2Q7BA

Crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
FQGMEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKMAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVLKKFFTYPKYRGNPVRLGRKLFERFMLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase (NP_689019.1) from Streptococcus agalactiae 2603 at 2.00 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q7bA00
4KOVA 5CNPA 3BLNA 3FYNA 4PSWA 4KZTA 1R57A 1I1DA 3SXOA 3VWEA 2IL4A 3DR8A 1BOBA 2ZW7A 3I9SA 3FB3A 2Q0YA 5JQ4A 3P2HA 4KUAA 4Y49C 4ZBGA 4CAXA 5KTCA 1GHEA 2CY2A 2G3AA 4U5YA 2HQYA 3C26A 2ZW5A 1XF8A 3FNCA 3TTHA 2VI7A 5FVJA 3G3SA 4L8AA 3LD2A 2R8VA 4KOWA 1QSNA 1KZFA 4AG7A 2F5IA 3BJ8A 2OZUA 2G0BA 3DNSA 3ZJ0A 3DSBA 4E0AA 4M85A 4E8OA 1M4DA 1WWZA 1YR0A 3F0AA 3IWGA 2CNSA 2R7HA 2B4BA 3FBUA 3TE4A 1YGHA 1S60A 2PR1A 1K4JA 2J8RA 3GYAA 4YGOA 2BEIA 1S7FA 1M44A 3F8KA 4BMHA 4PK2A 1MJAA 4B5OA 2VBQA 1Y9WA 4UA3A 1Z4EA 3JUWA 2FSRA 5IX3A 1S7KA 4QBJA 2Z0ZA 3D2PA 1L0CA 2B4DA 4NSQA 2ATRA 1PUAA 1V0CA 1B87A 4NXYA 1KUXA 2PC1A 4FD4A 4U9ZA 5EC4A 4KLWA 2HUZA 1Y9KA 3G8WA 1SQHA 4QB9A 3VWDA 4YFJA 4CRYB 1M4GA 1LRZA 1QSMA 3OWCA 3PZJA 2EUIA 4MY3A 4MHDA 2KCWA 4X5KA 4XPLA 4AVCA 2BUEA 1YK3A 4RS2A 2GIVA 4NF1A 4EVYA 3CXPA 1P0HA 4PV6A 3V8IA 3E0KA 2OZHA 2X7BA 2JEVA 4KORA 3R9FA 3MGDA 1M1DA 3I3GA 2OZGA 1QSTA 2AE6A 2P6GA 2B3UA 4I49A 4ONUA 4JWPA 2ZXVA 2FIWA 2Z10A 3D8PA 4M3SA 2P0WA 4CRZB 4HNWB 3R1KA 4KOUA 5J8CA 3LODA 2J8NA 4F6AA 2PR8A 1YX0A 5H84A 4XNHB 2Y0MA 2B5GB 2VZYA 4E2AA 3TFYA 4JXRA 4KVME 3PP9A 2VQYA 3PGPA 1NMTA 4YRHA 2JDCA 1CM0A 2VXKA 4JD6A 1Y7RA 2D4OA 2H5MA 2QECA 1J4JA 5KTAA 3EXNA 1XEBA 3T9YA 4UWJA 2VZZA 3RYOA 1MJBA 4IF5A 4ORFA 3EY5A 4UWIA 4XPDC 1TIQA 2VEZA 2FL4A 2Q04A 1WK4A 3TO7A 4KOXA 4GS4A 4H6ZA 5E96A 2ARHA 1S3ZA 5F48A 2AJ6A 1UFHA 2QMLA 4Y49B 2GANA 3ZZIA 4HNYB 1IB1E 2FT0A 4J3GA 2FCKA 1XMTA 3N7ZA 1I12A 1ON0A 2RC4A 3EFAA 1YVOA 3CXQA 1Q2DA 4XPDB 2JLMA 2EVNA 5ISVA 4R57A 4PK3A 2QIRA 4KOYA 2OH1A 4FD7A 2R1IA 4CS0B 5C88A 2Z11A 5HH1A 2C27A 1NSLA 2D4PA 3W6XA 1N71A 5C82A 4OAEA 3S6FA 2B3VA 4U9YA 3S6GA 4CAVA 3T90A 4AVAA 3DDDA 3QAHA 2ZPAA 2PRBA 4R3LA 1OZPA 4R9MA 5J8FA 3R9EA 3TO9A 1RO5A 1Z4RA 4MBUA 4DNCA 4JXQA 2OU2A 3P2FA 3SXNA 1P4NA 3FXTA 1YREA 2GE3A 2Q44A 4HNXB 2HV2A 2OB0A 3GY9A 2ZW4A 1IYKA 2B58A 3W6SA 4NEXA 1FY7A 3IGRA 1S5KA 2WPWA 3QB8A 4LUAA 4KOSA 3TO6A 4CAWA 2JDDA 4OADA 1QSRA 1Q2CA 2P6EA 4K30A 3D2MA 2A4NA 2R98A 5IV0A 5HMNA 4UBRA 2PDOA 5EBVA 4OLLA 1KUVA 2FXFA 4JJXA 2Q4YA 1IIDA 4MY0A 2B4DB 2PSWA 4QVTA 3WR7A 2DXQA 3R96A 3D3SA 4KUBA 4KVXA 4QUSA 4II9A 4H6UA 4IUSA 4QC6A 3SHPA 2CNMA 1VHSA 1Z9UA 4JLYA 5JPHA 4B5PA 2CNTA 1BO4A 3F5BA 3R9GA 4KVOE 4MJ8A 5DWNA 4F0YA 1VKCA 3FIXA 2NMTA 3GKRA 2FE7A 2FIAA 2I79A 4AB7A 1S7LA 3CXSA 3EO4A 5F46A 4HKFA 2Q7BA 1PU9A 1NE9A 4KLVA 1QSOA 4MI4A 1I21A 2G3TA 4LX9A 2WPXA 3H4QA 3W91A 1M4IA 2B5GA 4NCZA 4RI1A 3BJ7A 5H86A 3UY5A 2BL1A 3TT2A 4FD5A 2ZW6A 1RXTA 2P6FA 4R3KA 2REEA 4PSXA 1YLEA 1B6BA 1U6MA 5F49A 2K5TA 1S7NA 1MJ9A 3FRMA 1Q2YA 1XIXA 5I0CA 3B8GA 1IYLA 1KUYA 1CJWA 2I00A 3TOAA 2FS5A 4R87A 4FD6A 3TOBA 5IB0A 4AVBA 2J8MA 3JVNA 4XNHC 5DWMA 3KKWA 1IICA 4B5PB 3S6KA 1YVKA 4XPKA 2REFA 5F47A 3K9UA 3S6HA 3R95A 4AG9A 4L89A 2Q4VA 2BSWA 4H89A 4KOTA 3DR6A 3EC4A 1XE4A 3NE7A 5GCNA 3TCVA 2PQ8A 2O28A 1MK4A 5KTDA
chains in the Genus database with same CATH superfamily
3SJEA 3KQZA 7CPAA 3CZXA 3JTKA 3IU2A 5G21A 4KOVA 5CNPA 5LRGA 2YNEA 3BLNA 3FYNA 3IJ3A 4PSWA 4KZTA 1R57A 4MFJA 1IU8A 2AFZA 2YNCA 3D7GA 4NJQA 2PJ8A 1I1DA 4C2ZA 3JRUA 4ONWA 2AFOA 3KI9A 3SXOA 4MHYA 3VWEA 2IL4A 4GXHA 2Z3PA 3L2NA 3DR8A 1BOBA 2ZW7A 3I9SA 3FB3A 5LYIA 2Q0YA 2EK9A 5JQ4A 3CPXA 4UCPA 5EMIA 3P2HA 4KUAA 1Y7EA 4Y49C 1Z8XA 2ZENA 2CIJA 4ZBGA 4CAXA 1GHEA 4MHZA 5KTCA 3SI2A 3K9TA 2CY2A 2G3AA 3NH5A 4M6HA 4NGQA 3PB8X 1EE3P 4U5YA 2HQYA 1BPMA 1Q7LA 2FVGA 2ZW5A 1XF8A 3C26A 3FNCA 3LWUA 4A37A 3TTHA 2PRQA 4NGPA 2VI7A 5FVJA 2OOTA 4CAFA 3G3SA 4L8AA 2F8HA 2PJBA 3IWWA 3K2KA 4B14A 3FECA 3LD2A 4UCMA 2R8VA 4OKOA 4P4JA 4KOWA 1QSNA 4P45A 1KZFA 4AG7A 2F5IA 3BJ8A 1R3NA 2OZUA 4B13A 4NGTA 2G0BA 4CGNA 3DNSA 3ZJ0A 3DSBA 2DPSA 1YQEA 4E0AA 2QVPA 4IK2A 4M85A 4E8OA 2NSMA 3V38A 1M4DA 1WWZA 1YR0A 3F0AA 3IWGA 4C7HA 2CNSA 2YNCC 3D7FA 5J1QA 2R7HA 1IOIA 1YMEA 2B4BA 3FBUA 4DJLA 3D66A 3TE4A 3FF3A 1YGHA 1S60A 2PIZA 2PR1A 1K4JA 2J8RA 3GYAA 5AGEA 3GB0A 1CX8A 4YGOA 2BEIA 3NFZA 1S7FA 2Z3OA 4R8FA 4C2YA 1YLOA 2WSAA 1M44A 3F8KA 4BMHA 4PK2A 1MJAA 4B5OA 4P6YA 2VBQA 3DGVA 3HLPA 5LYDA 4CYOA 2I3CA 5F09A 1Y9WA 4UA3A 4F9UA 5IB9A 1Z4EA 2BCOA 1HDUA 2ZEFA 3JUWA 4A39A 2FSRA 2ZEMA 5IX3A 1S7KA 4KS9A 4MFZA 3KL9A 4QBJA 4CGLA 2Z0ZA 2Z3KA 3D2PA 1L0CA 2B4DA 4NSQA 5CBMA 2AFWA 2ATRA 3B7IA 1Z8WA 1PUAA 3CDXA 1V0CA 4M6GA 1B87A 4NXYA 1XOVA 5G22A 2J9AA 2QJ8A 4K3NA 1KUXA 2PC1A 4FD4A 4U9ZA 5EC4A 3CPAA 4KLWA 2HUZA 1Y9KA 3G8WA 1DTDA 4OIDA 2F7VA 1ZO0A 2ABZA 1SQHA 1OBRA 2ZEHA 2PJ5A 4QB9A 3FEDA 3VWDA 2XEFA 3NE8A 4CRYB 4YFJA 5JM6A 1M4GA 1LRZA 4WJBA 1QMUA 1LFWA 3QNVA 3KASA 2PIYA 1QSMA 2CTBA 3OWCA 3PZJA 2EUIA 4FWUA 4MHDA 2KCWA 4MY3A 4X5KA 4XPLA 4AVCA 2BUEA 3RO0A 5A28A 4MCSA 2PVVA 1YK3A 4MFPA 4RS2A 2GIVA 4NF1A 4PQAA 3RAMA 4EVYA 3CXPA 1P0HA 4KSIA 3PFEA 1TKJA 4PV6A 3V8IA 3E0KA 2BOAA 3D7DA 2OZHA 2X7BA 2JEVA 4KORA 1TXRA 4OIWA 3R9FA 3MGDA 1M1DA 3I3GA 2OZGA 3PBBA 1QSTA 2AE6A 2P6GA 6CPAA 2B3UA 4JYWA 4I49A 4ONUA 2NYQA 4JWPA 4MCPA 4UFWA 3WC6A 3SI0A 2ZEEA 2ZXVA 3HUVA 4G1PA 3D67A 2FIWA 2O53A 2Z10A 2Q7SA 3D8PA 4RUHA 4NFRA 4PXBA 4M3SA 3S9LA 4KSFA 5D8NA 3PB7X 4MHPA 4MRIA 2P0WA 2DF5A 4MMOA 4CRZB 3D68A 4HNWB 3R1KA 4KOUA 5J8CA 3LODA 1CPXA 2J8NA 4CYPA 4F6AA 4FBEA 2PR8A 4RN7A 1YX0A 2DPTA 2PJ9A 2PJCA 3PBEA 4P4BA 3B2YA 5H84A 2C6PA 2IMOA 3IIBA 1X10A 4XNHB 2Y0MA 2B5GB 4EMEA 1ELMP 1NSAA 3NH4A 2VZYA 4E2AA 3TFYA 4JXRA 1XJOA 4KVME 3PP9A 4MXUA 2VQYA 5K8PA 3PGPA 3GLJA 1NMTA 1CPSA 4YRHA 4BINA 2JDCA 1CM0A 4NGMA 1LAPA 4JZ0A 4OC1A 2VXKA 4C2XA 1TF9A 4JD6A 1Y7RA 2D4OA 2H5MA 2QECA 3FMCA 1J4JA 2ZELA 4UFXA 5KTAA 3EXNA 3KZWA 1XEBA 1ZG9A 1IY7A 4OMEA 4PXEA 3T9YA 1LANA 4UWJA 1YSJA 1PCAA 2VZZA 4UEFA 1MJBA 3RYOA 3FX6A 4IF5A 2HB6A 3KQXA 3BI0A 3EY5A 4ORFA 4UWIA 1Y0RA 2CF4A 4UF4A 4UIAA 2IJZA 1Z8LA 1F2OA 1TIQA 1TKHA 3H8EA 3KR4A 4XPDC 2VEZA 3IU1A 2FL4A 2Q04A 1IGBA 1JQGA 4P10A 3IC1A 1AMPA 2V8GA 1WK4A 3TO7A 1IOFA 2V8VA 1BAVA 3BHXA 1A2ZA 4KOXA 1ARMA 3PRTA 4WWVA 4Q7AA 2PJAA 2AFMA 4GS4A 4H6ZA 5E96A 3GIUA 1ZG8A 2ARHA 1S3ZA 5F48A 4Z65A 5LYFA 2GLJA 2AJ6A 1UFHA 1UWYA 2QMLA 4A38A 3B3WA 2RB7A 4X8IA 4Y49B 2GANA 3ZZIA 1Z8TA 3A9LA 4CYNA 4HNYB 1IB1E 1VHEA 2FT0A 3D4UA 2Q51A 4J3GA 2FCKA 3NA6A 2PJ4A 1XMTA 3N7ZA 1I12A 4F9VA 2JEWA 1ON0A 2RC4A 3H5ZA 3EFAA 1YVOA 2RFHA 4A94A 3BI1A 3CXQA 1Q2DA 3IFEA 4XPDB 2QYVA 2YGWA 4LQGA 2JLMA 2ODFA 2EVNA 4IHMA 3WABA 1HEEA 4PK3A 4R57A 5ISVA 4OC4A 5LRKA 2JBKA 2PJ1A 2QIRA 2ZEDA 4KOYA 2OH1A 4FD7A 4PXCA 2R1IA 5JGFA 3D7HA 3MN8A 4CS0B 5A27A 4OC5A 4A31A 2GFQA 5C88A 2Z11A 4M6IA 4NGRA 5HH1A 1TF8A 2C27A 2GU2A 2D4PA 1NSLA 2ZEOA 4ZI6A 3W6XA 1N71A 5ELYA 4BBHA 4F0XA 1BLLE 5C82A 4OAEA 3GUXA 3S6FA 4ZGYB 1ARLA 4CYQA 2B3VA 4U9YA 3S6GA 4CAVA 3T90A 4AVAA 3DDDA 1VGYA 3QAHA 4ZY2A 4ZY1A 4OC3A 2ZPAA 4C68A 5HXDA 1XRYA 2Z3NA 3PB4X 5HVFA 2AFSA 2PRBA 4R3LA 1OZPA 2WYRA 2VL1A 4R9MA 5J8FA 3R9EA 3TO9A 1RO5A 1Z4RA 4MBUA 4R6TA 4DNCA 4JXQA 4MCRA 3NH8A 1VHOA 2OU2A 4NGNA 3P2FA 2V8DA 3LACA 3SXNA 2CXAA 2PCUA 3RNZA 5I4MA 1P4NA 1LCPA 4X2TA 1Z2LA 3FXTA 1QQ9A 3N5FA 1YREA 2GE3A 2Q44A 4HNXB 4Q36A 4B11A 4TWEA 2PE3A 2OR4A 3PEIA 2HV2A 2OB0A 4X3RA 3T8WA 3GY9A 2ZW4A 1IYKA 1CP7A 2B58A 3W6SA 1LAMA 4NEXA 1R43A 1FY7A 1H8LA 4P4EA 4DYOA 3IGRA 3IEHA 2Q4ZA 3B35A 4W9YA 1S5KA 2IQ6A 2WPWA 4YU9A 3QB8A 3WC5A 4LUAA 3PFOA 1TKFA 4KOSA 3TO6A 5DS0A 4O23A 1YW4A 2JDDA 4P4IA 4CAWA 4CGMA 5CPAA 2POKA 4OADA 1QSRA 1Q2CA 2P6EA 2Z3LA 4K30A 3D2MA 3FH4A 2ZOGA 3PB6X 1ZG7A 2C6CA 2EBJA 2A4NA 2PJ3A 2ZOFA 3KR5A 2R98A 5HVGA 5G1ZA 3SJGA 1ZLHA 2XEJA 4MFKA 5IV0A 5HMNA 1Z5RA 8CPAA 2C1CA 4PXDA 2PDOA 4H2KA 4UBRA 4FAIA 5AG4A 5EBVA 2YNDA 1KUVA 1AYEA 1F2PA 4IAVA 4OLLA 4A2ZA 2FXFA 4JJXA 2Q4YA 3VARA 4UEEA 4CPAA 2CTCA 1IIDA 1ELLP 4MFLA 4MY0A 4ZX8A 3KHXA 3FVLA 2WUUA 2B4DB 1AUGA 4BD9A 2PSWA 3DLJA 4P4DA 4QVTA 3WR7A 4C7IA 4GM5A 2DXQA 1M4LA 5LRJA 4ZY0A 3R96A 3D3SA 4KUBA 4KVXA 4QUSA 3VH9A 4II9A 3R9GA 4H6UA 4IUSA 4QC6A 3BXMA 3SHPA 2CNMA 1VHSA 3CT9A 1Z9UA 2G9DA 4JLYA 5JPHA 4B5PA 2CNTA 1BO4A 3MRUA 1GYTA 3F5BA 1CP6A 3H8GA 2Z3MA 4UFVA 5AG7A 4ZX9A 1CBXA 1RTQA 1XMBA 4KVOE 4MJ8A 5DWNA 4F0YA 1VKCA 3FIXA 2NMTA 5K8MA 3GKRA 4HPSA 4CAEA 2FE7A 4TNUA 4NGSA 2FIAA 1HDQA 5G20A 4LQ6A 5LYLA 2DEAA 3VATA 2I79A 4AB7A 1S7LA 3LMSA 3CXSA 3EO4A 5F46A 4HKFA 2Q7BA 2O4HA 3FJUA 1PU9A 1NE9A 3WT4A 4KLVA 1QSOA 4MI4A 2HC9A 2JBJA 3B3TA 4B6ZA 2ZEPA 4OC0A 2PJ0A 1I21A 2GLFA 2EO8A 3I1UA 3ISXA 3V7ZA 2G3TA 2ZEGA 4LX9A 1VIXA 2AFXA 2WPXA 3H4QA 3W91A 5K8OA 5AG5A 5D29A 1M4IA 2B5GA 4UEZA 3TC8A 3RBUA 4MCQA 4CGOA 4F8ZA 4NCZA 5JH9A 4RI1A 1CG2A 3BJ7A 5H86A 4B10A 3RZAA 3UY5A 4MFQA 2BL1A 3H8FA 3TT2A 4ZYQA 4FD5A 2ZW6A 1RXTA 1PYTB 1FNOA 3TX8A 2P6FA 4R3KA 2REEA 4NJRA 4PSXA 1X12A 1Y0YA 1YLEA 1B6BA 1U6MA 5F49A 3QAYA 4R7MA 3S9MA 2K5TA 2GREA 3PB9X 1S7NA 1MJ9A 3ISZA 4KSAA 2WZNA 4OP4A 4A32A 3FRMA 3B3VA 3KHZA 2EK8A 4P4FA 1Q2YA 1XIXA 4A30A 3B8GA 5I0CA 3FEEA 1IYLA 1F57A 1LOKA 4P44A 4FUUA 1KUYA 3KGQA 4PPZA 1CJWA 2I00A 3TOAA 3WC7A 2FS5A 1JWQA 4R87A 4FD6A 5THWA 3TOBA 4EFDA 1YW6A 5IB0A 3SI1A 2XEIA 2J8MA 4MHNA 4AVBA 1KWMA 4R76A 2PJ2A 4UIBA 1XBUA 3JVNA 4B12A 1BPNA 4XNHC 5DWMA 3KKWA 5HVHA 3B3SA 1IICA 4B5PB 2V77A 1YVKA 2PJ6A 3S6KA 4XPKA 2XEGA 3IWEA 1DE4C 3B3CA 5BWAB 2REFA 5F47A 3K9UA 2EWBA 2V8HA 4Q38A 3S6HA 4EWTA 4OC2A 2AFUA 5K8NA 4UCNA 3R95A 4AG9A 4L89A 2Q4VA 1FT7A 4DUKA 1XFOA 2BSWA 5AG6A 4H89A 4YWYA 3S9NA 4KOTA 3DR6A 2C6GA 2PJ7A 2Q43A 3EC4A 3SJFA 1XE4A 1ZLIA 3NE7A 5GCNA 3TCVA 4CGPA 2PVWA 4A95A 4AXVA 4A33A 2PQ8A 2BO9A 3SJXA 2O28A 3IO1A 1MK4A 5KTDA 2ANPA
chains in the Genus database with same CATH topology
3JTKA 3IU2A 5G21A 4KOVA 5CNPA 2YNEA 3BLNA 3FYNA 4PSWA 4KZTA 1R57A 4MFJA 2YNCA 4C2ZA 1I1DA 3SXOA 3VWEA 2IL4A 2Z3PA 3DR8A 1BOBA 2ZW7A 3I9SA 3FB3A 2Q0YA 5JQ4A 4UCPA 3P2HA 4KUAA 4Y49C 4ZBGA 4CAXA 5KTCA 1GHEA 2CY2A 2G3AA 4U5YA 2HQYA 3C26A 2ZW5A 1XF8A 3FNCA 3TTHA 2VI7A 5FVJA 4CAFA 3G3SA 4L8AA 4B14A 3LD2A 4UCMA 2R8VA 4KOWA 1QSNA 1KZFA 4AG7A 2F5IA 3BJ8A 2OZUA 4B13A 2G0BA 4CGNA 3DNSA 3ZJ0A 3DSBA 2DPSA 4E0AA 4M85A 4E8OA 1M4DA 1WWZA 1YR0A 3F0AA 3IWGA 4C7HA 2CNSA 2YNCC 2R7HA 2B4BA 3FBUA 3TE4A 1YGHA 1S60A 2PR1A 1K4JA 2J8RA 3GYAA 5AGEA 4YGOA 2BEIA 1S7FA 2Z3OA 4C2YA 2WSAA 1M44A 3F8KA 4BMHA 4PK2A 1MJAA 4B5OA 2VBQA 4CYOA 1Y9WA 4UA3A 1Z4EA 3JUWA 2FSRA 5IX3A 1S7KA 4KS9A 4MFZA 4QBJA 4CGLA 2Z0ZA 2Z3KA 3D2PA 1L0CA 2B4DA 4NSQA 2ATRA 1PUAA 1V0CA 1B87A 4NXYA 5G22A 1KUXA 2PC1A 4FD4A 4U9ZA 5EC4A 4KLWA 2HUZA 1Y9KA 3G8WA 1ZO0A 1SQHA 4QB9A 3VWDA 4YFJA 4CRYB 1M4GA 1LRZA 1QSMA 3OWCA 3PZJA 2EUIA 4MY3A 4MHDA 2KCWA 4X5KA 4XPLA 4AVCA 2BUEA 5A28A 1YK3A 4MFPA 4RS2A 2GIVA 4NF1A 4EVYA 3CXPA 1P0HA 4PV6A 3V8IA 3E0KA 2OZHA 2X7BA 2JEVA 4KORA 3R9FA 3MGDA 1M1DA 3I3GA 2OZGA 1QSTA 2AE6A 2P6GA 2B3UA 4I49A 4ONUA 4JWPA 4UFWA 2ZXVA 2FIWA 2Z10A 3D8PA 4M3SA 4KSFA 2P0WA 4CRZB 4HNWB 3R1KA 4KOUA 5J8CA 3LODA 2J8NA 4CYPA 4F6AA 2PR8A 1YX0A 2DPTA 5H84A 4XNHB 2Y0MA 2B5GB 2VZYA 4E2AA 3TFYA 4JXRA 4KVME 3PP9A 2VQYA 3PGPA 1NMTA 4YRHA 2JDCA 1CM0A 4C2XA 2VXKA 4JD6A 1Y7RA 2D4OA 2H5MA 2QECA 4UFXA 1J4JA 5KTAA 3EXNA 1XEBA 3T9YA 4UWJA 2VZZA 3RYOA 1MJBA 4B12A 4IF5A 4ORFA 3EY5A 4UWIA 4XPDC 1TIQA 2VEZA 3IU1A 2FL4A 2Q04A 1WK4A 3TO7A 4KOXA 4GS4A 4H6ZA 5E96A 2ARHA 1S3ZA 5F48A 2AJ6A 1UFHA 2QMLA 4Y49B 2GANA 3ZZIA 3A9LA 4CYNA 4HNYB 1IB1E 2FT0A 4J3GA 2FCKA 1XMTA 3N7ZA 1I12A 1ON0A 2RC4A 3H5ZA 3EFAA 1YVOA 3CXQA 1Q2DA 4XPDB 2YGWA 2JLMA 2EVNA 5ISVA 4R57A 4PK3A 2QIRA 4KOYA 2OH1A 4FD7A 2R1IA 4CS0B 5A27A 4A31A 5C88A 2Z11A 5HH1A 2C27A 1NSLA 2D4PA 3W6XA 1N71A 4BBHA 4F0XA 5C82A 4OAEA 4ZGYB 3S6FA 4CYQA 2B3VA 4U9YA 3S6GA 4CAVA 3T90A 4AVAA 3DDDA 3QAHA 2ZPAA 4C68A 2Z3NA 2PRBA 4R3LA 1OZPA 4R9MA 5J8FA 3R9EA 3TO9A 1RO5A 1Z4RA 4MBUA 4DNCA 4JXQA 2OU2A 3P2FA 3SXNA 2CXAA 1P4NA 3FXTA 1YREA 2GE3A 2Q44A 4HNXB 4Q36A 4B11A 2HV2A 2OB0A 3GY9A 2ZW4A 1IYKA 2B58A 3W6SA 4NEXA 1FY7A 3IGRA 1S5KA 2WPWA 3QB8A 4LUAA 4KOSA 3TO6A 4CAWA 2JDDA 4CGMA 4OADA 1QSRA 1Q2CA 2P6EA 2Z3LA 4K30A 3D2MA 2A4NA 2R98A 5G1ZA 4MFKA 5IV0A 5HMNA 4UBRA 2PDOA 5AG4A 5EBVA 2YNDA 1KUVA 4OLLA 4A2ZA 2FXFA 4JJXA 2Q4YA 4MFLA 1IIDA 4MY0A 2WUUA 2B4DB 2PSWA 4QVTA 3WR7A 4C7IA 2DXQA 3R96A 3D3SA 4KUBA 4KVXA 4QUSA 4II9A 4H6UA 4IUSA 4QC6A 3SHPA 2CNMA 1VHSA 1Z9UA 4JLYA 5JPHA 4B5PA 2CNTA 1BO4A 3F5BA 4UFVA 3R9GA 5AG7A 2Z3MA 4KVOE 4MJ8A 5DWNA 4F0YA 1VKCA 3FIXA 2NMTA 3GKRA 4CAEA 2FE7A 2FIAA 5G20A 2I79A 4AB7A 1S7LA 3CXSA 3EO4A 5F46A 4HKFA 2Q7BA 1PU9A 1NE9A 4KLVA 1QSOA 4MI4A 1I21A 2G3TA 4LX9A 2WPXA 3H4QA 3W91A 5AG5A 1M4IA 2B5GA 4CGOA 4NCZA 4RI1A 3BJ7A 5H86A 4B10A 3UY5A 4MFQA 2BL1A 3TT2A 4FD5A 2ZW6A 1RXTA 2P6FA 4R3KA 2REEA 4PSXA 1YLEA 1B6BA 1U6MA 5F49A 2K5TA 1S7NA 1MJ9A 4KSAA 4A32A 3FRMA 1Q2YA 1XIXA 4A30A 3B8GA 5I0CA 1IYLA 1KUYA 1CJWA 2I00A 3TOAA 2FS5A 4R87A 4FD6A 3TOBA 5IB0A 4AVBA 2J8MA 3JVNA 4XNHC 5DWMA 3KKWA 1IICA 4B5PB 3S6KA 1YVKA 4XPKA 3IWEA 5BWAB 2REFA 5F47A 3K9UA 4Q38A 3S6HA 4UCNA 3R95A 4AG9A 4L89A 2Q4VA 2BSWA 5AG6A 4H89A 4KOTA 3DR6A 3EC4A 1XE4A 3NE7A 5GCNA 3TCVA 4CGPA 4A95A 4A33A 2PQ8A 2O28A 1MK4A 5KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOV A;  5CNP A;  3BLN A;  3FYN A;  4PSW A;  4KZT A;  1R57 A;  1I1D A;  3SXO A;  3VWE A;  2IL4 A;  3DR8 A;  1BOB A;  2ZW7 A;  3I9S A;  3FB3 A;  2Q0Y A;  5JQ4 A;  3P2H A;  4KUA A;  4Y49 C;  4ZBG A;  4CAX A;  5KTC A;  1GHE A;  2CY2 A;  2G3A A;  4U5Y A;  2HQY A;  3C26 A;  2ZW5 A;  1XF8 A;  3FNC A;  3TTH A;  2VI7 A;  5FVJ A;  3G3S A;  4L8A A;  3LD2 A;  2R8V A;  4KOW A;  1QSN A;  1KZF A;  4AG7 A;  2F5I A;  3BJ8 A;  2OZU A;  2G0B A;  3DNS A;  3ZJ0 A;  3DSB A;  4E0A A;  4M85 A;  4E8O A;  1M4D A;  1WWZ A;  1YR0 A;  3F0A A;  3IWG A;  2CNS A;  2R7H A;  2B4B A;  3FBU A;  3TE4 A;  1YGH A;  1S60 A;  2PR1 A;  1K4J A;  2J8R A;  3GYA A;  4YGO A;  2BEI A;  1S7F A;  1M44 A;  3F8K A;  4BMH A;  4PK2 A;  1MJA A;  4B5O A;  2VBQ A;  1Y9W A;  4UA3 A;  1Z4E A;  3JUW A;  2FSR A;  5IX3 A;  1S7K A;  4QBJ A;  2Z0Z A;  3D2P A;  1L0C A;  2B4D A;  4NSQ A;  2ATR A;  1PUA A;  1V0C A;  1B87 A;  4NXY A;  1KUX A;  2PC1 A;  4FD4 A;  4U9Z A;  5EC4 A;  4KLW A;  2HUZ A;  1Y9K A;  3G8W A;  1SQH A;  4QB9 A;  3VWD A;  4YFJ A;  4CRY B;  1M4G A;  1LRZ A;  1QSM A;  3OWC A;  3PZJ A;  2EUI A;  4MY3 A;  4MHD A;  2KCW A;  4X5K A;  4XPL A;  4AVC A;  2BUE A;  1YK3 A;  4RS2 A;  2GIV A;  4NF1 A;  4EVY A;  3CXP A;  1P0H A;  4PV6 A;  3V8I A;  3E0K A;  2OZH A;  2X7B A;  2JEV A;  4KOR A;  3R9F A;  3MGD A;  1M1D A;  3I3G A;  2OZG A;  1QST A;  2AE6 A;  2P6G A;  2B3U A;  4I49 A;  4ONU A;  4JWP A;  2ZXV A;  2FIW A;  2Z10 A;  3D8P A;  4M3S A;  2P0W A;  4CRZ B;  4HNW B;  3R1K A;  4KOU A;  5J8C A;  3LOD A;  2J8N A;  4F6A A;  2PR8 A;  1YX0 A;  5H84 A;  4XNH B;  2Y0M A;  2B5G B;  2VZY A;  4E2A A;  3TFY A;  4JXR A;  4KVM E;  3PP9 A;  2VQY A;  3PGP A;  1NMT A;  4YRH A;  2JDC A;  1CM0 A;  2VXK A;  4JD6 A;  1Y7R A;  2D4O A;  2H5M A;  2QEC A;  1J4J A;  5KTA A;  3EXN A;  1XEB A;  3T9Y A;  4UWJ A;  2VZZ A;  3RYO A;  1MJB A;  4IF5 A;  4ORF A;  3EY5 A;  4UWI A;  4XPD C;  1TIQ A;  2VEZ A;  2FL4 A;  2Q04 A;  1WK4 A;  3TO7 A;  4KOX A;  4GS4 A;  4H6Z A;  5E96 A;  2ARH A;  1S3Z A;  5F48 A;  2AJ6 A;  1UFH A;  2QML A;  4Y49 B;  2GAN A;  3ZZI A;  4HNY B;  1IB1 E;  2FT0 A;  4J3G A;  2FCK A;  1XMT A;  3N7Z A;  1I12 A;  1ON0 A;  2RC4 A;  3EFA A;  1YVO A;  3CXQ A;  1Q2D A;  4XPD B;  2JLM A;  2EVN A;  5ISV A;  4R57 A;  4PK3 A;  2QIR A;  4KOY A;  2OH1 A;  4FD7 A;  2R1I A;  4CS0 B;  5C88 A;  2Z11 A;  5HH1 A;  2C27 A;  1NSL A;  2D4P A;  3W6X A;  1N71 A;  5C82 A;  4OAE A;  3S6F A;  2B3V A;  4U9Y A;  3S6G A;  4CAV A;  3T90 A;  4AVA A;  3DDD A;  3QAH A;  2ZPA A;  2PRB A;  4R3L A;  1OZP A;  4R9M A;  5J8F A;  3R9E A;  3TO9 A;  1RO5 A;  1Z4R A;  4MBU A;  4DNC A;  4JXQ A;  2OU2 A;  3P2F A;  3SXN A;  1P4N A;  3FXT A;  1YRE A;  2GE3 A;  2Q44 A;  4HNX B;  2HV2 A;  2OB0 A;  3GY9 A;  2ZW4 A;  1IYK A;  2B58 A;  3W6S A;  4NEX A;  1FY7 A;  3IGR A;  1S5K A;  2WPW A;  3QB8 A;  4LUA A;  4KOS A;  3TO6 A;  4CAW A;  2JDD A;  4OAD A;  1QSR A;  1Q2C A;  2P6E A;  4K30 A;  3D2M A;  2A4N A;  2R98 A;  5IV0 A;  5HMN A;  4UBR A;  2PDO A;  5EBV A;  4OLL A;  1KUV A;  2FXF A;  4JJX A;  2Q4Y A;  1IID A;  4MY0 A;  2B4D B;  2PSW A;  4QVT A;  3WR7 A;  2DXQ A;  3R96 A;  3D3S A;  4KUB A;  4KVX A;  4QUS A;  4II9 A;  4H6U A;  4IUS A;  4QC6 A;  3SHP A;  2CNM A;  1VHS A;  1Z9U A;  4JLY A;  5JPH A;  4B5P A;  2CNT A;  1BO4 A;  3F5B A;  3R9G A;  4KVO E;  4MJ8 A;  5DWN A;  4F0Y A;  1VKC A;  3FIX A;  2NMT A;  3GKR A;  2FE7 A;  2FIA A;  2I79 A;  4AB7 A;  1S7L A;  3CXS A;  3EO4 A;  5F46 A;  4HKF A;  2Q7B A;  1PU9 A;  1NE9 A;  4KLV A;  1QSO A;  4MI4 A;  1I21 A;  2G3T A;  4LX9 A;  2WPX A;  3H4Q A;  3W91 A;  1M4I A;  2B5G A;  4NCZ A;  4RI1 A;  3BJ7 A;  5H86 A;  3UY5 A;  2BL1 A;  3TT2 A;  4FD5 A;  2ZW6 A;  1RXT A;  2P6F A;  4R3K A;  2REE A;  4PSX A;  1YLE A;  1B6B A;  1U6M A;  5F49 A;  2K5T A;  1S7N A;  1MJ9 A;  3FRM A;  1Q2Y A;  1XIX A;  5I0C A;  3B8G A;  1IYL A;  1KUY A;  1CJW A;  2I00 A;  3TOA A;  2FS5 A;  4R87 A;  4FD6 A;  3TOB A;  5IB0 A;  4AVB A;  2J8M A;  3JVN A;  4XNH C;  5DWM A;  3KKW A;  1IIC A;  4B5P B;  3S6K A;  1YVK A;  4XPK A;  2REF A;  5F47 A;  3K9U A;  3S6H A;  3R95 A;  4AG9 A;  4L89 A;  2Q4V A;  2BSW A;  4H89 A;  4KOT A;  3DR6 A;  3EC4 A;  1XE4 A;  3NE7 A;  5GCN A;  3TCV A;  2PQ8 A;  2O28 A;  1MK4 A;  5KTD A; 
#chains in the Genus database with same CATH topology
 3SJE A;  3KQZ A;  7CPA A;  3CZX A;  3JTK A;  3IU2 A;  5G21 A;  4KOV A;  5CNP A;  5LRG A;  2YNE A;  3BLN A;  3FYN A;  3IJ3 A;  4PSW A;  4KZT A;  1R57 A;  4MFJ A;  1IU8 A;  2AFZ A;  2YNC A;  3D7G A;  4NJQ A;  2PJ8 A;  1I1D A;  4C2Z A;  3JRU A;  4ONW A;  2AFO A;  3KI9 A;  3SXO A;  4MHY A;  3VWE A;  2IL4 A;  4GXH A;  2Z3P A;  3L2N A;  3DR8 A;  1BOB A;  2ZW7 A;  3I9S A;  3FB3 A;  5LYI A;  2Q0Y A;  2EK9 A;  5JQ4 A;  3CPX A;  4UCP A;  5EMI A;  3P2H A;  4KUA A;  1Y7E A;  4Y49 C;  1Z8X A;  2ZEN A;  2CIJ A;  4ZBG A;  4CAX A;  1GHE A;  4MHZ A;  5KTC A;  3SI2 A;  3K9T A;  2CY2 A;  2G3A A;  3NH5 A;  4M6H A;  4NGQ A;  3PB8 X;  1EE3 P;  4U5Y A;  2HQY A;  1BPM A;  1Q7L A;  2FVG A;  2ZW5 A;  1XF8 A;  3C26 A;  3FNC A;  3LWU A;  4A37 A;  3TTH A;  2PRQ A;  4NGP A;  2VI7 A;  5FVJ A;  2OOT A;  4CAF A;  3G3S A;  4L8A A;  2F8H A;  2PJB A;  3IWW A;  3K2K A;  4B14 A;  3FEC A;  3LD2 A;  4UCM A;  2R8V A;  4OKO A;  4P4J A;  4KOW A;  1QSN A;  4P45 A;  1KZF A;  4AG7 A;  2F5I A;  3BJ8 A;  1R3N A;  2OZU A;  4B13 A;  4NGT A;  2G0B A;  4CGN A;  3DNS A;  3ZJ0 A;  3DSB A;  2DPS A;  1YQE A;  4E0A A;  2QVP A;  4IK2 A;  4M85 A;  4E8O A;  2NSM A;  3V38 A;  1M4D A;  1WWZ A;  1YR0 A;  3F0A A;  3IWG A;  4C7H A;  2CNS A;  2YNC C;  3D7F A;  5J1Q A;  2R7H A;  1IOI A;  1YME A;  2B4B A;  3FBU A;  4DJL A;  3D66 A;  3TE4 A;  3FF3 A;  1YGH A;  1S60 A;  2PIZ A;  2PR1 A;  1K4J A;  2J8R A;  3GYA A;  5AGE A;  3GB0 A;  1CX8 A;  4YGO A;  2BEI A;  3NFZ A;  1S7F A;  2Z3O A;  4R8F A;  4C2Y A;  1YLO A;  2WSA A;  1M44 A;  3F8K A;  4BMH A;  4PK2 A;  1MJA A;  4B5O A;  4P6Y A;  2VBQ A;  3DGV A;  3HLP A;  5LYD A;  4CYO A;  2I3C A;  5F09 A;  1Y9W A;  4UA3 A;  4F9U A;  5IB9 A;  1Z4E A;  2BCO A;  1HDU A;  2ZEF A;  3JUW A;  4A39 A;  2FSR A;  2ZEM A;  5IX3 A;  1S7K A;  4KS9 A;  4MFZ A;  3KL9 A;  4QBJ A;  4CGL A;  2Z0Z A;  2Z3K A;  3D2P A;  1L0C A;  2B4D A;  4NSQ A;  5CBM A;  2AFW A;  2ATR A;  3B7I A;  1Z8W A;  1PUA A;  3CDX A;  1V0C A;  4M6G A;  1B87 A;  4NXY A;  1XOV A;  5G22 A;  2J9A A;  2QJ8 A;  4K3N A;  1KUX A;  2PC1 A;  4FD4 A;  4U9Z A;  5EC4 A;  3CPA A;  4KLW A;  2HUZ A;  1Y9K A;  3G8W A;  1DTD A;  4OID A;  2F7V A;  1ZO0 A;  2ABZ A;  1SQH A;  1OBR A;  2ZEH A;  2PJ5 A;  4QB9 A;  3FED A;  3VWD A;  2XEF A;  3NE8 A;  4CRY B;  4YFJ A;  5JM6 A;  1M4G A;  1LRZ A;  4WJB A;  1QMU A;  1LFW A;  3QNV A;  3KAS A;  2PIY A;  1QSM A;  2CTB A;  3OWC A;  3PZJ A;  2EUI A;  4FWU A;  4MHD A;  2KCW A;  4MY3 A;  4X5K A;  4XPL A;  4AVC A;  2BUE A;  3RO0 A;  5A28 A;  4MCS A;  2PVV A;  1YK3 A;  4MFP A;  4RS2 A;  2GIV A;  4NF1 A;  4PQA A;  3RAM A;  4EVY A;  3CXP A;  1P0H A;  4KSI A;  3PFE A;  1TKJ A;  4PV6 A;  3V8I A;  3E0K A;  2BOA A;  3D7D A;  2OZH A;  2X7B A;  2JEV A;  4KOR A;  1TXR A;  4OIW A;  3R9F A;  3MGD A;  1M1D A;  3I3G A;  2OZG A;  3PBB A;  1QST A;  2AE6 A;  2P6G A;  6CPA A;  2B3U A;  4JYW A;  4I49 A;  4ONU A;  2NYQ A;  4JWP A;  4MCP A;  4UFW A;  3WC6 A;  3SI0 A;  2ZEE A;  2ZXV A;  3HUV A;  4G1P A;  3D67 A;  2FIW A;  2O53 A;  2Z10 A;  2Q7S A;  3D8P A;  4RUH A;  4NFR A;  4PXB A;  4M3S A;  3S9L A;  4KSF A;  5D8N A;  3PB7 X;  4MHP A;  4MRI A;  2P0W A;  2DF5 A;  4MMO A;  4CRZ B;  3D68 A;  4HNW B;  3R1K A;  4KOU A;  5J8C A;  3LOD A;  1CPX A;  2J8N A;  4CYP A;  4F6A A;  4FBE A;  2PR8 A;  4RN7 A;  1YX0 A;  2DPT A;  2PJ9 A;  2PJC A;  3PBE A;  4P4B A;  3B2Y A;  5H84 A;  2C6P A;  2IMO A;  3IIB A;  1X10 A;  4XNH B;  2Y0M A;  2B5G B;  4EME A;  1ELM P;  1NSA A;  3NH4 A;  2VZY A;  4E2A A;  3TFY A;  4JXR A;  1XJO A;  4KVM E;  3PP9 A;  4MXU A;  2VQY A;  5K8P A;  3PGP A;  3GLJ A;  1NMT A;  1CPS A;  4YRH A;  4BIN A;  2JDC A;  1CM0 A;  4NGM A;  1LAP A;  4JZ0 A;  4OC1 A;  2VXK A;  4C2X A;  1TF9 A;  4JD6 A;  1Y7R A;  2D4O A;  2H5M A;  2QEC A;  3FMC A;  1J4J A;  2ZEL A;  4UFX A;  5KTA A;  3EXN A;  3KZW A;  1XEB A;  1ZG9 A;  1IY7 A;  4OME A;  4PXE A;  3T9Y A;  1LAN A;  4UWJ A;  1YSJ A;  1PCA A;  2VZZ A;  4UEF A;  1MJB A;  3RYO A;  3FX6 A;  4IF5 A;  2HB6 A;  3KQX A;  3BI0 A;  3EY5 A;  4ORF A;  4UWI A;  1Y0R A;  2CF4 A;  4UF4 A;  4UIA A;  2IJZ A;  1Z8L A;  1F2O A;  1TIQ A;  1TKH A;  3H8E A;  3KR4 A;  4XPD C;  2VEZ A;  3IU1 A;  2FL4 A;  2Q04 A;  1IGB A;  1JQG A;  4P10 A;  3IC1 A;  1AMP A;  2V8G A;  1WK4 A;  3TO7 A;  1IOF A;  2V8V A;  1BAV A;  3BHX A;  1A2Z A;  4KOX A;  1ARM A;  3PRT A;  4WWV A;  4Q7A A;  2PJA A;  2AFM A;  4GS4 A;  4H6Z A;  5E96 A;  3GIU A;  1ZG8 A;  2ARH A;  1S3Z A;  5F48 A;  4Z65 A;  5LYF A;  2GLJ A;  2AJ6 A;  1UFH A;  1UWY A;  2QML A;  4A38 A;  3B3W A;  2RB7 A;  4X8I A;  4Y49 B;  2GAN A;  3ZZI A;  1Z8T A;  3A9L A;  4CYN A;  4HNY B;  1IB1 E;  1VHE A;  2FT0 A;  3D4U A;  2Q51 A;  4J3G A;  2FCK A;  3NA6 A;  2PJ4 A;  1XMT A;  3N7Z A;  1I12 A;  4F9V A;  2JEW A;  1ON0 A;  2RC4 A;  3H5Z A;  3EFA A;  1YVO A;  2RFH A;  4A94 A;  3BI1 A;  3CXQ A;  1Q2D A;  3IFE A;  4XPD B;  2QYV A;  2YGW A;  4LQG A;  2JLM A;  2ODF A;  2EVN A;  4IHM A;  3WAB A;  1HEE A;  4PK3 A;  4R57 A;  5ISV A;  4OC4 A;  5LRK A;  2JBK A;  2PJ1 A;  2QIR A;  2ZED A;  4KOY A;  2OH1 A;  4FD7 A;  4PXC A;  2R1I A;  5JGF A;  3D7H A;  3MN8 A;  4CS0 B;  5A27 A;  4OC5 A;  4A31 A;  2GFQ A;  5C88 A;  2Z11 A;  4M6I A;  4NGR A;  5HH1 A;  1TF8 A;  2C27 A;  2GU2 A;  2D4P A;  1NSL A;  2ZEO A;  4ZI6 A;  3W6X A;  1N71 A;  5ELY A;  4BBH A;  4F0X A;  1BLL E;  5C82 A;  4OAE A;  3GUX A;  3S6F A;  4ZGY B;  1ARL A;  4CYQ A;  2B3V A;  4U9Y A;  3S6G A;  4CAV A;  3T90 A;  4AVA A;  3DDD A;  1VGY A;  3QAH A;  4ZY2 A;  4ZY1 A;  4OC3 A;  2ZPA A;  4C68 A;  5HXD A;  1XRY A;  2Z3N A;  3PB4 X;  5HVF A;  2AFS A;  2PRB A;  4R3L A;  1OZP A;  2WYR A;  2VL1 A;  4R9M A;  5J8F A;  3R9E A;  3TO9 A;  1RO5 A;  1Z4R A;  4MBU A;  4R6T A;  4DNC A;  4JXQ A;  4MCR A;  3NH8 A;  1VHO A;  2OU2 A;  4NGN A;  3P2F A;  2V8D A;  3LAC A;  3SXN A;  2CXA A;  2PCU A;  3RNZ A;  5I4M A;  1P4N A;  1LCP A;  4X2T A;  1Z2L A;  3FXT A;  1QQ9 A;  3N5F A;  1YRE A;  2GE3 A;  2Q44 A;  4HNX B;  4Q36 A;  4B11 A;  4TWE A;  2PE3 A;  2OR4 A;  3PEI A;  2HV2 A;  2OB0 A;  4X3R A;  3T8W A;  3GY9 A;  2ZW4 A;  1IYK A;  1CP7 A;  2B58 A;  3W6S A;  1LAM A;  4NEX A;  1R43 A;  1FY7 A;  1H8L A;  4P4E A;  4DYO A;  3IGR A;  3IEH A;  2Q4Z A;  3B35 A;  4W9Y A;  1S5K A;  2IQ6 A;  2WPW A;  4YU9 A;  3QB8 A;  3WC5 A;  4LUA A;  3PFO A;  1TKF A;  4KOS A;  3TO6 A;  5DS0 A;  4O23 A;  1YW4 A;  2JDD A;  4P4I A;  4CAW A;  4CGM A;  5CPA A;  2POK A;  4OAD A;  1QSR A;  1Q2C A;  2P6E A;  2Z3L A;  4K30 A;  3D2M A;  3FH4 A;  2ZOG A;  3PB6 X;  1ZG7 A;  2C6C A;  2EBJ A;  2A4N A;  2PJ3 A;  2ZOF A;  3KR5 A;  2R98 A;  5HVG A;  5G1Z A;  3SJG A;  1ZLH A;  2XEJ A;  4MFK A;  5IV0 A;  5HMN A;  1Z5R A;  8CPA A;  2C1C A;  4PXD A;  2PDO A;  4H2K A;  4UBR A;  4FAI A;  5AG4 A;  5EBV A;  2YND A;  1KUV A;  1AYE A;  1F2P A;  4IAV A;  4OLL A;  4A2Z A;  2FXF A;  4JJX A;  2Q4Y A;  3VAR A;  4UEE A;  4CPA A;  2CTC A;  1IID A;  1ELL P;  4MFL A;  4MY0 A;  4ZX8 A;  3KHX A;  3FVL A;  2WUU A;  2B4D B;  1AUG A;  4BD9 A;  2PSW A;  3DLJ A;  4P4D A;  4QVT A;  3WR7 A;  4C7I A;  4GM5 A;  2DXQ A;  1M4L A;  5LRJ A;  4ZY0 A;  3R96 A;  3D3S A;  4KUB A;  4KVX A;  4QUS A;  3VH9 A;  4II9 A;  3R9G A;  4H6U A;  4IUS A;  4QC6 A;  3BXM A;  3SHP A;  2CNM A;  1VHS A;  3CT9 A;  1Z9U A;  2G9D A;  4JLY A;  5JPH A;  4B5P A;  2CNT A;  1BO4 A;  3MRU A;  1GYT A;  3F5B A;  1CP6 A;  3H8G A;  2Z3M A;  4UFV A;  5AG7 A;  4ZX9 A;  1CBX A;  1RTQ A;  1XMB A;  4KVO E;  4MJ8 A;  5DWN A;  4F0Y A;  1VKC A;  3FIX A;  2NMT A;  5K8M A;  3GKR A;  4HPS A;  4CAE A;  2FE7 A;  4TNU A;  4NGS A;  2FIA A;  1HDQ A;  5G20 A;  4LQ6 A;  5LYL A;  2DEA A;  3VAT A;  2I79 A;  4AB7 A;  1S7L A;  3LMS A;  3CXS A;  3EO4 A;  5F46 A;  4HKF A;  2Q7B A;  2O4H A;  3FJU A;  1PU9 A;  1NE9 A;  3WT4 A;  4KLV A;  1QSO A;  4MI4 A;  2HC9 A;  2JBJ A;  3B3T A;  4B6Z A;  2ZEP A;  4OC0 A;  2PJ0 A;  1I21 A;  2GLF A;  2EO8 A;  3I1U A;  3ISX A;  3V7Z A;  2G3T A;  2ZEG A;  4LX9 A;  1VIX A;  2AFX A;  2WPX A;  3H4Q A;  3W91 A;  5K8O A;  5AG5 A;  5D29 A;  1M4I A;  2B5G A;  4UEZ A;  3TC8 A;  3RBU A;  4MCQ A;  4CGO A;  4F8Z A;  4NCZ A;  5JH9 A;  4RI1 A;  1CG2 A;  3BJ7 A;  5H86 A;  4B10 A;  3RZA A;  3UY5 A;  4MFQ A;  2BL1 A;  3H8F A;  3TT2 A;  4ZYQ A;  4FD5 A;  2ZW6 A;  1RXT A;  1PYT B;  1FNO A;  3TX8 A;  2P6F A;  4R3K A;  2REE A;  4NJR A;  4PSX A;  1X12 A;  1Y0Y A;  1YLE A;  1B6B A;  1U6M A;  5F49 A;  3QAY A;  4R7M A;  3S9M A;  2K5T A;  2GRE A;  3PB9 X;  1S7N A;  1MJ9 A;  3ISZ A;  4KSA A;  2WZN A;  4OP4 A;  4A32 A;  3FRM A;  3B3V A;  3KHZ A;  2EK8 A;  4P4F A;  1Q2Y A;  1XIX A;  4A30 A;  3B8G A;  5I0C A;  3FEE A;  1IYL A;  1F57 A;  1LOK A;  4P44 A;  4FUU A;  1KUY A;  3KGQ A;  4PPZ A;  1CJW A;  2I00 A;  3TOA A;  3WC7 A;  2FS5 A;  1JWQ A;  4R87 A;  4FD6 A;  5THW A;  3TOB A;  4EFD A;  1YW6 A;  5IB0 A;  3SI1 A;  2XEI A;  2J8M A;  4MHN A;  4AVB A;  1KWM A;  4R76 A;  2PJ2 A;  4UIB A;  1XBU A;  3JVN A;  4B12 A;  1BPN A;  4XNH C;  5DWM A;  3KKW A;  5HVH A;  3B3S A;  1IIC A;  4B5P B;  2V77 A;  1YVK A;  2PJ6 A;  3S6K A;  4XPK A;  2XEG A;  3IWE A;  1DE4 C;  3B3C A;  5BWA B;  2REF A;  5F47 A;  3K9U A;  2EWB A;  2V8H A;  4Q38 A;  3S6H A;  4EWT A;  4OC2 A;  2AFU A;  5K8N A;  4UCN A;  3R95 A;  4AG9 A;  4L89 A;  2Q4V A;  1FT7 A;  4DUK A;  1XFO A;  2BSW A;  5AG6 A;  4H89 A;  4YWY A;  3S9N A;  4KOT A;  3DR6 A;  2C6G A;  2PJ7 A;  2Q43 A;  3EC4 A;  3SJF A;  1XE4 A;  1ZLI A;  3NE7 A;  5GCN A;  3TCV A;  4CGP A;  2PVW A;  4A95 A;  4AXV A;  4A33 A;  2PQ8 A;  2BO9 A;  3SJX A;  2O28 A;  3IO1 A;  1MK4 A;  5KTD A;  2ANP A; 
#chains in the Genus database with same CATH homology
 3JTK A;  3IU2 A;  5G21 A;  4KOV A;  5CNP A;  2YNE A;  3BLN A;  3FYN A;  4PSW A;  4KZT A;  1R57 A;  4MFJ A;  2YNC A;  4C2Z A;  1I1D A;  3SXO A;  3VWE A;  2IL4 A;  2Z3P A;  3DR8 A;  1BOB A;  2ZW7 A;  3I9S A;  3FB3 A;  2Q0Y A;  5JQ4 A;  4UCP A;  3P2H A;  4KUA A;  4Y49 C;  4ZBG A;  4CAX A;  5KTC A;  1GHE A;  2CY2 A;  2G3A A;  4U5Y A;  2HQY A;  3C26 A;  2ZW5 A;  1XF8 A;  3FNC A;  3TTH A;  2VI7 A;  5FVJ A;  4CAF A;  3G3S A;  4L8A A;  4B14 A;  3LD2 A;  4UCM A;  2R8V A;  4KOW A;  1QSN A;  1KZF A;  4AG7 A;  2F5I A;  3BJ8 A;  2OZU A;  4B13 A;  2G0B A;  4CGN A;  3DNS A;  3ZJ0 A;  3DSB A;  2DPS A;  4E0A A;  4M85 A;  4E8O A;  1M4D A;  1WWZ A;  1YR0 A;  3F0A A;  3IWG A;  4C7H A;  2CNS A;  2YNC C;  2R7H A;  2B4B A;  3FBU A;  3TE4 A;  1YGH A;  1S60 A;  2PR1 A;  1K4J A;  2J8R A;  3GYA A;  5AGE A;  4YGO A;  2BEI A;  1S7F A;  2Z3O A;  4C2Y A;  2WSA A;  1M44 A;  3F8K A;  4BMH A;  4PK2 A;  1MJA A;  4B5O A;  2VBQ A;  4CYO A;  1Y9W A;  4UA3 A;  1Z4E A;  3JUW A;  2FSR A;  5IX3 A;  1S7K A;  4KS9 A;  4MFZ A;  4QBJ A;  4CGL A;  2Z0Z A;  2Z3K A;  3D2P A;  1L0C A;  2B4D A;  4NSQ A;  2ATR A;  1PUA A;  1V0C A;  1B87 A;  4NXY A;  5G22 A;  1KUX A;  2PC1 A;  4FD4 A;  4U9Z A;  5EC4 A;  4KLW A;  2HUZ A;  1Y9K A;  3G8W A;  1ZO0 A;  1SQH A;  4QB9 A;  3VWD A;  4YFJ A;  4CRY B;  1M4G A;  1LRZ A;  1QSM A;  3OWC A;  3PZJ A;  2EUI A;  4MY3 A;  4MHD A;  2KCW A;  4X5K A;  4XPL A;  4AVC A;  2BUE A;  5A28 A;  1YK3 A;  4MFP A;  4RS2 A;  2GIV A;  4NF1 A;  4EVY A;  3CXP A;  1P0H A;  4PV6 A;  3V8I A;  3E0K A;  2OZH A;  2X7B A;  2JEV A;  4KOR A;  3R9F A;  3MGD A;  1M1D A;  3I3G A;  2OZG A;  1QST A;  2AE6 A;  2P6G A;  2B3U A;  4I49 A;  4ONU A;  4JWP A;  4UFW A;  2ZXV A;  2FIW A;  2Z10 A;  3D8P A;  4M3S A;  4KSF A;  2P0W A;  4CRZ B;  4HNW B;  3R1K A;  4KOU A;  5J8C A;  3LOD A;  2J8N A;  4CYP A;  4F6A A;  2PR8 A;  1YX0 A;  2DPT A;  5H84 A;  4XNH B;  2Y0M A;  2B5G B;  2VZY A;  4E2A A;  3TFY A;  4JXR A;  4KVM E;  3PP9 A;  2VQY A;  3PGP A;  1NMT A;  4YRH A;  2JDC A;  1CM0 A;  4C2X A;  2VXK A;  4JD6 A;  1Y7R A;  2D4O A;  2H5M A;  2QEC A;  4UFX A;  1J4J A;  5KTA A;  3EXN A;  1XEB A;  3T9Y A;  4UWJ A;  2VZZ A;  3RYO A;  1MJB A;  4B12 A;  4IF5 A;  4ORF A;  3EY5 A;  4UWI A;  4XPD C;  1TIQ A;  2VEZ A;  3IU1 A;  2FL4 A;  2Q04 A;  1WK4 A;  3TO7 A;  4KOX A;  4GS4 A;  4H6Z A;  5E96 A;  2ARH A;  1S3Z A;  5F48 A;  2AJ6 A;  1UFH A;  2QML A;  4Y49 B;  2GAN A;  3ZZI A;  3A9L A;  4CYN A;  4HNY B;  1IB1 E;  2FT0 A;  4J3G A;  2FCK A;  1XMT A;  3N7Z A;  1I12 A;  1ON0 A;  2RC4 A;  3H5Z A;  3EFA A;  1YVO A;  3CXQ A;  1Q2D A;  4XPD B;  2YGW A;  2JLM A;  2EVN A;  5ISV A;  4R57 A;  4PK3 A;  2QIR A;  4KOY A;  2OH1 A;  4FD7 A;  2R1I A;  4CS0 B;  5A27 A;  4A31 A;  5C88 A;  2Z11 A;  5HH1 A;  2C27 A;  1NSL A;  2D4P A;  3W6X A;  1N71 A;  4BBH A;  4F0X A;  5C82 A;  4OAE A;  4ZGY B;  3S6F A;  4CYQ A;  2B3V A;  4U9Y A;  3S6G A;  4CAV A;  3T90 A;  4AVA A;  3DDD A;  3QAH A;  2ZPA A;  4C68 A;  2Z3N A;  2PRB A;  4R3L A;  1OZP A;  4R9M A;  5J8F A;  3R9E A;  3TO9 A;  1RO5 A;  1Z4R A;  4MBU A;  4DNC A;  4JXQ A;  2OU2 A;  3P2F A;  3SXN A;  2CXA A;  1P4N A;  3FXT A;  1YRE A;  2GE3 A;  2Q44 A;  4HNX B;  4Q36 A;  4B11 A;  2HV2 A;  2OB0 A;  3GY9 A;  2ZW4 A;  1IYK A;  2B58 A;  3W6S A;  4NEX A;  1FY7 A;  3IGR A;  1S5K A;  2WPW A;  3QB8 A;  4LUA A;  4KOS A;  3TO6 A;  4CAW A;  2JDD A;  4CGM A;  4OAD A;  1QSR A;  1Q2C A;  2P6E A;  2Z3L A;  4K30 A;  3D2M A;  2A4N A;  2R98 A;  5G1Z A;  4MFK A;  5IV0 A;  5HMN A;  4UBR A;  2PDO A;  5AG4 A;  5EBV A;  2YND A;  1KUV A;  4OLL A;  4A2Z A;  2FXF A;  4JJX A;  2Q4Y A;  4MFL A;  1IID A;  4MY0 A;  2WUU A;  2B4D B;  2PSW A;  4QVT A;  3WR7 A;  4C7I A;  2DXQ A;  3R96 A;  3D3S A;  4KUB A;  4KVX A;  4QUS A;  4II9 A;  4H6U A;  4IUS A;  4QC6 A;  3SHP A;  2CNM A;  1VHS A;  1Z9U A;  4JLY A;  5JPH A;  4B5P A;  2CNT A;  1BO4 A;  3F5B A;  4UFV A;  3R9G A;  5AG7 A;  2Z3M A;  4KVO E;  4MJ8 A;  5DWN A;  4F0Y A;  1VKC A;  3FIX A;  2NMT A;  3GKR A;  4CAE A;  2FE7 A;  2FIA A;  5G20 A;  2I79 A;  4AB7 A;  1S7L A;  3CXS A;  3EO4 A;  5F46 A;  4HKF A;  2Q7B A;  1PU9 A;  1NE9 A;  4KLV A;  1QSO A;  4MI4 A;  1I21 A;  2G3T A;  4LX9 A;  2WPX A;  3H4Q A;  3W91 A;  5AG5 A;  1M4I A;  2B5G A;  4CGO A;  4NCZ A;  4RI1 A;  3BJ7 A;  5H86 A;  4B10 A;  3UY5 A;  4MFQ A;  2BL1 A;  3TT2 A;  4FD5 A;  2ZW6 A;  1RXT A;  2P6F A;  4R3K A;  2REE A;  4PSX A;  1YLE A;  1B6B A;  1U6M A;  5F49 A;  2K5T A;  1S7N A;  1MJ9 A;  4KSA A;  4A32 A;  3FRM A;  1Q2Y A;  1XIX A;  4A30 A;  3B8G A;  5I0C A;  1IYL A;  1KUY A;  1CJW A;  2I00 A;  3TOA A;  2FS5 A;  4R87 A;  4FD6 A;  3TOB A;  5IB0 A;  4AVB A;  2J8M A;  3JVN A;  4XNH C;  5DWM A;  3KKW A;  1IIC A;  4B5P B;  3S6K A;  1YVK A;  4XPK A;  3IWE A;  5BWA B;  2REF A;  5F47 A;  3K9U A;  4Q38 A;  3S6H A;  4UCN A;  3R95 A;  4AG9 A;  4L89 A;  2Q4V A;  2BSW A;  5AG6 A;  4H89 A;  4KOT A;  3DR6 A;  3EC4 A;  1XE4 A;  3NE7 A;  5GCN A;  3TCV A;  4CGP A;  4A95 A;  4A33 A;  2PQ8 A;  2O28 A;  1MK4 A;  5KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...