2Q7BA

Crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
b'FQGMEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKMAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVLKKFFTYPKYRGNPVRLGRKLFERFMLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase (NP_689019.1) from Streptococcus agalactiae 2603 at 2.00 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q7bA00
4HNWB 4MBUA 3P2HA 4HNXB 2GANA 1Z9UA 2Q4YA 3S6HA 4PSXA 2ZXVA 4IF5A 2ARHA 4HKFA 4CAXA 2I79A 3KKWA 1Y9KA 4R57A 5EC4A 5KTCA 3TO9A 2ZW5A 2Q44A 2Q04A 4B5PA 1WK4A 1IYKA 5DWNA 2G0BA 4MI4A 4KVXA 1YX0A 3TO7A 1N71A 1IB1E 4XNHB 4BMHA 2H5MA 3S6KA 3LD2A 1NSLA 3DDDA 2WPWA 2KCWA 4H6ZA 4XNHC 2AJ6A 1M4DA 4JWPA 3FRMA 4YRHA 3F0AA 5IV0A 3JVNA 3TCVA 5F48A 2BUEA 4JD6A 1I21A 4NXYA 4IUSA 4R3LA 2PRBA 2B4DA 4AG7A 3EY5A 2Q0YA 5HMNA 3I3GA 2VBQA 4F0YA 3V8IA 2Z10A 2ZW4A 3R1KA 2VEZA 3H4QA 2JDCA 4FD4A 1CM0A 2J8RA 2FE7A 2IL4A 3ZJ0A 4PK2A 1S5KA 1M4GA 1S60A 2P0WA 4M85A 4LUAA 3G3SA 2P6GA 4GS4A 1QSOA 4KOUA 4MY3A 2X7BA 4YFJA 5F46A 3BJ8A 1S7NA 2D4OA 3IGRA 2NMTA 3FIXA 1XIXA 4E8OA 4QB9A 4MHDA 5JQ4A 4U9ZA 4RI1A 2GE3A 1KUXA 5DWMA 4JXQA 3D2MA 2J8NA 1XEBA 3EO4A 4KVME 1L0CA 2K5TA 2PDOA 4LX9A 1XMTA 2OZHA 3K9UA 3W6SA 5C88A 3C26A 1WWZA 1XE4A 2CY2A 1Z4EA 4JLYA 2ATRA 3GKRA 2JEVA 1U6MA 3FXTA 4F6AA 1GHEA 3VWDA 5C82A 4B5PB 3OWCA 1Z4RA 1CJWA 4Y49B 2Y0MA 2BL1A 1LRZA 5EBVA 3BLNA 3TE4A 1BOBA 1PUAA 5JPHA 2RC4A 4KOTA 2J8MA 4XPDB 4Y49C 4II9A 4NF1A 2PR8A 2JDDA 2Z0ZA 2VQYA 2OZGA 1BO4A 4XPDC 1Q2YA 4JJXA 1QSRA 3W6XA 3DSBA 4KVOE 4PSWA 3D2PA 1TIQA 1IICA 5E96A 2ZPAA 4R3KA 4U9YA 2AE6A 4KLVA 3D3SA 1UFHA 2B4DB 2VZYA 2Z11A 1MK4A 3MGDA 4KUBA 3R9GA 2BEIA 1Y7RA 4M3SA 1I1DA 2FL4A 2OZUA 4ONUA 3TOBA 1IYLA 3DNSA 3R9FA 4CAVA 2P6EA 2QECA 3BJ7A 4KOXA 4R9MA 5KTDA 3G8WA 3F8KA 1MJBA 2CNMA 4U5YA 2REFA 2F5IA 3FYNA 2ZW6A 1YGHA 1OZPA 2P6FA 5I0CA 4CAWA 4KOWA 1MJ9A 2G3AA 4OAEA 1R57A 3EFAA 2CNTA 4AVAA 4FD6A 5KTAA 2PC1A 4K30A 2B58A 1Q2CA 4R87A 4KOYA 2Q4VA 1J4JA 3R9EA 2Q7BA 4UWJA 4EVYA 3JUWA 1VKCA 1S7KA 4QC6A 3N7ZA 3T9YA 2FIWA 3I9SA 3CXSA 4XPLA 3F5BA 1VHSA 4L8AA 1KUVA 2A4NA 3SHPA 2FSRA 4KORA 2FCKA 2VI7A 1KUYA 2FT0A 1B87A 3EXNA 3S6FA 4MY0A 5HH1A 2B3VA 4KZTA 4CRYB 2B4BA 2PR1A 5H84A 3GY9A 3PGPA 4DNCA 4JXRA 4RS2A 3B8GA 2FXFA 1KZFA 1QSNA 2CNSA 2B5GB 1K4JA 1QSMA 3ZZIA 2B3UA 4PV6A 2FIAA 4KUAA 4XPKA 4QUSA 1IIDA 4I49A 3PZJA 5F47A 3P2FA 3D8PA 1S7LA 3WR7A 3UY5A 5IB0A 2B5GA 1ON0A 1YVKA 4ORFA 4YGOA 2BSWA 2REEA 3QAHA 1YR0A 5J8FA 3NE7A 3CXQA 4OLLA 4H89A 3TOAA 1PU9A 3IWGA 5CNPA 4QBJA 3DR6A 1S7FA 4KLWA 3FBUA 2VZZA 4CRZB 3LODA 3FNCA 4QVTA 4NSQA 2ZW7A 1I12A 3FB3A 4NEXA 5ISVA 2EVNA 2R98A 4AVCA 1FY7A 1B6BA 3R96A 3T90A 2VXKA 3S6GA 2R1IA 2JLMA 3SXNA 3SXOA 1NMTA 4AG9A 1QSTA 4PK3A 4ZBGA 1RXTA 2OB0A 2PQ8A 3CXPA 1Y9WA 1P0HA 4NCZA 1SQHA 4HNYB 2I00A 3TFYA 5J8CA 2EUIA 3E0KA 4AVBA 2HUZA 2FS5A 4KOSA 2R7HA 4FD7A 2HQYA 5F49A 2C27A 4J3GA 5FVJA 2HV2A 1M4IA 5H86A 3QB8A 3R95A 3VWEA 2DXQA 4B5OA 1V0CA 2O28A 4H6UA 3TT2A 3RYOA 1M1DA 2QIRA 2WPXA 1YLEA 5GCNA 4AB7A 2PSWA 1MJAA 3W91A 3TTHA 2OH1A 2R8VA 3TO6A 4E2AA 4UA3A 1YK3A 2OU2A 4CS0B 3GYAA 3PP9A 4FD5A 4UBRA 1XF8A 1YVOA 1P4NA 2QMLA 2D4PA 3EC4A 2G3TA 4L89A 1S3ZA 4E0AA 1Q2DA 1RO5A 1YREA 3DR8A 4KOVA 4UWIA 2GIVA 1M44A 5IX3A 4MJ8A 4OADA 4X5KA 1NE9A
chains in the Genus database with same CATH superfamily
4ZX8A 3RNZA 4ZI6A 1ZLHA 3K2KA 3B7IA 4HNWB 4MBUA 1GYTA 3P2HA 4HNXB 4BINA 3FECA 4A33A 2GANA 4OC1A 2J9AA 4MFZA 4OMEA 1Z9UA 2Q4YA 3PB7X 4FBEA 3S6HA 2WZNA 5LYLA 4PSXA 4P4EA 4DJLA 3D7DA 1FT7A 2VL1A 4UCNA 2ZXVA 3HUVA 3N5FA 4IF5A 2ZEDA 2QVPA 2ARHA 4HKFA 4CAXA 4P4FA 2I79A 3KKWA 2PJ4A 1Y9KA 3PB8X 4GM5A 4LQ6A 4LQGA 4R57A 5EC4A 5AG4A 1FNOA 3TO9A 5KTCA 2ZW5A 3DGVA 4B10A 2Z3MA 4MFQA 2Q44A 2Q04A 4B5PA 3B3WA 1WK4A 3KASA 3L2NA 3LMSA 1A2ZA 4MFLA 2PJ7A 1IYKA 5DWNA 2C6GA 3K9TA 4P6YA 2G0BA 3IU2A 5D29A 4MI4A 4KVXA 1YX0A 3TO7A 1N71A 4MFKA 1IB1E 4XNHB 4EWTA 4BMHA 1ZG8A 2H5MA 4R6TA 4IHMA 3S6KA 3LD2A 4OC2A 1NSLA 3DDDA 3FEDA 2EBJA 2ZEFA 2V8GA 2WPWA 1LCPA 2KCWA 1QMUA 3KQXA 4H6ZA 4P45A 2AJ6A 4XNHC 1M4DA 4A32A 3FMCA 1X12A 4WJBA 1VHOA 2Q43A 4JWPA 3NA6A 3FRMA 1ELMP 4YRHA 3B3TA 3F0AA 4UIBA 3ISXA 4RUHA 5IV0A 3JVNA 4UIAA 5F48A 3TCVA 3KR5A 3PBEA 4IAVA 2ZEMA 2DPSA 2BUEA 2PIYA 3NFZA 1I21A 4JD6A 1IY7A 4NXYA 3IWWA 4IUSA 4M6GA 4R3LA 2PRBA 2B4DA 4AG7A 3EY5A 2Q0YA 2C6PA 8CPAA 5HMNA 1ZG7A 3I3GA 2VBQA 3PBBA 1TF8A 4CYQA 3BXMA 4F0YA 5A27A 4UFVA 3V8IA 5F09A 2Z10A 2ZW4A 4OIWA 2C1CA 4MCRA 3R1KA 3D66A 3NH8A 1XFOA 2VEZA 1ZO0A 3H4QA 2JDCA 4FD4A 1XOVA 1KWMA 2O53A 2ZEEA 3IWEA 1YSJA 3IU1A 1CM0A 2J8RA 1TF9A 2AFZA 4A38A 2CTCA 1AMPA 2FE7A 2IL4A 3ZJ0A 4TWEA 4PK2A 4DUKA 3KGQA 1S5KA 1M4GA 1S60A 2P0WA 4M85A 2Q7SA 4LUAA 3PB6X 3G3SA 3PB4X 2V8VA 2YNDA 2CTBA 3KI9A 1HDUA 4W9YA 5THWA 2PCUA 2P6GA 4GS4A 1QSOA 2ZEHA 4ONWA 2XEGA 4KOUA 4MY3A 2Q51A 2X7BA 4CGPA 1LOKA 1HDQA 4YFJA 5F46A 5G20A 4B6ZA 3BJ8A 1S7NA 4MHZA 4P4IA 2AFUA 2D4OA 3IGRA 4MHYA 4UFXA 2NMTA 3FIXA 4MMOA 1XIXA 2AFSA 4E8OA 2V8DA 4MCPA 4QB9A 4PQAA 3H8FA 4MHDA 5JQ4A 4MFPA 4U9ZA 4MRIA 4RI1A 4ZY0A 2GE3A 4B14A 5LRJA 3NH5A 1KUXA 5DWMA 4JXQA 4X3RA 3TC8A 2AFWA 3IJ3A 4G1PA 3D2MA 2J8NA 1XEBA 2QJ8A 1PCAA 3EO4A 3WC6A 4F9UA 4KVME 2AFXA 3FH4A 1L0CA 2K5TA 3KZWA 2EWBA 2PDOA 4LX9A 1XMTA 1Z5RA 3D67A 2OZHA 3K9UA 4A39A 4A95A 2XEIA 3S9MA 1IGBA 3W6SA 4C2ZA 5C88A 4F9VA 3C26A 1F2OA 1WWZA 1XE4A 2CIJA 2CY2A 1Z4EA 4KSFA 2AFMA 4JLYA 2ATRA 3MRUA 2BO9A 2ZOFA 3GKRA 2JEVA 3IEHA 5G21A 1U6MA 5HVHA 3KL9A 2ABZA 4UEEA 3FXTA 4F6AA 1GHEA 3VWDA 5C82A 4B5PB 3OWCA 1Z4RA 4PXBA 5EMIA 2DF5A 1CJWA 4Y49B 2Y0MA 2BL1A 1LRZA 3B2YA 5EBVA 4NJQA 4OIDA 3SI2A 3BLNA 3TE4A 1BOBA 1PUAA 5JH9A 2RC4A 4KOTA 2J8MA 4NGPA 5JPHA 4EMEA 4XPDB 1Z2LA 2JEWA 4KSIA 4Y49C 3VATA 4PXDA 4II9A 4NF1A 4NJRA 3BI0A 2IJZA 1BPNA 2PR8A 1YLOA 5AG5A 2JDDA 2Z0ZA 3RO0A 3FJUA 4PPZA 2PJCA 2VQYA 2OZGA 1BO4A 3GLJA 3IC1A 4XPDC 1Q2YA 4B11A 5LYIA 2ZEPA 4CAEA 4JJXA 1QSRA 3W6XA 3DSBA 4KVOE 4NGMA 2Z3LA 3D2PA 4PSWA 4TNUA 4UCPA 1TIQA 1IICA 2GLJA 5E96A 4FAIA 4BBHA 1VIXA 2ZPAA 3D7HA 4R3KA 4U9YA 2EK8A 4KSAA 2AE6A 4ZX9A 3SJEA 4C7IA 4KLVA 4BD9A 3D3SA 1UFHA 4YU9A 2B4DB 2PJ6A 2VZYA 2Z11A 2Q4ZA 1MK4A 3MGDA 3RZAA 4CYPA 5LRKA 3B3SA 4GXHA 4KUBA 3GUXA 3FVLA 4X8IA 3R9GA 3B3CA 2ZENA 2BEIA 1Y7RA 4OC3A 4M3SA 5K8MA 1I1DA 2ZEGA 2FL4A 1RTQA 2OZUA 2Z3OA 4KS9A 1IYLA 4ONUA 3DNSA 3TOBA 3R9FA 3D7FA 4CAVA 1NSAA 2P6EA 2QECA 5JM6A 1LFWA 1Y7EA 3BJ7A 4KOXA 1IU8A 4R9MA 5KTDA 2YNEA 3V7ZA 3G8WA 3F8KA 4B13A 1MJBA 4A37A 2CNMA 4U5YA 2REFA 2F5IA 5HXDA 3FYNA 1Z8WA 2ZW6A 1YGHA 1OZPA 3H8EA 2C6CA 1Y0YA 1XJOA 2BCOA 2P6FA 3T8WA 5I0CA 4MCSA 4KOWA 4NGSA 4CAWA 1MJ9A 4H2KA 2G3AA 1JQGA 4OAEA 2XEJA 2CXAA 4OKOA 4O23A 4P10A 1QQ9A 1R57A 3EFAA 3FF3A 2CNTA 4AVAA 4FD6A 5A28A 3KHXA 5KTAA 4PXCA 2PC1A 4C2YA 4K30A 4NFRA 2O4HA 2B58A 1Q2CA 2GLFA 3PB9X 4KOYA 2Q4VA 3A9LA 3JRUA 1J4JA 4R87A 4RN7A 3R9EA 1Y0RA 4OC4A 1CBXA 5K8PA 2Q7BA 4MXUA 4UWJA 4EVYA 3CPAA 5HVGA 1XRYA 3JUWA 2YGWA 1VKCA 2PJ5A 4M6IA 1S7KA 4QC6A 4OC5A 3N7ZA 4Q7AA 3T9YA 2FIWA 3I9SA 1F57A 2CF4A 3CXSA 1ARMA 2PJAA 4XPLA 3F5BA 1VHSA 4L8AA 1KUVA 2Z3KA 4PXEA 1BAVA 1TXRA 2A4NA 3SHPA 2FSRA 3KHZA 4KORA 2FCKA 3DLJA 4UFWA 2VI7A 4C68A 1Z8TA 2NSMA 1KUYA 2FT0A 3WC5A 1B87A 3EXNA 3S6FA 4CGMA 4MY0A 5HH1A 2B3VA 4KZTA 4CRYB 3B35A 1ARLA 2B4BA 2PR1A 5H84A 4A94A 3GY9A 4JZ0A 1LAPA 3PGPA 4YWYA 4DNCA 4JXRA 2PRQA 4RS2A 2ZOGA 3B8GA 3WC7A 2FXFA 1KZFA 5D8NA 1QSNA 4MHPA 4EFDA 3LACA 2CNSA 2B5GB 3SI1A 4CYNA 4CYOA 3KR4A 5LRGA 1K4JA 3RAMA 1CP6A 3SI0A 2FVGA 1QSMA 3ZZIA 2B3UA 4PV6A 2FIAA 4KUAA 4XPKA 1OBRA 2QYVA 4QUSA 5AGEA 1YW6A 1CG2A 1IIDA 1LAMA 3LWUA 3NE8A 4I49A 3PZJA 4CAFA 5F47A 3P2FA 3IFEA 4IK2A 2JBJA 3D8PA 1S7LA 2YNCC 3WR7A 3IIBA 3UY5A 1AYEA 5IB0A 2B5GA 1ON0A 2ODFA 1YVKA 4ORFA 4YGOA 2BSWA 2REEA 3QAHA 3QAYA 1YR0A 5J8FA 3NE7A 2PVVA 3CXQA 4OLLA 4H89A 3CT9A 2BOAA 4Q36A 5AG6A 2YNCA 2PJ0A 3TOAA 1PU9A 3FEEA 3IWGA 2I3CA 2PJ9A 5CNPA 4NGQA 1H8LA 5HVFA 3DR6A 3V38A 4QBJA 1S7FA 1XBUA 3I1UA 3CPXA 4DYOA 3B3VA 1F2PA 2VZZA 3FBUA 4KLWA 4CRZB 2HC9A 1IOIA 3FNCA 2PJBA 3LODA 4QVTA 2DPTA 3TX8A 4ZGYB 5AG7A 4NSQA 3PRTA 2ZW7A 2OOTA 4FUUA 2Z3NA 1CPXA 3HLPA 1I12A 1CP7A 3FB3A 4NEXA 4A30A 5ISVA 2EVNA 2R98A 4AVCA 5BWAB 2WYRA 4Q38A 2NYQA 1FY7A 2ANPA 4R76A 1B6BA 2Z3PA 3R96A 3T90A 2VXKA 3FX6A 1ZG9A 4MCQA 3VH9A 1R3NA 3CDXA 3CZXA 4ZYQA 2XEFA 2IMOA 4M6HA 3S6GA 2V8HA 2GFQA 2R1IA 2JLMA 3SXNA 7CPAA 3SXOA 5LYFA 1NMTA 1YQEA 4A31A 4AG9A 1CX8A 1QSTA 4CGNA 2GREA 4P4JA 1EE3P 4PK3A 4ZBGA 1RXTA 1LANA 2OB0A 2PQ8A 3CXPA 3ISZA 3PFOA 1Q7LA 1Y9WA 2PVWA 4K3NA 2HB6A 4HPSA 1P0HA 1PYTB 5LYDA 2AFOA 2F7VA 4NCZA 3KQZA 1SQHA 4HNYB 2I00A 3TFYA 5J8CA 3SJGA 3H5ZA 2EUIA 3E0KA 4JYWA 4ZY2A 4AVBA 1YMEA 3NH4A 2HUZA 3IO1A 4UCMA 2PJ2A 3PEIA 2JBKA 2FS5A 4KOSA 1VGYA 2R7HA 4FD7A 2HQYA 2PJ3A 4OP4A 2C27A 5F49A 5DS0A 4J3GA 2EO8A 4F8ZA 2RFHA 1XMBA 4P4BA 4C2XA 2WSAA 5FVJA 2HV2A 3RBUA 1M4IA 1VHEA 4CPAA 6CPAA 4AXVA 5H86A 4UF4A 2GU2A 3H8GA 3JTKA 2POKA 3QB8A 3R95A 4CGLA 5IB9A 3VWEA 4C7HA 2DXQA 4Z65A 4R7MA 4B5OA 1ZLIA 1BPMA 3WT4A 1V0CA 1BLLE 1TKHA 2O28A 2ZEOA 4H6UA 3TT2A 4FWUA 3RYOA 1M1DA 4F0XA 3SJXA 5ELYA 2QIRA 4OC0A 2WPXA 1YLEA 3BI1A 3QNVA 5GCNA 4AB7A 2PSWA 4MFJA 3WABA 1MJAA 1TKJA 5K8OA 1X10A 3GB0A 3W91A 4R8FA 4WWVA 2ZELA 3S9LA 4X2TA 3TTHA 2G9DA 1ELLP 2OH1A 2PJ1A 2R8VA 3D68A 1DE4C 5CPAA 3TO6A 2IQ6A 1CPSA 4NGNA 4E2AA 3SJFA 1AUGA 2PIZA 4UA3A 1R43A 3PFEA 2RB7A 2V77A 1Z8XA 1YK3A 2OU2A 4UEFA 4CS0B 3GYAA 5J1QA 3PP9A 4FD5A 1HEEA 1UWYA 3S9NA 2PJ8A 4UBRA 4UEZA 1XF8A 1YVOA 1P4NA 2QMLA 2F8HA 4NGTA 4MHNA 2D4PA 3EC4A 5I4MA 2G3TA 4L89A 1S3ZA 5K8NA 4E0AA 1Q2DA 4B12A 1RO5A 5JGFA 1IOFA 1YREA 5CBMA 3DR8A 1YW4A 4KOVA 4CGOA 4UWIA 2EK9A 1Z8LA 2GIVA 3D4UA 1TKFA 3BHXA 1M4LA 4A2ZA 4P4DA 1M44A 3GIUA 5G22A 5G1ZA 5IX3A 4MJ8A 3VARA 4OADA 2DEAA 4P44A 2PE3A 2WUUA 3D7GA 1JWQA 4NGRA 2OR4A 1DTDA 4ZY1A 4X5KA 1NE9A 3MN8A
chains in the Genus database with same CATH topology
4HNWB 4MBUA 3P2HA 4HNXB 4A33A 2GANA 4MFZA 1Z9UA 2Q4YA 3S6HA 4PSXA 4UCNA 2ZXVA 4IF5A 2ARHA 4HKFA 4CAXA 2I79A 3KKWA 1Y9KA 5AG4A 4R57A 5EC4A 5KTCA 3TO9A 2ZW5A 4B10A 2Z3MA 4MFQA 2Q44A 2Q04A 4B5PA 1WK4A 4MFLA 1IYKA 5DWNA 2G0BA 3IU2A 4MI4A 4KVXA 1YX0A 3TO7A 1N71A 4MFKA 1IB1E 4XNHB 4BMHA 2H5MA 3S6KA 3LD2A 1NSLA 3DDDA 2WPWA 2KCWA 4H6ZA 4XNHC 4A32A 2AJ6A 1M4DA 4JWPA 3FRMA 4YRHA 3F0AA 5IV0A 3JVNA 3TCVA 5F48A 2DPSA 2BUEA 4JD6A 1I21A 4NXYA 4IUSA 4R3LA 2PRBA 2B4DA 4AG7A 3EY5A 2Q0YA 5HMNA 3I3GA 2VBQA 4CYQA 4F0YA 5A27A 4UFVA 3V8IA 2Z10A 2ZW4A 3R1KA 2VEZA 1ZO0A 3H4QA 4FD4A 2JDCA 3IWEA 3IU1A 1CM0A 2J8RA 2FE7A 2IL4A 3ZJ0A 4PK2A 1S5KA 1M4GA 1S60A 2P0WA 4M85A 4LUAA 3G3SA 2YNDA 2P6GA 4GS4A 1QSOA 4KOUA 4MY3A 4CGPA 2X7BA 4YFJA 5F46A 5G20A 3BJ8A 1S7NA 2D4OA 3IGRA 4UFXA 2NMTA 3FIXA 1XIXA 4E8OA 4QB9A 4MHDA 5JQ4A 4MFPA 4U9ZA 4RI1A 2GE3A 4B14A 1KUXA 5DWMA 4JXQA 3D2MA 2J8NA 1XEBA 3EO4A 4KVME 1L0CA 2K5TA 2PDOA 4LX9A 1XMTA 2OZHA 3K9UA 4A95A 3W6SA 4C2ZA 5C88A 3C26A 1WWZA 1XE4A 2CY2A 1Z4EA 4KSFA 4JLYA 2ATRA 3GKRA 2JEVA 5G21A 1U6MA 3FXTA 4F6AA 1GHEA 3VWDA 5C82A 4B5PB 3OWCA 1Z4RA 1CJWA 4Y49B 2Y0MA 2BL1A 1LRZA 5EBVA 3BLNA 3TE4A 1BOBA 1PUAA 5JPHA 2RC4A 4KOTA 2J8MA 4XPDB 4Y49C 4II9A 4NF1A 2PR8A 5AG5A 2JDDA 2Z0ZA 2VQYA 2OZGA 1BO4A 4XPDC 1Q2YA 4B11A 4CAEA 4JJXA 1QSRA 3W6XA 3DSBA 4KVOE 4PSWA 2Z3LA 3D2PA 4UCPA 1TIQA 1IICA 5E96A 4BBHA 2ZPAA 4R3KA 4U9YA 4KSAA 2AE6A 4C7IA 4KLVA 3D3SA 1UFHA 2B4DB 2VZYA 2Z11A 1MK4A 3MGDA 4CYPA 4KUBA 3R9GA 2BEIA 1Y7RA 4M3SA 1I1DA 2FL4A 2OZUA 2Z3OA 4KS9A 4ONUA 1IYLA 3TOBA 3DNSA 3R9FA 4CAVA 2P6EA 2QECA 3BJ7A 4KOXA 4R9MA 5KTDA 2YNEA 3G8WA 3F8KA 4B13A 1MJBA 2CNMA 4U5YA 2REFA 2F5IA 3FYNA 2ZW6A 1YGHA 1OZPA 2P6FA 5I0CA 4CAWA 4KOWA 1MJ9A 2G3AA 4OAEA 2CXAA 1R57A 3EFAA 5A28A 2CNTA 4AVAA 4FD6A 5KTAA 2PC1A 4C2YA 4K30A 2B58A 1Q2CA 4R87A 4KOYA 2Q4VA 3A9LA 1J4JA 3R9EA 2Q7BA 4UWJA 4EVYA 3JUWA 2YGWA 1VKCA 1S7KA 4QC6A 3N7ZA 3T9YA 2FIWA 3I9SA 3CXSA 4XPLA 3F5BA 1VHSA 4L8AA 1KUVA 2Z3KA 2A4NA 3SHPA 2FSRA 4UFWA 4KORA 2FCKA 2VI7A 4C68A 1KUYA 2FT0A 1B87A 3EXNA 3S6FA 4CGMA 4MY0A 5HH1A 2B3VA 4KZTA 4CRYB 2B4BA 2PR1A 5H84A 3GY9A 3PGPA 4DNCA 4JXRA 4RS2A 3B8GA 2FXFA 1KZFA 1QSNA 2CNSA 2B5GB 4CYNA 4CYOA 1K4JA 1QSMA 3ZZIA 2B3UA 4PV6A 2FIAA 4KUAA 4XPKA 4QUSA 5AGEA 1IIDA 4I49A 3PZJA 4CAFA 5F47A 3P2FA 3D8PA 1S7LA 2YNCC 3WR7A 3UY5A 5IB0A 2B5GA 1ON0A 1YVKA 4ORFA 4YGOA 2BSWA 2REEA 3QAHA 1YR0A 5J8FA 3NE7A 3CXQA 4OLLA 4Q36A 4H89A 5AG6A 2YNCA 3TOAA 1PU9A 3IWGA 5CNPA 4QBJA 3DR6A 1S7FA 4KLWA 3FBUA 2VZZA 4CRZB 3LODA 3FNCA 4QVTA 4ZGYB 2DPTA 5AG7A 4NSQA 2ZW7A 2Z3NA 1I12A 3FB3A 4NEXA 4A30A 5ISVA 2EVNA 2R98A 4AVCA 5BWAB 4Q38A 1FY7A 1B6BA 2Z3PA 3R96A 3T90A 2VXKA 3S6GA 2R1IA 2JLMA 3SXNA 3SXOA 1NMTA 4A31A 4AG9A 1QSTA 4CGNA 4PK3A 4ZBGA 1RXTA 2OB0A 2PQ8A 3CXPA 1Y9WA 1P0HA 4NCZA 1SQHA 4HNYB 2I00A 3TFYA 5J8CA 3H5ZA 2EUIA 3E0KA 4AVBA 2HUZA 4UCMA 2FS5A 4KOSA 2R7HA 4FD7A 2HQYA 5F49A 2C27A 4J3GA 4C2XA 2WSAA 5FVJA 2HV2A 1M4IA 5H86A 3JTKA 3QB8A 3R95A 4CGLA 3VWEA 4C7HA 2DXQA 4B5OA 1V0CA 2O28A 4H6UA 3TT2A 3RYOA 1M1DA 4F0XA 2QIRA 2WPXA 1YLEA 5GCNA 4AB7A 2PSWA 4MFJA 1MJAA 3W91A 3TTHA 2OH1A 2R8VA 3TO6A 4E2AA 4UA3A 1YK3A 2OU2A 4CS0B 3GYAA 3PP9A 4FD5A 4UBRA 1XF8A 1YVOA 1P4NA 2QMLA 2D4PA 3EC4A 2G3TA 4L89A 1S3ZA 4E0AA 1Q2DA 4B12A 1RO5A 1YREA 3DR8A 4KOVA 4CGOA 4UWIA 2GIVA 4A2ZA 1M44A 5G22A 5G1ZA 5IX3A 4MJ8A 4OADA 2WUUA 4X5KA 1NE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNW B;  4MBU A;  3P2H A;  4HNX B;  2GAN A;  1Z9U A;  2Q4Y A;  3S6H A;  4PSX A;  2ZXV A;  4IF5 A;  2ARH A;  4HKF A;  4CAX A;  2I79 A;  3KKW A;  1Y9K A;  4R57 A;  5EC4 A;  5KTC A;  3TO9 A;  2ZW5 A;  2Q44 A;  2Q04 A;  4B5P A;  1WK4 A;  1IYK A;  5DWN A;  2G0B A;  4MI4 A;  4KVX A;  1YX0 A;  3TO7 A;  1N71 A;  1IB1 E;  4XNH B;  4BMH A;  2H5M A;  3S6K A;  3LD2 A;  1NSL A;  3DDD A;  2WPW A;  2KCW A;  4H6Z A;  4XNH C;  2AJ6 A;  1M4D A;  4JWP A;  3FRM A;  4YRH A;  3F0A A;  5IV0 A;  3JVN A;  3TCV A;  5F48 A;  2BUE A;  4JD6 A;  1I21 A;  4NXY A;  4IUS A;  4R3L A;  2PRB A;  2B4D A;  4AG7 A;  3EY5 A;  2Q0Y A;  5HMN A;  3I3G A;  2VBQ A;  4F0Y A;  3V8I A;  2Z10 A;  2ZW4 A;  3R1K A;  2VEZ A;  3H4Q A;  2JDC A;  4FD4 A;  1CM0 A;  2J8R A;  2FE7 A;  2IL4 A;  3ZJ0 A;  4PK2 A;  1S5K A;  1M4G A;  1S60 A;  2P0W A;  4M85 A;  4LUA A;  3G3S A;  2P6G A;  4GS4 A;  1QSO A;  4KOU A;  4MY3 A;  2X7B A;  4YFJ A;  5F46 A;  3BJ8 A;  1S7N A;  2D4O A;  3IGR A;  2NMT A;  3FIX A;  1XIX A;  4E8O A;  4QB9 A;  4MHD A;  5JQ4 A;  4U9Z A;  4RI1 A;  2GE3 A;  1KUX A;  5DWM A;  4JXQ A;  3D2M A;  2J8N A;  1XEB A;  3EO4 A;  4KVM E;  1L0C A;  2K5T A;  2PDO A;  4LX9 A;  1XMT A;  2OZH A;  3K9U A;  3W6S A;  5C88 A;  3C26 A;  1WWZ A;  1XE4 A;  2CY2 A;  1Z4E A;  4JLY A;  2ATR A;  3GKR A;  2JEV A;  1U6M A;  3FXT A;  4F6A A;  1GHE A;  3VWD A;  5C82 A;  4B5P B;  3OWC A;  1Z4R A;  1CJW A;  4Y49 B;  2Y0M A;  2BL1 A;  1LRZ A;  5EBV A;  3BLN A;  3TE4 A;  1BOB A;  1PUA A;  5JPH A;  2RC4 A;  4KOT A;  2J8M A;  4XPD B;  4Y49 C;  4II9 A;  4NF1 A;  2PR8 A;  2JDD A;  2Z0Z A;  2VQY A;  2OZG A;  1BO4 A;  4XPD C;  1Q2Y A;  4JJX A;  1QSR A;  3W6X A;  3DSB A;  4KVO E;  4PSW A;  3D2P A;  1TIQ A;  1IIC A;  5E96 A;  2ZPA A;  4R3K A;  4U9Y A;  2AE6 A;  4KLV A;  3D3S A;  1UFH A;  2B4D B;  2VZY A;  2Z11 A;  1MK4 A;  3MGD A;  4KUB A;  3R9G A;  2BEI A;  1Y7R A;  4M3S A;  1I1D A;  2FL4 A;  2OZU A;  4ONU A;  3TOB A;  1IYL A;  3DNS A;  3R9F A;  4CAV A;  2P6E A;  2QEC A;  3BJ7 A;  4KOX A;  4R9M A;  5KTD A;  3G8W A;  3F8K A;  1MJB A;  2CNM A;  4U5Y A;  2REF A;  2F5I A;  3FYN A;  2ZW6 A;  1YGH A;  1OZP A;  2P6F A;  5I0C A;  4CAW A;  4KOW A;  1MJ9 A;  2G3A A;  4OAE A;  1R57 A;  3EFA A;  2CNT A;  4AVA A;  4FD6 A;  5KTA A;  2PC1 A;  4K30 A;  2B58 A;  1Q2C A;  4R87 A;  4KOY A;  2Q4V A;  1J4J A;  3R9E A;  2Q7B A;  4UWJ A;  4EVY A;  3JUW A;  1VKC A;  1S7K A;  4QC6 A;  3N7Z A;  3T9Y A;  2FIW A;  3I9S A;  3CXS A;  4XPL A;  3F5B A;  1VHS A;  4L8A A;  1KUV A;  2A4N A;  3SHP A;  2FSR A;  4KOR A;  2FCK A;  2VI7 A;  1KUY A;  2FT0 A;  1B87 A;  3EXN A;  3S6F A;  4MY0 A;  5HH1 A;  2B3V A;  4KZT A;  4CRY B;  2B4B A;  2PR1 A;  5H84 A;  3GY9 A;  3PGP A;  4DNC A;  4JXR A;  4RS2 A;  3B8G A;  2FXF A;  1KZF A;  1QSN A;  2CNS A;  2B5G B;  1K4J A;  1QSM A;  3ZZI A;  2B3U A;  4PV6 A;  2FIA A;  4KUA A;  4XPK A;  4QUS A;  1IID A;  4I49 A;  3PZJ A;  5F47 A;  3P2F A;  3D8P A;  1S7L A;  3WR7 A;  3UY5 A;  5IB0 A;  2B5G A;  1ON0 A;  1YVK A;  4ORF A;  4YGO A;  2BSW A;  2REE A;  3QAH A;  1YR0 A;  5J8F A;  3NE7 A;  3CXQ A;  4OLL A;  4H89 A;  3TOA A;  1PU9 A;  3IWG A;  5CNP A;  4QBJ A;  3DR6 A;  1S7F A;  4KLW A;  3FBU A;  2VZZ A;  4CRZ B;  3LOD A;  3FNC A;  4QVT A;  4NSQ A;  2ZW7 A;  1I12 A;  3FB3 A;  4NEX A;  5ISV A;  2EVN A;  2R98 A;  4AVC A;  1FY7 A;  1B6B A;  3R96 A;  3T90 A;  2VXK A;  3S6G A;  2R1I A;  2JLM A;  3SXN A;  3SXO A;  1NMT A;  4AG9 A;  1QST A;  4PK3 A;  4ZBG A;  1RXT A;  2OB0 A;  2PQ8 A;  3CXP A;  1Y9W A;  1P0H A;  4NCZ A;  1SQH A;  4HNY B;  2I00 A;  3TFY A;  5J8C A;  2EUI A;  3E0K A;  4AVB A;  2HUZ A;  2FS5 A;  4KOS A;  2R7H A;  4FD7 A;  2HQY A;  5F49 A;  2C27 A;  4J3G A;  5FVJ A;  2HV2 A;  1M4I A;  5H86 A;  3QB8 A;  3R95 A;  3VWE A;  2DXQ A;  4B5O A;  1V0C A;  2O28 A;  4H6U A;  3TT2 A;  3RYO A;  1M1D A;  2QIR A;  2WPX A;  1YLE A;  5GCN A;  4AB7 A;  2PSW A;  1MJA A;  3W91 A;  3TTH A;  2OH1 A;  2R8V A;  3TO6 A;  4E2A A;  4UA3 A;  1YK3 A;  2OU2 A;  4CS0 B;  3GYA A;  3PP9 A;  4FD5 A;  4UBR A;  1XF8 A;  1YVO A;  1P4N A;  2QML A;  2D4P A;  3EC4 A;  2G3T A;  4L89 A;  1S3Z A;  4E0A A;  1Q2D A;  1RO5 A;  1YRE A;  3DR8 A;  4KOV A;  4UWI A;  2GIV A;  1M44 A;  5IX3 A;  4MJ8 A;  4OAD A;  4X5K A;  1NE9 A; 
#chains in the Genus database with same CATH topology
 4ZX8 A;  3RNZ A;  4ZI6 A;  1ZLH A;  3K2K A;  3B7I A;  4HNW B;  4MBU A;  1GYT A;  3P2H A;  4HNX B;  4BIN A;  3FEC A;  4A33 A;  2GAN A;  4OC1 A;  2J9A A;  4MFZ A;  4OME A;  1Z9U A;  2Q4Y A;  3PB7 X;  4FBE A;  3S6H A;  2WZN A;  5LYL A;  4PSX A;  4P4E A;  4DJL A;  3D7D A;  1FT7 A;  2VL1 A;  4UCN A;  2ZXV A;  3HUV A;  3N5F A;  4IF5 A;  2ZED A;  2QVP A;  2ARH A;  4HKF A;  4CAX A;  4P4F A;  2I79 A;  3KKW A;  2PJ4 A;  1Y9K A;  3PB8 X;  4GM5 A;  4LQ6 A;  4LQG A;  4R57 A;  5EC4 A;  5AG4 A;  1FNO A;  3TO9 A;  5KTC A;  2ZW5 A;  3DGV A;  4B10 A;  2Z3M A;  4MFQ A;  2Q44 A;  2Q04 A;  4B5P A;  3B3W A;  1WK4 A;  3KAS A;  3L2N A;  3LMS A;  1A2Z A;  4MFL A;  2PJ7 A;  1IYK A;  5DWN A;  2C6G A;  3K9T A;  4P6Y A;  2G0B A;  3IU2 A;  5D29 A;  4MI4 A;  4KVX A;  1YX0 A;  3TO7 A;  1N71 A;  4MFK A;  1IB1 E;  4XNH B;  4EWT A;  4BMH A;  1ZG8 A;  2H5M A;  4R6T A;  4IHM A;  3S6K A;  3LD2 A;  4OC2 A;  1NSL A;  3DDD A;  3FED A;  2EBJ A;  2ZEF A;  2V8G A;  2WPW A;  1LCP A;  2KCW A;  1QMU A;  3KQX A;  4H6Z A;  4P45 A;  2AJ6 A;  4XNH C;  1M4D A;  4A32 A;  3FMC A;  1X12 A;  4WJB A;  1VHO A;  2Q43 A;  4JWP A;  3NA6 A;  3FRM A;  1ELM P;  4YRH A;  3B3T A;  3F0A A;  4UIB A;  3ISX A;  4RUH A;  5IV0 A;  3JVN A;  4UIA A;  5F48 A;  3TCV A;  3KR5 A;  3PBE A;  4IAV A;  2ZEM A;  2DPS A;  2BUE A;  2PIY A;  3NFZ A;  1I21 A;  4JD6 A;  1IY7 A;  4NXY A;  3IWW A;  4IUS A;  4M6G A;  4R3L A;  2PRB A;  2B4D A;  4AG7 A;  3EY5 A;  2Q0Y A;  2C6P A;  8CPA A;  5HMN A;  1ZG7 A;  3I3G A;  2VBQ A;  3PBB A;  1TF8 A;  4CYQ A;  3BXM A;  4F0Y A;  5A27 A;  4UFV A;  3V8I A;  5F09 A;  2Z10 A;  2ZW4 A;  4OIW A;  2C1C A;  4MCR A;  3R1K A;  3D66 A;  3NH8 A;  1XFO A;  2VEZ A;  1ZO0 A;  3H4Q A;  2JDC A;  4FD4 A;  1XOV A;  1KWM A;  2O53 A;  2ZEE A;  3IWE A;  1YSJ A;  3IU1 A;  1CM0 A;  2J8R A;  1TF9 A;  2AFZ A;  4A38 A;  2CTC A;  1AMP A;  2FE7 A;  2IL4 A;  3ZJ0 A;  4TWE A;  4PK2 A;  4DUK A;  3KGQ A;  1S5K A;  1M4G A;  1S60 A;  2P0W A;  4M85 A;  2Q7S A;  4LUA A;  3PB6 X;  3G3S A;  3PB4 X;  2V8V A;  2YND A;  2CTB A;  3KI9 A;  1HDU A;  4W9Y A;  5THW A;  2PCU A;  2P6G A;  4GS4 A;  1QSO A;  2ZEH A;  4ONW A;  2XEG A;  4KOU A;  4MY3 A;  2Q51 A;  2X7B A;  4CGP A;  1LOK A;  1HDQ A;  4YFJ A;  5F46 A;  5G20 A;  4B6Z A;  3BJ8 A;  1S7N A;  4MHZ A;  4P4I A;  2AFU A;  2D4O A;  3IGR A;  4MHY A;  4UFX A;  2NMT A;  3FIX A;  4MMO A;  1XIX A;  2AFS A;  4E8O A;  2V8D A;  4MCP A;  4QB9 A;  4PQA A;  3H8F A;  4MHD A;  5JQ4 A;  4MFP A;  4U9Z A;  4MRI A;  4RI1 A;  4ZY0 A;  2GE3 A;  4B14 A;  5LRJ A;  3NH5 A;  1KUX A;  5DWM A;  4JXQ A;  4X3R A;  3TC8 A;  2AFW A;  3IJ3 A;  4G1P A;  3D2M A;  2J8N A;  1XEB A;  2QJ8 A;  1PCA A;  3EO4 A;  3WC6 A;  4F9U A;  4KVM E;  2AFX A;  3FH4 A;  1L0C A;  2K5T A;  3KZW A;  2EWB A;  2PDO A;  4LX9 A;  1XMT A;  1Z5R A;  3D67 A;  2OZH A;  3K9U A;  4A39 A;  4A95 A;  2XEI A;  3S9M A;  1IGB A;  3W6S A;  4C2Z A;  5C88 A;  4F9V A;  3C26 A;  1F2O A;  1WWZ A;  1XE4 A;  2CIJ A;  2CY2 A;  1Z4E A;  4KSF A;  2AFM A;  4JLY A;  2ATR A;  3MRU A;  2BO9 A;  2ZOF A;  3GKR A;  2JEV A;  3IEH A;  5G21 A;  1U6M A;  5HVH A;  3KL9 A;  2ABZ A;  4UEE A;  3FXT A;  4F6A A;  1GHE A;  3VWD A;  5C82 A;  4B5P B;  3OWC A;  1Z4R A;  4PXB A;  5EMI A;  2DF5 A;  1CJW A;  4Y49 B;  2Y0M A;  2BL1 A;  1LRZ A;  3B2Y A;  5EBV A;  4NJQ A;  4OID A;  3SI2 A;  3BLN A;  3TE4 A;  1BOB A;  1PUA A;  5JH9 A;  2RC4 A;  4KOT A;  2J8M A;  4NGP A;  5JPH A;  4EME A;  4XPD B;  1Z2L A;  2JEW A;  4KSI A;  4Y49 C;  3VAT A;  4PXD A;  4II9 A;  4NF1 A;  4NJR A;  3BI0 A;  2IJZ A;  1BPN A;  2PR8 A;  1YLO A;  5AG5 A;  2JDD A;  2Z0Z A;  3RO0 A;  3FJU A;  4PPZ A;  2PJC A;  2VQY A;  2OZG A;  1BO4 A;  3GLJ A;  3IC1 A;  4XPD C;  1Q2Y A;  4B11 A;  5LYI A;  2ZEP A;  4CAE A;  4JJX A;  1QSR A;  3W6X A;  3DSB A;  4KVO E;  4NGM A;  2Z3L A;  3D2P A;  4PSW A;  4TNU A;  4UCP A;  1TIQ A;  1IIC A;  2GLJ A;  5E96 A;  4FAI A;  4BBH A;  1VIX A;  2ZPA A;  3D7H A;  4R3K A;  4U9Y A;  2EK8 A;  4KSA A;  2AE6 A;  4ZX9 A;  3SJE A;  4C7I A;  4KLV A;  4BD9 A;  3D3S A;  1UFH A;  4YU9 A;  2B4D B;  2PJ6 A;  2VZY A;  2Z11 A;  2Q4Z A;  1MK4 A;  3MGD A;  3RZA A;  4CYP A;  5LRK A;  3B3S A;  4GXH A;  4KUB A;  3GUX A;  3FVL A;  4X8I A;  3R9G A;  3B3C A;  2ZEN A;  2BEI A;  1Y7R A;  4OC3 A;  4M3S A;  5K8M A;  1I1D A;  2ZEG A;  2FL4 A;  1RTQ A;  2OZU A;  2Z3O A;  4KS9 A;  1IYL A;  4ONU A;  3DNS A;  3TOB A;  3R9F A;  3D7F A;  4CAV A;  1NSA A;  2P6E A;  2QEC A;  5JM6 A;  1LFW A;  1Y7E A;  3BJ7 A;  4KOX A;  1IU8 A;  4R9M A;  5KTD A;  2YNE A;  3V7Z A;  3G8W A;  3F8K A;  4B13 A;  1MJB A;  4A37 A;  2CNM A;  4U5Y A;  2REF A;  2F5I A;  5HXD A;  3FYN A;  1Z8W A;  2ZW6 A;  1YGH A;  1OZP A;  3H8E A;  2C6C A;  1Y0Y A;  1XJO A;  2BCO A;  2P6F A;  3T8W A;  5I0C A;  4MCS A;  4KOW A;  4NGS A;  4CAW A;  1MJ9 A;  4H2K A;  2G3A A;  1JQG A;  4OAE A;  2XEJ A;  2CXA A;  4OKO A;  4O23 A;  4P10 A;  1QQ9 A;  1R57 A;  3EFA A;  3FF3 A;  2CNT A;  4AVA A;  4FD6 A;  5A28 A;  3KHX A;  5KTA A;  4PXC A;  2PC1 A;  4C2Y A;  4K30 A;  4NFR A;  2O4H A;  2B58 A;  1Q2C A;  2GLF A;  3PB9 X;  4KOY A;  2Q4V A;  3A9L A;  3JRU A;  1J4J A;  4R87 A;  4RN7 A;  3R9E A;  1Y0R A;  4OC4 A;  1CBX A;  5K8P A;  2Q7B A;  4MXU A;  4UWJ A;  4EVY A;  3CPA A;  5HVG A;  1XRY A;  3JUW A;  2YGW A;  1VKC A;  2PJ5 A;  4M6I A;  1S7K A;  4QC6 A;  4OC5 A;  3N7Z A;  4Q7A A;  3T9Y A;  2FIW A;  3I9S A;  1F57 A;  2CF4 A;  3CXS A;  1ARM A;  2PJA A;  4XPL A;  3F5B A;  1VHS A;  4L8A A;  1KUV A;  2Z3K A;  4PXE A;  1BAV A;  1TXR A;  2A4N A;  3SHP A;  2FSR A;  3KHZ A;  4KOR A;  2FCK A;  3DLJ A;  4UFW A;  2VI7 A;  4C68 A;  1Z8T A;  2NSM A;  1KUY A;  2FT0 A;  3WC5 A;  1B87 A;  3EXN A;  3S6F A;  4CGM A;  4MY0 A;  5HH1 A;  2B3V A;  4KZT A;  4CRY B;  3B35 A;  1ARL A;  2B4B A;  2PR1 A;  5H84 A;  4A94 A;  3GY9 A;  4JZ0 A;  1LAP A;  3PGP A;  4YWY A;  4DNC A;  4JXR A;  2PRQ A;  4RS2 A;  2ZOG A;  3B8G A;  3WC7 A;  2FXF A;  1KZF A;  5D8N A;  1QSN A;  4MHP A;  4EFD A;  3LAC A;  2CNS A;  2B5G B;  3SI1 A;  4CYN A;  4CYO A;  3KR4 A;  5LRG A;  1K4J A;  3RAM A;  1CP6 A;  3SI0 A;  2FVG A;  1QSM A;  3ZZI A;  2B3U A;  4PV6 A;  2FIA A;  4KUA A;  4XPK A;  1OBR A;  2QYV A;  4QUS A;  5AGE A;  1YW6 A;  1CG2 A;  1IID A;  1LAM A;  3LWU A;  3NE8 A;  4I49 A;  3PZJ A;  4CAF A;  5F47 A;  3P2F A;  3IFE A;  4IK2 A;  2JBJ A;  3D8P A;  1S7L A;  2YNC C;  3WR7 A;  3IIB A;  3UY5 A;  1AYE A;  5IB0 A;  2B5G A;  1ON0 A;  2ODF A;  1YVK A;  4ORF A;  4YGO A;  2BSW A;  2REE A;  3QAH A;  3QAY A;  1YR0 A;  5J8F A;  3NE7 A;  2PVV A;  3CXQ A;  4OLL A;  4H89 A;  3CT9 A;  2BOA A;  4Q36 A;  5AG6 A;  2YNC A;  2PJ0 A;  3TOA A;  1PU9 A;  3FEE A;  3IWG A;  2I3C A;  2PJ9 A;  5CNP A;  4NGQ A;  1H8L A;  5HVF A;  3DR6 A;  3V38 A;  4QBJ A;  1S7F A;  1XBU A;  3I1U A;  3CPX A;  4DYO A;  3B3V A;  1F2P A;  2VZZ A;  3FBU A;  4KLW A;  4CRZ B;  2HC9 A;  1IOI A;  3FNC A;  2PJB A;  3LOD A;  4QVT A;  2DPT A;  3TX8 A;  4ZGY B;  5AG7 A;  4NSQ A;  3PRT A;  2ZW7 A;  2OOT A;  4FUU A;  2Z3N A;  1CPX A;  3HLP A;  1I12 A;  1CP7 A;  3FB3 A;  4NEX A;  4A30 A;  5ISV A;  2EVN A;  2R98 A;  4AVC A;  5BWA B;  2WYR A;  4Q38 A;  2NYQ A;  1FY7 A;  2ANP A;  4R76 A;  1B6B A;  2Z3P A;  3R96 A;  3T90 A;  2VXK A;  3FX6 A;  1ZG9 A;  4MCQ A;  3VH9 A;  1R3N A;  3CDX A;  3CZX A;  4ZYQ A;  2XEF A;  2IMO A;  4M6H A;  3S6G A;  2V8H A;  2GFQ A;  2R1I A;  2JLM A;  3SXN A;  7CPA A;  3SXO A;  5LYF A;  1NMT A;  1YQE A;  4A31 A;  4AG9 A;  1CX8 A;  1QST A;  4CGN A;  2GRE A;  4P4J A;  1EE3 P;  4PK3 A;  4ZBG A;  1RXT A;  1LAN A;  2OB0 A;  2PQ8 A;  3CXP A;  3ISZ A;  3PFO A;  1Q7L A;  1Y9W A;  2PVW A;  4K3N A;  2HB6 A;  4HPS A;  1P0H A;  1PYT B;  5LYD A;  2AFO A;  2F7V A;  4NCZ A;  3KQZ A;  1SQH A;  4HNY B;  2I00 A;  3TFY A;  5J8C A;  3SJG A;  3H5Z A;  2EUI A;  3E0K A;  4JYW A;  4ZY2 A;  4AVB A;  1YME A;  3NH4 A;  2HUZ A;  3IO1 A;  4UCM A;  2PJ2 A;  3PEI A;  2JBK A;  2FS5 A;  4KOS A;  1VGY A;  2R7H A;  4FD7 A;  2HQY A;  2PJ3 A;  4OP4 A;  2C27 A;  5F49 A;  5DS0 A;  4J3G A;  2EO8 A;  4F8Z A;  2RFH A;  1XMB A;  4P4B A;  4C2X A;  2WSA A;  5FVJ A;  2HV2 A;  3RBU A;  1M4I A;  1VHE A;  4CPA A;  6CPA A;  4AXV A;  5H86 A;  4UF4 A;  2GU2 A;  3H8G A;  3JTK A;  2POK A;  3QB8 A;  3R95 A;  4CGL A;  5IB9 A;  3VWE A;  4C7H A;  2DXQ A;  4Z65 A;  4R7M A;  4B5O A;  1ZLI A;  1BPM A;  3WT4 A;  1V0C A;  1BLL E;  1TKH A;  2O28 A;  2ZEO A;  4H6U A;  3TT2 A;  4FWU A;  3RYO A;  1M1D A;  4F0X A;  3SJX A;  5ELY A;  2QIR A;  4OC0 A;  2WPX A;  1YLE A;  3BI1 A;  3QNV A;  5GCN A;  4AB7 A;  2PSW A;  4MFJ A;  3WAB A;  1MJA A;  1TKJ A;  5K8O A;  1X10 A;  3GB0 A;  3W91 A;  4R8F A;  4WWV A;  2ZEL A;  3S9L A;  4X2T A;  3TTH A;  2G9D A;  1ELL P;  2OH1 A;  2PJ1 A;  2R8V A;  3D68 A;  1DE4 C;  5CPA A;  3TO6 A;  2IQ6 A;  1CPS A;  4NGN A;  4E2A A;  3SJF A;  1AUG A;  2PIZ A;  4UA3 A;  1R43 A;  3PFE A;  2RB7 A;  2V77 A;  1Z8X A;  1YK3 A;  2OU2 A;  4UEF A;  4CS0 B;  3GYA A;  5J1Q A;  3PP9 A;  4FD5 A;  1HEE A;  1UWY A;  3S9N A;  2PJ8 A;  4UBR A;  4UEZ A;  1XF8 A;  1YVO A;  1P4N A;  2QML A;  2F8H A;  4NGT A;  4MHN A;  2D4P A;  3EC4 A;  5I4M A;  2G3T A;  4L89 A;  1S3Z A;  5K8N A;  4E0A A;  1Q2D A;  4B12 A;  1RO5 A;  5JGF A;  1IOF A;  1YRE A;  5CBM A;  3DR8 A;  1YW4 A;  4KOV A;  4CGO A;  4UWI A;  2EK9 A;  1Z8L A;  2GIV A;  3D4U A;  1TKF A;  3BHX A;  1M4L A;  4A2Z A;  4P4D A;  1M44 A;  3GIU A;  5G22 A;  5G1Z A;  5IX3 A;  4MJ8 A;  3VAR A;  4OAD A;  2DEA A;  4P44 A;  2PE3 A;  2WUU A;  3D7G A;  1JWQ A;  4NGR A;  2OR4 A;  1DTD A;  4ZY1 A;  4X5K A;  1NE9 A;  3MN8 A; 
#chains in the Genus database with same CATH homology
 4HNW B;  4MBU A;  3P2H A;  4HNX B;  4A33 A;  2GAN A;  4MFZ A;  1Z9U A;  2Q4Y A;  3S6H A;  4PSX A;  4UCN A;  2ZXV A;  4IF5 A;  2ARH A;  4HKF A;  4CAX A;  2I79 A;  3KKW A;  1Y9K A;  5AG4 A;  4R57 A;  5EC4 A;  5KTC A;  3TO9 A;  2ZW5 A;  4B10 A;  2Z3M A;  4MFQ A;  2Q44 A;  2Q04 A;  4B5P A;  1WK4 A;  4MFL A;  1IYK A;  5DWN A;  2G0B A;  3IU2 A;  4MI4 A;  4KVX A;  1YX0 A;  3TO7 A;  1N71 A;  4MFK A;  1IB1 E;  4XNH B;  4BMH A;  2H5M A;  3S6K A;  3LD2 A;  1NSL A;  3DDD A;  2WPW A;  2KCW A;  4H6Z A;  4XNH C;  4A32 A;  2AJ6 A;  1M4D A;  4JWP A;  3FRM A;  4YRH A;  3F0A A;  5IV0 A;  3JVN A;  3TCV A;  5F48 A;  2DPS A;  2BUE A;  4JD6 A;  1I21 A;  4NXY A;  4IUS A;  4R3L A;  2PRB A;  2B4D A;  4AG7 A;  3EY5 A;  2Q0Y A;  5HMN A;  3I3G A;  2VBQ A;  4CYQ A;  4F0Y A;  5A27 A;  4UFV A;  3V8I A;  2Z10 A;  2ZW4 A;  3R1K A;  2VEZ A;  1ZO0 A;  3H4Q A;  4FD4 A;  2JDC A;  3IWE A;  3IU1 A;  1CM0 A;  2J8R A;  2FE7 A;  2IL4 A;  3ZJ0 A;  4PK2 A;  1S5K A;  1M4G A;  1S60 A;  2P0W A;  4M85 A;  4LUA A;  3G3S A;  2YND A;  2P6G A;  4GS4 A;  1QSO A;  4KOU A;  4MY3 A;  4CGP A;  2X7B A;  4YFJ A;  5F46 A;  5G20 A;  3BJ8 A;  1S7N A;  2D4O A;  3IGR A;  4UFX A;  2NMT A;  3FIX A;  1XIX A;  4E8O A;  4QB9 A;  4MHD A;  5JQ4 A;  4MFP A;  4U9Z A;  4RI1 A;  2GE3 A;  4B14 A;  1KUX A;  5DWM A;  4JXQ A;  3D2M A;  2J8N A;  1XEB A;  3EO4 A;  4KVM E;  1L0C A;  2K5T A;  2PDO A;  4LX9 A;  1XMT A;  2OZH A;  3K9U A;  4A95 A;  3W6S A;  4C2Z A;  5C88 A;  3C26 A;  1WWZ A;  1XE4 A;  2CY2 A;  1Z4E A;  4KSF A;  4JLY A;  2ATR A;  3GKR A;  2JEV A;  5G21 A;  1U6M A;  3FXT A;  4F6A A;  1GHE A;  3VWD A;  5C82 A;  4B5P B;  3OWC A;  1Z4R A;  1CJW A;  4Y49 B;  2Y0M A;  2BL1 A;  1LRZ A;  5EBV A;  3BLN A;  3TE4 A;  1BOB A;  1PUA A;  5JPH A;  2RC4 A;  4KOT A;  2J8M A;  4XPD B;  4Y49 C;  4II9 A;  4NF1 A;  2PR8 A;  5AG5 A;  2JDD A;  2Z0Z A;  2VQY A;  2OZG A;  1BO4 A;  4XPD C;  1Q2Y A;  4B11 A;  4CAE A;  4JJX A;  1QSR A;  3W6X A;  3DSB A;  4KVO E;  4PSW A;  2Z3L A;  3D2P A;  4UCP A;  1TIQ A;  1IIC A;  5E96 A;  4BBH A;  2ZPA A;  4R3K A;  4U9Y A;  4KSA A;  2AE6 A;  4C7I A;  4KLV A;  3D3S A;  1UFH A;  2B4D B;  2VZY A;  2Z11 A;  1MK4 A;  3MGD A;  4CYP A;  4KUB A;  3R9G A;  2BEI A;  1Y7R A;  4M3S A;  1I1D A;  2FL4 A;  2OZU A;  2Z3O A;  4KS9 A;  4ONU A;  1IYL A;  3TOB A;  3DNS A;  3R9F A;  4CAV A;  2P6E A;  2QEC A;  3BJ7 A;  4KOX A;  4R9M A;  5KTD A;  2YNE A;  3G8W A;  3F8K A;  4B13 A;  1MJB A;  2CNM A;  4U5Y A;  2REF A;  2F5I A;  3FYN A;  2ZW6 A;  1YGH A;  1OZP A;  2P6F A;  5I0C A;  4CAW A;  4KOW A;  1MJ9 A;  2G3A A;  4OAE A;  2CXA A;  1R57 A;  3EFA A;  5A28 A;  2CNT A;  4AVA A;  4FD6 A;  5KTA A;  2PC1 A;  4C2Y A;  4K30 A;  2B58 A;  1Q2C A;  4R87 A;  4KOY A;  2Q4V A;  3A9L A;  1J4J A;  3R9E A;  2Q7B A;  4UWJ A;  4EVY A;  3JUW A;  2YGW A;  1VKC A;  1S7K A;  4QC6 A;  3N7Z A;  3T9Y A;  2FIW A;  3I9S A;  3CXS A;  4XPL A;  3F5B A;  1VHS A;  4L8A A;  1KUV A;  2Z3K A;  2A4N A;  3SHP A;  2FSR A;  4UFW A;  4KOR A;  2FCK A;  2VI7 A;  4C68 A;  1KUY A;  2FT0 A;  1B87 A;  3EXN A;  3S6F A;  4CGM A;  4MY0 A;  5HH1 A;  2B3V A;  4KZT A;  4CRY B;  2B4B A;  2PR1 A;  5H84 A;  3GY9 A;  3PGP A;  4DNC A;  4JXR A;  4RS2 A;  3B8G A;  2FXF A;  1KZF A;  1QSN A;  2CNS A;  2B5G B;  4CYN A;  4CYO A;  1K4J A;  1QSM A;  3ZZI A;  2B3U A;  4PV6 A;  2FIA A;  4KUA A;  4XPK A;  4QUS A;  5AGE A;  1IID A;  4I49 A;  3PZJ A;  4CAF A;  5F47 A;  3P2F A;  3D8P A;  1S7L A;  2YNC C;  3WR7 A;  3UY5 A;  5IB0 A;  2B5G A;  1ON0 A;  1YVK A;  4ORF A;  4YGO A;  2BSW A;  2REE A;  3QAH A;  1YR0 A;  5J8F A;  3NE7 A;  3CXQ A;  4OLL A;  4Q36 A;  4H89 A;  5AG6 A;  2YNC A;  3TOA A;  1PU9 A;  3IWG A;  5CNP A;  4QBJ A;  3DR6 A;  1S7F A;  4KLW A;  3FBU A;  2VZZ A;  4CRZ B;  3LOD A;  3FNC A;  4QVT A;  4ZGY B;  2DPT A;  5AG7 A;  4NSQ A;  2ZW7 A;  2Z3N A;  1I12 A;  3FB3 A;  4NEX A;  4A30 A;  5ISV A;  2EVN A;  2R98 A;  4AVC A;  5BWA B;  4Q38 A;  1FY7 A;  1B6B A;  2Z3P A;  3R96 A;  3T90 A;  2VXK A;  3S6G A;  2R1I A;  2JLM A;  3SXN A;  3SXO A;  1NMT A;  4A31 A;  4AG9 A;  1QST A;  4CGN A;  4PK3 A;  4ZBG A;  1RXT A;  2OB0 A;  2PQ8 A;  3CXP A;  1Y9W A;  1P0H A;  4NCZ A;  1SQH A;  4HNY B;  2I00 A;  3TFY A;  5J8C A;  3H5Z A;  2EUI A;  3E0K A;  4AVB A;  2HUZ A;  4UCM A;  2FS5 A;  4KOS A;  2R7H A;  4FD7 A;  2HQY A;  5F49 A;  2C27 A;  4J3G A;  4C2X A;  2WSA A;  5FVJ A;  2HV2 A;  1M4I A;  5H86 A;  3JTK A;  3QB8 A;  3R95 A;  4CGL A;  3VWE A;  4C7H A;  2DXQ A;  4B5O A;  1V0C A;  2O28 A;  4H6U A;  3TT2 A;  3RYO A;  1M1D A;  4F0X A;  2QIR A;  2WPX A;  1YLE A;  5GCN A;  4AB7 A;  2PSW A;  4MFJ A;  1MJA A;  3W91 A;  3TTH A;  2OH1 A;  2R8V A;  3TO6 A;  4E2A A;  4UA3 A;  1YK3 A;  2OU2 A;  4CS0 B;  3GYA A;  3PP9 A;  4FD5 A;  4UBR A;  1XF8 A;  1YVO A;  1P4N A;  2QML A;  2D4P A;  3EC4 A;  2G3T A;  4L89 A;  1S3Z A;  4E0A A;  1Q2D A;  4B12 A;  1RO5 A;  1YRE A;  3DR8 A;  4KOV A;  4CGO A;  4UWI A;  2GIV A;  4A2Z A;  1M44 A;  5G22 A;  5G1Z A;  5IX3 A;  4MJ8 A;  4OAD A;  2WUU A;  4X5K A;  1NE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...