;  1QSN A;  5F46 A;  2KCW A;  4QUS A;  2WPX A;  2PR8 A;  4XPL A;  5G1Z A;  2BL1 A;  2BSW A;  4ONU A;  5BWA B;  1IID A;  4MFJ A;  4KVO E;  2JLM A;  4R9M A;  2G3A A;  1IIC A;  2ZW6 A;  2I79 A;  1K4J A;  1J4J A;  2ZXV A;  3D2P A;  3SXO A;  2R8V A;  4KOY A;  3P2F A;  3R9F A;  4KOW A;  5H84 A;  5A27 A;  4PK3 A;  1WWZ A;  4JWP A;  4R87 A;  2Z3N A;  4PSW A;  3DSB A;  2Z11 A;  4MJ8 A;  4UCM A;  4A95 A;  2B4B A;  4F0Y A;  4JJX A;  2YGW A;  3TTH A;  2A4N A;  4KZT A;  4M85 A;  3CXS A;  4Q36 A;  4CGN A;  3FIX A;  4H89 A;  4M3S A;  4R57 A;  4B5O A;  4UWI A;  3TE4 A;  3NE7 A;  4NCZ A;  2DXQ A;  2HQY A;  5AG5 A;  5A28 A;  4AB7 A;  3IU2 A;  3EXN A;  1YRE A;  3EC4 A;  2X7B A;  4FD4 A;  4HNW B;  4KOS A;  2B5G A;  3D3S A;  5GCN A;  4KOX A;  4XPD C;  2IL4 A;  1CJW A;  1VHS A;  4K30 A;  4U9Z A;  1Q2Y A;  3W91 A;  3W6X A;  5E96 A;  3TO6 A;  3BJ8 A;  1M44 A;  4MBU A;  4FD5 A;  2EUI A;  4J3G A;  1RXT A;  4BMH A;  4AVA A;  4CYP A;  2VEZ A;  2R98 A;  2B3U A;  3D2M A;  3QB8 A;  2OB0 A;  4MY3 A;  1TIQ A;  2J8M A;  4ORF A;  3FB3 A;  4KOT A;  3ZJ0 A;  3OWC A;  3F0A A;  3TCV A;  2JDD A;  2Z10 A;  2VZZ A;  4KVX A;  3FBU A;  5F48 A;  4E2A A;  1IB1 E;  1U6M A;  4CYO A;  1MJA A;  2BUE A;  2G0B A;  2P6F A;  2B4D A;  2Q4V A;  2YNE A;  4LUA A;  4X5K A;  4B11 A;  4CGO A;  2PRB A;  2Z3O A;  3F5B A;  5AG7 A;  3VWD A;  1M4D A;  1YR0 A;  2CY2 A;  2FSR A;  2OZH A;  5AG4 A;  1Z4R A;  2CNS A;  3KKW A;  4B5P B;  2F5I A;  3DNS A;  3EFA A;  1YX0 A;  4Y49 C;  2QML A;  3R9G A;  2Z3P A;  1S7F A;  3FXT A;  3G3S A;  4Q38 A;  4CYN A;  2ZW4 A;  5KTC A;  2OZU A;  4L89 A;  1Z4E A;  2HV2 A;  1S60 A;  4KUB A;  4KUA A;  4C2Y A;  1NMT A;  2FXF A;  4R3L A;  4AVB A;  1BO4 A;  1VKC A;  4MFQ A;  4I49 A;  1Q2D A;  4CAX A;  5JQ4 A;  4AG9 A;  3TT2 A;  4E8O A;  5C82 A;  1YVK A;  5G21 A;  4KOV A;  4C2Z A;  1KUX A;  2Z3M A;  2R7H A;  3BJ7 A;  5C88 A;  1QSM A;  3H5Z A;  2WPW A;  2PC1 A;  2FIW A;  4UWJ A;  4QB9 A;  2OH1 A;  3C26 A;  2Q4Y A;  3S6H A;  1P4N A;  2GAN A;  2VBQ A;  1Q2C A;  2Z3L A;  1PUA A;  4PSX A;  1IYK A;  2OZG A;  1B6B A;  4UCP A;  2ZPA A;  5JPH A;  2B3V A;  3TO9 A;  4FD6 A;  4OAE A;  4QC6 A;  1B87 A;  3S6F A;  1QSR A;  5HH1 A;  3R9E A;  5AGE A;  1MJ9 A;  4KSA A;  4B14 A;  4CS0 B;  4JXR A;  3GYA A;  4KSF A;  1RO5 A;  4U9Y A;  1FY7 A;  1P0H A;  1KUV A;  5G22 A;  1QST A;  4ZGY B;  4B13 A;  1ON0 A;  1Z9U A;  4A33 A;  2G3T A;  1I1D A;  4UA3 A;  4IF5 A;  2JDC A;  3DR6 A;  4MFZ A;  3B8G A;  2ARH A;  1NSL A;  4A32 A;  2PQ8 A;  4AG7 A;  2Y0M A;  2AJ6 A;  4OLL A;  3IU1 A;  1S7K A;  3RYO A;  1KZF A;  1YGH A;  2WUU A;  4NSQ A;  4CGM A;  4NXY A;  3TO7 A;  5CNP A;  4NEX A;  2CNM A;  4MI4 A;  1S3Z A;  5DWM A;  4B10 A;  4F6A A;  1XF8 A;  1Y9W A;  1S5K A;  4A2Z A;  5IV0 A;  5AG6 A;  5G20 A;  4CYQ A;  1SQH A;  4JLY A;  3JUW A;  3D8P A;  2OU2 A;  1GHE A;  3ZZI A;  3LOD A;  3R95 A;  3WR7 A;  1M4I A;  4H6Z A;  2B58 A;  4II9 A;  4PV6 A;  4L8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...