2Q7BA

Crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
164
structure length
164
Chain Sequence
FQGMEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKMAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVLKKFFTYPKYRGNPVRLGRKLFERFMLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetyltransferase (NP_689019.1) from Streptococcus agalactiae 2603 at 2.00 A resolution
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transferase
molecule keywords Acetyltransferase, GNAT family
total genus 54
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q7bA00
4HNYB 1P0HA 5IX3A 2JDDA 3DDDA 4Y49C 3W91A 5FVJA 5E96A 3NE7A 2JEVA 2AJ6A 4GS4A 1IYKA 4MBUA 4FD7A 5EBVA 2Q04A 1I12A 3PGPA 2Q4VA 3R9FA 5I0CA 4JD6A 1SQHA 2R7HA 4R57A 3G3SA 1Z9UA 2R8VA 2C27A 2J8RA 3R96A 3TE4A 1KZFA 3QAHA 1BO4A 4KOUA 2FT0A 4U9ZA 1S7FA 4JJXA 2HQYA 3QB8A 1KUXA 1P4NA 3PZJA 3H4QA 4UBRA 1IIDA 1Z4RA 4KVXA 2OZHA 2FSRA 3F5BA 3TO9A 1WWZA 4AG7A 1KUVA 3VWDA 1Q2CA 4AB7A 1IICA 4KOVA 4OAEA 4CS0B 4KLWA 4E8OA 1K4JA 2VZZA 3S6HA 4KOWA 3BJ7A 1V0CA 1S5KA 3IGRA 3K9UA 1Y7RA 4JLYA 4KOXA 3TCVA 3EY5A 4XNHB 3TO6A 5EC4A 1QSMA 1YLEA 2CNSA 3R9EA 2B4DB 1PUAA 2VQYA 2GANA 2F5IA 1FY7A 2J8MA 3FB3A 1ON0A 2OU2A 4YGOA 3D2PA 5F48A 4B5PB 2VEZA 4KUBA 3IWGA 4ZBGA 5KTCA 1YGHA 4UWJA 3FXTA 1M4GA 3TFYA 3V8IA 4HNWB 4MY3A 1Y9WA 1I1DA 2BUEA 4YFJA 1YK3A 3GY9A 4KLVA 4DNCA 2OH1A 1TIQA 1MJBA 3D3SA 1GHEA 1LRZA 5KTDA 3FRMA 1YREA 2QIRA 3BLNA 2BEIA 4M85A 4MY0A 4FD4A 4XPDC 1CJWA 2D4OA 2GE3A 2P6GA 3DR8A 2HUZA 2FIWA 3E0KA 4AVBA 3R1KA 1PU9A 3LD2A 2VZYA 2BL1A 1L0CA 3BJ8A 5GCNA 4QBJA 4UA3A 4X5KA 3W6XA 4NCZA 4Y49B 2H5MA 2B3VA 2WPXA 3TTHA 1S7KA 3PP9A 3S6FA 3JVNA 4II9A 3TT2A 1RO5A 2JDCA 3DR6A 3EO4A 2PDOA 3P2FA 4B5PA 2AE6A 1QSOA 4K30A 4PK2A 2QECA 3W6SA 3TOBA 3SXOA 4ORFA 4F0YA 2FCKA 2P0WA 1J4JA 2ATRA 1IB1E 2Q0YA 4NEXA 3T90A 3EC4A 2B5GB 3G8WA 4XPKA 4PV6A 2OB0A 2K5TA 5HMNA 3D2MA 2OZUA 3R9GA 4CAXA 1MJAA 4LUAA 5F47A 5F49A 4UWIA 2FIAA 1OZPA 4AVAA 2Z11A 1NSLA 4J3GA 1B6BA 1N71A 5JQ4A 3KKWA 2Y0MA 2NMTA 1XMTA 3DNSA 1YX0A 2FS5A 2PQ8A 3FIXA 3UY5A 1R57A 4R3LA 3SXNA 2R98A 3EXNA 1IYLA 2Q4YA 3D8PA 2CY2A 1MJ9A 4CRYB 2B3UA 2G0BA 2G3TA 4AG9A 4JWPA 4NF1A 2FE7A 4CAVA 4IUSA 5H86A 1VHSA 1Q2YA 4IF5A 4MI4A 4YRHA 2O28A 2Z10A 4AVCA 3CXQA 2J8NA 3JUWA 4M3SA 3C26A 4B5OA 3I3GA 4KOYA 1M4DA 1VKCA 4KVME 1QSRA 4E0AA 2WPWA 1XEBA 4R87A 4XNHC 1YR0A 4KUAA 3GYAA 1YVKA 4OLLA 4NXYA 5J8FA 2IL4A 2GIVA 1QSTA 3WR7A 3TOAA 3DSBA 4JXQA 4FD6A 2DXQA 3S6KA 2B58A 3ZJ0A 4QVTA 1XIXA 4U5YA 3OWCA 3B8GA 1I21A 3N7ZA 3S6GA 5IB0A 3I9SA 1M1DA 5F46A 2ZW6A 4L89A 1XF8A 4LX9A 2Q44A 2R1IA 1S3ZA 1KUYA 2QMLA 3SHPA 5C82A 2I79A 3EFAA 2OZGA 4R9MA 2ZW7A 2ARHA 3FBUA 2PRBA 3CXPA 4OADA 2FXFA 3LODA 4PK3A 4XPLA 4QB9A 1NE9A 4L8AA 1RXTA 2B4DA 1XE4A 4MJ8A 5CNPA 2EUIA 4XPDB 1B87A 3FYNA 3FNCA 4ONUA 4QC6A 4HKFA 2P6EA 2G3AA 2VI7A 4QUSA 2ZW4A 1Z4EA 4KVOE 3F0AA 2PSWA 1NMTA 4HNXB 4KOSA 4H6ZA 2A4NA 1S60A 5C88A 2Q7BA 2I00A 3TO7A 3T9YA 2REEA 4EVYA 2B4BA 2PR8A 4E2AA 4H6UA 2ZXVA 4KZTA 4MHDA 1UFHA 2FL4A 1QSNA 1CM0A 3CXSA 3ZZIA 4CAWA 5HH1A 2ZW5A 4RS2A 1S7LA 2KCWA 4RI1A 4F6AA 4H89A 3RYOA 2X7BA 4BMHA 4JXRA 2B5GA 1S7NA 2PC1A 2ZPAA 2Z0ZA 1BOBA 5H84A 1Y9KA 4I49A 3VWEA 4R3KA 2VBQA 1YVOA 2JLMA 2P6FA 4CRZB 2RC4A 4U9YA 2D4PA 5IV0A 1M44A 2HV2A 3P2HA 2CNMA 1M4IA 5ISVA 2EVNA 2REFA 1U6MA 4NSQA 5DWMA 4PSWA 1MK4A 3F8KA 1WK4A 3GKRA 2PR1A 3MGDA 2BSWA 4FD5A 4PSXA 4KOTA 5KTAA 1Q2DA 2VXKA 4KORA 3R95A 5J8CA 5JPHA 2CNTA 5DWNA
chains in the Genus database with same CATH superfamily
4A95A 4HNYB 3VARA 1P0HA 4TNUA 5IX3A 2PCUA 2PJ4A 2JDDA 3DDDA 4Y49C 2CTBA 2ZEHA 3W91A 5FVJA 3ISXA 2ZEEA 5E96A 5K8MA 2WUUA 3QAYA 2PJ5A 3NE7A 2JEVA 2AJ6A 1XJOA 4GM5A 4MHPA 5AG5A 4GS4A 1IYKA 4MBUA 2C6PA 4FD7A 1Z5RA 1DE4C 5EBVA 2Q04A 2ZEGA 4NJRA 1I12A 1R3NA 3PGPA 2Q4VA 3R9FA 5I0CA 4JD6A 1SQHA 3NA6A 2R7HA 4LQGA 4R57A 3G3SA 4EMEA 1Z9UA 2R8VA 2PIZA 2OOTA 2C27A 1FT7A 2J8RA 3RO0A 4AXVA 3R96A 1YLOA 4X3RA 5JM6A 3TE4A 1KZFA 1ZLHA 1F2PA 1BO4A 1XMBA 3QAHA 4CYNA 2PJCA 2O4HA 2V8GA 3FVLA 4ONWA 4KSAA 4KOUA 2FT0A 3B7IA 4MMOA 1XBUA 4MCRA 4U9ZA 1S7FA 4JJXA 2AFXA 2HQYA 1BPMA 2PIYA 4NGMA 3QB8A 5CPAA 1KUXA 1P4NA 1XOVA 2V8DA 3PZJA 4TWEA 2XEFA 4P10A 3PEIA 1JWQA 3H4QA 4FWUA 2QJ8A 4JZ0A 4UBRA 4MFJA 5AG4A 3PBBA 4MFLA 1IIDA 1Z4RA 4KVXA 1A2ZA 4FAIA 2YNDA 2OZHA 2FSRA 3F5BA 4Q36A 3TO9A 3DGVA 1WWZA 3RZAA 4IHMA 4AG7A 1KUVA 3B3VA 4OKOA 3B3WA 3VWDA 1Q2CA 4AB7A 2GLFA 3KR4A 4PQAA 2ZEOA 1IICA 3QNVA 1IY7A 4KOVA 4OAEA 2PJ2A 4CS0B 5BWAB 4KLWA 2V8HA 4E8OA 1AUGA 1ARMA 3IO1A 5HVFA 1K4JA 2BO9A 3SJXA 4C2YA 2VZZA 1IGBA 3S6HA 3JTKA 1Y0RA 4MCPA 4KOWA 3MN8A 2PJ6A 3BJ7A 2POKA 1V0CA 1S5KA 3IGRA 1ZG9A 1Y7RA 1M4LA 3K9UA 4JLYA 4KOXA 2WZNA 3JRUA 3TCVA 3EY5A 4UFVA 3WT4A 4ZI6A 4XNHB 2O53A 3TO6A 1TKFA 5EC4A 1QSMA 1YLEA 4CYPA 2CNSA 1IOFA 3WC5A 1HDUA 2WSAA 1NSAA 3R9EA 5AG7A 2PJ3A 3FMCA 1TXRA 2B4DB 1PUAA 2VQYA 2ZELA 3KASA 2GANA 4Q7AA 2F5IA 5J1QA 4CAFA 2YNCC 1FY7A 1F57A 4DUKA 2J8MA 1ZG7A 3FB3A 1ON0A 2OU2A 4YGOA 3D2PA 5F48A 4B5PB 2VEZA 3B3SA 4KUBA 3IWGA 4MFZA 1FNOA 4ZBGA 5KTCA 1YGHA 4UWJA 3KL9A 3FXTA 3KHZA 1CG2A 2JEWA 2OR4A 1M4GA 2HB6A 3TFYA 3V8IA 4HNWB 4MY3A 1Y9WA 1I1DA 2JBKA 5AGEA 1LOKA 2PVVA 4C2ZA 2BUEA 4KS9A 1CP6A 5ELYA 4YFJA 1YW4A 1YK3A 5I4MA 3GY9A 3FECA 4KLVA 4P4FA 1Z2LA 2C6CA 2OH1A 1IU8A 4M6IA 4DNCA 5F09A 4IAVA 3DLJA 4F8ZA 1TIQA 1MJBA 4P4EA 3D3SA 1GHEA 3SI1A 3SJGA 4A39A 4CGNA 1LRZA 5LYIA 5KTDA 1Q7LA 3PBEA 4P44A 3B2YA 4UEEA 4BD9A 1PCAA 3FRMA 1YREA 2QIRA 2RB7A 2RFHA 3BLNA 2PJBA 4NGPA 2QYVA 2AFMA 2PJ9A 2BEIA 4M85A 4MY0A 4NGTA 3PB8X 4FD4A 2NYQA 4YU9A 1XFOA 4XPDC 4ZX8A 1CJWA 2D4OA 2GE3A 4HPSA 4A94A 1Z8XA 3T8WA 4F9UA 2P6GA 3DR8A 2HUZA 3V38A 2FIWA 3NH8A 2Z3KA 4B13A 3KQXA 3E0KA 4UEZA 4W9YA 4AVBA 4GXHA 3R1KA 1PU9A 3LD2A 3V7ZA 1ZLIA 2VZYA 2BL1A 1L0CA 4C7HA 4MHYA 3BJ8A 4MCSA 5GCNA 4OC0A 4CGOA 4QBJA 4UA3A 2Z3OA 3GIUA 4X5KA 3W6XA 4NCZA 3D7FA 4Y49B 2EO8A 3S9MA 2H5MA 3H5ZA 2B3VA 3B35A 2Z3LA 3HUVA 2GLJA 4IK2A 1VHEA 2GFQA 2WPXA 4EFDA 3TC8A 3FEDA 2Q4ZA 3TTHA 3PB4X 4WJBA 1S7KA 1HEEA 4A30A 2ZOGA 2NSMA 3PP9A 2ZENA 3JVNA 3S6FA 4C68A 4OC4A 4II9A 3TT2A 1F2OA 1RO5A 4CYQA 2JDCA 2C1CA 4UFWA 5LRGA 2XEJA 4UCPA 1ARLA 3DR6A 3EO4A 2PDOA 3IU2A 2QVPA 3CT9A 3P2FA 4B5PA 2ANPA 2EK9A 2AE6A 2AFSA 1QSOA 4B6ZA 3PRTA 4K30A 4PK2A 2QECA 5LRKA 4P6YA 3W6SA 5K8OA 3TOBA 3SXOA 4MFKA 4ORFA 4O23A 1YSJA 2BOAA 3K9TA 4F0YA 2FCKA 1BPNA 5G22A 3LWUA 4PXCA 2P0WA 1J4JA 2ATRA 2Q0YA 1IB1E 4OC3A 4NEXA 3FF3A 3T90A 1KWMA 2HC9A 3L2NA 2F7VA 3EC4A 5LYLA 2B5GB 5AG6A 1H8LA 3G8WA 4XPKA 4EWTA 3IJ3A 1LANA 4OC5A 4UCMA 1Y0YA 2AFZA 2DPTA 4PV6A 2OB0A 2K5TA 3PB6X 5HMNA 2DEAA 2IMOA 4MRIA 3D2MA 4X2TA 2OZUA 2XEGA 4OIWA 4OP4A 3R9GA 3A9LA 3S9NA 4CAXA 4ZYQA 1MJAA 1R43A 4C2XA 4LUAA 5F47A 1TKHA 3FJUA 3HLPA 4PXBA 5F49A 1CX8A 4UWIA 2FIAA 5G21A 4F9VA 1OZPA 4P4DA 4B11A 4K3NA 4AVAA 3IWWA 2Z11A 3PFOA 2PE3A 1NSLA 4J3GA 1B6BA 1N71A 4UCNA 5JQ4A 3KKWA 1LAPA 2Y0MA 2NMTA 5DS0A 2G9DA 1XMTA 3DNSA 2ZEDA 1Z8TA 3N5FA 1YX0A 1VGYA 2FS5A 2PQ8A 3FIXA 3UY5A 2ODFA 1R57A 4PPZA 4B12A 4R3LA 3SXNA 2R98A 4CYOA 5HVHA 4F0XA 3EXNA 2V8VA 5K8NA 1IYLA 4OIDA 2IJZA 1CPXA 2Q4YA 3D8PA 2CY2A 1MJ9A 2FVGA 1RTQA 4MXUA 4CRYB 3PB7X 2B3UA 2G0BA 2G3TA 4ZY2A 4A2ZA 4AG9A 4JWPA 4NF1A 1ZG8A 2FE7A 5G20A 4CAVA 2CF4A 4IUSA 1IOIA 5H86A 1VHSA 1Q2YA 4IF5A 4MI4A 4YRHA 2O28A 3KR5A 2F8HA 2Z10A 3NE8A 3CXQA 4AVCA 4G1PA 1TF8A 2J8NA 1DTDA 3JUWA 3B3TA 4M3SA 3C26A 2EBJA 5LYDA 3I3GA 4B5OA 4KOYA 1M4DA 1VKCA 4KVME 4M6GA 4P45A 2Z3PA 1QSRA 3S9LA 4E0AA 2WPWA 1XEBA 4R87A 3D66A 2Q7SA 4XNHC 1YR0A 4KUAA 3SI2A 3GYAA 1YVKA 3D67A 4OLLA 4NXYA 2PJ8A 5J8FA 2IL4A 2GIVA 1LAMA 1QSTA 3WR7A 4NFRA 3CPAA 4R6TA 2GREA 4NGQA 3TOAA 3DSBA 3D68A 4JXQA 4FD6A 2PJAA 2DXQA 4UFXA 2JBJA 2Z3NA 3S6KA 4KSFA 2B58A 4M6HA 3ZJ0A 3K2KA 4A31A 4QVTA 1XIXA 4U5YA 4RUHA 4MCQA 3OWCA 1X10A 3B8GA 1I21A 3N7ZA 3CZXA 4PXDA 3KI9A 3S6GA 4BBHA 3I9SA 5IB0A 5J8CA 1M1DA 2PJ7A 1BLLE 3IC1A 3KZWA 2AFUA 3VH9A 2BCOA 4B10A 2Z3MA 4MFQA 2Q43A 5F46A 1HDQA 3IFEA 4H2KA 1LCPA 2ZW6A 1AYEA 4L89A 4A32A 4CPAA 1XF8A 3KGQA 4P4IA 4LX9A 5G1ZA 4MHZA 2Q44A 2YNCA 3FX6A 2R1IA 2J9AA 1CBXA 1S3ZA 2EWBA 4P4BA 4CAEA 7CPAA 1TKJA 3ISZA 3SJFA 1KUYA 2QMLA 3SHPA 5C82A 3WABA 3D7GA 4LQ6A 5JH9A 3PFEA 2AFOA 3BXMA 5JGFA 2PVWA 2CIJA 4KSIA 2I79A 2CXAA 3EFAA 2OZGA 3H8FA 4R9MA 1EE3P 2ARHA 2ZW7A 5A28A 3FBUA 3TX8A 1PYTB 2PRBA 3CXPA 3BI1A 1AMPA 4OADA 2FXFA 2VL1A 3BI0A 3LODA 3D4UA 3KHXA 4PK3A 4XPLA 4QB9A 2YGWA 1ZO0A 1NE9A 3MRUA 4L8AA 2ZEPA 1OBRA 5D8NA 5LRJA 1RXTA 2B4DA 3FEEA 1XE4A 4MJ8A 4NGNA 2XEIA 3NH5A 2PJ1A 5CNPA 2PJ0A 1YW6A 2EUIA 2Q51A 4XPDB 1B87A 3FYNA 3FNCA 4JYWA 4ONUA 4QC6A 5HXDA 2CTCA 3B3CA 4HKFA 2P6EA 2G3AA 2VI7A 1Y7EA 4MFPA 4QUSA 4A33A 4B14A 2ZW4A 4C7IA 1Z4EA 3RAMA 4KVOE 3F0AA 4X8IA 2PSWA 1NMTA 2YNEA 3D7DA 4YWYA 3IU1A 3SI0A 5A27A 4HNXB 2GU2A 4ZY0A 4CGPA 4BINA 4KOSA 5CBMA 4H6ZA 2A4NA 4OC1A 1S60A 4P4JA 4A37A 5C88A 3RNZA 4ZGYB 2Q7BA 2I00A 3TO7A 3T9YA 4FUUA 2REEA 1GYTA 3BHXA 4EVYA 3LMSA 2B4BA 2PR8A 4E2AA 1ELLP 4H6UA 3WC6A 4NGRA 2ZXVA 4KZTA 4MHDA 8CPAA 1UFHA 3GUXA 3IWEA 2V77A 1BAVA 2FL4A 4UF4A 3CPXA 3H8EA 4OC2A 1QSNA 1CM0A 4CGLA 1CPSA 3CXSA 4WWVA 3ZZIA 4DYOA 4CAWA 5HH1A 3RBUA 2ZW5A 3NFZA 4RS2A 3FH4A 3LACA 1UWYA 1S7LA 2KCWA 4RI1A 4Z65A 3D7HA 4F6AA 3H8GA 4H89A 3RYOA 2X7BA 4A38A 5LYFA 4OMEA 4JXRA 4BMHA 2B5GA 5HVGA 5EMIA 3PB9X 4Q38A 1S7NA 1QQ9A 2PC1A 2ZEFA 2ZPAA 2Z0ZA 4R7MA 1X12A 1BOBA 5D29A 1Z8WA 5H84A 3CDXA 1Y9KA 4I49A 3GB0A 3WC7A 1VHOA 4R3KA 3VWEA 5K8PA 2AFWA 4UIAA 2VBQA 2WYRA 4NJQA 2C6GA 1YVOA 2JLMA 2P6FA 4CRZB 4FBEA 4ZX9A 2RC4A 4U9YA 2D4PA 3SJEA 5IV0A 1M44A 2IQ6A 4UIBA 2HV2A 3P2HA 2EK8A 3NH4A 3IIBA 2I3CA 4RN7A 2PRQA 2CNMA 4UEFA 1M4IA 5ISVA 1YQEA 1XRYA 1JQGA 1CP7A 2EVNA 2DF5A 3I1UA 2REFA 1U6MA 3KQZA 4NSQA 4PXEA 4R8FA 5THWA 5DWMA 1LFWA 4PSWA 1VIXA 1MK4A 2ABZA 1QMUA 1WK4A 3F8KA 3GKRA 2PR1A 4DJLA 3MGDA 2BSWA 3GLJA 1TF9A 4CGMA 2ZEMA 1YMEA 1Z8LA 4FD5A 4PSXA 3VATA 4KOTA 5IB9A 2ZOFA 4R76A 5KTAA 1Q2DA 1ELMP 2VXKA 4KORA 3R95A 2DPSA 4MHNA 4ZY1A 2CNTA 6CPAA 4NGSA 5JPHA 5DWNA 3IEHA
chains in the Genus database with same CATH topology
4A95A 4HNYB 1P0HA 5IX3A 2JDDA 3DDDA 4Y49C 3W91A 5FVJA 5E96A 2WUUA 3NE7A 2JEVA 2AJ6A 5AG5A 4GS4A 1IYKA 4MBUA 4FD7A 5EBVA 2Q04A 1I12A 3PGPA 2Q4VA 3R9FA 5I0CA 4JD6A 1SQHA 2R7HA 4R57A 3G3SA 1Z9UA 2R8VA 2C27A 2J8RA 3R96A 3TE4A 1KZFA 3QAHA 1BO4A 4CYNA 4KSAA 4KOUA 2FT0A 4U9ZA 1S7FA 4JJXA 2HQYA 3QB8A 1KUXA 1P4NA 3PZJA 3H4QA 4UBRA 4MFJA 5AG4A 4MFLA 1IIDA 1Z4RA 4KVXA 2YNDA 2OZHA 2FSRA 3F5BA 4Q36A 3TO9A 1WWZA 4AG7A 1KUVA 3VWDA 1Q2CA 4AB7A 1IICA 5BWAB 4KOVA 4OAEA 4CS0B 4KLWA 4E8OA 1K4JA 4C2YA 2VZZA 3S6HA 3JTKA 4KOWA 3BJ7A 1V0CA 1S5KA 3IGRA 3K9UA 1Y7RA 4JLYA 4KOXA 3TCVA 3EY5A 4UFVA 4XNHB 3TO6A 5EC4A 4CYPA 1QSMA 1YLEA 2CNSA 2WSAA 3R9EA 5AG7A 2B4DB 1PUAA 2VQYA 2GANA 2F5IA 4CAFA 2YNCC 1FY7A 2J8MA 3FB3A 1ON0A 2OU2A 4YGOA 3D2PA 5F48A 4B5PB 2VEZA 4KUBA 3IWGA 4MFZA 4ZBGA 5KTCA 1YGHA 4UWJA 3FXTA 1M4GA 3TFYA 3V8IA 4HNWB 4MY3A 1Y9WA 1I1DA 5AGEA 4C2ZA 2BUEA 4KS9A 4YFJA 1YK3A 3GY9A 4KLVA 4DNCA 2OH1A 1TIQA 1MJBA 4CGNA 3D3SA 1GHEA 1LRZA 5KTDA 3FRMA 1YREA 2QIRA 3BLNA 2BEIA 4M85A 4MY0A 4FD4A 4XPDC 1CJWA 2D4OA 2GE3A 2P6GA 3DR8A 2HUZA 2FIWA 2Z3KA 4B13A 3E0KA 4AVBA 3R1KA 1PU9A 3LD2A 2VZYA 2BL1A 1L0CA 4C7HA 3BJ8A 5GCNA 4CGOA 4QBJA 4UA3A 2Z3OA 4X5KA 3W6XA 4NCZA 4Y49B 2H5MA 3H5ZA 2B3VA 2Z3LA 2WPXA 3TTHA 1S7KA 4A30A 3PP9A 3S6FA 3JVNA 4C68A 4II9A 3TT2A 1RO5A 4CYQA 2JDCA 4UFWA 4UCPA 3DR6A 3EO4A 2PDOA 3IU2A 3P2FA 4B5PA 2AE6A 1QSOA 4K30A 4PK2A 2QECA 3W6SA 3TOBA 3SXOA 4MFKA 4ORFA 4F0YA 2FCKA 5G22A 2P0WA 1J4JA 2ATRA 1IB1E 2Q0YA 4NEXA 3T90A 3EC4A 2B5GB 5AG6A 3G8WA 4XPKA 4UCMA 2DPTA 4PV6A 2OB0A 2K5TA 5HMNA 3D2MA 2OZUA 3R9GA 3A9LA 4CAXA 1MJAA 4C2XA 4LUAA 5F47A 5F49A 4UWIA 2FIAA 5G21A 1OZPA 4B11A 4AVAA 2Z11A 1NSLA 4J3GA 1B6BA 1N71A 4UCNA 5JQ4A 3KKWA 2Y0MA 2NMTA 1XMTA 3DNSA 1YX0A 2FS5A 2PQ8A 3FIXA 3UY5A 1R57A 4B12A 4R3LA 3SXNA 2R98A 4CYOA 4F0XA 3EXNA 1IYLA 2Q4YA 3D8PA 2CY2A 1MJ9A 4CRYB 2B3UA 2G0BA 2G3TA 4AG9A 4A2ZA 4JWPA 4NF1A 2FE7A 5G20A 4CAVA 4IUSA 5H86A 1VHSA 1Q2YA 4IF5A 4MI4A 4YRHA 2O28A 2Z10A 4AVCA 3CXQA 2J8NA 3JUWA 4M3SA 3C26A 4B5OA 3I3GA 4KOYA 1M4DA 1VKCA 4KVME 2Z3PA 1QSRA 4E0AA 2WPWA 1XEBA 4R87A 4XNHC 1YR0A 4KUAA 3GYAA 1YVKA 4OLLA 4NXYA 5J8FA 2IL4A 2GIVA 1QSTA 3WR7A 3TOAA 3DSBA 4JXQA 4FD6A 2DXQA 4UFXA 3S6KA 2Z3NA 4A31A 4KSFA 2B58A 3ZJ0A 4QVTA 1XIXA 4U5YA 3OWCA 3B8GA 1I21A 3N7ZA 3S6GA 4BBHA 5IB0A 3I9SA 1M1DA 4B10A 2Z3MA 4MFQA 5F46A 2ZW6A 4L89A 4A32A 1XF8A 4LX9A 5G1ZA 2Q44A 2YNCA 2R1IA 1S3ZA 4CAEA 1KUYA 2QMLA 3SHPA 5C82A 2I79A 2CXAA 3EFAA 2OZGA 4R9MA 5A28A 2ZW7A 2ARHA 3FBUA 2PRBA 3CXPA 4OADA 2FXFA 3LODA 4PK3A 4XPLA 4QB9A 2YGWA 1ZO0A 1NE9A 4L8AA 1RXTA 2B4DA 1XE4A 4MJ8A 5CNPA 2EUIA 4XPDB 1B87A 3FYNA 3FNCA 4ONUA 4QC6A 4HKFA 2P6EA 2G3AA 2VI7A 4MFPA 4QUSA 4A33A 4B14A 2ZW4A 4C7IA 1Z4EA 4KVOE 3F0AA 2PSWA 1NMTA 2YNEA 3IU1A 5A27A 4HNXB 4CGPA 4KOSA 4H6ZA 2A4NA 1S60A 5C88A 4ZGYB 2Q7BA 2I00A 3TO7A 3T9YA 2REEA 4EVYA 2B4BA 2PR8A 4E2AA 4H6UA 2ZXVA 4KZTA 4MHDA 1UFHA 3IWEA 2FL4A 1QSNA 1CM0A 4CGLA 3CXSA 3ZZIA 4CAWA 5HH1A 2ZW5A 4RS2A 1S7LA 2KCWA 4RI1A 4F6AA 4H89A 3RYOA 2X7BA 4BMHA 4JXRA 2B5GA 4Q38A 1S7NA 2PC1A 2ZPAA 2Z0ZA 1BOBA 5H84A 1Y9KA 4I49A 3VWEA 4R3KA 2VBQA 1YVOA 2JLMA 2P6FA 4CRZB 2RC4A 4U9YA 2D4PA 5IV0A 1M44A 2HV2A 3P2HA 2CNMA 1M4IA 5ISVA 2EVNA 2REFA 1U6MA 4NSQA 5DWMA 4PSWA 1MK4A 3F8KA 1WK4A 3GKRA 2PR1A 3MGDA 2BSWA 4CGMA 4FD5A 4PSXA 4KOTA 5KTAA 1Q2DA 2VXKA 4KORA 3R95A 5J8CA 2DPSA 5JPHA 2CNTA 5DWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNY B;  1P0H A;  5IX3 A;  2JDD A;  3DDD A;  4Y49 C;  3W91 A;  5FVJ A;  5E96 A;  3NE7 A;  2JEV A;  2AJ6 A;  4GS4 A;  1IYK A;  4MBU A;  4FD7 A;  5EBV A;  2Q04 A;  1I12 A;  3PGP A;  2Q4V A;  3R9F A;  5I0C A;  4JD6 A;  1SQH A;  2R7H A;  4R57 A;  3G3S A;  1Z9U A;  2R8V A;  2C27 A;  2J8R A;  3R96 A;  3TE4 A;  1KZF A;  3QAH A;  1BO4 A;  4KOU A;  2FT0 A;  4U9Z A;  1S7F A;  4JJX A;  2HQY A;  3QB8 A;  1KUX A;  1P4N A;  3PZJ A;  3H4Q A;  4UBR A;  1IID A;  1Z4R A;  4KVX A;  2OZH A;  2FSR A;  3F5B A;  3TO9 A;  1WWZ A;  4AG7 A;  1KUV A;  3VWD A;  1Q2C A;  4AB7 A;  1IIC A;  4KOV A;  4OAE A;  4CS0 B;  4KLW A;  4E8O A;  1K4J A;  2VZZ A;  3S6H A;  4KOW A;  3BJ7 A;  1V0C A;  1S5K A;  3IGR A;  3K9U A;  1Y7R A;  4JLY A;  4KOX A;  3TCV A;  3EY5 A;  4XNH B;  3TO6 A;  5EC4 A;  1QSM A;  1YLE A;  2CNS A;  3R9E A;  2B4D B;  1PUA A;  2VQY A;  2GAN A;  2F5I A;  1FY7 A;  2J8M A;  3FB3 A;  1ON0 A;  2OU2 A;  4YGO A;  3D2P A;  5F48 A;  4B5P B;  2VEZ A;  4KUB A;  3IWG A;  4ZBG A;  5KTC A;  1YGH A;  4UWJ A;  3FXT A;  1M4G A;  3TFY A;  3V8I A;  4HNW B;  4MY3 A;  1Y9W A;  1I1D A;  2BUE A;  4YFJ A;  1YK3 A;  3GY9 A;  4KLV A;  4DNC A;  2OH1 A;  1TIQ A;  1MJB A;  3D3S A;  1GHE A;  1LRZ A;  5KTD A;  3FRM A;  1YRE A;  2QIR A;  3BLN A;  2BEI A;  4M85 A;  4MY0 A;  4FD4 A;  4XPD C;  1CJW A;  2D4O A;  2GE3 A;  2P6G A;  3DR8 A;  2HUZ A;  2FIW A;  3E0K A;  4AVB A;  3R1K A;  1PU9 A;  3LD2 A;  2VZY A;  2BL1 A;  1L0C A;  3BJ8 A;  5GCN A;  4QBJ A;  4UA3 A;  4X5K A;  3W6X A;  4NCZ A;  4Y49 B;  2H5M A;  2B3V A;  2WPX A;  3TTH A;  1S7K A;  3PP9 A;  3S6F A;  3JVN A;  4II9 A;  3TT2 A;  1RO5 A;  2JDC A;  3DR6 A;  3EO4 A;  2PDO A;  3P2F A;  4B5P A;  2AE6 A;  1QSO A;  4K30 A;  4PK2 A;  2QEC A;  3W6S A;  3TOB A;  3SXO A;  4ORF A;  4F0Y A;  2FCK A;  2P0W A;  1J4J A;  2ATR A;  1IB1 E;  2Q0Y A;  4NEX A;  3T90 A;  3EC4 A;  2B5G B;  3G8W A;  4XPK A;  4PV6 A;  2OB0 A;  2K5T A;  5HMN A;  3D2M A;  2OZU A;  3R9G A;  4CAX A;  1MJA A;  4LUA A;  5F47 A;  5F49 A;  4UWI A;  2FIA A;  1OZP A;  4AVA A;  2Z11 A;  1NSL A;  4J3G A;  1B6B A;  1N71 A;  5JQ4 A;  3KKW A;  2Y0M A;  2NMT A;  1XMT A;  3DNS A;  1YX0 A;  2FS5 A;  2PQ8 A;  3FIX A;  3UY5 A;  1R57 A;  4R3L A;  3SXN A;  2R98 A;  3EXN A;  1IYL A;  2Q4Y A;  3D8P A;  2CY2 A;  1MJ9 A;  4CRY B;  2B3U A;  2G0B A;  2G3T A;  4AG9 A;  4JWP A;  4NF1 A;  2FE7 A;  4CAV A;  4IUS A;  5H86 A;  1VHS A;  1Q2Y A;  4IF5 A;  4MI4 A;  4YRH A;  2O28 A;  2Z10 A;  4AVC A;  3CXQ A;  2J8N A;  3JUW A;  4M3S A;  3C26 A;  4B5O A;  3I3G A;  4KOY A;  1M4D A;  1VKC A;  4KVM E;  1QSR A;  4E0A A;  2WPW A;  1XEB A;  4R87 A;  4XNH C;  1YR0 A;  4KUA A;  3GYA A;  1YVK A;  4OLL A;  4NXY A;  5J8F A;  2IL4 A;  2GIV A;  1QST A;  3WR7 A;  3TOA A;  3DSB A;  4JXQ A;  4FD6 A;  2DXQ A;  3S6K A;  2B58 A;  3ZJ0 A;  4QVT A;  1XIX A;  4U5Y A;  3OWC A;  3B8G A;  1I21 A;  3N7Z A;  3S6G A;  5IB0 A;  3I9S A;  1M1D A;  5F46 A;  2ZW6 A;  4L89 A;  1XF8 A;  4LX9 A;  2Q44 A;  2R1I A;  1S3Z A;  1KUY A;  2QML A;  3SHP A;  5C82 A;  2I79 A;  3EFA A;  2OZG A;  4R9M A;  2ZW7 A;  2ARH A;  3FBU A;  2PRB A;  3CXP A;  4OAD A;  2FXF A;  3LOD A;  4PK3 A;  4XPL A;  4QB9 A;  1NE9 A;  4L8A A;  1RXT A;  2B4D A;  1XE4 A;  4MJ8 A;  5CNP A;  2EUI A;  4XPD B;  1B87 A;  3FYN A;  3FNC A;  4ONU A;  4QC6 A;  4HKF A;  2P6E A;  2G3A A;  2VI7 A;  4QUS A;  2ZW4 A;  1Z4E A;  4KVO E;  3F0A A;  2PSW A;  1NMT A;  4HNX B;  4KOS A;  4H6Z A;  2A4N A;  1S60 A;  5C88 A;  2Q7B A;  2I00 A;  3TO7 A;  3T9Y A;  2REE A;  4EVY A;  2B4B A;  2PR8 A;  4E2A A;  4H6U A;  2ZXV A;  4KZT A;  4MHD A;  1UFH A;  2FL4 A;  1QSN A;  1CM0 A;  3CXS A;  3ZZI A;  4CAW A;  5HH1 A;  2ZW5 A;  4RS2 A;  1S7L A;  2KCW A;  4RI1 A;  4F6A A;  4H89 A;  3RYO A;  2X7B A;  4BMH A;  4JXR A;  2B5G A;  1S7N A;  2PC1 A;  2ZPA A;  2Z0Z A;  1BOB A;  5H84 A;  1Y9K A;  4I49 A;  3VWE A;  4R3K A;  2VBQ A;  1YVO A;  2JLM A;  2P6F A;  4CRZ B;  2RC4 A;  4U9Y A;  2D4P A;  5IV0 A;  1M44 A;  2HV2 A;  3P2H A;  2CNM A;  1M4I A;  5ISV A;  2EVN A;  2REF A;  1U6M A;  4NSQ A;  5DWM A;  4PSW A;  1MK4 A;  3F8K A;  1WK4 A;  3GKR A;  2PR1 A;  3MGD A;  2BSW A;  4FD5 A;  4PSX A;  4KOT A;  5KTA A;  1Q2D A;  2VXK A;  4KOR A;  3R95 A;  5J8C A;  5JPH A;  2CNT A;  5DWN A; 
#chains in the Genus database with same CATH topology
 4A95 A;  4HNY B;  3VAR A;  1P0H A;  4TNU A;  5IX3 A;  2PCU A;  2PJ4 A;  2JDD A;  3DDD A;  4Y49 C;  2CTB A;  2ZEH A;  3W91 A;  5FVJ A;  3ISX A;  2ZEE A;  5E96 A;  5K8M A;  2WUU A;  3QAY A;  2PJ5 A;  3NE7 A;  2JEV A;  2AJ6 A;  1XJO A;  4GM5 A;  4MHP A;  5AG5 A;  4GS4 A;  1IYK A;  4MBU A;  2C6P A;  4FD7 A;  1Z5R A;  1DE4 C;  5EBV A;  2Q04 A;  2ZEG A;  4NJR A;  1I12 A;  1R3N A;  3PGP A;  2Q4V A;  3R9F A;  5I0C A;  4JD6 A;  1SQH A;  3NA6 A;  2R7H A;  4LQG A;  4R57 A;  3G3S A;  4EME A;  1Z9U A;  2R8V A;  2PIZ A;  2OOT A;  2C27 A;  1FT7 A;  2J8R A;  3RO0 A;  4AXV A;  3R96 A;  1YLO A;  4X3R A;  5JM6 A;  3TE4 A;  1KZF A;  1ZLH A;  1F2P A;  1BO4 A;  1XMB A;  3QAH A;  4CYN A;  2PJC A;  2O4H A;  2V8G A;  3FVL A;  4ONW A;  4KSA A;  4KOU A;  2FT0 A;  3B7I A;  4MMO A;  1XBU A;  4MCR A;  4U9Z A;  1S7F A;  4JJX A;  2AFX A;  2HQY A;  1BPM A;  2PIY A;  4NGM A;  3QB8 A;  5CPA A;  1KUX A;  1P4N A;  1XOV A;  2V8D A;  3PZJ A;  4TWE A;  2XEF A;  4P10 A;  3PEI A;  1JWQ A;  3H4Q A;  4FWU A;  2QJ8 A;  4JZ0 A;  4UBR A;  4MFJ A;  5AG4 A;  3PBB A;  4MFL A;  1IID A;  1Z4R A;  4KVX A;  1A2Z A;  4FAI A;  2YND A;  2OZH A;  2FSR A;  3F5B A;  4Q36 A;  3TO9 A;  3DGV A;  1WWZ A;  3RZA A;  4IHM A;  4AG7 A;  1KUV A;  3B3V A;  4OKO A;  3B3W A;  3VWD A;  1Q2C A;  4AB7 A;  2GLF A;  3KR4 A;  4PQA A;  2ZEO A;  1IIC A;  3QNV A;  1IY7 A;  4KOV A;  4OAE A;  2PJ2 A;  4CS0 B;  5BWA B;  4KLW A;  2V8H A;  4E8O A;  1AUG A;  1ARM A;  3IO1 A;  5HVF A;  1K4J A;  2BO9 A;  3SJX A;  4C2Y A;  2VZZ A;  1IGB A;  3S6H A;  3JTK A;  1Y0R A;  4MCP A;  4KOW A;  3MN8 A;  2PJ6 A;  3BJ7 A;  2POK A;  1V0C A;  1S5K A;  3IGR A;  1ZG9 A;  1Y7R A;  1M4L A;  3K9U A;  4JLY A;  4KOX A;  2WZN A;  3JRU A;  3TCV A;  3EY5 A;  4UFV A;  3WT4 A;  4ZI6 A;  4XNH B;  2O53 A;  3TO6 A;  1TKF A;  5EC4 A;  1QSM A;  1YLE A;  4CYP A;  2CNS A;  1IOF A;  3WC5 A;  1HDU A;  2WSA A;  1NSA A;  3R9E A;  5AG7 A;  2PJ3 A;  3FMC A;  1TXR A;  2B4D B;  1PUA A;  2VQY A;  2ZEL A;  3KAS A;  2GAN A;  4Q7A A;  2F5I A;  5J1Q A;  4CAF A;  2YNC C;  1FY7 A;  1F57 A;  4DUK A;  2J8M A;  1ZG7 A;  3FB3 A;  1ON0 A;  2OU2 A;  4YGO A;  3D2P A;  5F48 A;  4B5P B;  2VEZ A;  3B3S A;  4KUB A;  3IWG A;  4MFZ A;  1FNO A;  4ZBG A;  5KTC A;  1YGH A;  4UWJ A;  3KL9 A;  3FXT A;  3KHZ A;  1CG2 A;  2JEW A;  2OR4 A;  1M4G A;  2HB6 A;  3TFY A;  3V8I A;  4HNW B;  4MY3 A;  1Y9W A;  1I1D A;  2JBK A;  5AGE A;  1LOK A;  2PVV A;  4C2Z A;  2BUE A;  4KS9 A;  1CP6 A;  5ELY A;  4YFJ A;  1YW4 A;  1YK3 A;  5I4M A;  3GY9 A;  3FEC A;  4KLV A;  4P4F A;  1Z2L A;  2C6C A;  2OH1 A;  1IU8 A;  4M6I A;  4DNC A;  5F09 A;  4IAV A;  3DLJ A;  4F8Z A;  1TIQ A;  1MJB A;  4P4E A;  3D3S A;  1GHE A;  3SI1 A;  3SJG A;  4A39 A;  4CGN A;  1LRZ A;  5LYI A;  5KTD A;  1Q7L A;  3PBE A;  4P44 A;  3B2Y A;  4UEE A;  4BD9 A;  1PCA A;  3FRM A;  1YRE A;  2QIR A;  2RB7 A;  2RFH A;  3BLN A;  2PJB A;  4NGP A;  2QYV A;  2AFM A;  2PJ9 A;  2BEI A;  4M85 A;  4MY0 A;  4NGT A;  3PB8 X;  4FD4 A;  2NYQ A;  4YU9 A;  1XFO A;  4XPD C;  4ZX8 A;  1CJW A;  2D4O A;  2GE3 A;  4HPS A;  4A94 A;  1Z8X A;  3T8W A;  4F9U A;  2P6G A;  3DR8 A;  2HUZ A;  3V38 A;  2FIW A;  3NH8 A;  2Z3K A;  4B13 A;  3KQX A;  3E0K A;  4UEZ A;  4W9Y A;  4AVB A;  4GXH A;  3R1K A;  1PU9 A;  3LD2 A;  3V7Z A;  1ZLI A;  2VZY A;  2BL1 A;  1L0C A;  4C7H A;  4MHY A;  3BJ8 A;  4MCS A;  5GCN A;  4OC0 A;  4CGO A;  4QBJ A;  4UA3 A;  2Z3O A;  3GIU A;  4X5K A;  3W6X A;  4NCZ A;  3D7F A;  4Y49 B;  2EO8 A;  3S9M A;  2H5M A;  3H5Z A;  2B3V A;  3B35 A;  2Z3L A;  3HUV A;  2GLJ A;  4IK2 A;  1VHE A;  2GFQ A;  2WPX A;  4EFD A;  3TC8 A;  3FED A;  2Q4Z A;  3TTH A;  3PB4 X;  4WJB A;  1S7K A;  1HEE A;  4A30 A;  2ZOG A;  2NSM A;  3PP9 A;  2ZEN A;  3JVN A;  3S6F A;  4C68 A;  4OC4 A;  4II9 A;  3TT2 A;  1F2O A;  1RO5 A;  4CYQ A;  2JDC A;  2C1C A;  4UFW A;  5LRG A;  2XEJ A;  4UCP A;  1ARL A;  3DR6 A;  3EO4 A;  2PDO A;  3IU2 A;  2QVP A;  3CT9 A;  3P2F A;  4B5P A;  2ANP A;  2EK9 A;  2AE6 A;  2AFS A;  1QSO A;  4B6Z A;  3PRT A;  4K30 A;  4PK2 A;  2QEC A;  5LRK A;  4P6Y A;  3W6S A;  5K8O A;  3TOB A;  3SXO A;  4MFK A;  4ORF A;  4O23 A;  1YSJ A;  2BOA A;  3K9T A;  4F0Y A;  2FCK A;  1BPN A;  5G22 A;  3LWU A;  4PXC A;  2P0W A;  1J4J A;  2ATR A;  2Q0Y A;  1IB1 E;  4OC3 A;  4NEX A;  3FF3 A;  3T90 A;  1KWM A;  2HC9 A;  3L2N A;  2F7V A;  3EC4 A;  5LYL A;  2B5G B;  5AG6 A;  1H8L A;  3G8W A;  4XPK A;  4EWT A;  3IJ3 A;  1LAN A;  4OC5 A;  4UCM A;  1Y0Y A;  2AFZ A;  2DPT A;  4PV6 A;  2OB0 A;  2K5T A;  3PB6 X;  5HMN A;  2DEA A;  2IMO A;  4MRI A;  3D2M A;  4X2T A;  2OZU A;  2XEG A;  4OIW A;  4OP4 A;  3R9G A;  3A9L A;  3S9N A;  4CAX A;  4ZYQ A;  1MJA A;  1R43 A;  4C2X A;  4LUA A;  5F47 A;  1TKH A;  3FJU A;  3HLP A;  4PXB A;  5F49 A;  1CX8 A;  4UWI A;  2FIA A;  5G21 A;  4F9V A;  1OZP A;  4P4D A;  4B11 A;  4K3N A;  4AVA A;  3IWW A;  2Z11 A;  3PFO A;  2PE3 A;  1NSL A;  4J3G A;  1B6B A;  1N71 A;  4UCN A;  5JQ4 A;  3KKW A;  1LAP A;  2Y0M A;  2NMT A;  5DS0 A;  2G9D A;  1XMT A;  3DNS A;  2ZED A;  1Z8T A;  3N5F A;  1YX0 A;  1VGY A;  2FS5 A;  2PQ8 A;  3FIX A;  3UY5 A;  2ODF A;  1R57 A;  4PPZ A;  4B12 A;  4R3L A;  3SXN A;  2R98 A;  4CYO A;  5HVH A;  4F0X A;  3EXN A;  2V8V A;  5K8N A;  1IYL A;  4OID A;  2IJZ A;  1CPX A;  2Q4Y A;  3D8P A;  2CY2 A;  1MJ9 A;  2FVG A;  1RTQ A;  4MXU A;  4CRY B;  3PB7 X;  2B3U A;  2G0B A;  2G3T A;  4ZY2 A;  4A2Z A;  4AG9 A;  4JWP A;  4NF1 A;  1ZG8 A;  2FE7 A;  5G20 A;  4CAV A;  2CF4 A;  4IUS A;  1IOI A;  5H86 A;  1VHS A;  1Q2Y A;  4IF5 A;  4MI4 A;  4YRH A;  2O28 A;  3KR5 A;  2F8H A;  2Z10 A;  3NE8 A;  3CXQ A;  4AVC A;  4G1P A;  1TF8 A;  2J8N A;  1DTD A;  3JUW A;  3B3T A;  4M3S A;  3C26 A;  2EBJ A;  5LYD A;  3I3G A;  4B5O A;  4KOY A;  1M4D A;  1VKC A;  4KVM E;  4M6G A;  4P45 A;  2Z3P A;  1QSR A;  3S9L A;  4E0A A;  2WPW A;  1XEB A;  4R87 A;  3D66 A;  2Q7S A;  4XNH C;  1YR0 A;  4KUA A;  3SI2 A;  3GYA A;  1YVK A;  3D67 A;  4OLL A;  4NXY A;  2PJ8 A;  5J8F A;  2IL4 A;  2GIV A;  1LAM A;  1QST A;  3WR7 A;  4NFR A;  3CPA A;  4R6T A;  2GRE A;  4NGQ A;  3TOA A;  3DSB A;  3D68 A;  4JXQ A;  4FD6 A;  2PJA A;  2DXQ A;  4UFX A;  2JBJ A;  2Z3N A;  3S6K A;  4KSF A;  2B58 A;  4M6H A;  3ZJ0 A;  3K2K A;  4A31 A;  4QVT A;  1XIX A;  4U5Y A;  4RUH A;  4MCQ A;  3OWC A;  1X10 A;  3B8G A;  1I21 A;  3N7Z A;  3CZX A;  4PXD A;  3KI9 A;  3S6G A;  4BBH A;  3I9S A;  5IB0 A;  5J8C A;  1M1D A;  2PJ7 A;  1BLL E;  3IC1 A;  3KZW A;  2AFU A;  3VH9 A;  2BCO A;  4B10 A;  2Z3M A;  4MFQ A;  2Q43 A;  5F46 A;  1HDQ A;  3IFE A;  4H2K A;  1LCP A;  2ZW6 A;  1AYE A;  4L89 A;  4A32 A;  4CPA A;  1XF8 A;  3KGQ A;  4P4I A;  4LX9 A;  5G1Z A;  4MHZ A;  2Q44 A;  2YNC A;  3FX6 A;  2R1I A;  2J9A A;  1CBX A;  1S3Z A;  2EWB A;  4P4B A;  4CAE A;  7CPA A;  1TKJ A;  3ISZ A;  3SJF A;  1KUY A;  2QML A;  3SHP A;  5C82 A;  3WAB A;  3D7G A;  4LQ6 A;  5JH9 A;  3PFE A;  2AFO A;  3BXM A;  5JGF A;  2PVW A;  2CIJ A;  4KSI A;  2I79 A;  2CXA A;  3EFA A;  2OZG A;  3H8F A;  4R9M A;  1EE3 P;  2ARH A;  2ZW7 A;  5A28 A;  3FBU A;  3TX8 A;  1PYT B;  2PRB A;  3CXP A;  3BI1 A;  1AMP A;  4OAD A;  2FXF A;  2VL1 A;  3BI0 A;  3LOD A;  3D4U A;  3KHX A;  4PK3 A;  4XPL A;  4QB9 A;  2YGW A;  1ZO0 A;  1NE9 A;  3MRU A;  4L8A A;  2ZEP A;  1OBR A;  5D8N A;  5LRJ A;  1RXT A;  2B4D A;  3FEE A;  1XE4 A;  4MJ8 A;  4NGN A;  2XEI A;  3NH5 A;  2PJ1 A;  5CNP A;  2PJ0 A;  1YW6 A;  2EUI A;  2Q51 A;  4XPD B;  1B87 A;  3FYN A;  3FNC A;  4JYW A;  4ONU A;  4QC6 A;  5HXD A;  2CTC A;  3B3C A;  4HKF A;  2P6E A;  2G3A A;  2VI7 A;  1Y7E A;  4MFP A;  4QUS A;  4A33 A;  4B14 A;  2ZW4 A;  4C7I A;  1Z4E A;  3RAM A;  4KVO E;  3F0A A;  4X8I A;  2PSW A;  1NMT A;  2YNE A;  3D7D A;  4YWY A;  3IU1 A;  3SI0 A;  5A27 A;  4HNX B;  2GU2 A;  4ZY0 A;  4CGP A;  4BIN A;  4KOS A;  5CBM A;  4H6Z A;  2A4N A;  4OC1 A;  1S60 A;  4P4J A;  4A37 A;  5C88 A;  3RNZ A;  4ZGY B;  2Q7B A;  2I00 A;  3TO7 A;  3T9Y A;  4FUU A;  2REE A;  1GYT A;  3BHX A;  4EVY A;  3LMS A;  2B4B A;  2PR8 A;  4E2A A;  1ELL P;  4H6U A;  3WC6 A;  4NGR A;  2ZXV A;  4KZT A;  4MHD A;  8CPA A;  1UFH A;  3GUX A;  3IWE A;  2V77 A;  1BAV A;  2FL4 A;  4UF4 A;  3CPX A;  3H8E A;  4OC2 A;  1QSN A;  1CM0 A;  4CGL A;  1CPS A;  3CXS A;  4WWV A;  3ZZI A;  4DYO A;  4CAW A;  5HH1 A;  3RBU A;  2ZW5 A;  3NFZ A;  4RS2 A;  3FH4 A;  3LAC A;  1UWY A;  1S7L A;  2KCW A;  4RI1 A;  4Z65 A;  3D7H A;  4F6A A;  3H8G A;  4H89 A;  3RYO A;  2X7B A;  4A38 A;  5LYF A;  4OME A;  4JXR A;  4BMH A;  2B5G A;  5HVG A;  5EMI A;  3PB9 X;  4Q38 A;  1S7N A;  1QQ9 A;  2PC1 A;  2ZEF A;  2ZPA A;  2Z0Z A;  4R7M A;  1X12 A;  1BOB A;  5D29 A;  1Z8W A;  5H84 A;  3CDX A;  1Y9K A;  4I49 A;  3GB0 A;  3WC7 A;  1VHO A;  4R3K A;  3VWE A;  5K8P A;  2AFW A;  4UIA A;  2VBQ A;  2WYR A;  4NJQ A;  2C6G A;  1YVO A;  2JLM A;  2P6F A;  4CRZ B;  4FBE A;  4ZX9 A;  2RC4 A;  4U9Y A;  2D4P A;  3SJE A;  5IV0 A;  1M44 A;  2IQ6 A;  4UIB A;  2HV2 A;  3P2H A;  2EK8 A;  3NH4 A;  3IIB A;  2I3C A;  4RN7 A;  2PRQ A;  2CNM A;  4UEF A;  1M4I A;  5ISV A;  1YQE A;  1XRY A;  1JQG A;  1CP7 A;  2EVN A;  2DF5 A;  3I1U A;  2REF A;  1U6M A;  3KQZ A;  4NSQ A;  4PXE A;  4R8F A;  5THW A;  5DWM A;  1LFW A;  4PSW A;  1VIX A;  1MK4 A;  2ABZ A;  1QMU A;  1WK4 A;  3F8K A;  3GKR A;  2PR1 A;  4DJL A;  3MGD A;  2BSW A;  3GLJ A;  1TF9 A;  4CGM A;  2ZEM A;  1YME A;  1Z8L A;  4FD5 A;  4PSX A;  3VAT A;  4KOT A;  5IB9 A;  2ZOF A;  4R76 A;  5KTA A;  1Q2D A;  1ELM P;  2VXK A;  4KOR A;  3R95 A;  2DPS A;  4MHN A;  4ZY1 A;  2CNT A;  6CPA A;  4NGS A;  5JPH A;  5DWN A;  3IEH A; 
#chains in the Genus database with same CATH homology
 4A95 A;  4HNY B;  1P0H A;  5IX3 A;  2JDD A;  3DDD A;  4Y49 C;  3W91 A;  5FVJ A;  5E96 A;  2WUU A;  3NE7 A;  2JEV A;  2AJ6 A;  5AG5 A;  4GS4 A;  1IYK A;  4MBU A;  4FD7 A;  5EBV A;  2Q04 A;  1I12 A;  3PGP A;  2Q4V A;  3R9F A;  5I0C A;  4JD6 A;  1SQH A;  2R7H A;  4R57 A;  3G3S A;  1Z9U A;  2R8V A;  2C27 A;  2J8R A;  3R96 A;  3TE4 A;  1KZF A;  3QAH A;  1BO4 A;  4CYN A;  4KSA A;  4KOU A;  2FT0 A;  4U9Z A;  1S7F A;  4JJX A;  2HQY A;  3QB8 A;  1KUX A;  1P4N A;  3PZJ A;  3H4Q A;  4UBR A;  4MFJ A;  5AG4 A;  4MFL A;  1IID A;  1Z4R A;  4KVX A;  2YND A;  2OZH A;  2FSR A;  3F5B A;  4Q36 A;  3TO9 A;  1WWZ A;  4AG7 A;  1KUV A;  3VWD A;  1Q2C A;  4AB7 A;  1IIC A;  5BWA B;  4KOV A;  4OAE A;  4CS0 B;  4KLW A;  4E8O A;  1K4J A;  4C2Y A;  2VZZ A;  3S6H A;  3JTK A;  4KOW A;  3BJ7 A;  1V0C A;  1S5K A;  3IGR A;  3K9U A;  1Y7R A;  4JLY A;  4KOX A;  3TCV A;  3EY5 A;  4UFV A;  4XNH B;  3TO6 A;  5EC4 A;  4CYP A;  1QSM A;  1YLE A;  2CNS A;  2WSA A;  3R9E A;  5AG7 A;  2B4D B;  1PUA A;  2VQY A;  2GAN A;  2F5I A;  4CAF A;  2YNC C;  1FY7 A;  2J8M A;  3FB3 A;  1ON0 A;  2OU2 A;  4YGO A;  3D2P A;  5F48 A;  4B5P B;  2VEZ A;  4KUB A;  3IWG A;  4MFZ A;  4ZBG A;  5KTC A;  1YGH A;  4UWJ A;  3FXT A;  1M4G A;  3TFY A;  3V8I A;  4HNW B;  4MY3 A;  1Y9W A;  1I1D A;  5AGE A;  4C2Z A;  2BUE A;  4KS9 A;  4YFJ A;  1YK3 A;  3GY9 A;  4KLV A;  4DNC A;  2OH1 A;  1TIQ A;  1MJB A;  4CGN A;  3D3S A;  1GHE A;  1LRZ A;  5KTD A;  3FRM A;  1YRE A;  2QIR A;  3BLN A;  2BEI A;  4M85 A;  4MY0 A;  4FD4 A;  4XPD C;  1CJW A;  2D4O A;  2GE3 A;  2P6G A;  3DR8 A;  2HUZ A;  2FIW A;  2Z3K A;  4B13 A;  3E0K A;  4AVB A;  3R1K A;  1PU9 A;  3LD2 A;  2VZY A;  2BL1 A;  1L0C A;  4C7H A;  3BJ8 A;  5GCN A;  4CGO A;  4QBJ A;  4UA3 A;  2Z3O A;  4X5K A;  3W6X A;  4NCZ A;  4Y49 B;  2H5M A;  3H5Z A;  2B3V A;  2Z3L A;  2WPX A;  3TTH A;  1S7K A;  4A30 A;  3PP9 A;  3S6F A;  3JVN A;  4C68 A;  4II9 A;  3TT2 A;  1RO5 A;  4CYQ A;  2JDC A;  4UFW A;  4UCP A;  3DR6 A;  3EO4 A;  2PDO A;  3IU2 A;  3P2F A;  4B5P A;  2AE6 A;  1QSO A;  4K30 A;  4PK2 A;  2QEC A;  3W6S A;  3TOB A;  3SXO A;  4MFK A;  4ORF A;  4F0Y A;  2FCK A;  5G22 A;  2P0W A;  1J4J A;  2ATR A;  1IB1 E;  2Q0Y A;  4NEX A;  3T90 A;  3EC4 A;  2B5G B;  5AG6 A;  3G8W A;  4XPK A;  4UCM A;  2DPT A;  4PV6 A;  2OB0 A;  2K5T A;  5HMN A;  3D2M A;  2OZU A;  3R9G A;  3A9L A;  4CAX A;  1MJA A;  4C2X A;  4LUA A;  5F47 A;  5F49 A;  4UWI A;  2FIA A;  5G21 A;  1OZP A;  4B11 A;  4AVA A;  2Z11 A;  1NSL A;  4J3G A;  1B6B A;  1N71 A;  4UCN A;  5JQ4 A;  3KKW A;  2Y0M A;  2NMT A;  1XMT A;  3DNS A;  1YX0 A;  2FS5 A;  2PQ8 A;  3FIX A;  3UY5 A;  1R57 A;  4B12 A;  4R3L A;  3SXN A;  2R98 A;  4CYO A;  4F0X A;  3EXN A;  1IYL A;  2Q4Y A;  3D8P A;  2CY2 A;  1MJ9 A;  4CRY B;  2B3U A;  2G0B A;  2G3T A;  4AG9 A;  4A2Z A;  4JWP A;  4NF1 A;  2FE7 A;  5G20 A;  4CAV A;  4IUS A;  5H86 A;  1VHS A;  1Q2Y A;  4IF5 A;  4MI4 A;  4YRH A;  2O28 A;  2Z10 A;  4AVC A;  3CXQ A;  2J8N A;  3JUW A;  4M3S A;  3C26 A;  4B5O A;  3I3G A;  4KOY A;  1M4D A;  1VKC A;  4KVM E;  2Z3P A;  1QSR A;  4E0A A;  2WPW A;  1XEB A;  4R87 A;  4XNH C;  1YR0 A;  4KUA A;  3GYA A;  1YVK A;  4OLL A;  4NXY A;  5J8F A;  2IL4 A;  2GIV A;  1QST A;  3WR7 A;  3TOA A;  3DSB A;  4JXQ A;  4FD6 A;  2DXQ A;  4UFX A;  3S6K A;  2Z3N A;  4A31 A;  4KSF A;  2B58 A;  3ZJ0 A;  4QVT A;  1XIX A;  4U5Y A;  3OWC A;  3B8G A;  1I21 A;  3N7Z A;  3S6G A;  4BBH A;  5IB0 A;  3I9S A;  1M1D A;  4B10 A;  2Z3M A;  4MFQ A;  5F46 A;  2ZW6 A;  4L89 A;  4A32 A;  1XF8 A;  4LX9 A;  5G1Z A;  2Q44 A;  2YNC A;  2R1I A;  1S3Z A;  4CAE A;  1KUY A;  2QML A;  3SHP A;  5C82 A;  2I79 A;  2CXA A;  3EFA A;  2OZG A;  4R9M A;  5A28 A;  2ZW7 A;  2ARH A;  3FBU A;  2PRB A;  3CXP A;  4OAD A;  2FXF A;  3LOD A;  4PK3 A;  4XPL A;  4QB9 A;  2YGW A;  1ZO0 A;  1NE9 A;  4L8A A;  1RXT A;  2B4D A;  1XE4 A;  4MJ8 A;  5CNP A;  2EUI A;  4XPD B;  1B87 A;  3FYN A;  3FNC A;  4ONU A;  4QC6 A;  4HKF A;  2P6E A;  2G3A A;  2VI7 A;  4MFP A;  4QUS A;  4A33 A;  4B14 A;  2ZW4 A;  4C7I A;  1Z4E A;  4KVO E;  3F0A A;  2PSW A;  1NMT A;  2YNE A;  3IU1 A;  5A27 A;  4HNX B;  4CGP A;  4KOS A;  4H6Z A;  2A4N A;  1S60 A;  5C88 A;  4ZGY B;  2Q7B A;  2I00 A;  3TO7 A;  3T9Y A;  2REE A;  4EVY A;  2B4B A;  2PR8 A;  4E2A A;  4H6U A;  2ZXV A;  4KZT A;  4MHD A;  1UFH A;  3IWE A;  2FL4 A;  1QSN A;  1CM0 A;  4CGL A;  3CXS A;  3ZZI A;  4CAW A;  5HH1 A;  2ZW5 A;  4RS2 A;  1S7L A;  2KCW A;  4RI1 A;  4F6A A;  4H89 A;  3RYO A;  2X7B A;  4BMH A;  4JXR A;  2B5G A;  4Q38 A;  1S7N A;  2PC1 A;  2ZPA A;  2Z0Z A;  1BOB A;  5H84 A;  1Y9K A;  4I49 A;  3VWE A;  4R3K A;  2VBQ A;  1YVO A;  2JLM A;  2P6F A;  4CRZ B;  2RC4 A;  4U9Y A;  2D4P A;  5IV0 A;  1M44 A;  2HV2 A;  3P2H A;  2CNM A;  1M4I A;  5ISV A;  2EVN A;  2REF A;  1U6M A;  4NSQ A;  5DWM A;  4PSW A;  1MK4 A;  3F8K A;  1WK4 A;  3GKR A;  2PR1 A;  3MGD A;  2BSW A;  4CGM A;  4FD5 A;  4PSX A;  4KOT A;  5KTA A;  1Q2D A;  2VXK A;  4KOR A;  3R95 A;  5J8C A;  2DPS A;  5JPH A;  2CNT A;  5DWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...