2Q7BA

Crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
FQGMEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKMAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVLKKFFTYPKYRGNPVRLGRKLFERFMLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetyltransferase (NP_689019.1) from Streptococcus agalactiae 2603 at 2.00 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
molecule keywords Acetyltransferase, GNAT family
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q7bA00
2FCKA 2BEIA 2OB0A 2HV2A 1IICA 4KOUA 2JDDA 4U5YA 1P0HA 3FIXA 2D4OA 2VZYA 1YVKA 2R98A 2B4DA 2P0WA 4L89A 1RO5A 1UFHA 1KUXA 3FRMA 4MY3A 3LODA 1CM0A 3SXNA 3R9EA 2Y0MA 5FVJA 3S6FA 3FNCA 2QECA 1M4GA 5KTCA 5J8CA 4Y49C 3GKRA 2A4NA 4H89A 4B5PB 2FXFA 4KVXA 3D3SA 4GS4A 4I49A 1S7NA 4M85A 3SXOA 1WWZA 4KZTA 4NF1A 4QC6A 2Q7BA 3T9YA 4YRHA 4CAVA 4JJXA 4FD7A 1S7LA 5CNPA 2VI7A 2Q44A 4PV6A 4LUAA 1VHSA 5EBVA 4R57A 3EO4A 4RI1A 4KOWA 1MJ9A 2P6GA 3R96A 4NSQA 2P6EA 4KVME 4R9MA 2I00A 2Q0YA 1YR0A 2PDOA 2OZHA 4PSWA 4JWPA 2ZW4A 4H6UA 4OADA 3TE4A 1V0CA 3G8WA 1YGHA 3F8KA 4JD6A 2RC4A 1QSMA 1Z4EA 1Q2DA 1IYKA 2DXQA 4CRYB 2PQ8A 2Q4YA 4JXRA 3FYNA 3C26A 2F5IA 4XPDB 4KOTA 4NEXA 4XPDC 3R9GA 2I79A 2B3VA 2R7HA 1IIDA 4CAWA 3KKWA 4U9YA 2EUIA 1S3ZA 3D8PA 1QSOA 1XEBA 4UWIA 4AG9A 4CRZB 4F0YA 5E96A 2R1IA 2BUEA 2FSRA 1YX0A 4U9ZA 3QAHA 2FIWA 2QIRA 3SHPA 1GHEA 1M1DA 1MJBA 1B6BA 4KLWA 2FE7A 3OWCA 1I21A 4FD6A 1Y9WA 4XNHB 5C82A 1J4JA 1KUYA 2P6FA 3VWEA 2JEVA 5J8FA 5H86A 5KTDA 4KOSA 3FBUA 4AG7A 4E2AA 2VQYA 1LRZA 1S7FA 1N71A 1YVOA 4B5PA 3I3GA 1RXTA 4KUBA 1ON0A 2WPXA 3EY5A 2G0BA 1IYLA 4KUAA 4E8OA 2FT0A 3CXQA 4B5OA 5DWMA 2PRBA 2J8RA 4JLYA 2B3UA 1M4DA 3D2PA 2EVNA 4HNYB 1YK3A 3LD2A 3P2FA 1S7KA 1QSNA 1VKCA 1NSLA 4FD5A 3DNSA 2ARHA 3GYAA 3PZJA 4ONUA 3PP9A 3TT2A 1I1DA 3PGPA 1YLEA 3ZJ0A 3ZZIA 2R8VA 2ZPAA 3QB8A 1CJWA 4QVTA 1XF8A 4DNCA 1Y7RA 1BOBA 3JUWA 3DDDA 3BJ8A 3K9UA 2OZUA 2QMLA 4JXQA 2GANA 3TO9A 1XIXA 3S6GA 5DWNA 2BL1A 5H84A 4ZBGA 2FL4A 3TOAA 4Y49B 4R87A 2Z10A 4CS0B 2B5GA 2GIVA 4KLVA 4AB7A 2HUZA 1YREA 4YFJA 3W6XA 4KORA 2D4PA 4ORFA 2PR8A 1XMTA 2Q04A 3E0KA 3R1KA 5HMNA 2BSWA 3B8GA 2JLMA 2VZZA 1Z9UA 3JVNA 3R9FA 4PK2A 4XPLA 2CY2A 1Q2YA 5F47A 1Q2CA 1TIQA 3DR6A 4NCZA 2VEZA 1B87A 3IWGA 4MI4A 4KOYA 1KZFA 2B4BA 2J8MA 3TFYA 4QBJA 1BO4A 3T90A 3MGDA 1WK4A 4M3SA 3FB3A 3BLNA 4AVCA 1XE4A 4K30A 3RYOA 5JPHA 2ZW6A 2B4DB 4MY0A 3CXSA 1R57A 4LX9A 2C27A 2O28A 1NE9A 4II9A 4QB9A 3WR7A 3V8IA 4KOXA 3S6HA 1S5KA 4HKFA 2ZW7A 2KCWA 4IF5A 4KOVA 5ISVA 3UY5A 2B58A 4AVAA 4UBRA 4HNXB 5IV0A 2OH1A 4KVOE 4QUSA 3F0AA 2IL4A 5IX3A 1U6MA 4J3GA 2G3TA 3VWDA 4FD4A 2AE6A 4MBUA 4E0AA 3IGRA 2NMTA 2JDCA 2ZXVA 1I12A 2K5TA 5C88A 1Y9KA 4RS2A 1PU9A 1L0CA 3DSBA 1M4IA 4BMHA 5KTAA 1OZPA 3TCVA 1KUVA 3FXTA 5F49A 3N7ZA 2PC1A 5F48A 2OZGA 2Z0ZA 3BJ7A 2CNTA 3EXNA 4R3KA 3G3SA 3TO6A 4R3LA 2FS5A 2Z11A 5F46A 1MK4A 3F5BA 3GY9A 4EVYA 2VXKA 1K4JA 4HNWB 1QSTA 4H6ZA 5JQ4A 4PK3A 2H5MA 3D2MA 4OAEA 3P2HA 2VBQA 3TTHA 3H4QA 2J8NA 4XPKA 3DR8A 1Z4RA 2PR1A 3W91A 4OLLA 4NXYA 4YGOA 2ATRA 3EC4A 4X5KA 5EC4A 4F6AA 2CNMA 1P4NA 2HQYA 5IB0A 4PSXA 2Q4VA 3R95A 4UA3A 4CAXA 3EFAA 2G3AA 1FY7A 3TOBA 2X7BA 3TO7A 4MHDA 4XNHC 4L8AA 3CXPA 4UWJA 2REFA 2PSWA 2B5GB 2FIAA 1QSRA 1S60A 5GCNA 2ZW5A 4AVBA 1IB1E 3NE7A 3S6KA 1M44A 3I9SA 2OU2A 1NMTA 3W6SA 1SQHA 5I0CA 2AJ6A 4IUSA 2CNSA 1MJAA 2REEA 4MJ8A 2GE3A 1PUAA 5HH1A 2WPWA
chains in the Genus database with same CATH superfamily
2FCKA 2BEIA 3KR4A 2OB0A 2ZEOA 2HV2A 3IFEA 1IICA 4KOUA 3SJGA 2JDDA 1TF9A 8CPAA 1ZLIA 4BBHA 3KGQA 4MFPA 4U5YA 1P0HA 2QJ8A 3FIXA 1KWMA 3IJ3A 2D4OA 3PB8X 4P4JA 2CIJA 2VZYA 2Z3NA 1YVKA 4MHYA 2R98A 4UF4A 2B4DA 2P0WA 4L89A 1RO5A 1UFHA 4UEEA 1KUXA 2AFUA 3DGVA 3FRMA 4MY3A 3LODA 1CM0A 1ZG9A 4P6YA 3SXNA 3R9EA 2Y0MA 2FVGA 5FVJA 3S6FA 3FNCA 2QECA 3PB9X 1HEEA 3RO0A 3I1UA 1ARMA 4Q38A 1M4GA 7CPAA 5KTCA 3DLJA 5J8CA 2ZEPA 4Y49C 2DPSA 3GKRA 2O53A 4DJLA 3V7ZA 2A4NA 3NA6A 4UFWA 4NGTA 4H89A 4B5PB 2PJ3A 2FXFA 1CPSA 4KVXA 3D3SA 4GS4A 4I49A 1S7NA 4CAEA 4M85A 2PRQA 4PQAA 2IQ6A 1XFOA 3SXOA 1EE3P 1WWZA 2ZEEA 3LACA 5D29A 4KZTA 4NF1A 4QC6A 5LRJA 2Q7BA 4YRHA 3T9YA 4CAVA 4NGNA 5K8PA 3PB7X 4JJXA 1CX8A 5AG4A 4FD7A 1IU8A 2CTBA 1S7LA 5CNPA 1Y0RA 4UIBA 2WSAA 3KQXA 2VI7A 2Q44A 3D67A 1LAPA 4K3NA 3GUXA 4LUAA 4PV6A 3H8EA 5K8MA 1DE4C 1HDUA 1Z8XA 4A33A 2YGWA 4MCRA 1VHSA 5EBVA 2PJ7A 1Y0YA 2YNDA 4A32A 2JEWA 1VIXA 4R57A 3CT9A 4R7MA 3EO4A 1DTDA 4RI1A 4B6ZA 1AYEA 4KOWA 3FF3A 1MJ9A 2P6GA 3R96A 3T8WA 4NSQA 1F57A 2P6EA 2Q51A 3BI1A 4KVME 3PFOA 4OKOA 1YMEA 4R9MA 1A2ZA 2I00A 2Q0YA 1VHEA 2YNCC 2QYVA 4MFJA 1YR0A 5LRGA 5BWAB 4OP4A 5I4MA 2PDOA 2PVWA 2OZHA 4PSWA 3WC5A 4JWPA 2ZW4A 3GB0A 4H6UA 4OADA 3SI1A 2QVPA 4OMEA 3TE4A 1V0CA 3G8WA 4B14A 4B12A 1YGHA 3F8KA 4JD6A 4B13A 2RC4A 3NE8A 3PEIA 1QSMA 1OBRA 1Z4EA 1Q2DA 2ZENA 4GM5A 2Z3MA 1IYKA 2DXQA 3SJXA 3CZXA 4CRYB 2J9AA 2PQ8A 2BOAA 2IJZA 2PJ8A 3ISXA 2CXAA 1PYTB 3QAYA 4NJQA 5EMIA 4A2ZA 2Q4YA 4JXRA 3FYNA 4NFRA 4PXBA 3SI2A 1IOIA 3C26A 5JM6A 2F5IA 2RB7A 4XPDB 1PCAA 4KOTA 4NEXA 2V8GA 4XPDC 3R9GA 5THWA 3NFZA 3B7IA 4OC4A 2I79A 2B3VA 2R7HA 1TKFA 4RUHA 1IIDA 4WJBA 1AUGA 3GLJA 4OC0A 3KQZA 4CGNA 4CAWA 3K9TA 3KKWA 4U9YA 1Z8TA 2EUIA 4C68A 4UIAA 1S3ZA 1YSJA 3D8PA 3JRUA 1QSOA 4ZY1A 2JBJA 1YQEA 4ZX9A 2C6GA 4H2KA 1XEBA 3D7FA 4UWIA 1LCPA 2V8VA 4PXDA 4AG9A 4A94A 2BO9A 4M6GA 4CRZB 4F0YA 5E96A 1TKJA 1F2PA 4BINA 1X12A 2R1IA 2BUEA 5AG6A 5IB9A 3JTKA 2AFZA 2FSRA 2GLFA 3MRUA 1YX0A 4U9ZA 3KHXA 2G9DA 3S9NA 1IY7A 3QAHA 2FIWA 2QIRA 2V8DA 3NH5A 2EWBA 3SHPA 3B3CA 4C7HA 1GHEA 1M1DA 2EO8A 2PJ4A 1MJBA 1B6BA 2PJ5A 2FE7A 4KLWA 1ARLA 3OWCA 1I21A 4FD6A 4CGPA 1Y9WA 2WUUA 4XNHB 2F8HA 1J4JA 1KUYA 4EWTA 5C82A 2P6FA 2GLJA 2RFHA 2JEVA 4MXUA 3VWEA 5F09A 5J8FA 5H86A 5KTDA 4DYOA 4KOSA 4OC2A 4P4EA 2AFXA 1IOFA 4CGOA 2YNEA 3FBUA 1XBUA 5D8NA 4AG7A 1ZG7A 2DEAA 2YNCA 4E2AA 1TF8A 4MFZA 3FX6A 4AXVA 4ZGYB 2VQYA 2C6CA 3VATA 1LRZA 1H8LA 1CP7A 1FT7A 1S7FA 4ONWA 1N71A 3IU1A 1YVOA 4OC5A 3V38A 4B5PA 3I3GA 1RXTA 2GREA 3LWUA 4KUBA 1ON0A 2WPXA 3EY5A 2G0BA 4NGSA 2Z3KA 4MCPA 1IYLA 3K2KA 4KUAA 4E8OA 2FT0A 4MFKA 3H8GA 3CXQA 3SJEA 4B5OA 1R3NA 1CP6A 3VH9A 2EK8A 1F2OA 1LAMA 2DPTA 2PRBA 4W9YA 5DWMA 1TXRA 2J8RA 4JLYA 2B3UA 2BCOA 1M4DA 3D2PA 2EVNA 4HNYB 1YK3A 3LD2A 3P2FA 1S7KA 1QSNA 1VKCA 2CF4A 4UEFA 2PCUA 2XEJA 2PJBA 5AG5A 1NSLA 4CYOA 4FD5A 3DNSA 2ZOFA 2ARHA 2C6PA 4ZY0A 4P4IA 4B10A 3GYAA 3PZJA 4MHPA 4ONUA 5LYDA 3H8FA 3PP9A 3TT2A 1I1DA 4A30A 4CYNA 4X3RA 3PGPA 3KI9A 1YLEA 5A28A 2WZNA 4NGQA 3ZJ0A 3ZZIA 2R8VA 4JZ0A 2O4HA 2ZPAA 3QB8A 1BLLE 2ZOGA 1XJOA 3RZAA 2ZEGA 5LYFA 1CJWA 4QVTA 1BAVA 3MN8A 1M4LA 3WABA 3RNZA 1XF8A 4DNCA 1Y7RA 4P4BA 5K8NA 5J1QA 1BOBA 3JUWA 3DDDA 4IAVA 5DS0A 2OZUA 2GANA 3BJ8A 2PIYA 2QMLA 3K9UA 4JXQA 3TO9A 4PXCA 2ZEDA 1XIXA 3S6GA 2EK9A 5HVFA 5DWNA 2Z3LA 2BL1A 2HC9A 5H84A 3H5ZA 4ZBGA 2FL4A 5G21A 3TOAA 4CGMA 4Y49B 1ELLP 4ZY2A 5JH9A 3D7HA 4R87A 2Z10A 4ZX8A 2B5GA 4CS0B 2GIVA 2PJ1A 4KLVA 4R6TA 4AB7A 4FAIA 2HUZA 1YREA 2AFOA 4YFJA 2ABZA 2ZEFA 2Q7SA 3PB4X 3W6XA 3WT4A 4KORA 2D4PA 4ZYQA 3IC1A 4ORFA 3VARA 5LRKA 2PR8A 2WPWA 1XMTA 2Q04A 3E0KA 3R1KA 4KS9A 4TNUA 5HMNA 2BSWA 1GYTA 4UEZA 3B2YA 4P44A 3B8GA 1ZG8A 1Z8LA 2JLMA 2VZZA 3PB6X 1QQ9A 1XOVA 1Z9UA 3D4UA 3JVNA 4MHNA 1BPMA 4PK2A 5G1ZA 4XPLA 3R9FA 2POKA 2CY2A 1AMPA 1Q2YA 3KR5A 3TX8A 2ZEHA 4C2XA 3IWEA 4TWEA 1Y7EA 5F47A 3WC7A 1Q2CA 1Q7LA 1TIQA 1YW6A 3IU2A 5G20A 3DR6A 1RTQA 4NCZA 2VEZA 1B87A 3IWGA 5LYIA 4MI4A 4P4DA 4F0XA 3B3SA 4KOYA 1KZFA 4MMOA 2B4BA 2J8MA 4M6IA 2AFMA 3TFYA 4QBJA 1BO4A 2NYQA 3MGDA 3T90A 2Z3OA 2NSMA 4FBEA 4B11A 1WK4A 4DUKA 1JWQA 3FECA 4M3SA 2PJ2A 3FB3A 3BLNA 4AVCA 3A9LA 1XE4A 4K30A 3RYOA 1UWYA 4OIDA 3S9MA 4R8FA 5JPHA 2Z3PA 2ZW6A 2B4DB 2VL1A 4IHMA 4MY0A 3CXSA 4KSFA 4X8IA 1R57A 4LX9A 2C27A 2O28A 2GFQA 1NE9A 3D7GA 4CAFA 4II9A 4WWVA 4QB9A 3D66A 3WR7A 3V8IA 4KOXA 3S6HA 5AGEA 3LMSA 4C2ZA 3HLPA 1S5KA 3IEHA 4HKFA 4A31A 2ZW7A 2DF5A 3PBEA 2KCWA 1YLOA 3ISZA 4IF5A 4KOVA 4M6HA 1YW4A 4Q36A 4X2TA 3UY5A 4A38A 5ISVA 2PIZA 2B58A 4AVAA 2PE3A 1LOKA 3N5FA 4UBRA 1CBXA 4HNXB 5IV0A 2OH1A 3FVLA 4MFLA 1BPNA 2Q4ZA 2V8HA 4KVOE 5AG7A 5A27A 2PVVA 2XEFA 4UFVA 3HUVA 4UCPA 3WC6A 3TC8A 4QUSA 3PRTA 4UFXA 3F0AA 2IL4A 5IX3A 1U6MA 4J3GA 2G3TA 3VWDA 4FD4A 4NGRA 5G22A 2AE6A 4MBUA 4E0AA 3IGRA 4NGPA 3NH8A 4A95A 3B3WA 2NMTA 2JDCA 2ZXVA 1R43A 1I12A 2K5TA 5C88A 1Y9KA 4RS2A 1PU9A 1L0CA 4PXEA 4C2YA 3DSBA 1M4IA 3B35A 3KZWA 1X10A 4BMHA 5KTAA 4F9VA 3QNVA 3KL9A 1OZPA 3TCVA 1KUVA 1VGYA 1Z5RA 4KSIA 3CPAA 5ELYA 3FXTA 4CYPA 4NJRA 3BHXA 4OC3A 5F49A 3N7ZA 2XEIA 2AFSA 2PC1A 2OZGA 3FH4A 4NGMA 5F48A 4MCSA 2Z0ZA 4R76A 1ELMP 5CPAA 3BJ7A 1ZLHA 4G1PA 2CNTA 3EXNA 4OC1A 3RAMA 2ANPA 4BD9A 4R3KA 1CG2A 5LYLA 3G3SA 3TO6A 4R3LA 1LANA 2FS5A 1NSAA 2OR4A 2Z11A 5F46A 1MK4A 3F5BA 2C1CA 3GY9A 4C7IA 4P45A 4EVYA 2VXKA 4LQGA 1K4JA 4HNWB 1QSTA 2ZELA 3NH4A 4H6ZA 4PK3A 5JQ4A 3D68A 2H5MA 3D2MA 4OAEA 3S9LA 3P2HA 1LFWA 4RN7A 2VBQA 4MRIA 2AFWA 4F9UA 3KASA 3TTHA 3BI0A 3H4QA 4P4FA 1ZO0A 2J8NA 3GIUA 2CTCA 4A37A 4XPKA 2ZEMA 3DR8A 3CDXA 1VHOA 5HVHA 3KHZA 3FEEA 4LQ6A 4CGLA 1Z4RA 4GXHA 2PR1A 2PJ9A 2Q43A 2PJ0A 3FMCA 3L2NA 4OLLA 3IIBA 3W91A 1JQGA 4NXYA 2OOTA 1CPXA 4ZI6A 4YGOA 2ATRA 3PFEA 3EC4A 4X5KA 5EC4A 4F6AA 4YU9A 3FEDA 1XRYA 2CNMA 1P4NA 2HQYA 5IB0A 4PSXA 5JGFA 4HPSA 3RBUA 3SI0A 2Q4VA 4IK2A 4UCMA 3R95A 4JYWA 3B3TA 1XMBA 4PPZA 4CYQA 5HXDA 4UA3A 4CAXA 2XEGA 4KSAA 2I3CA 3EFAA 2G3AA 3IWWA 1FY7A 2WYRA 4FWUA 2X7BA 3TOBA 3TO7A 4MHDA 4XNHC 2PJ6A 4L8AA 3B3VA 4OIWA 2F7VA 3CXPA 4UWJA 2REFA 2PSWA 1TKHA 3IO1A 4F8ZA 3BXMA 2PJAA 3SJFA 4CPAA 1QMUA 1HDQA 3FJUA 6CPAA 2B5GB 2FIAA 1IGBA 1QSRA 1S60A 2HB6A 5GCNA 1Z2LA 3CPXA 2ZW5A 4AVBA 1IB1E 3NE7A 4P10A 5K8OA 3S6KA 4EFDA 1M44A 4MCQA 4Q7AA 3I9SA 2ODFA 1Z8WA 2OU2A 1NMTA 4MHZA 3W6SA 1SQHA 2V77A 4YWYA 5I0CA 2AJ6A 4IUSA 5CBMA 1FNOA 4O23A 2CNSA 2IMOA 1MJAA 4UCNA 4A39A 4Z65A 4EMEA 2REEA 4FUUA 2JBKA 2GU2A 4MJ8A 3D7DA 3PBBA 2GE3A 1PUAA 5HH1A 4MFQA 5HVGA 2EBJA 2PJCA
chains in the Genus database with same CATH topology
2FCKA 2BEIA 2OB0A 2HV2A 1IICA 4KOUA 2JDDA 4BBHA 4MFPA 4U5YA 1P0HA 3FIXA 2D4OA 2VZYA 2Z3NA 1YVKA 2R98A 2B4DA 2P0WA 4L89A 1RO5A 1UFHA 1KUXA 3FRMA 4MY3A 3LODA 1CM0A 3SXNA 3R9EA 2Y0MA 5FVJA 3S6FA 3FNCA 2QECA 4Q38A 1M4GA 5KTCA 5J8CA 4Y49C 2DPSA 3GKRA 2A4NA 4UFWA 4H89A 4B5PB 2FXFA 4KVXA 3D3SA 4GS4A 4I49A 1S7NA 4CAEA 4M85A 3SXOA 1WWZA 4KZTA 4NF1A 4QC6A 2Q7BA 3T9YA 4YRHA 4CAVA 4JJXA 5AG4A 4FD7A 1S7LA 5CNPA 2WSAA 2VI7A 2Q44A 4PV6A 4LUAA 4A33A 2YGWA 1VHSA 5EBVA 2YNDA 4A32A 4R57A 3EO4A 4RI1A 4KOWA 1MJ9A 2P6GA 3R96A 4NSQA 2P6EA 4KVME 4R9MA 2I00A 2Q0YA 2YNCC 4MFJA 1YR0A 5BWAB 2PDOA 2OZHA 4PSWA 4JWPA 2ZW4A 4H6UA 4OADA 3TE4A 1V0CA 3G8WA 4B14A 4B12A 1YGHA 3F8KA 4JD6A 4B13A 2RC4A 1QSMA 1Z4EA 1Q2DA 2Z3MA 1IYKA 2DXQA 4CRYB 2PQ8A 4A2ZA 2CXAA 2Q4YA 4JXRA 3FYNA 3C26A 2F5IA 4XPDB 4KOTA 4NEXA 4XPDC 3R9GA 2I79A 2B3VA 2R7HA 1IIDA 4CGNA 4CAWA 3KKWA 4U9YA 2EUIA 4C68A 1S3ZA 3D8PA 1QSOA 1XEBA 4UWIA 4AG9A 4CRZB 4F0YA 5E96A 2R1IA 2BUEA 5AG6A 3JTKA 2FSRA 1YX0A 4U9ZA 3QAHA 2FIWA 2QIRA 3SHPA 4C7HA 1GHEA 1M1DA 1MJBA 1B6BA 4KLWA 2FE7A 3OWCA 4CGPA 1I21A 4FD6A 1Y9WA 2WUUA 4XNHB 5C82A 1J4JA 1KUYA 2P6FA 3VWEA 2JEVA 5J8FA 5H86A 5KTDA 4KOSA 4CGOA 2YNEA 3FBUA 4AG7A 4E2AA 2YNCA 4MFZA 4ZGYB 2VQYA 1LRZA 1S7FA 1N71A 3IU1A 1YVOA 4B5PA 3I3GA 1RXTA 4KUBA 1ON0A 2WPXA 3EY5A 2G0BA 2Z3KA 1IYLA 4KUAA 4E8OA 2FT0A 4MFKA 3CXQA 4B5OA 2DPTA 2PRBA 5DWMA 2J8RA 4JLYA 2B3UA 1M4DA 3D2PA 2EVNA 4HNYB 1YK3A 3LD2A 3P2FA 1S7KA 1QSNA 1VKCA 4CYOA 5AG5A 1NSLA 4FD5A 3DNSA 2ARHA 4B10A 3GYAA 3PZJA 4ONUA 3PP9A 3TT2A 1I1DA 4A30A 4CYNA 3PGPA 1YLEA 5A28A 3ZJ0A 3ZZIA 2R8VA 2ZPAA 3QB8A 1CJWA 4QVTA 1XF8A 4DNCA 1Y7RA 1BOBA 3JUWA 3DDDA 3BJ8A 3K9UA 2OZUA 2QMLA 4JXQA 2GANA 3TO9A 1XIXA 3S6GA 5DWNA 2Z3LA 2BL1A 5H84A 3H5ZA 4ZBGA 2FL4A 5G21A 3TOAA 4CGMA 4Y49B 4R87A 2Z10A 4CS0B 2B5GA 2GIVA 4KLVA 4AB7A 2HUZA 1YREA 4YFJA 3W6XA 4KORA 2D4PA 4ORFA 2PR8A 1XMTA 2Q04A 3E0KA 3R1KA 4KS9A 5HMNA 2BSWA 3B8GA 2JLMA 2VZZA 1Z9UA 3JVNA 5G1ZA 4PK2A 3R9FA 4XPLA 2CY2A 4C2XA 1Q2YA 3IWEA 5F47A 1Q2CA 1TIQA 3IU2A 5G20A 3DR6A 4NCZA 2VEZA 1B87A 3IWGA 4MI4A 4F0XA 4KOYA 1KZFA 2B4BA 2J8MA 3TFYA 4QBJA 1BO4A 3T90A 3MGDA 2Z3OA 4B11A 1WK4A 4M3SA 3FB3A 3BLNA 4AVCA 3A9LA 1XE4A 4K30A 3RYOA 5JPHA 2Z3PA 2ZW6A 2B4DB 4MY0A 3CXSA 4KSFA 1R57A 4LX9A 2C27A 2O28A 4CAFA 1NE9A 4II9A 4QB9A 3WR7A 3V8IA 4KOXA 3S6HA 5AGEA 4C2ZA 1S5KA 4HKFA 4A31A 2ZW7A 2KCWA 4IF5A 4KOVA 4Q36A 5ISVA 3UY5A 2B58A 4AVAA 4UBRA 4HNXB 5IV0A 2OH1A 4MFLA 4KVOE 5AG7A 5A27A 4UFVA 4UCPA 4QUSA 4UFXA 3F0AA 2IL4A 5IX3A 1U6MA 4J3GA 2G3TA 3VWDA 4FD4A 5G22A 2AE6A 4MBUA 4E0AA 3IGRA 4A95A 2NMTA 2JDCA 2ZXVA 1I12A 2K5TA 5C88A 1Y9KA 4RS2A 1PU9A 1L0CA 4C2YA 3DSBA 1M4IA 4BMHA 5KTAA 1OZPA 3TCVA 1KUVA 3FXTA 4CYPA 5F49A 3N7ZA 2PC1A 5F48A 2OZGA 2Z0ZA 3BJ7A 2CNTA 3EXNA 4R3KA 3G3SA 3TO6A 4R3LA 2FS5A 2Z11A 5F46A 1MK4A 3F5BA 3GY9A 4C7IA 4EVYA 2VXKA 1K4JA 4HNWB 1QSTA 4H6ZA 5JQ4A 4PK3A 2H5MA 3D2MA 4OAEA 3P2HA 2VBQA 3TTHA 3H4QA 1ZO0A 2J8NA 4XPKA 3DR8A 4CGLA 1Z4RA 2PR1A 3W91A 4OLLA 4NXYA 4YGOA 2ATRA 3EC4A 4X5KA 5EC4A 4F6AA 2CNMA 1P4NA 2HQYA 5IB0A 4PSXA 2Q4VA 3R95A 4UCMA 4CYQA 4UA3A 4CAXA 4KSAA 3EFAA 2G3AA 1FY7A 3TOBA 2X7BA 3TO7A 4MHDA 4XNHC 4L8AA 3CXPA 4UWJA 2REFA 2PSWA 2B5GB 2FIAA 1QSRA 1S60A 5GCNA 2ZW5A 4AVBA 1IB1E 3NE7A 3S6KA 1M44A 3I9SA 2OU2A 1NMTA 3W6SA 1SQHA 5I0CA 2AJ6A 4IUSA 2CNSA 1MJAA 4UCNA 2REEA 4MJ8A 2GE3A 1PUAA 5HH1A 4MFQA 2WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCK A;  2BEI A;  2OB0 A;  2HV2 A;  1IIC A;  4KOU A;  2JDD A;  4U5Y A;  1P0H A;  3FIX A;  2D4O A;  2VZY A;  1YVK A;  2R98 A;  2B4D A;  2P0W A;  4L89 A;  1RO5 A;  1UFH A;  1KUX A;  3FRM A;  4MY3 A;  3LOD A;  1CM0 A;  3SXN A;  3R9E A;  2Y0M A;  5FVJ A;  3S6F A;  3FNC A;  2QEC A;  1M4G A;  5KTC A;  5J8C A;  4Y49 C;  3GKR A;  2A4N A;  4H89 A;  4B5P B;  2FXF A;  4KVX A;  3D3S A;  4GS4 A;  4I49 A;  1S7N A;  4M85 A;  3SXO A;  1WWZ A;  4KZT A;  4NF1 A;  4QC6 A;  2Q7B A;  3T9Y A;  4YRH A;  4CAV A;  4JJX A;  4FD7 A;  1S7L A;  5CNP A;  2VI7 A;  2Q44 A;  4PV6 A;  4LUA A;  1VHS A;  5EBV A;  4R57 A;  3EO4 A;  4RI1 A;  4KOW A;  1MJ9 A;  2P6G A;  3R96 A;  4NSQ A;  2P6E A;  4KVM E;  4R9M A;  2I00 A;  2Q0Y A;  1YR0 A;  2PDO A;  2OZH A;  4PSW A;  4JWP A;  2ZW4 A;  4H6U A;  4OAD A;  3TE4 A;  1V0C A;  3G8W A;  1YGH A;  3F8K A;  4JD6 A;  2RC4 A;  1QSM A;  1Z4E A;  1Q2D A;  1IYK A;  2DXQ A;  4CRY B;  2PQ8 A;  2Q4Y A;  4JXR A;  3FYN A;  3C26 A;  2F5I A;  4XPD B;  4KOT A;  4NEX A;  4XPD C;  3R9G A;  2I79 A;  2B3V A;  2R7H A;  1IID A;  4CAW A;  3KKW A;  4U9Y A;  2EUI A;  1S3Z A;  3D8P A;  1QSO A;  1XEB A;  4UWI A;  4AG9 A;  4CRZ B;  4F0Y A;  5E96 A;  2R1I A;  2BUE A;  2FSR A;  1YX0 A;  4U9Z A;  3QAH A;  2FIW A;  2QIR A;  3SHP A;  1GHE A;  1M1D A;  1MJB A;  1B6B A;  4KLW A;  2FE7 A;  3OWC A;  1I21 A;  4FD6 A;  1Y9W A;  4XNH B;  5C82 A;  1J4J A;  1KUY A;  2P6F A;  3VWE A;  2JEV A;  5J8F A;  5H86 A;  5KTD A;  4KOS A;  3FBU A;  4AG7 A;  4E2A A;  2VQY A;  1LRZ A;  1S7F A;  1N71 A;  1YVO A;  4B5P A;  3I3G A;  1RXT A;  4KUB A;  1ON0 A;  2WPX A;  3EY5 A;  2G0B A;  1IYL A;  4KUA A;  4E8O A;  2FT0 A;  3CXQ A;  4B5O A;  5DWM A;  2PRB A;  2J8R A;  4JLY A;  2B3U A;  1M4D A;  3D2P A;  2EVN A;  4HNY B;  1YK3 A;  3LD2 A;  3P2F A;  1S7K A;  1QSN A;  1VKC A;  1NSL A;  4FD5 A;  3DNS A;  2ARH A;  3GYA A;  3PZJ A;  4ONU A;  3PP9 A;  3TT2 A;  1I1D A;  3PGP A;  1YLE A;  3ZJ0 A;  3ZZI A;  2R8V A;  2ZPA A;  3QB8 A;  1CJW A;  4QVT A;  1XF8 A;  4DNC A;  1Y7R A;  1BOB A;  3JUW A;  3DDD A;  3BJ8 A;  3K9U A;  2OZU A;  2QML A;  4JXQ A;  2GAN A;  3TO9 A;  1XIX A;  3S6G A;  5DWN A;  2BL1 A;  5H84 A;  4ZBG A;  2FL4 A;  3TOA A;  4Y49 B;  4R87 A;  2Z10 A;  4CS0 B;  2B5G A;  2GIV A;  4KLV A;  4AB7 A;  2HUZ A;  1YRE A;  4YFJ A;  3W6X A;  4KOR A;  2D4P A;  4ORF A;  2PR8 A;  1XMT A;  2Q04 A;  3E0K A;  3R1K A;  5HMN A;  2BSW A;  3B8G A;  2JLM A;  2VZZ A;  1Z9U A;  3JVN A;  3R9F A;  4PK2 A;  4XPL A;  2CY2 A;  1Q2Y A;  5F47 A;  1Q2C A;  1TIQ A;  3DR6 A;  4NCZ A;  2VEZ A;  1B87 A;  3IWG A;  4MI4 A;  4KOY A;  1KZF A;  2B4B A;  2J8M A;  3TFY A;  4QBJ A;  1BO4 A;  3T90 A;  3MGD A;  1WK4 A;  4M3S A;  3FB3 A;  3BLN A;  4AVC A;  1XE4 A;  4K30 A;  3RYO A;  5JPH A;  2ZW6 A;  2B4D B;  4MY0 A;  3CXS A;  1R57 A;  4LX9 A;  2C27 A;  2O28 A;  1NE9 A;  4II9 A;  4QB9 A;  3WR7 A;  3V8I A;  4KOX A;  3S6H A;  1S5K A;  4HKF A;  2ZW7 A;  2KCW A;  4IF5 A;  4KOV A;  5ISV A;  3UY5 A;  2B58 A;  4AVA A;  4UBR A;  4HNX B;  5IV0 A;  2OH1 A;  4KVO E;  4QUS A;  3F0A A;  2IL4 A;  5IX3 A;  1U6M A;  4J3G A;  2G3T A;  3VWD A;  4FD4 A;  2AE6 A;  4MBU A;  4E0A A;  3IGR A;  2NMT A;  2JDC A;  2ZXV A;  1I12 A;  2K5T A;  5C88 A;  1Y9K A;  4RS2 A;  1PU9 A;  1L0C A;  3DSB A;  1M4I A;  4BMH A;  5KTA A;  1OZP A;  3TCV A;  1KUV A;  3FXT A;  5F49 A;  3N7Z A;  2PC1 A;  5F48 A;  2OZG A;  2Z0Z A;  3BJ7 A;  2CNT A;  3EXN A;  4R3K A;  3G3S A;  3TO6 A;  4R3L A;  2FS5 A;  2Z11 A;  5F46 A;  1MK4 A;  3F5B A;  3GY9 A;  4EVY A;  2VXK A;  1K4J A;  4HNW B;  1QST A;  4H6Z A;  5JQ4 A;  4PK3 A;  2H5M A;  3D2M A;  4OAE A;  3P2H A;  2VBQ A;  3TTH A;  3H4Q A;  2J8N A;  4XPK A;  3DR8 A;  1Z4R A;  2PR1 A;  3W91 A;  4OLL A;  4NXY A;  4YGO A;  2ATR A;  3EC4 A;  4X5K A;  5EC4 A;  4F6A A;  2CNM A;  1P4N A;  2HQY A;  5IB0 A;  4PSX A;  2Q4V A;  3R95 A;  4UA3 A;  4CAX A;  3EFA A;  2G3A A;  1FY7 A;  3TOB A;  2X7B A;  3TO7 A;  4MHD A;  4XNH C;  4L8A A;  3CXP A;  4UWJ A;  2REF A;  2PSW A;  2B5G B;  2FIA A;  1QSR A;  1S60 A;  5GCN A;  2ZW5 A;  4AVB A;  1IB1 E;  3NE7 A;  3S6K A;  1M44 A;  3I9S A;  2OU2 A;  1NMT A;  3W6S A;  1SQH A;  5I0C A;  2AJ6 A;  4IUS A;  2CNS A;  1MJA A;  2REE A;  4MJ8 A;  2GE3 A;  1PUA A;  5HH1 A;  2WPW A; 
#chains in the Genus database with same CATH topology
 2FCK A;  2BEI A;  3KR4 A;  2OB0 A;  2ZEO A;  2HV2 A;  3IFE A;  1IIC A;  4KOU A;  3SJG A;  2JDD A;  1TF9 A;  8CPA A;  1ZLI A;  4BBH A;  3KGQ A;  4MFP A;  4U5Y A;  1P0H A;  2QJ8 A;  3FIX A;  1KWM A;  3IJ3 A;  2D4O A;  3PB8 X;  4P4J A;  2CIJ A;  2VZY A;  2Z3N A;  1YVK A;  4MHY A;  2R98 A;  4UF4 A;  2B4D A;  2P0W A;  4L89 A;  1RO5 A;  1UFH A;  4UEE A;  1KUX A;  2AFU A;  3DGV A;  3FRM A;  4MY3 A;  3LOD A;  1CM0 A;  1ZG9 A;  4P6Y A;  3SXN A;  3R9E A;  2Y0M A;  2FVG A;  5FVJ A;  3S6F A;  3FNC A;  2QEC A;  3PB9 X;  1HEE A;  3RO0 A;  3I1U A;  1ARM A;  4Q38 A;  1M4G A;  7CPA A;  5KTC A;  3DLJ A;  5J8C A;  2ZEP A;  4Y49 C;  2DPS A;  3GKR A;  2O53 A;  4DJL A;  3V7Z A;  2A4N A;  3NA6 A;  4UFW A;  4NGT A;  4H89 A;  4B5P B;  2PJ3 A;  2FXF A;  1CPS A;  4KVX A;  3D3S A;  4GS4 A;  4I49 A;  1S7N A;  4CAE A;  4M85 A;  2PRQ A;  4PQA A;  2IQ6 A;  1XFO A;  3SXO A;  1EE3 P;  1WWZ A;  2ZEE A;  3LAC A;  5D29 A;  4KZT A;  4NF1 A;  4QC6 A;  5LRJ A;  2Q7B A;  4YRH A;  3T9Y A;  4CAV A;  4NGN A;  5K8P A;  3PB7 X;  4JJX A;  1CX8 A;  5AG4 A;  4FD7 A;  1IU8 A;  2CTB A;  1S7L A;  5CNP A;  1Y0R A;  4UIB A;  2WSA A;  3KQX A;  2VI7 A;  2Q44 A;  3D67 A;  1LAP A;  4K3N A;  3GUX A;  4LUA A;  4PV6 A;  3H8E A;  5K8M A;  1DE4 C;  1HDU A;  1Z8X A;  4A33 A;  2YGW A;  4MCR A;  1VHS A;  5EBV A;  2PJ7 A;  1Y0Y A;  2YND A;  4A32 A;  2JEW A;  1VIX A;  4R57 A;  3CT9 A;  4R7M A;  3EO4 A;  1DTD A;  4RI1 A;  4B6Z A;  1AYE A;  4KOW A;  3FF3 A;  1MJ9 A;  2P6G A;  3R96 A;  3T8W A;  4NSQ A;  1F57 A;  2P6E A;  2Q51 A;  3BI1 A;  4KVM E;  3PFO A;  4OKO A;  1YME A;  4R9M A;  1A2Z A;  2I00 A;  2Q0Y A;  1VHE A;  2YNC C;  2QYV A;  4MFJ A;  1YR0 A;  5LRG A;  5BWA B;  4OP4 A;  5I4M A;  2PDO A;  2PVW A;  2OZH A;  4PSW A;  3WC5 A;  4JWP A;  2ZW4 A;  3GB0 A;  4H6U A;  4OAD A;  3SI1 A;  2QVP A;  4OME A;  3TE4 A;  1V0C A;  3G8W A;  4B14 A;  4B12 A;  1YGH A;  3F8K A;  4JD6 A;  4B13 A;  2RC4 A;  3NE8 A;  3PEI A;  1QSM A;  1OBR A;  1Z4E A;  1Q2D A;  2ZEN A;  4GM5 A;  2Z3M A;  1IYK A;  2DXQ A;  3SJX A;  3CZX A;  4CRY B;  2J9A A;  2PQ8 A;  2BOA A;  2IJZ A;  2PJ8 A;  3ISX A;  2CXA A;  1PYT B;  3QAY A;  4NJQ A;  5EMI A;  4A2Z A;  2Q4Y A;  4JXR A;  3FYN A;  4NFR A;  4PXB A;  3SI2 A;  1IOI A;  3C26 A;  5JM6 A;  2F5I A;  2RB7 A;  4XPD B;  1PCA A;  4KOT A;  4NEX A;  2V8G A;  4XPD C;  3R9G A;  5THW A;  3NFZ A;  3B7I A;  4OC4 A;  2I79 A;  2B3V A;  2R7H A;  1TKF A;  4RUH A;  1IID A;  4WJB A;  1AUG A;  3GLJ A;  4OC0 A;  3KQZ A;  4CGN A;  4CAW A;  3K9T A;  3KKW A;  4U9Y A;  1Z8T A;  2EUI A;  4C68 A;  4UIA A;  1S3Z A;  1YSJ A;  3D8P A;  3JRU A;  1QSO A;  4ZY1 A;  2JBJ A;  1YQE A;  4ZX9 A;  2C6G A;  4H2K A;  1XEB A;  3D7F A;  4UWI A;  1LCP A;  2V8V A;  4PXD A;  4AG9 A;  4A94 A;  2BO9 A;  4M6G A;  4CRZ B;  4F0Y A;  5E96 A;  1TKJ A;  1F2P A;  4BIN A;  1X12 A;  2R1I A;  2BUE A;  5AG6 A;  5IB9 A;  3JTK A;  2AFZ A;  2FSR A;  2GLF A;  3MRU A;  1YX0 A;  4U9Z A;  3KHX A;  2G9D A;  3S9N A;  1IY7 A;  3QAH A;  2FIW A;  2QIR A;  2V8D A;  3NH5 A;  2EWB A;  3SHP A;  3B3C A;  4C7H A;  1GHE A;  1M1D A;  2EO8 A;  2PJ4 A;  1MJB A;  1B6B A;  2PJ5 A;  2FE7 A;  4KLW A;  1ARL A;  3OWC A;  1I21 A;  4FD6 A;  4CGP A;  1Y9W A;  2WUU A;  4XNH B;  2F8H A;  1J4J A;  1KUY A;  4EWT A;  5C82 A;  2P6F A;  2GLJ A;  2RFH A;  2JEV A;  4MXU A;  3VWE A;  5F09 A;  5J8F A;  5H86 A;  5KTD A;  4DYO A;  4KOS A;  4OC2 A;  4P4E A;  2AFX A;  1IOF A;  4CGO A;  2YNE A;  3FBU A;  1XBU A;  5D8N A;  4AG7 A;  1ZG7 A;  2DEA A;  2YNC A;  4E2A A;  1TF8 A;  4MFZ A;  3FX6 A;  4AXV A;  4ZGY B;  2VQY A;  2C6C A;  3VAT A;  1LRZ A;  1H8L A;  1CP7 A;  1FT7 A;  1S7F A;  4ONW A;  1N71 A;  3IU1 A;  1YVO A;  4OC5 A;  3V38 A;  4B5P A;  3I3G A;  1RXT A;  2GRE A;  3LWU A;  4KUB A;  1ON0 A;  2WPX A;  3EY5 A;  2G0B A;  4NGS A;  2Z3K A;  4MCP A;  1IYL A;  3K2K A;  4KUA A;  4E8O A;  2FT0 A;  4MFK A;  3H8G A;  3CXQ A;  3SJE A;  4B5O A;  1R3N A;  1CP6 A;  3VH9 A;  2EK8 A;  1F2O A;  1LAM A;  2DPT A;  2PRB A;  4W9Y A;  5DWM A;  1TXR A;  2J8R A;  4JLY A;  2B3U A;  2BCO A;  1M4D A;  3D2P A;  2EVN A;  4HNY B;  1YK3 A;  3LD2 A;  3P2F A;  1S7K A;  1QSN A;  1VKC A;  2CF4 A;  4UEF A;  2PCU A;  2XEJ A;  2PJB A;  5AG5 A;  1NSL A;  4CYO A;  4FD5 A;  3DNS A;  2ZOF A;  2ARH A;  2C6P A;  4ZY0 A;  4P4I A;  4B10 A;  3GYA A;  3PZJ A;  4MHP A;  4ONU A;  5LYD A;  3H8F A;  3PP9 A;  3TT2 A;  1I1D A;  4A30 A;  4CYN A;  4X3R A;  3PGP A;  3KI9 A;  1YLE A;  5A28 A;  2WZN A;  4NGQ A;  3ZJ0 A;  3ZZI A;  2R8V A;  4JZ0 A;  2O4H A;  2ZPA A;  3QB8 A;  1BLL E;  2ZOG A;  1XJO A;  3RZA A;  2ZEG A;  5LYF A;  1CJW A;  4QVT A;  1BAV A;  3MN8 A;  1M4L A;  3WAB A;  3RNZ A;  1XF8 A;  4DNC A;  1Y7R A;  4P4B A;  5K8N A;  5J1Q A;  1BOB A;  3JUW A;  3DDD A;  4IAV A;  5DS0 A;  2OZU A;  2GAN A;  3BJ8 A;  2PIY A;  2QML A;  3K9U A;  4JXQ A;  3TO9 A;  4PXC A;  2ZED A;  1XIX A;  3S6G A;  2EK9 A;  5HVF A;  5DWN A;  2Z3L A;  2BL1 A;  2HC9 A;  5H84 A;  3H5Z A;  4ZBG A;  2FL4 A;  5G21 A;  3TOA A;  4CGM A;  4Y49 B;  1ELL P;  4ZY2 A;  5JH9 A;  3D7H A;  4R87 A;  2Z10 A;  4ZX8 A;  2B5G A;  4CS0 B;  2GIV A;  2PJ1 A;  4KLV A;  4R6T A;  4AB7 A;  4FAI A;  2HUZ A;  1YRE A;  2AFO A;  4YFJ A;  2ABZ A;  2ZEF A;  2Q7S A;  3PB4 X;  3W6X A;  3WT4 A;  4KOR A;  2D4P A;  4ZYQ A;  3IC1 A;  4ORF A;  3VAR A;  5LRK A;  2PR8 A;  2WPW A;  1XMT A;  2Q04 A;  3E0K A;  3R1K A;  4KS9 A;  4TNU A;  5HMN A;  2BSW A;  1GYT A;  4UEZ A;  3B2Y A;  4P44 A;  3B8G A;  1ZG8 A;  1Z8L A;  2JLM A;  2VZZ A;  3PB6 X;  1QQ9 A;  1XOV A;  1Z9U A;  3D4U A;  3JVN A;  4MHN A;  1BPM A;  4PK2 A;  5G1Z A;  4XPL A;  3R9F A;  2POK A;  2CY2 A;  1AMP A;  1Q2Y A;  3KR5 A;  3TX8 A;  2ZEH A;  4C2X A;  3IWE A;  4TWE A;  1Y7E A;  5F47 A;  3WC7 A;  1Q2C A;  1Q7L A;  1TIQ A;  1YW6 A;  3IU2 A;  5G20 A;  3DR6 A;  1RTQ A;  4NCZ A;  2VEZ A;  1B87 A;  3IWG A;  5LYI A;  4MI4 A;  4P4D A;  4F0X A;  3B3S A;  4KOY A;  1KZF A;  4MMO A;  2B4B A;  2J8M A;  4M6I A;  2AFM A;  3TFY A;  4QBJ A;  1BO4 A;  2NYQ A;  3MGD A;  3T90 A;  2Z3O A;  2NSM A;  4FBE A;  4B11 A;  1WK4 A;  4DUK A;  1JWQ A;  3FEC A;  4M3S A;  2PJ2 A;  3FB3 A;  3BLN A;  4AVC A;  3A9L A;  1XE4 A;  4K30 A;  3RYO A;  1UWY A;  4OID A;  3S9M A;  4R8F A;  5JPH A;  2Z3P A;  2ZW6 A;  2B4D B;  2VL1 A;  4IHM A;  4MY0 A;  3CXS A;  4KSF A;  4X8I A;  1R57 A;  4LX9 A;  2C27 A;  2O28 A;  2GFQ A;  1NE9 A;  3D7G A;  4CAF A;  4II9 A;  4WWV A;  4QB9 A;  3D66 A;  3WR7 A;  3V8I A;  4KOX A;  3S6H A;  5AGE A;  3LMS A;  4C2Z A;  3HLP A;  1S5K A;  3IEH A;  4HKF A;  4A31 A;  2ZW7 A;  2DF5 A;  3PBE A;  2KCW A;  1YLO A;  3ISZ A;  4IF5 A;  4KOV A;  4M6H A;  1YW4 A;  4Q36 A;  4X2T A;  3UY5 A;  4A38 A;  5ISV A;  2PIZ A;  2B58 A;  4AVA A;  2PE3 A;  1LOK A;  3N5F A;  4UBR A;  1CBX A;  4HNX B;  5IV0 A;  2OH1 A;  3FVL A;  4MFL A;  1BPN A;  2Q4Z A;  2V8H A;  4KVO E;  5AG7 A;  5A27 A;  2PVV A;  2XEF A;  4UFV A;  3HUV A;  4UCP A;  3WC6 A;  3TC8 A;  4QUS A;  3PRT A;  4UFX A;  3F0A A;  2IL4 A;  5IX3 A;  1U6M A;  4J3G A;  2G3T A;  3VWD A;  4FD4 A;  4NGR A;  5G22 A;  2AE6 A;  4MBU A;  4E0A A;  3IGR A;  4NGP A;  3NH8 A;  4A95 A;  3B3W A;  2NMT A;  2JDC A;  2ZXV A;  1R43 A;  1I12 A;  2K5T A;  5C88 A;  1Y9K A;  4RS2 A;  1PU9 A;  1L0C A;  4PXE A;  4C2Y A;  3DSB A;  1M4I A;  3B35 A;  3KZW A;  1X10 A;  4BMH A;  5KTA A;  4F9V A;  3QNV A;  3KL9 A;  1OZP A;  3TCV A;  1KUV A;  1VGY A;  1Z5R A;  4KSI A;  3CPA A;  5ELY A;  3FXT A;  4CYP A;  4NJR A;  3BHX A;  4OC3 A;  5F49 A;  3N7Z A;  2XEI A;  2AFS A;  2PC1 A;  2OZG A;  3FH4 A;  4NGM A;  5F48 A;  4MCS A;  2Z0Z A;  4R76 A;  1ELM P;  5CPA A;  3BJ7 A;  1ZLH A;  4G1P A;  2CNT A;  3EXN A;  4OC1 A;  3RAM A;  2ANP A;  4BD9 A;  4R3K A;  1CG2 A;  5LYL A;  3G3S A;  3TO6 A;  4R3L A;  1LAN A;  2FS5 A;  1NSA A;  2OR4 A;  2Z11 A;  5F46 A;  1MK4 A;  3F5B A;  2C1C A;  3GY9 A;  4C7I A;  4P45 A;  4EVY A;  2VXK A;  4LQG A;  1K4J A;  4HNW B;  1QST A;  2ZEL A;  3NH4 A;  4H6Z A;  4PK3 A;  5JQ4 A;  3D68 A;  2H5M A;  3D2M A;  4OAE A;  3S9L A;  3P2H A;  1LFW A;  4RN7 A;  2VBQ A;  4MRI A;  2AFW A;  4F9U A;  3KAS A;  3TTH A;  3BI0 A;  3H4Q A;  4P4F A;  1ZO0 A;  2J8N A;  3GIU A;  2CTC A;  4A37 A;  4XPK A;  2ZEM A;  3DR8 A;  3CDX A;  1VHO A;  5HVH A;  3KHZ A;  3FEE A;  4LQ6 A;  4CGL A;  1Z4R A;  4GXH A;  2PR1 A;  2PJ9 A;  2Q43 A;  2PJ0 A;  3FMC A;  3L2N A;  4OLL A;  3IIB A;  3W91 A;  1JQG A;  4NXY A;  2OOT A;  1CPX A;  4ZI6 A;  4YGO A;  2ATR A;  3PFE A;  3EC4 A;  4X5K A;  5EC4 A;  4F6A A;  4YU9 A;  3FED A;  1XRY A;  2CNM A;  1P4N A;  2HQY A;  5IB0 A;  4PSX A;  5JGF A;  4HPS A;  3RBU A;  3SI0 A;  2Q4V A;  4IK2 A;  4UCM A;  3R95 A;  4JYW A;  3B3T A;  1XMB A;  4PPZ A;  4CYQ A;  5HXD A;  4UA3 A;  4CAX A;  2XEG A;  4KSA A;  2I3C A;  3EFA A;  2G3A A;  3IWW A;  1FY7 A;  2WYR A;  4FWU A;  2X7B A;  3TOB A;  3TO7 A;  4MHD A;  4XNH C;  2PJ6 A;  4L8A A;  3B3V A;  4OIW A;  2F7V A;  3CXP A;  4UWJ A;  2REF A;  2PSW A;  1TKH A;  3IO1 A;  4F8Z A;  3BXM A;  2PJA A;  3SJF A;  4CPA A;  1QMU A;  1HDQ A;  3FJU A;  6CPA A;  2B5G B;  2FIA A;  1IGB A;  1QSR A;  1S60 A;  2HB6 A;  5GCN A;  1Z2L A;  3CPX A;  2ZW5 A;  4AVB A;  1IB1 E;  3NE7 A;  4P10 A;  5K8O A;  3S6K A;  4EFD A;  1M44 A;  4MCQ A;  4Q7A A;  3I9S A;  2ODF A;  1Z8W A;  2OU2 A;  1NMT A;  4MHZ A;  3W6S A;  1SQH A;  2V77 A;  4YWY A;  5I0C A;  2AJ6 A;  4IUS A;  5CBM A;  1FNO A;  4O23 A;  2CNS A;  2IMO A;  1MJA A;  4UCN A;  4A39 A;  4Z65 A;  4EME A;  2REE A;  4FUU A;  2JBK A;  2GU2 A;  4MJ8 A;  3D7D A;  3PBB A;  2GE3 A;  1PUA A;  5HH1 A;  4MFQ A;  5HVG A;  2EBJ A;  2PJC A; 
#chains in the Genus database with same CATH homology
 2FCK A;  2BEI A;  2OB0 A;  2HV2 A;  1IIC A;  4KOU A;  2JDD A;  4BBH A;  4MFP A;  4U5Y A;  1P0H A;  3FIX A;  2D4O A;  2VZY A;  2Z3N A;  1YVK A;  2R98 A;  2B4D A;  2P0W A;  4L89 A;  1RO5 A;  1UFH A;  1KUX A;  3FRM A;  4MY3 A;  3LOD A;  1CM0 A;  3SXN A;  3R9E A;  2Y0M A;  5FVJ A;  3S6F A;  3FNC A;  2QEC A;  4Q38 A;  1M4G A;  5KTC A;  5J8C A;  4Y49 C;  2DPS A;  3GKR A;  2A4N A;  4UFW A;  4H89 A;  4B5P B;  2FXF A;  4KVX A;  3D3S A;  4GS4 A;  4I49 A;  1S7N A;  4CAE A;  4M85 A;  3SXO A;  1WWZ A;  4KZT A;  4NF1 A;  4QC6 A;  2Q7B A;  3T9Y A;  4YRH A;  4CAV A;  4JJX A;  5AG4 A;  4FD7 A;  1S7L A;  5CNP A;  2WSA A;  2VI7 A;  2Q44 A;  4PV6 A;  4LUA A;  4A33 A;  2YGW A;  1VHS A;  5EBV A;  2YND A;  4A32 A;  4R57 A;  3EO4 A;  4RI1 A;  4KOW A;  1MJ9 A;  2P6G A;  3R96 A;  4NSQ A;  2P6E A;  4KVM E;  4R9M A;  2I00 A;  2Q0Y A;  2YNC C;  4MFJ A;  1YR0 A;  5BWA B;  2PDO A;  2OZH A;  4PSW A;  4JWP A;  2ZW4 A;  4H6U A;  4OAD A;  3TE4 A;  1V0C A;  3G8W A;  4B14 A;  4B12 A;  1YGH A;  3F8K A;  4JD6 A;  4B13 A;  2RC4 A;  1QSM A;  1Z4E A;  1Q2D A;  2Z3M A;  1IYK A;  2DXQ A;  4CRY B;  2PQ8 A;  4A2Z A;  2CXA A;  2Q4Y A;  4JXR A;  3FYN A;  3C26 A;  2F5I A;  4XPD B;  4KOT A;  4NEX A;  4XPD C;  3R9G A;  2I79 A;  2B3V A;  2R7H A;  1IID A;  4CGN A;  4CAW A;  3KKW A;  4U9Y A;  2EUI A;  4C68 A;  1S3Z A;  3D8P A;  1QSO A;  1XEB A;  4UWI A;  4AG9 A;  4CRZ B;  4F0Y A;  5E96 A;  2R1I A;  2BUE A;  5AG6 A;  3JTK A;  2FSR A;  1YX0 A;  4U9Z A;  3QAH A;  2FIW A;  2QIR A;  3SHP A;  4C7H A;  1GHE A;  1M1D A;  1MJB A;  1B6B A;  4KLW A;  2FE7 A;  3OWC A;  4CGP A;  1I21 A;  4FD6 A;  1Y9W A;  2WUU A;  4XNH B;  5C82 A;  1J4J A;  1KUY A;  2P6F A;  3VWE A;  2JEV A;  5J8F A;  5H86 A;  5KTD A;  4KOS A;  4CGO A;  2YNE A;  3FBU A;  4AG7 A;  4E2A A;  2YNC A;  4MFZ A;  4ZGY B;  2VQY A;  1LRZ A;  1S7F A;  1N71 A;  3IU1 A;  1YVO A;  4B5P A;  3I3G A;  1RXT A;  4KUB A;  1ON0 A;  2WPX A;  3EY5 A;  2G0B A;  2Z3K A;  1IYL A;  4KUA A;  4E8O A;  2FT0 A;  4MFK A;  3CXQ A;  4B5O A;  2DPT A;  2PRB A;  5DWM A;  2J8R A;  4JLY A;  2B3U A;  1M4D A;  3D2P A;  2EVN A;  4HNY B;  1YK3 A;  3LD2 A;  3P2F A;  1S7K A;  1QSN A;  1VKC A;  4CYO A;  5AG5 A;  1NSL A;  4FD5 A;  3DNS A;  2ARH A;  4B10 A;  3GYA A;  3PZJ A;  4ONU A;  3PP9 A;  3TT2 A;  1I1D A;  4A30 A;  4CYN A;  3PGP A;  1YLE A;  5A28 A;  3ZJ0 A;  3ZZI A;  2R8V A;  2ZPA A;  3QB8 A;  1CJW A;  4QVT A;  1XF8 A;  4DNC A;  1Y7R A;  1BOB A;  3JUW A;  3DDD A;  3BJ8 A;  3K9U A;  2OZU A;  2QML A;  4JXQ A;  2GAN A;  3TO9 A;  1XIX A;  3S6G A;  5DWN A;  2Z3L A;  2BL1 A;  5H84 A;  3H5Z A;  4ZBG A;  2FL4 A;  5G21 A;  3TOA A;  4CGM A;  4Y49 B;  4R87 A;  2Z10 A;  4CS0 B;  2B5G A;  2GIV A;  4KLV A;  4AB7 A;  2HUZ A;  1YRE A;  4YFJ A;  3W6X A;  4KOR A;  2D4P A;  4ORF A;  2PR8 A;  1XMT A;  2Q04 A;  3E0K A;  3R1K A;  4KS9 A;  5HMN A;  2BSW A;  3B8G A;  2JLM A;  2VZZ A;  1Z9U A;  3JVN A;  5G1Z A;  4PK2 A;  3R9F A;  4XPL A;  2CY2 A;  4C2X A;  1Q2Y A;  3IWE A;  5F47 A;  1Q2C A;  1TIQ A;  3IU2 A;  5G20 A;  3DR6 A;  4NCZ A;  2VEZ A;  1B87 A;  3IWG A;  4MI4 A;  4F0X A;  4KOY A;  1KZF A;  2B4B A;  2J8M A;  3TFY A;  4QBJ A;  1BO4 A;  3T90 A;  3MGD A;  2Z3O A;  4B11 A;  1WK4 A;  4M3S A;  3FB3 A;  3BLN A;  4AVC A;  3A9L A;  1XE4 A;  4K30 A;  3RYO A;  5JPH A;  2Z3P A;  2ZW6 A;  2B4D B;  4MY0 A;  3CXS A;  4KSF A;  1R57 A;  4LX9 A;  2C27 A;  2O28 A;  4CAF A;  1NE9 A;  4II9 A;  4QB9 A;  3WR7 A;  3V8I A;  4KOX A;  3S6H A;  5AGE A;  4C2Z A;  1S5K A;  4HKF A;  4A31 A;  2ZW7 A;  2KCW A;  4IF5 A;  4KOV A;  4Q36 A;  5ISV A;  3UY5 A;  2B58 A;  4AVA A;  4UBR A;  4HNX B;  5IV0 A;  2OH1 A;  4MFL A;  4KVO E;  5AG7 A;  5A27 A;  4UFV A;  4UCP A;  4QUS A;  4UFX A;  3F0A A;  2IL4 A;  5IX3 A;  1U6M A;  4J3G A;  2G3T A;  3VWD A;  4FD4 A;  5G22 A;  2AE6 A;  4MBU A;  4E0A A;  3IGR A;  4A95 A;  2NMT A;  2JDC A;  2ZXV A;  1I12 A;  2K5T A;  5C88 A;  1Y9K A;  4RS2 A;  1PU9 A;  1L0C A;  4C2Y A;  3DSB A;  1M4I A;  4BMH A;  5KTA A;  1OZP A;  3TCV A;  1KUV A;  3FXT A;  4CYP A;  5F49 A;  3N7Z A;  2PC1 A;  5F48 A;  2OZG A;  2Z0Z A;  3BJ7 A;  2CNT A;  3EXN A;  4R3K A;  3G3S A;  3TO6 A;  4R3L A;  2FS5 A;  2Z11 A;  5F46 A;  1MK4 A;  3F5B A;  3GY9 A;  4C7I A;  4EVY A;  2VXK A;  1K4J A;  4HNW B;  1QST A;  4H6Z A;  5JQ4 A;  4PK3 A;  2H5M A;  3D2M A;  4OAE A;  3P2H A;  2VBQ A;  3TTH A;  3H4Q A;  1ZO0 A;  2J8N A;  4XPK A;  3DR8 A;  4CGL A;  1Z4R A;  2PR1 A;  3W91 A;  4OLL A;  4NXY A;  4YGO A;  2ATR A;  3EC4 A;  4X5K A;  5EC4 A;  4F6A A;  2CNM A;  1P4N A;  2HQY A;  5IB0 A;  4PSX A;  2Q4V A;  3R95 A;  4UCM A;  4CYQ A;  4UA3 A;  4CAX A;  4KSA A;  3EFA A;  2G3A A;  1FY7 A;  3TOB A;  2X7B A;  3TO7 A;  4MHD A;  4XNH C;  4L8A A;  3CXP A;  4UWJ A;  2REF A;  2PSW A;  2B5G B;  2FIA A;  1QSR A;  1S60 A;  5GCN A;  2ZW5 A;  4AVB A;  1IB1 E;  3NE7 A;  3S6K A;  1M44 A;  3I9S A;  2OU2 A;  1NMT A;  3W6S A;  1SQH A;  5I0C A;  2AJ6 A;  4IUS A;  2CNS A;  1MJA A;  4UCN A;  2REE A;  4MJ8 A;  2GE3 A;  1PUA A;  5HH1 A;  4MFQ A;  2WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...