2Q7FA

Crystal structure of yrrb: a tpr protein with an unusual peptide-binding site
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
194
structure length
194
Chain Sequence
AAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDHMLALHAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YrrB protein
publication title Crystal structure of YrrB: A TPR protein with an unusual peptide-binding site
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Protein binding
total genus 71
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2q7fA00
4GZ6A 2PZIA 2VYIA 4N3BA 5M72A 5BNWA 2VGYA 4BTBA 3ZHEA 2FEZA 2IFUA 4J8FA 1OUVA 2VSYA 5D0OD 3UQ3A 2WQHA 4G26A 4U0UA 5CCLA 2V5FA 4RG6A 2XPIA 3CV0A 4U0SA 2XEVA 3PE3A 2KC7A 3LY7A 3QWWA 4UQYA 2BUGA 2C0MA 2HYZA 5HI7A 2Y4TA 3WXXA 3OXFA 3U4TA 4GA0A 4W9RA 2FO7A 5A7DB 3AS8A 1IYGA 2PL2A 3KS2A 3LY8A 4EQFA 5FTPA 3S7DA 4GYOA 4YNDA 3CVNA 2MHKA 4GYWA 4XI9A 3PE4A 4UQZA 3MKRA 4BTAA 3CKBA 4XI0A 3QWVA 1A17A 4U0ZA 4N2QA 5FZSA 2YHCA 2R5SA 5KJMA 3GZ1A 4I1AA 3MV3B 2L6JA 5FT9A 3RJVA 3MEKA 5CCMA 2VGXA 4WNDA 4BT9A 3Q47B 2UWJG 4N39A 3RO2A 4N3CA 4GYYA 4J8DA 2LNIA 3LKUA 2E2EA 1ELWA 2DBAA 1W3BA 4F3VA 5LCWC 4J0UA 3RO3A 3ESKA 3LCAA 3KAEA 4I2ZA 5AYWD 3ASDA 2FF4A 3RKVA 4G24A 4GZ5A 4GPKA 2KCVA 2LSVA 2C2LA 4BWRA 5G05J 3CVPA 3QOUA 1P5QA 5ARGA 4UI9J 5KJLA 4JA7A 3UUXA 5JJ6A 4ABNA 2FI7A 4Y6CA 3MV2B 4A1SA 4I2WA 3CK7A 4JA9A 3Q15A 3CKCA 3R9AB 4N2SA 5BW8C 3ZGQA 3CK9A 1KT0A 4WNGA 5D0QD 3ASFA 3OXGA 5KJKA 4JL0A 5ARFA 2HO1A 5EKQD 3TGOA 2I6HA 5EX3A 3S7FA 2YQ8A 4G2VA 5C1DA 3CK8A 4BT8A 4UI9K 2QFCA 2JLBA 2XGSA 3OXLA 3IEGA 4GA1A 1E96B 1TJCA 1XNFA 3U3WA 2J9QA 3GYZA 1WM5A 1ZBPA 1PC2A 1KLXA 2UY1B 4GZ3A 4H7YA 4NRHB 5HQ8A 3FP3A 4I9CA 3UPVA 5FJYA 2XGMA 2WPVA 5G04J 1B89A 3E4BA 4CGWA 3HYMB 3PDNA 4YVQC 1NZNA 5DIZA 4UQXA 3AS4A 2OOEA 1HH8A 2VSNA 3NF1A 4HOUA 2XCBA 3Q49B 2PQNA 4HOTA 1IHGA 4B94A 1HXIA 4XIFA 4AY5A 1Y8MA 4G25A 3K9IA 4H7XA 4Y6WA 4WNFA 2XCCA 4J8EA 3TAXA 4RG9A 4G1TA 3JYSA 1NA3A 3ZPJA 3EDTB 4WUYA 3RIBA 2Y4UA 4APOA 4KBQA 3Q5MA 2P58C 2ONDA 5A6CA 4U07A 4CGVA 3RU0A 4IN3B 4KYOB 2UY1A 2NC9A 2Q7FA 4JHRA 4AM9A 3URZA 3LPZA 1QZ2A 2GW1A 4KXKB 1YA0A 5G05C 2FBNA 3ULQA 4LEUA 4UI9C 2IF4A 3AS5A 5DBKA 4NQ0A 3ASHA 2C0LA 4I17A 3ZHEB 4WNEA 3ZFWA 3S7JA 3VTYA 3ZN3A 4U04A 2VQ2A 3QDNA 5CHEE 5LCWJ 4CDRA 3KD7A 3S7BA 4O6FA 3BEEA 2KCLA 3SZ7A 4YVOA 4ME2A 4N3AA 1NA0A 3LY9A 4G23A 3LYAA 3GZ2A 4N5CA 1ELRA 4I9EA 3MA5A 2PQRA 3O48A 2LSUA 2HR2A 1QQEA 3N71A 5JJ7A 5FZRA 4AIFA 1ZU2A 5KJNA 4GCOA 3QKYA 4HORA 5EX0A 2AVPA 3FWVA 4HOSA 4AY6A 3TG4A 5FZQA 3SF4A 3CVLA 5G04C 5BT1A 3CVQA 3FFLA 2KATA 4GA2A 3QWPA 1WAO1 3Q4AB 4HOQA 5JJTA 2XGOA 2KCKA 1KT1A 4GCNA 3CEQA 3ASGA 1FCHA 2VGXB 3GW4A 3TG5A 1HZ4A 3VTXA
chains in the Genus database with same CATH superfamily
2PZIA 3FUNA 4N3BA 5M72A 4DLOA 3EU9A 1DVPA 5T3RA 2R02A 1LD7A 1H6PA 4FHKA 1OT8A 3UMVA 4DI3A 1TNZA 1INZA 3UQ3A 1OCOE 2WXQA 4HLEA 1SZ9A 3ULEG 5B1AE 4Q96A 5CCLA 4RG6A 1O1SA 3FEXA 2XPIA 3CV0A 2AXZA 1E8XA 2A4ZA 3PE3A 2ZISA 2WXMA 2J09A 2B6CA 2OEVA 2HYZA 5HI7A 1S63A 2KZTA 3FY4A 4FLBA 3ZNGA 3FU0A 5KNGA 1U3DA 5FINA 3SFXA 5CEAA 1OXJA 3EHRA 3NB2A 4HRLA 5FTPA 2IQCA 4ILIA 3CVNA 3AG2E 4BTAA 4HB5A 4MLPA 1Z6TA 3I5PA 3ML9A 1A17A 2ZXWE 2OVBA 3UINC 4BESA 2XHEA 4JZYA 1V54E 4CDNA 3RJVA 3MEKA 2V4HC 2YINA 3FHEA 4EHMA 4DX2A 2DVWA 3PNTB 4L7TA 5T4YA 4GTTA 5AIJA 3SY2A 2UWJG 1HU3A 1MQSA 3S2AA 3CQCB 2X6FA 4BEPA 3SHFA 3J5QB 5H7PA 2DBAA 4TXPA 4HQDA 4EBAA 4LNUD 2XEHA 2XZDG 4P29A 3FULA 3KEAA 4BWRA 2CFUA 5G05J 4B89A 5KCMA 3CVPA 4I43A 2L0TB 1P5QA 1UOHA 4I6JA 4UI9J 3APFA 5KJLA 2Y3AA 4L9PA 3SO8A 4Y6CA 1S70B 3MKQB 4A1SA 1S0PA 3PZ1A 3IV0A 4L23A 4N2SA 3D9LA 4XKCA 3PREA 3C72A 3ZGQA 1E8WA 4WNGA 3ASFA 1PY1A 4LNGA 2LXLA 4JL0A 4F7AA 4L2YA 2I6HA 3ZEFA 5EX3A 3S7FA 4UI9K 4XEIG 2VTBA 2YNQA 3LDZA 4YDWA 3CHSA 1YCSB 3FUDA 2IO2C 1N4PA 3IEGA 1E96B 1TJCA 4M3OA 3E30A 4PUCA 5D66A 1D9SA 1N0QA 4FC8A 1PC2A 1KLXA 3GZSA 5G55A 4BX8A 4GZ3A 2AW6A 3CR3A 3NAWA 5FIOA 4I9CA 3ZYLA 3HRAA 2WPVA 3L16A 2L6BA 3I4GA 4CZ2D 2NYJA 4QFVA 4A3VA 4LCTA 1FVFA 5DIZA 4JHJA 4NURA 4DJAA 3HXBA 4E6HA 2CHWA 1HH8A 2VSNA 3NF1A 2PQNA 1S64A 4HOTA 4DK5A 2H6GA 1YMPA 4RSYA 2F0YA 3KSLA 1Y8MA 3K9IA 4ACLA 3PH0C 4B93B 3FTZA 4J6IA 5FQ8A 3TXNA 4ILGA 3AJIA 2XCCA 1H19A 5AN8A 1SZAA 2QYJA 4RG9A 4FJZA 3V2OA 3D9HA 2A5EA 3IHVA 1O1TA 1MHQA 1K1AA 3Q5MA 3UXGA 1SA5A 2P58C 1JCQA 4CGVA 2DZNA 2WXGA 4GTSA 4IULA 1MJ0A 2X6KA 3LPZA 2CHZA 1QZ2A 1XGWA 3L9TA 1YA0A 4PS7A 5G05C 4OAUC 2J8SD 3CQGB 3NOGD 4UI9C 2I9CA 3MYVA 4NQ0A 2EIKE 4AOFA 1IQRA 5BXUA 3CHOA 3S7JA 3VTYA 5AQAA 3PZ4A 3HG0D 4XZ4A 4TUUA 3UI2A 4CDRA 3S7BA 4K5BA 4HBDA 3CIAA 3FUEA 4UWFA 1EYHA 3BEEA 3SZ7A 3LXUX 5KNHD 5KWDA 3LY9A 1K1BA 3ZW3A 1JCSA 1MZCA 3GZ2A 2DIWA 4G11A 3FUMA 4JC8A 4LRZA 2AXUA 4HLLA 1H2TC 4GMLA 3L6AA 3N71A 5JJ7A 4BSZB 3D3MA 2BF0X 3TG4A 3CSTA 1NI1A 3SF4A 4BX9A 3CVLA 3PVLA 3FFLA 3E33A 5B3SE 4ANWA 5JHBA 5BUZA 2FO1E 3Q4AB 2XGOA 5AARA 5AJLA 3ASGA 2M63A 4L2LA 2VGXB 4CT4A 3C3RA 2R17C 5AAOA 3VTXA 1RW2A 2VYIA 5BNWA 3SBTB 4LG6A 3IHYA 2VGYA 5ENOD 3TWTA 5AENA 4TXQA 3V30A 2IFUA 4J8FA 2GRRB 3ZYMA 3FEYA 2VSYA 2ETAA 1OCZE 1KZPA 4U0UA 5AJDA 4CYMD 5B1BE 2P9SG 2KC7A 5CRVA 1N9AA 3LY7A 1WY6A 1BI8B 2EIJE 4AJWA 1JWGA 3EUVA 5EYPF 2Y4TA 2YHEA 4GA0A 4W9RA 2FO7A 2KM4A 3CGHA 3S7DA 3Q73A 4GYOA 3UM0A 2BEDA 5ENQD 3RRUA 2MHKA 2EQXA 4UQZA 4ANVA 2MYOA 4R7LA 1TN8A 3CKBA 3QWVA 4A1GA 4ANUA 3CVVA 4U0ZA 4N2QA 2IOSA 3DXKG 2WXFA 4JVSA 3MV3B 2PNNA 4UWHA 3DWLG 2RD0A 2PM7A 3UM3A 5CCMA 4KZCA 4GTPA 4BT9A 3JUEA 2IY0C 4N39A 3JXJA 3RO2A 4N3CA 1TNOA 4GTQA 2E2EA 1ELWA 4AXHA 1W3BA 3EIQC 3UT8A 2GRPB 3FTUA 4F53A 2DYSE 3TWRA 1AP7A 4F1SA 4DPRA 2XQ0A 3RRMB 3SFYA 3KSQA 1TN7A 2GROB 4GZ5A 2P9IG 4I6GA 5J08A 1UW4B 2KCVA 3QB2A 2WMOA 4RLYA 4OAVB 3QOUA 4GPMA 2GRLA 4EZKA 3MJWA 4XE0A 5BPPA 4HI9A 2DWZA 4ABNA 2FI7A 3MV2B 2MOWA 3ISMC 4I2WA 3TWUA 4JA9A 3Q15A 3CKCA 3CHRA 3LJ3A 2KXPC 5JA4D 4E85A 2X6HA 1FVHA 1KT0A 3R7RA 4EPZA 4JPSA 3LVQE 3G2SA 5KJKA 5ARFA 4WWOA 3TGOA 4U7EB 4BETA 2Y1LE 3AG4E 2HE0A 3RK6A 4G2VA 3EJNA 3JQ1A 1IKND 2QFCA 4GU5A 2JLBA 1Z5SC 2GRQB 4GA1A 2IEJA 3P1UA 2WXRA 3QNKA 2J9QA 3E32A 3GYZA 2BTDA 3T9KA 1ZBPA 3HIZA 4GTVA 2FULA 4H7YA 3SI5A 2F37A 5HQ8A 1E8YA 4C9BB 2XGMA 5G04J 3FU3A 1B89A 3E4BA 3HYMB 3PDNA 3ZIMA 1N95A 1NZNA 1NL4A 3MCXA 1EF1C 3FH5A 4B0ZA 4ATGA 1QNFA 3G2UA 2WB2A 2OOEA 3OTNA 1HF8A 4HOUA 2EIME 4J8YA 3DXMG 4MRUA 1IHGA 1TEZA 4AY5A 3MKQA 3SFZA 3DSVA 5FWQA 3D9IA 5KBAA 4IYPA 2P9PG 1UG3A 1O5MA 2MRIA 2XS1A 3Q79A 4BERA 5FQ4A 4AEZC 1D8EA 3HXCA 5LOZA 1NA3A 1OCRE 3LS8A 4WUYA 2DYRE 3G2VA 3ULYA 3PEVB 3TJPA 4GZCA 4JW1A 3ONKA 4GTMA 4U8VD 3V2XA 5FQ7A 4HVBA 1FPPA 4IN3B 1U2VG 2F8XK 2ETBA 3FUJA 4UWKA 4C0MA 5JMND 1X81A 3B13A 3VLFA 2WXOA 1HFAA 2X6IA 3T8MA 4KXKB 2X6JA 4HXIA 3B7SA 4ZFHA 2JEKA 1N0RA 2IF4A 5DBKA 2C0LA 3ASOE 2ILRA 4TV3A 5CRUA 3PRZA 1OWNA 3FUIA 4I17A 3ZHEB 3Q9UC 1LD8A 4UWGA 1BU9A 1Q2ZA 4CT0A 3Q75A 3FTSA 1L5JA 5AQ7A 1DCQA 2VQ2A 4I6EA 3QDNA 4UUCA 5LCWJ 2P9NG 2R59A 3CHPA 2KBXA 3E34A 3ASNE 3UM1A 3V79K 4N3AA 1BI7B 1NA0A 3CVYA 4EZJA 5ENSD 4N5CA 1ELRA 3G2WA 3MA5A 3CLJA 4K5AB 1DCEA 1WDYA 1A5EA 5KJNA 4HORA 4DX7D 5EX0A 1TJFA 4HOSA 4BSXA 1PAQA 5G04C 3DPDA 5BT1A 3CVQA 2GRMA 2IOLA 3ML8A 1IHBA 2IO3C 1KT1A 4GCNA 5ANLA 2PM6A 1N4QA 4J8SA 1FT2A 2WXNA 3I3NA 3TWXA 4EECA 3FDHA 2IU1A 4MKTA 4GZ6A 3FU6A 3IBEA 1E8ZA 2WXKA 1TNUA 2ZGGA 2FEZA 3DSXA 3FUKA 3KEZA 5D0OD 5D2MC 2WXPA 2JABA 4KVOA 3ZYKA 2V5FA 2Y0BG 3EIJA 1UN9A 4U0SA 3LVRE 4ZHBA 4UQYA 2WVIA 3TWVA 2LAIA 2BUGA 2C0MA 2ETCA 3OXFA 3BU8A 1Z3YA 2WXIA 1DC2A 3APDA 4G8LA 3AS8A 2HM8A 2PL2A 3KS2A 3LY8A 4EQFA 2BKKB 1EDUA 4FADA 3L54A 2LXMA 4GYWA 3DRAA 5E76A 2VJ8A 1H2UA 5JHAA 3FUHA 5KJMA 1VDYA 3GZ1A 3PZ3A 4I1AA 1HE8A 2L6JA 5FT9A 2DCPA 1G3NB 2VGXA 1QBQA 4U8YD 4WNDA 2P9LG 1H0AA 2VGEA 3NQPA 1HS6A 2OCCE 4A55A 3UIPC 4Q69A 3NZUA 3TWSA 2OV8A 4J8DA 2LNIA 2V4LA 3LKUA 4DLQA 2P9KG 3EHQA 5ENRD 4CCAA 5LCWC 4J0UA 3BQOA 3RO3A 3W9FA 5EIDA 3LCAA 2R05A 1HG5A 3LJNA 4I2ZA 2J07A 5AYWD 3ASDA 3O4ZA 4ILHB 2H6FA 2LSVA 4DX6D 3CVXA 4N5QA 3SQVA 4JA7A 2QY7A 3UUXA 3DSSA 4A63B 1JCRA 2XENA 2WXHA 4TUMA 4CRWA 3NZSA 3CK7A 2J4DA 2GGFA 5BW8C 3ZUVB 3CK9A 3ZVVA 5BV1A 5EILA 4K03A 5D0QD 3Q78A 2I1JA 3OXGA 4WWPA 2HO1A 4ANXA 4AV7A 2YQ8A 5CBNA 4HRMB 2XZTG 5C1DA 4BT8A 5LX8A 4XX5A 3ZU7B 3Q9NC 2LUHA 4GAAA 1XNFA 3U3WA 1WM5A 3OAWA 4WWNA 2QC9A 2UY1B 4OVUA 4NRHB 3ESLA 3CSFA 3UPVA 5FJYA 1EPUA 4C0EA 1TR4A 1ZB1A 1GW6A 2BKGA 2E0IA 2LAHA 2OVFA 3AS4A 3D9PA 3UIOC 3QJZA 1KPSB 4M7CA 4U8HA 1YYHA 1Y6IA 2LO6A 4B94A 4GZDA 1MYOA 3FUFA 4LSZE 4F6RD 2CFZA 4Y6WA 3JXIA 4OVVA 2XRZA 4KVMA 4I1OB 3TAXA 4GTOA 4O1PA 3HHMA 5CEDB 3G2TA 3AAAC 4U95D 5LFAA 3ZPJA 4NACA 5CBOA 4BY6A 3JUIA 4APOA 4RVBA 4QQIA 1NP7A 3ZYQA 3T8KA 3L08A 5ENTD 3PEUB 4U63A 4NIKA 5A6CA 2L9BA 3NBNB 4LNBA 4UWLA 4GMJA 4DUIA 3P2BA 2Q7FA 3TL5A 3C98A 4AM9A 3URZA 3AG1E 2GW1A 1TN6A 5ENPD 3QAQA 2A5UA 1UJJA 1SQMA 1HO8A 4JEUA 4LEUA 3ASHA 3AU5A 5HRYA 3V31A 5EDSA 1WG0A 3DSUA 3ZFWA 4HNAD 2J49A 1HG2A 5CMYA 3X2QE 3EHNA 4JHKA 4U04A 1OY3D 4EBAG 4XKBA 3U66A 3KD7A 1K3ZD 3W9GA 5CERB 2AJAA 4APFA 1V55E 2XEEA 4TXRA 4DX1A 3AU4A 2KZTB 1TNYA 4YVOA 5HS0A 4LUNU 2RG8A 4RQIA 3LYAA 3UX4A 4X8QA 3ONLA 1E7UA 4FLHA 2PQRA 4FJYA 2LSUA 1QQEA 4YDOA 3ENEA 5FZRA 5ITZF 4AP2A 1ZU2A 3FTXA 4DI4A 4ACKA 2AVPA 3FWVA 4AY6A 1TYQG 3HXFA 2XPYA 4GA2A 1SA4A 3QWPA 3C5RA 4HOQA 2DZOA 2KCKA 3PS6A 1FCHA 2EINE 4OYSA 1HZ4A 1MX2A 1O1RA 3R7QA 5ANRA 2OEWA 2XS8A 4CDMA 4BTBA 1AWCB 4GMRA 3ZHEA 1OCCE 4D10C 1OUVA 2CG3A 2WQHA 4G26A 3QC1A 2F8YA 2I1KA 2WXJA 2WMNA 5FQ6A 3R9MA 2XEVA 3LEWA 5E75A 3QWWA 3ZXPA 2XPZA 3FH8A 4G8KA 3QARA 1QYMA 3PNLB 3D9NA 4JB8P 4PDXA 3WXXA 1SW6A 3U4TA 3DEOA 3DSTA 2J4BA 5A7DB 1IYGA 1N11A 3L22A 5EIBE 3D9KA 3QK0A 4YNDA 3BUAA 5LP0A 1N4RA 1FT1A 4XI9A 4Z68A 2I2OA 3PE4A 3PUJA 3APCA 4KT6B 3MKRA 5BXOA 3FTVA 4WAFA 4XI0A 2XRYA 5FZSA 1RZ4A 3FH7A 2L0IA 3UT4A 1LTXA 2YHCA 2QZAA 2R5SA 3NOCD 4V3IA 1OWLA 2VTBB 2B0OE 3PUKA 2VSOE 1JUQA 3ABLE 3WG7E 3Q47B 3Q7AA 3SNXA 4HI8A 4GYYA 2P2CP 3MZLB 4F3VA 4KZ0A 1D8DA 3F6QA 3CHMA 1H6OA 1MX6A 2H6HA 4PS3A 3D9MA 3J5PA 3ESKA 4JD2G 3KAEA 2AWIA 4HFGA 1OWPA 1KZOA 2FF4A 4FP7A 3RKVA 4YDYA 4G24A 5ENNA 4GPKA 5J90A 1JPLA 1BLXB 4K0RA 2C2LA 1MX4A 2ZIRA 3TXMA 5ARGA 3DPYA 3U9WA 5JJ6A 2WQ6A 4O60A 3D9JA 4LERA 3R9AB 5T8IA 1LF8A 1IQUA 2ZU6B 5HKPA 3L17A 3PZ2A 2RFMA 1K8KG 5A23A 3PZDA 5EKQD 4TRQA 4C48B 3CK8A 2X38A 2R03A 4I1MA 2XGSA 5EYLA 1N4SA 3OXLA 4B8CB 4U96D 1H2VC 2VSXE 3B7BA 1N94A 3EU5A 4IRUA 4B8AA 4L1BA 3MX3A 3HVEA 1E90A 3BG1B 3FP3A 3SD5A 3C3QA 3CVUA 3BG0B 4CGWA 3AG3E 2WM9A 4YVQC 4J7WA 3B7RL 5EN5D 3FTYA 4PS8A 4FULA 2ZGDA 5IY5E 3B7TA 3ZKJA 4UQXA 2XCBA 3Q49B 3TWWA 3DSWA 2CHXA 3HVEB 4Q94A 5BV0A 1HXIA 3RAUA 4XIFA 4G25A 3L13A 5CMWA 4H7XA 4PH4B 3E37A 3SBSA 3ZXSA 3HXDA 4WNFA 1H6KA 1UN8A 4FU3A 4EZLA 4KMOA 4J8EA 4A3TA 4G1TA 3JYSA 4URKA 4HRNA 3HXEA 1HX8A 3UKRG 3UT7A 5C2YA 3EDTB 5AQBA 1U3CA 3UKUG 3RIBA 2Y4UA 1JWFA 3ZRHA 4BFRA 4FA6A 3T5XA 4FHJA 1UJKA 4KBQA 4F1PA 3C3OA 3Q7FA 2R2LA 2EILE 2AXVA 2RKKA 2ONDA 2H6IA 4U07A 1IXVA 2QYUA 4DRXE 3RU0A 2GRNB 2V5QC 4KYOB 2UY1A 2Y69E 2NC9A 4JHRA 3VLDA 3I4RB 3TWQA 3EHMA 3JQ0A 3DBSA 5CECB 2IONA 1ELKA 4HS2A 4ATZD 4JEHA 2FBNA 3ULQA 2V8SE 3AS5A 3VLEA 2NXPA 2IJGX 3HDXA 4WNEA 1TNBA 1NFIE 4GTRA 3ZN3A 4JXTA 3ABME 5CHEE 1BD8A 2V0PA 2X3MA 3RRNB 2P9UG 3L82A 4O1OA 1E7VA 1Z3XA 4O6FA 1OWMA 3SGHA 2KCLA 3UM2A 4ME2A 3ABKE 1N54A 3CHQA 4G23A 1N52A 3FTWA 4AVXA 3RSEG 1BPOA 3B95A 3UTMA 2J08A 4I9EA 4GB9A 1SVXA 3O48A 2HR2A 3MGBA 4MS6A 5AQ9A 3D9OA 3FU5A 4MBGA 4AIFA 1OWOA 4GCOA 3QKYA 3B7UX 1X5BA 4K5CA 2WXLA 3U64A 5G2NA 5FZQA 3CVWA 2RFAA 2KATA 1WAO1 4DX5D 4CEMA 3IXEA 5JJTA 1DNPA 3T5VA 2NSZA 3IKOB 3CEQA 3GW4A 2CG2A 3TG5A 3DEPA 2WQ7A 4YDEA 3JCKC
chains in the Genus database with same CATH topology
2IU1A 4MKTA 4GZ6A 2PZIA 3FUNA 3FU6A 2VYIA 3IBEA 3R7QA 4N3BA 5M72A 5BNWA 5ANRA 1E8ZA 4DLOA 3SBTB 2WXKA 1DVPA 3IHYA 5T3RA 4CDMA 2VGYA 4BTBA 5AENA 4FHKA 3ZHEA 2FEZA 2IFUA 4J8FA 3FUKA 3UMVA 4DI3A 4D10C 1INZA 3ZYMA 1OUVA 3FEYA 3KEZA 2VSYA 5D0OD 3UQ3A 2WXQA 4HLEA 1SZ9A 2CG3A 2WQHA 2WXPA 4G26A 4U0UA 4KVOA 3QC1A 4Q96A 2I1KA 5CCLA 2WXJA 3ZYKA 2V5FA 2WMNA 4RG6A 3EIJA 1UN9A 5AJDA 3FEXA 5FQ6A 2XPIA 3CV0A 4U0SA 2AXZA 1E8XA 2XEVA 3LEWA 2A4ZA 3PE3A 2KC7A 5E75A 3LVRE 3LY7A 1WY6A 2WXMA 3QWWA 4UQYA 2WVIA 2LAIA 2XPZA 3FH8A 2J09A 3QARA 2BUGA 4AJWA 2C0MA 2HYZA 3PNLB 5HI7A 1JWGA 2KZTA 2Y4TA 3D9NA 3WXXA 3FY4A 3OXFA 4FLBA 4PDXA 3U4TA 2YHEA 1Z3YA 2WXIA 4GA0A 3FU0A 4W9RA 1U3DA 2J4BA 2FO7A 2KM4A 3APDA 5A7DB 3AS8A 1IYGA 2HM8A 2PL2A 3KS2A 3LY8A 4EQFA 3L22A 3CGHA 1EDUA 5FTPA 3S7DA 4FADA 3D9KA 2IQCA 4GYOA 3QK0A 4ILIA 4YNDA 3CVNA 5LP0A 3RRUA 2MHKA 3L54A 2EQXA 4GYWA 4XI9A 2I2OA 3PE4A 3PUJA 4UQZA 3APCA 4ANVA 4KT6B 3MKRA 4BTAA 4MLPA 4R7LA 3FTVA 4WAFA 3CKBA 4XI0A 1Z6TA 3QWVA 3I5PA 2XRYA 5E76A 3ML9A 2VJ8A 1A17A 4A1GA 4ANUA 3CVVA 4U0ZA 4N2QA 5FZSA 3FH7A 1H2UA 2IOSA 2L0IA 2OVBA 3UT4A 5JHAA 3FUHA 2YHCA 2XHEA 2R5SA 2WXFA 1VDYA 3GZ1A 5KJMA 4I1AA 4JZYA 4JVSA 4V3IA 1HE8A 1OWLA 2VTBB 3MV3B 4CDNA 2L6JA 5FT9A 4UWHA 3RJVA 3FHEA 3MEKA 2YINA 2DCPA 2RD0A 3PUKA 2VSOE 2PM7A 5CCMA 2VGXA 4WNDA 4KZCA 1H0AA 4BT9A 3PNTB 4L7TA 1JUQA 5T4YA 5AIJA 3NQPA 3Q47B 1HS6A 2UWJG 1HU3A 1MQSA 3S2AA 4A55A 4N39A 3SNXA 3CQCB 2X6FA 3RO2A 4Q69A 3NZUA 4N3CA 2OV8A 4GYYA 4J8DA 2LNIA 3SHFA 2V4LA 3LKUA 2E2EA 1ELWA 3MZLB 2DBAA 4AXHA 4DLQA 1W3BA 4F3VA 3EIQC 3UT8A 3FTUA 4CCAA 4KZ0A 4F53A 5LCWC 4J0UA 3RO3A 3CHMA 4F1SA 4PS3A 4EBAA 3D9MA 4DPRA 2XQ0A 3ESKA 3LCAA 3KAEA 1HG5A 2AWIA 4I2ZA 3RRMB 4HFGA 4P29A 2J07A 5AYWD 1OWPA 3ASDA 3FULA 3O4ZA 2FF4A 4FP7A 4ILHB 3RKVA 4G24A 4GZ5A 5ENNA 4GPKA 5J90A 1JPLA 4I6GA 5J08A 1UW4B 2KCVA 2LSVA 4K0RA 2C2LA 3QB2A 4BWRA 2CFUA 2WMOA 5G05J 4B89A 5KCMA 3CVPA 3CVXA 4I43A 3QOUA 2L0TB 1P5QA 2GRLA 4EZKA 4I6JA 3TXMA 3MJWA 5ARGA 4UI9J 3APFA 5KJLA 2Y3AA 4JA7A 2QY7A 4XE0A 5BPPA 3UUXA 3U9WA 5JJ6A 4ABNA 2FI7A 2WQ6A 4Y6CA 3D9JA 3MV2B 2MOWA 2WXHA 3MKQB 4A1SA 4CRWA 1S0PA 3NZSA 4I2WA 3CK7A 4JA9A 3Q15A 3CKCA 2J4DA 3IV0A 3CHRA 2GGFA 4LERA 4L23A 3LJ3A 3R9AB 5T8IA 4N2SA 3D9LA 4XKCA 5BW8C 2X6HA 1LF8A 4E85A 1IQUA 2ZU6B 3PREA 3CK9A 3ZGQA 1FVHA 1KT0A 1E8WA 4WNGA 3ZVVA 5BV1A 3R7RA 4K03A 5D0QD 3ASFA 4JPSA 4EPZA 1PY1A 2I1JA 3L17A 3G2SA 3LVQE 3OXGA 4WWPA 5KJKA 4JL0A 5ARFA 5A23A 2HO1A 3PZDA 5EKQD 4TRQA 4WWOA 3TGOA 4F7AA 4ANXA 4L2YA 2I6HA 3ZEFA 4AV7A 5EX3A 3S7FA 2YQ8A 3RK6A 4G2VA 5C1DA 3EJNA 3CK8A 3JQ1A 4BT8A 5LX8A 2X38A 4XX5A 4UI9K 2QFCA 4GU5A 2JLBA 2VTBA 2YNQA 2XGSA 4I1MA 3LDZA 3CHSA 3OXLA 3FUDA 3IEGA 4GA1A 1E96B 1TJCA 4GAAA 3P1UA 4M3OA 4B8CB 1XNFA 2WXRA 3U3WA 1H2VC 3QNKA 2J9QA 2VSXE 3GYZA 4PUCA 2BTDA 4IRUA 1WM5A 4B8AA 1ZBPA 3OAWA 4FC8A 1PC2A 1KLXA 4WWNA 3GZSA 4L1BA 3HIZA 2UY1B 3MX3A 5G55A 4GZ3A 2AW6A 3CR3A 3HVEA 4BX8A 4OVUA 2FULA 4H7YA 3SI5A 1E90A 3BG1B 4NRHB 5HQ8A 3FP3A 1E8YA 4C9BB 3ESLA 3CSFA 4I9CA 3UPVA 3ZYLA 5FJYA 1EPUA 4C0EA 2XGMA 2WPVA 5G04J 3SD5A 3FU3A 1GW6A 3L16A 3I4GA 3CVUA 1B89A 3BG0B 3E4BA 2E0IA 4QFVA 4A3VA 4CGWA 4LCTA 2WM9A 2LAHA 2OVFA 3HYMB 3PDNA 3ZIMA 1FVFA 4YVQC 1NZNA 5DIZA 3MCXA 3B7RL 1EF1C 3FTYA 4PS8A 3FH5A 4FULA 4B0ZA 4JHJA 4NURA 4ATGA 1QNFA 3G2UA 3B7TA 2WB2A 4DJAA 4UQXA 4E6HA 3AS4A 3D9PA 2OOEA 2CHWA 3OTNA 1HH8A 2VSNA 1HF8A 3NF1A 3QJZA 4HOUA 4U8HA 2XCBA 3Q49B 2PQNA 2CHXA 1Y6IA 3HVEB 4MRUA 4HOTA 1IHGA 2LO6A 1TEZA 4DK5A 4Q94A 5BV0A 4B94A 1HXIA 4GZDA 4XIFA 4AY5A 3MKQA 4RSYA 3FUFA 3SFZA 1Y8MA 4G25A 3K9IA 4ACLA 3L13A 5CMWA 3PH0C 5FWQA 4H7XA 4PH4B 3D9IA 4IYPA 2CFZA 3SBSA 3FTZA 3ZXSA 4Y6WA 4OVVA 2XRZA 4WNFA 1H6KA 1UG3A 4J6IA 1UN8A 4KVMA 5FQ8A 2MRIA 3TXNA 4FU3A 4I1OB 4ILGA 4KMOA 4EZLA 2XCCA 1H19A 4J8EA 1SZAA 5FQ4A 4AEZC 3TAXA 4RG9A 3HHMA 5LOZA 3G2TA 4A3TA 4G1TA 3JYSA 4URKA 4FJZA 1HX8A 3VTXA 1NA3A 3UT7A 5LFAA 3ZPJA 3LS8A 4NACA 3EDTB 5C2YA 4WUYA 4BY6A 1U3CA 3G2VA 3IHVA 3RIBA 2Y4UA 1JWFA 3ZRHA 3JUIA 3PEVB 4BFRA 1MHQA 4APOA 4FA6A 3T5XA 4RVBA 1NP7A 4FHJA 1UJKA 4KBQA 3Q5MA 3ZYQA 3TJPA 4GZCA 4JW1A 3ONKA 2P58C 3L08A 2AXVA 3PEUB 4U63A 5FQ7A 4HVBA 2ONDA 5A6CA 4U07A 4CGVA 3RU0A 2WXGA 2L9BA 4IULA 4UWLA 4IN3B 4GMJA 4KYOB 2UY1A 2NC9A 3P2BA 2Q7FA 3FUJA 4UWKA 3TL5A 4JHRA 4C0MA 3B13A 3VLFA 2X6KA 3VLDA 3I4RB 2WXOA 3C98A 4AM9A 1HFAA 3URZA 2X6IA 3EHMA 3LPZA 3JQ0A 3DBSA 2CHZA 1QZ2A 3T8MA 1XGWA 2GW1A 2IONA 4KXKB 1ELKA 1YA0A 4PS7A 3QAQA 2A5UA 2X6JA 1UJJA 4HS2A 1SQMA 1HO8A 4HXIA 4JEHA 5G05C 3B7SA 2FBNA 3ULQA 2JEKA 4JEUA 4LEUA 2V8SE 3CQGB 2IF4A 3AS5A 4UI9C 2I9CA 5DBKA 3MYVA 3ASHA 2C0LA 4NQ0A 3VLEA 2ILRA 4TV3A 3AU5A 3PRZA 1OWNA 5EDSA 3FUIA 2NXPA 4I17A 3ZHEB 4AOFA 2IJGX 1IQRA 4UWGA 3HDXA 4WNEA 4CT0A 3ZFWA 3CHOA 3FTSA 3S7JA 2J49A 1HG2A 5CMYA 3VTYA 1L5JA 3ZN3A 3EHNA 4JHKA 4XZ4A 4U04A 2VQ2A 4I6EA 3QDNA 4EBAG 4JXTA 4XKBA 5CHEE 5LCWJ 2V0PA 2X3MA 3RRNB 4TUUA 2R59A 3U66A 3CHPA 4CDRA 3KD7A 1E7VA 3S7BA 1Z3XA 3CIAA 3FUEA 4APFA 4O6FA 4UWFA 1OWMA 1EYHA 3SGHA 3BEEA 2KCLA 3SZ7A 3LXUX 3AU4A 2KZTB 4ME2A 4YVOA 4N3AA 1NA0A 1N54A 3CHQA 4LUNU 2RG8A 3LY9A 4G23A 3LYAA 3UX4A 3ZW3A 1N52A 3FTWA 3GZ2A 4AVXA 3CVYA 2DIWA 4G11A 4EZJA 3ONLA 1E7UA 1BPOA 4N5CA 1ELRA 3FUMA 4JC8A 3G2WA 2J08A 3MA5A 4I9EA 4FLHA 4GB9A 3CLJA 2PQRA 4LRZA 2AXUA 3O48A 4FJYA 1H2TC 2LSUA 2HR2A 3MGBA 1QQEA 4GMLA 4MS6A 3D9OA 3L6AA 3N71A 5JJ7A 3FU5A 3ENEA 5FZRA 4AIFA 4AP2A 1ZU2A 5KJNA 1OWOA 3D3MA 3FTXA 2BF0X 3B7UX 3QKYA 4GCOA 4HORA 4DI4A 4ACKA 1X5BA 2AVPA 1TJFA 3FWVA 5EX0A 4AY6A 2WXLA 4HOSA 3TG4A 3U64A 5G2NA 5FZQA 3CSTA 3CVWA 4BSXA 3SF4A 1PAQA 4BX9A 3CVLA 5G04C 3DPDA 3PVLA 2XPYA 5BT1A 3CVQA 3FFLA 2KATA 4GA2A 4ANWA 3QWPA 5JHBA 2GRMA 2IOLA 3ML8A 5BUZA 1WAO1 3Q4AB 4HOQA 4CEMA 5JJTA 1DNPA 2XGOA 3T5VA 2KCKA 2NSZA 5AJLA 1KT1A 3IKOB 3PS6A 4GCNA 3CEQA 5ANLA 3ASGA 2PM6A 1FCHA 2M63A 4J8SA 4L2LA 4OYSA 2VGXB 2WXNA 4CT4A 3GW4A 3I3NA 2CG2A 2R17C 4EECA 3TG5A 3FDHA 1HZ4A 2WQ7A 3JCKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ6 A;  2PZI A;  2VYI A;  4N3B A;  5M72 A;  5BNW A;  2VGY A;  4BTB A;  3ZHE A;  2FEZ A;  2IFU A;  4J8F A;  1OUV A;  2VSY A;  5D0O D;  3UQ3 A;  2WQH A;  4G26 A;  4U0U A;  5CCL A;  2V5F A;  4RG6 A;  2XPI A;  3CV0 A;  4U0S A;  2XEV A;  3PE3 A;  2KC7 A;  3LY7 A;  3QWW A;  4UQY A;  2BUG A;  2C0M A;  2HYZ A;  5HI7 A;  2Y4T A;  3WXX A;  3OXF A;  3U4T A;  4GA0 A;  4W9R A;  2FO7 A;  5A7D B;  3AS8 A;  1IYG A;  2PL2 A;  3KS2 A;  3LY8 A;  4EQF A;  5FTP A;  3S7D A;  4GYO A;  4YND A;  3CVN A;  2MHK A;  4GYW A;  4XI9 A;  3PE4 A;  4UQZ A;  3MKR A;  4BTA A;  3CKB A;  4XI0 A;  3QWV A;  1A17 A;  4U0Z A;  4N2Q A;  5FZS A;  2YHC A;  2R5S A;  5KJM A;  3GZ1 A;  4I1A A;  3MV3 B;  2L6J A;  5FT9 A;  3RJV A;  3MEK A;  5CCM A;  2VGX A;  4WND A;  4BT9 A;  3Q47 B;  2UWJ G;  4N39 A;  3RO2 A;  4N3C A;  4GYY A;  4J8D A;  2LNI A;  3LKU A;  2E2E A;  1ELW A;  2DBA A;  1W3B A;  4F3V A;  5LCW C;  4J0U A;  3RO3 A;  3ESK A;  3LCA A;  3KAE A;  4I2Z A;  5AYW D;  3ASD A;  2FF4 A;  3RKV A;  4G24 A;  4GZ5 A;  4GPK A;  2KCV A;  2LSV A;  2C2L A;  4BWR A;  5G05 J;  3CVP A;  3QOU A;  1P5Q A;  5ARG A;  4UI9 J;  5KJL A;  4JA7 A;  3UUX A;  5JJ6 A;  4ABN A;  2FI7 A;  4Y6C A;  3MV2 B;  4A1S A;  4I2W A;  3CK7 A;  4JA9 A;  3Q15 A;  3CKC A;  3R9A B;  4N2S A;  5BW8 C;  3ZGQ A;  3CK9 A;  1KT0 A;  4WNG A;  5D0Q D;  3ASF A;  3OXG A;  5KJK A;  4JL0 A;  5ARF A;  2HO1 A;  5EKQ D;  3TGO A;  2I6H A;  5EX3 A;  3S7F A;  2YQ8 A;  4G2V A;  5C1D A;  3CK8 A;  4BT8 A;  4UI9 K;  2QFC A;  2JLB A;  2XGS A;  3OXL A;  3IEG A;  4GA1 A;  1E96 B;  1TJC A;  1XNF A;  3U3W A;  2J9Q A;  3GYZ A;  1WM5 A;  1ZBP A;  1PC2 A;  1KLX A;  2UY1 B;  4GZ3 A;  4H7Y A;  4NRH B;  5HQ8 A;  3FP3 A;  4I9C A;  3UPV A;  5FJY A;  2XGM A;  2WPV A;  5G04 J;  1B89 A;  3E4B A;  4CGW A;  3HYM B;  3PDN A;  4YVQ C;  1NZN A;  5DIZ A;  4UQX A;  3AS4 A;  2OOE A;  1HH8 A;  2VSN A;  3NF1 A;  4HOU A;  2XCB A;  3Q49 B;  2PQN A;  4HOT A;  1IHG A;  4B94 A;  1HXI A;  4XIF A;  4AY5 A;  1Y8M A;  4G25 A;  3K9I A;  4H7X A;  4Y6W A;  4WNF A;  2XCC A;  4J8E A;  3TAX A;  4RG9 A;  4G1T A;  3JYS A;  1NA3 A;  3ZPJ A;  3EDT B;  4WUY A;  3RIB A;  2Y4U A;  4APO A;  4KBQ A;  3Q5M A;  2P58 C;  2OND A;  5A6C A;  4U07 A;  4CGV A;  3RU0 A;  4IN3 B;  4KYO B;  2UY1 A;  2NC9 A;  2Q7F A;  4JHR A;  4AM9 A;  3URZ A;  3LPZ A;  1QZ2 A;  2GW1 A;  4KXK B;  1YA0 A;  5G05 C;  2FBN A;  3ULQ A;  4LEU A;  4UI9 C;  2IF4 A;  3AS5 A;  5DBK A;  4NQ0 A;  3ASH A;  2C0L A;  4I17 A;  3ZHE B;  4WNE A;  3ZFW A;  3S7J A;  3VTY A;  3ZN3 A;  4U04 A;  2VQ2 A;  3QDN A;  5CHE E;  5LCW J;  4CDR A;  3KD7 A;  3S7B A;  4O6F A;  3BEE A;  2KCL A;  3SZ7 A;  4YVO A;  4ME2 A;  4N3A A;  1NA0 A;  3LY9 A;  4G23 A;  3LYA A;  3GZ2 A;  4N5C A;  1ELR A;  4I9E A;  3MA5 A;  2PQR A;  3O48 A;  2LSU A;  2HR2 A;  1QQE A;  3N71 A;  5JJ7 A;  5FZR A;  4AIF A;  1ZU2 A;  5KJN A;  4GCO A;  3QKY A;  4HOR A;  5EX0 A;  2AVP A;  3FWV A;  4HOS A;  4AY6 A;  3TG4 A;  5FZQ A;  3SF4 A;  3CVL A;  5G04 C;  5BT1 A;  3CVQ A;  3FFL A;  2KAT A;  4GA2 A;  3QWP A;  1WAO 1;  3Q4A B;  4HOQ A;  5JJT A;  2XGO A;  2KCK A;  1KT1 A;  4GCN A;  3CEQ A;  3ASG A;  1FCH A;  2VGX B;  3GW4 A;  3TG5 A;  1HZ4 A;  3VTX A; 
#chains in the Genus database with same CATH topology
 2PZI A;  3FUN A;  4N3B A;  5M72 A;  4DLO A;  3EU9 A;  1DVP A;  5T3R A;  2R02 A;  1LD7 A;  1H6P A;  4FHK A;  1OT8 A;  3UMV A;  4DI3 A;  1TNZ A;  1INZ A;  3UQ3 A;  1OCO E;  2WXQ A;  4HLE A;  1SZ9 A;  3ULE G;  5B1A E;  4Q96 A;  5CCL A;  4RG6 A;  1O1S A;  3FEX A;  2XPI A;  3CV0 A;  2AXZ A;  1E8X A;  2A4Z A;  3PE3 A;  2ZIS A;  2WXM A;  2J09 A;  2B6C A;  2OEV A;  2HYZ A;  5HI7 A;  1S63 A;  2KZT A;  3FY4 A;  4FLB A;  3ZNG A;  3FU0 A;  5KNG A;  1U3D A;  5FIN A;  3SFX A;  5CEA A;  1OXJ A;  3EHR A;  3NB2 A;  4HRL A;  5FTP A;  2IQC A;  4ILI A;  3CVN A;  3AG2 E;  4BTA A;  4HB5 A;  4MLP A;  1Z6T A;  3I5P A;  3ML9 A;  1A17 A;  2ZXW E;  2OVB A;  3UIN C;  4BES A;  2XHE A;  4JZY A;  1V54 E;  4CDN A;  3RJV A;  3MEK A;  2V4H C;  2YIN A;  3FHE A;  4EHM A;  4DX2 A;  2DVW A;  3PNT B;  4L7T A;  5T4Y A;  4GTT A;  5AIJ A;  3SY2 A;  2UWJ G;  1HU3 A;  1MQS A;  3S2A A;  3CQC B;  2X6F A;  4BEP A;  3SHF A;  3J5Q B;  5H7P A;  2DBA A;  4TXP A;  4HQD A;  4EBA A;  4LNU D;  2XEH A;  2XZD G;  4P29 A;  3FUL A;  3KEA A;  4BWR A;  2CFU A;  5G05 J;  4B89 A;  5KCM A;  3CVP A;  4I43 A;  2L0T B;  1P5Q A;  1UOH A;  4I6J A;  4UI9 J;  3APF A;  5KJL A;  2Y3A A;  4L9P A;  3SO8 A;  4Y6C A;  1S70 B;  3MKQ B;  4A1S A;  1S0P A;  3PZ1 A;  3IV0 A;  4L23 A;  4N2S A;  3D9L A;  4XKC A;  3PRE A;  3C72 A;  3ZGQ A;  1E8W A;  4WNG A;  3ASF A;  1PY1 A;  4LNG A;  2LXL A;  4JL0 A;  4F7A A;  4L2Y A;  2I6H A;  3ZEF A;  5EX3 A;  3S7F A;  4UI9 K;  4XEI G;  2VTB A;  2YNQ A;  3LDZ A;  4YDW A;  3CHS A;  1YCS B;  3FUD A;  2IO2 C;  1N4P A;  3IEG A;  1E96 B;  1TJC A;  4M3O A;  3E30 A;  4PUC A;  5D66 A;  1D9S A;  1N0Q A;  4FC8 A;  1PC2 A;  1KLX A;  3GZS A;  5G55 A;  4BX8 A;  4GZ3 A;  2AW6 A;  3CR3 A;  3NAW A;  5FIO A;  4I9C A;  3ZYL A;  3HRA A;  2WPV A;  3L16 A;  2L6B A;  3I4G A;  4CZ2 D;  2NYJ A;  4QFV A;  4A3V A;  4LCT A;  1FVF A;  5DIZ A;  4JHJ A;  4NUR A;  4DJA A;  3HXB A;  4E6H A;  2CHW A;  1HH8 A;  2VSN A;  3NF1 A;  2PQN A;  1S64 A;  4HOT A;  4DK5 A;  2H6G A;  1YMP A;  4RSY A;  2F0Y A;  3KSL A;  1Y8M A;  3K9I A;  4ACL A;  3PH0 C;  4B93 B;  3FTZ A;  4J6I A;  5FQ8 A;  3TXN A;  4ILG A;  3AJI A;  2XCC A;  1H19 A;  5AN8 A;  1SZA A;  2QYJ A;  4RG9 A;  4FJZ A;  3V2O A;  3D9H A;  2A5E A;  3IHV A;  1O1T A;  1MHQ A;  1K1A A;  3Q5M A;  3UXG A;  1SA5 A;  2P58 C;  1JCQ A;  4CGV A;  2DZN A;  2WXG A;  4GTS A;  4IUL A;  1MJ0 A;  2X6K A;  3LPZ A;  2CHZ A;  1QZ2 A;  1XGW A;  3L9T A;  1YA0 A;  4PS7 A;  5G05 C;  4OAU C;  2J8S D;  3CQG B;  3NOG D;  4UI9 C;  2I9C A;  3MYV A;  4NQ0 A;  2EIK E;  4AOF A;  1IQR A;  5BXU A;  3CHO A;  3S7J A;  3VTY A;  5AQA A;  3PZ4 A;  3HG0 D;  4XZ4 A;  4TUU A;  3UI2 A;  4CDR A;  3S7B A;  4K5B A;  4HBD A;  3CIA A;  3FUE A;  4UWF A;  1EYH A;  3BEE A;  3SZ7 A;  3LXU X;  5KNH D;  5KWD A;  3LY9 A;  1K1B A;  3ZW3 A;  1JCS A;  1MZC A;  3GZ2 A;  2DIW A;  4G11 A;  3FUM A;  4JC8 A;  4LRZ A;  2AXU A;  4HLL A;  1H2T C;  4GML A;  3L6A A;  3N71 A;  5JJ7 A;  4BSZ B;  3D3M A;  2BF0 X;  3TG4 A;  3CST A;  1NI1 A;  3SF4 A;  4BX9 A;  3CVL A;  3PVL A;  3FFL A;  3E33 A;  5B3S E;  4ANW A;  5JHB A;  5BUZ A;  2FO1 E;  3Q4A B;  2XGO A;  5AAR A;  5AJL A;  3ASG A;  2M63 A;  4L2L A;  2VGX B;  4CT4 A;  3C3R A;  2R17 C;  5AAO A;  3VTX A;  1RW2 A;  2VYI A;  5BNW A;  3SBT B;  4LG6 A;  3IHY A;  2VGY A;  5ENO D;  3TWT A;  5AEN A;  4TXQ A;  3V30 A;  2IFU A;  4J8F A;  2GRR B;  3ZYM A;  3FEY A;  2VSY A;  2ETA A;  1OCZ E;  1KZP A;  4U0U A;  5AJD A;  4CYM D;  5B1B E;  2P9S G;  2KC7 A;  5CRV A;  1N9A A;  3LY7 A;  1WY6 A;  1BI8 B;  2EIJ E;  4AJW A;  1JWG A;  3EUV A;  5EYP F;  2Y4T A;  2YHE A;  4GA0 A;  4W9R A;  2FO7 A;  2KM4 A;  3CGH A;  3S7D A;  3Q73 A;  4GYO A;  3UM0 A;  2BED A;  5ENQ D;  3RRU A;  2MHK A;  2EQX A;  4UQZ A;  4ANV A;  2MYO A;  4R7L A;  1TN8 A;  3CKB A;  3QWV A;  4A1G A;  4ANU A;  3CVV A;  4U0Z A;  4N2Q A;  2IOS A;  3DXK G;  2WXF A;  4JVS A;  3MV3 B;  2PNN A;  4UWH A;  3DWL G;  2RD0 A;  2PM7 A;  3UM3 A;  5CCM A;  4KZC A;  4GTP A;  4BT9 A;  3JUE A;  2IY0 C;  4N39 A;  3JXJ A;  3RO2 A;  4N3C A;  1TNO A;  4GTQ A;  2E2E A;  1ELW A;  4AXH A;  1W3B A;  3EIQ C;  3UT8 A;  2GRP B;  3FTU A;  4F53 A;  2DYS E;  3TWR A;  1AP7 A;  4F1S A;  4DPR A;  2XQ0 A;  3RRM B;  3SFY A;  3KSQ A;  1TN7 A;  2GRO B;  4GZ5 A;  2P9I G;  4I6G A;  5J08 A;  1UW4 B;  2KCV A;  3QB2 A;  2WMO A;  4RLY A;  4OAV B;  3QOU A;  4GPM A;  2GRL A;  4EZK A;  3MJW A;  4XE0 A;  5BPP A;  4HI9 A;  2DWZ A;  4ABN A;  2FI7 A;  3MV2 B;  2MOW A;  3ISM C;  4I2W A;  3TWU A;  4JA9 A;  3Q15 A;  3CKC A;  3CHR A;  3LJ3 A;  2KXP C;  5JA4 D;  4E85 A;  2X6H A;  1FVH A;  1KT0 A;  3R7R A;  4EPZ A;  4JPS A;  3LVQ E;  3G2S A;  5KJK A;  5ARF A;  4WWO A;  3TGO A;  4U7E B;  4BET A;  2Y1L E;  3AG4 E;  2HE0 A;  3RK6 A;  4G2V A;  3EJN A;  3JQ1 A;  1IKN D;  2QFC A;  4GU5 A;  2JLB A;  1Z5S C;  2GRQ B;  4GA1 A;  2IEJ A;  3P1U A;  2WXR A;  3QNK A;  2J9Q A;  3E32 A;  3GYZ A;  2BTD A;  3T9K A;  1ZBP A;  3HIZ A;  4GTV A;  2FUL A;  4H7Y A;  3SI5 A;  2F37 A;  5HQ8 A;  1E8Y A;  4C9B B;  2XGM A;  5G04 J;  3FU3 A;  1B89 A;  3E4B A;  3HYM B;  3PDN A;  3ZIM A;  1N95 A;  1NZN A;  1NL4 A;  3MCX A;  1EF1 C;  3FH5 A;  4B0Z A;  4ATG A;  1QNF A;  3G2U A;  2WB2 A;  2OOE A;  3OTN A;  1HF8 A;  4HOU A;  2EIM E;  4J8Y A;  3DXM G;  4MRU A;  1IHG A;  1TEZ A;  4AY5 A;  3MKQ A;  3SFZ A;  3DSV A;  5FWQ A;  3D9I A;  5KBA A;  4IYP A;  2P9P G;  1UG3 A;  1O5M A;  2MRI A;  2XS1 A;  3Q79 A;  4BER A;  5FQ4 A;  4AEZ C;  1D8E A;  3HXC A;  5LOZ A;  1NA3 A;  1OCR E;  3LS8 A;  4WUY A;  2DYR E;  3G2V A;  3ULY A;  3PEV B;  3TJP A;  4GZC A;  4JW1 A;  3ONK A;  4GTM A;  4U8V D;  3V2X A;  5FQ7 A;  4HVB A;  1FPP A;  4IN3 B;  1U2V G;  2F8X K;  2ETB A;  3FUJ A;  4UWK A;  4C0M A;  5JMN D;  1X81 A;  3B13 A;  3VLF A;  2WXO A;  1HFA A;  2X6I A;  3T8M A;  4KXK B;  2X6J A;  4HXI A;  3B7S A;  4ZFH A;  2JEK A;  1N0R A;  2IF4 A;  5DBK A;  2C0L A;  3ASO E;  2ILR A;  4TV3 A;  5CRU A;  3PRZ A;  1OWN A;  3FUI A;  4I17 A;  3ZHE B;  3Q9U C;  1LD8 A;  4UWG A;  1BU9 A;  1Q2Z A;  4CT0 A;  3Q75 A;  3FTS A;  1L5J A;  5AQ7 A;  1DCQ A;  2VQ2 A;  4I6E A;  3QDN A;  4UUC A;  5LCW J;  2P9N G;  2R59 A;  3CHP A;  2KBX A;  3E34 A;  3ASN E;  3UM1 A;  3V79 K;  4N3A A;  1BI7 B;  1NA0 A;  3CVY A;  4EZJ A;  5ENS D;  4N5C A;  1ELR A;  3G2W A;  3MA5 A;  3CLJ A;  4K5A B;  1DCE A;  1WDY A;  1A5E A;  5KJN A;  4HOR A;  4DX7 D;  5EX0 A;  1TJF A;  4HOS A;  4BSX A;  1PAQ A;  5G04 C;  3DPD A;  5BT1 A;  3CVQ A;  2GRM A;  2IOL A;  3ML8 A;  1IHB A;  2IO3 C;  1KT1 A;  4GCN A;  5ANL A;  2PM6 A;  1N4Q A;  4J8S A;  1FT2 A;  2WXN A;  3I3N A;  3TWX A;  4EEC A;  3FDH A;  2IU1 A;  4MKT A;  4GZ6 A;  3FU6 A;  3IBE A;  1E8Z A;  2WXK A;  1TNU A;  2ZGG A;  2FEZ A;  3DSX A;  3FUK A;  3KEZ A;  5D0O D;  5D2M C;  2WXP A;  2JAB A;  4KVO A;  3ZYK A;  2V5F A;  2Y0B G;  3EIJ A;  1UN9 A;  4U0S A;  3LVR E;  4ZHB A;  4UQY A;  2WVI A;  3TWV A;  2LAI A;  2BUG A;  2C0M A;  2ETC A;  3OXF A;  3BU8 A;  1Z3Y A;  2WXI A;  1DC2 A;  3APD A;  4G8L A;  3AS8 A;  2HM8 A;  2PL2 A;  3KS2 A;  3LY8 A;  4EQF A;  2BKK B;  1EDU A;  4FAD A;  3L54 A;  2LXM A;  4GYW A;  3DRA A;  5E76 A;  2VJ8 A;  1H2U A;  5JHA A;  3FUH A;  5KJM A;  1VDY A;  3GZ1 A;  3PZ3 A;  4I1A A;  1HE8 A;  2L6J A;  5FT9 A;  2DCP A;  1G3N B;  2VGX A;  1QBQ A;  4U8Y D;  4WND A;  2P9L G;  1H0A A;  2VGE A;  3NQP A;  1HS6 A;  2OCC E;  4A55 A;  3UIP C;  4Q69 A;  3NZU A;  3TWS A;  2OV8 A;  4J8D A;  2LNI A;  2V4L A;  3LKU A;  4DLQ A;  2P9K G;  3EHQ A;  5ENR D;  4CCA A;  5LCW C;  4J0U A;  3BQO A;  3RO3 A;  3W9F A;  5EID A;  3LCA A;  2R05 A;  1HG5 A;  3LJN A;  4I2Z A;  2J07 A;  5AYW D;  3ASD A;  3O4Z A;  4ILH B;  2H6F A;  2LSV A;  4DX6 D;  3CVX A;  4N5Q A;  3SQV A;  4JA7 A;  2QY7 A;  3UUX A;  3DSS A;  4A63 B;  1JCR A;  2XEN A;  2WXH A;  4TUM A;  4CRW A;  3NZS A;  3CK7 A;  2J4D A;  2GGF A;  5BW8 C;  3ZUV B;  3CK9 A;  3ZVV A;  5BV1 A;  5EIL A;  4K03 A;  5D0Q D;  3Q78 A;  2I1J A;  3OXG A;  4WWP A;  2HO1 A;  4ANX A;  4AV7 A;  2YQ8 A;  5CBN A;  4HRM B;  2XZT G;  5C1D A;  4BT8 A;  5LX8 A;  4XX5 A;  3ZU7 B;  3Q9N C;  2LUH A;  4GAA A;  1XNF A;  3U3W A;  1WM5 A;  3OAW A;  4WWN A;  2QC9 A;  2UY1 B;  4OVU A;  4NRH B;  3ESL A;  3CSF A;  3UPV A;  5FJY A;  1EPU A;  4C0E A;  1TR4 A;  1ZB1 A;  1GW6 A;  2BKG A;  2E0I A;  2LAH A;  2OVF A;  3AS4 A;  3D9P A;  3UIO C;  3QJZ A;  1KPS B;  4M7C A;  4U8H A;  1YYH A;  1Y6I A;  2LO6 A;  4B94 A;  4GZD A;  1MYO A;  3FUF A;  4LSZ E;  4F6R D;  2CFZ A;  4Y6W A;  3JXI A;  4OVV A;  2XRZ A;  4KVM A;  4I1O B;  3TAX A;  4GTO A;  4O1P A;  3HHM A;  5CED B;  3G2T A;  3AAA C;  4U95 D;  5LFA A;  3ZPJ A;  4NAC A;  5CBO A;  4BY6 A;  3JUI A;  4APO A;  4RVB A;  4QQI A;  1NP7 A;  3ZYQ A;  3T8K A;  3L08 A;  5ENT D;  3PEU B;  4U63 A;  4NIK A;  5A6C A;  2L9B A;  3NBN B;  4LNB A;  4UWL A;  4GMJ A;  4DUI A;  3P2B A;  2Q7F A;  3TL5 A;  3C98 A;  4AM9 A;  3URZ A;  3AG1 E;  2GW1 A;  1TN6 A;  5ENP D;  3QAQ A;  2A5U A;  1UJJ A;  1SQM A;  1HO8 A;  4JEU A;  4LEU A;  3ASH A;  3AU5 A;  5HRY A;  3V31 A;  5EDS A;  1WG0 A;  3DSU A;  3ZFW A;  4HNA D;  2J49 A;  1HG2 A;  5CMY A;  3X2Q E;  3EHN A;  4JHK A;  4U04 A;  1OY3 D;  4EBA G;  4XKB A;  3U66 A;  3KD7 A;  1K3Z D;  3W9G A;  5CER B;  2AJA A;  4APF A;  1V55 E;  2XEE A;  4TXR A;  4DX1 A;  3AU4 A;  2KZT B;  1TNY A;  4YVO A;  5HS0 A;  4LUN U;  2RG8 A;  4RQI A;  3LYA A;  3UX4 A;  4X8Q A;  3ONL A;  1E7U A;  4FLH A;  2PQR A;  4FJY A;  2LSU A;  1QQE A;  4YDO A;  3ENE A;  5FZR A;  5ITZ F;  4AP2 A;  1ZU2 A;  3FTX A;  4DI4 A;  4ACK A;  2AVP A;  3FWV A;  4AY6 A;  1TYQ G;  3HXF A;  2XPY A;  4GA2 A;  1SA4 A;  3QWP A;  3C5R A;  4HOQ A;  2DZO A;  2KCK A;  3PS6 A;  1FCH A;  2EIN E;  4OYS A;  1HZ4 A;  1MX2 A;  1O1R A;  3R7Q A;  5ANR A;  2OEW A;  2XS8 A;  4CDM A;  4BTB A;  1AWC B;  4GMR A;  3ZHE A;  1OCC E;  4D10 C;  1OUV A;  2CG3 A;  2WQH A;  4G26 A;  3QC1 A;  2F8Y A;  2I1K A;  2WXJ A;  2WMN A;  5FQ6 A;  3R9M A;  2XEV A;  3LEW A;  5E75 A;  3QWW A;  3ZXP A;  2XPZ A;  3FH8 A;  4G8K A;  3QAR A;  1QYM A;  3PNL B;  3D9N A;  4JB8 P;  4PDX A;  3WXX A;  1SW6 A;  3U4T A;  3DEO A;  3DST A;  2J4B A;  5A7D B;  1IYG A;  1N11 A;  3L22 A;  5EIB E;  3D9K A;  3QK0 A;  4YND A;  3BUA A;  5LP0 A;  1N4R A;  1FT1 A;  4XI9 A;  4Z68 A;  2I2O A;  3PE4 A;  3PUJ A;  3APC A;  4KT6 B;  3MKR A;  5BXO A;  3FTV A;  4WAF A;  4XI0 A;  2XRY A;  5FZS A;  1RZ4 A;  3FH7 A;  2L0I A;  3UT4 A;  1LTX A;  2YHC A;  2QZA A;  2R5S A;  3NOC D;  4V3I A;  1OWL A;  2VTB B;  2B0O E;  3PUK A;  2VSO E;  1JUQ A;  3ABL E;  3WG7 E;  3Q47 B;  3Q7A A;  3SNX A;  4HI8 A;  4GYY A;  2P2C P;  3MZL B;  4F3V A;  4KZ0 A;  1D8D A;  3F6Q A;  3CHM A;  1H6O A;  1MX6 A;  2H6H A;  4PS3 A;  3D9M A;  3J5P A;  3ESK A;  4JD2 G;  3KAE A;  2AWI A;  4HFG A;  1OWP A;  1KZO A;  2FF4 A;  4FP7 A;  3RKV A;  4YDY A;  4G24 A;  5ENN A;  4GPK A;  5J90 A;  1JPL A;  1BLX B;  4K0R A;  2C2L A;  1MX4 A;  2ZIR A;  3TXM A;  5ARG A;  3DPY A;  3U9W A;  5JJ6 A;  2WQ6 A;  4O60 A;  3D9J A;  4LER A;  3R9A B;  5T8I A;  1LF8 A;  1IQU A;  2ZU6 B;  5HKP A;  3L17 A;  3PZ2 A;  2RFM A;  1K8K G;  5A23 A;  3PZD A;  5EKQ D;  4TRQ A;  4C48 B;  3CK8 A;  2X38 A;  2R03 A;  4I1M A;  2XGS A;  5EYL A;  1N4S A;  3OXL A;  4B8C B;  4U96 D;  1H2V C;  2VSX E;  3B7B A;  1N94 A;  3EU5 A;  4IRU A;  4B8A A;  4L1B A;  3MX3 A;  3HVE A;  1E90 A;  3BG1 B;  3FP3 A;  3SD5 A;  3C3Q A;  3CVU A;  3BG0 B;  4CGW A;  3AG3 E;  2WM9 A;  4YVQ C;  4J7W A;  3B7R L;  5EN5 D;  3FTY A;  4PS8 A;  4FUL A;  2ZGD A;  5IY5 E;  3B7T A;  3ZKJ A;  4UQX A;  2XCB A;  3Q49 B;  3TWW A;  3DSW A;  2CHX A;  3HVE B;  4Q94 A;  5BV0 A;  1HXI A;  3RAU A;  4XIF A;  4G25 A;  3L13 A;  5CMW A;  4H7X A;  4PH4 B;  3E37 A;  3SBS A;  3ZXS A;  3HXD A;  4WNF A;  1H6K A;  1UN8 A;  4FU3 A;  4EZL A;  4KMO A;  4J8E A;  4A3T A;  4G1T A;  3JYS A;  4URK A;  4HRN A;  3HXE A;  1HX8 A;  3UKR G;  3UT7 A;  5C2Y A;  3EDT B;  5AQB A;  1U3C A;  3UKU G;  3RIB A;  2Y4U A;  1JWF A;  3ZRH A;  4BFR A;  4FA6 A;  3T5X A;  4FHJ A;  1UJK A;  4KBQ A;  4F1P A;  3C3O A;  3Q7F A;  2R2L A;  2EIL E;  2AXV A;  2RKK A;  2OND A;  2H6I A;  4U07 A;  1IXV A;  2QYU A;  4DRX E;  3RU0 A;  2GRN B;  2V5Q C;  4KYO B;  2UY1 A;  2Y69 E;  2NC9 A;  4JHR A;  3VLD A;  3I4R B;  3TWQ A;  3EHM A;  3JQ0 A;  3DBS A;  5CEC B;  2ION A;  1ELK A;  4HS2 A;  4ATZ D;  4JEH A;  2FBN A;  3ULQ A;  2V8S E;  3AS5 A;  3VLE A;  2NXP A;  2IJG X;  3HDX A;  4WNE A;  1TNB A;  1NFI E;  4GTR A;  3ZN3 A;  4JXT A;  3ABM E;  5CHE E;  1BD8 A;  2V0P A;  2X3M A;  3RRN B;  2P9U G;  3L82 A;  4O1O A;  1E7V A;  1Z3X A;  4O6F A;  1OWM A;  3SGH A;  2KCL A;  3UM2 A;  4ME2 A;  3ABK E;  1N54 A;  3CHQ A;  4G23 A;  1N52 A;  3FTW A;  4AVX A;  3RSE G;  1BPO A;  3B95 A;  3UTM A;  2J08 A;  4I9E A;  4GB9 A;  1SVX A;  3O48 A;  2HR2 A;  3MGB A;  4MS6 A;  5AQ9 A;  3D9O A;  3FU5 A;  4MBG A;  4AIF A;  1OWO A;  4GCO A;  3QKY A;  3B7U X;  1X5B A;  4K5C A;  2WXL A;  3U64 A;  5G2N A;  5FZQ A;  3CVW A;  2RFA A;  2KAT A;  1WAO 1;  4DX5 D;  4CEM A;  3IXE A;  5JJT A;  1DNP A;  3T5V A;  2NSZ A;  3IKO B;  3CEQ A;  3GW4 A;  2CG2 A;  3TG5 A;  3DEP A;  2WQ7 A;  4YDE A;  3JCK C; 
#chains in the Genus database with same CATH homology
 2IU1 A;  4MKT A;  4GZ6 A;  2PZI A;  3FUN A;  3FU6 A;  2VYI A;  3IBE A;  3R7Q A;  4N3B A;  5M72 A;  5BNW A;  5ANR A;  1E8Z A;  4DLO A;  3SBT B;  2WXK A;  1DVP A;  3IHY A;  5T3R A;  4CDM A;  2VGY A;  4BTB A;  5AEN A;  4FHK A;  3ZHE A;  2FEZ A;  2IFU A;  4J8F A;  3FUK A;  3UMV A;  4DI3 A;  4D10 C;  1INZ A;  3ZYM A;  1OUV A;  3FEY A;  3KEZ A;  2VSY A;  5D0O D;  3UQ3 A;  2WXQ A;  4HLE A;  1SZ9 A;  2CG3 A;  2WQH A;  2WXP A;  4G26 A;  4U0U A;  4KVO A;  3QC1 A;  4Q96 A;  2I1K A;  5CCL A;  2WXJ A;  3ZYK A;  2V5F A;  2WMN A;  4RG6 A;  3EIJ A;  1UN9 A;  5AJD A;  3FEX A;  5FQ6 A;  2XPI A;  3CV0 A;  4U0S A;  2AXZ A;  1E8X A;  2XEV A;  3LEW A;  2A4Z A;  3PE3 A;  2KC7 A;  5E75 A;  3LVR E;  3LY7 A;  1WY6 A;  2WXM A;  3QWW A;  4UQY A;  2WVI A;  2LAI A;  2XPZ A;  3FH8 A;  2J09 A;  3QAR A;  2BUG A;  4AJW A;  2C0M A;  2HYZ A;  3PNL B;  5HI7 A;  1JWG A;  2KZT A;  2Y4T A;  3D9N A;  3WXX A;  3FY4 A;  3OXF A;  4FLB A;  4PDX A;  3U4T A;  2YHE A;  1Z3Y A;  2WXI A;  4GA0 A;  3FU0 A;  4W9R A;  1U3D A;  2J4B A;  2FO7 A;  2KM4 A;  3APD A;  5A7D B;  3AS8 A;  1IYG A;  2HM8 A;  2PL2 A;  3KS2 A;  3LY8 A;  4EQF A;  3L22 A;  3CGH A;  1EDU A;  5FTP A;  3S7D A;  4FAD A;  3D9K A;  2IQC A;  4GYO A;  3QK0 A;  4ILI A;  4YND A;  3CVN A;  5LP0 A;  3RRU A;  2MHK A;  3L54 A;  2EQX A;  4GYW A;  4XI9 A;  2I2O A;  3PE4 A;  3PUJ A;  4UQZ A;  3APC A;  4ANV A;  4KT6 B;  3MKR A;  4BTA A;  4MLP A;  4R7L A;  3FTV A;  4WAF A;  3CKB A;  4XI0 A;  1Z6T A;  3QWV A;  3I5P A;  2XRY A;  5E76 A;  3ML9 A;  2VJ8 A;  1A17 A;  4A1G A;  4ANU A;  3CVV A;  4U0Z A;  4N2Q A;  5FZS A;  3FH7 A;  1H2U A;  2IOS A;  2L0I A;  2OVB A;  3UT4 A;  5JHA A;  3FUH A;  2YHC A;  2XHE A;  2R5S A;  2WXF A;  1VDY A;  3GZ1 A;  5KJM A;  4I1A A;  4JZY A;  4JVS A;  4V3I A;  1HE8 A;  1OWL A;  2VTB B;  3MV3 B;  4CDN A;  2L6J A;  5FT9 A;  4UWH A;  3RJV A;  3FHE A;  3MEK A;  2YIN A;  2DCP A;  2RD0 A;  3PUK A;  2VSO E;  2PM7 A;  5CCM A;  2VGX A;  4WND A;  4KZC A;  1H0A A;  4BT9 A;  3PNT B;  4L7T A;  1JUQ A;  5T4Y A;  5AIJ A;  3NQP A;  3Q47 B;  1HS6 A;  2UWJ G;  1HU3 A;  1MQS A;  3S2A A;  4A55 A;  4N39 A;  3SNX A;  3CQC B;  2X6F A;  3RO2 A;  4Q69 A;  3NZU A;  4N3C A;  2OV8 A;  4GYY A;  4J8D A;  2LNI A;  3SHF A;  2V4L A;  3LKU A;  2E2E A;  1ELW A;  3MZL B;  2DBA A;  4AXH A;  4DLQ A;  1W3B A;  4F3V A;  3EIQ C;  3UT8 A;  3FTU A;  4CCA A;  4KZ0 A;  4F53 A;  5LCW C;  4J0U A;  3RO3 A;  3CHM A;  4F1S A;  4PS3 A;  4EBA A;  3D9M A;  4DPR A;  2XQ0 A;  3ESK A;  3LCA A;  3KAE A;  1HG5 A;  2AWI A;  4I2Z A;  3RRM B;  4HFG A;  4P29 A;  2J07 A;  5AYW D;  1OWP A;  3ASD A;  3FUL A;  3O4Z A;  2FF4 A;  4FP7 A;  4ILH B;  3RKV A;  4G24 A;  4GZ5 A;  5ENN A;  4GPK A;  5J90 A;  1JPL A;  4I6G A;  5J08 A;  1UW4 B;  2KCV A;  2LSV A;  4K0R A;  2C2L A;  3QB2 A;  4BWR A;  2CFU A;  2WMO A;  5G05 J;  4B89 A;  5KCM A;  3CVP A;  3CVX A;  4I43 A;  3QOU A;  2L0T B;  1P5Q A;  2GRL A;  4EZK A;  4I6J A;  3TXM A;  3MJW A;  5ARG A;  4UI9 J;  3APF A;  5KJL A;  2Y3A A;  4JA7 A;  2QY7 A;  4XE0 A;  5BPP A;  3UUX A;  3U9W A;  5JJ6 A;  4ABN A;  2FI7 A;  2WQ6 A;  4Y6C A;  3D9J A;  3MV2 B;  2MOW A;  2WXH A;  3MKQ B;  4A1S A;  4CRW A;  1S0P A;  3NZS A;  4I2W A;  3CK7 A;  4JA9 A;  3Q15 A;  3CKC A;  2J4D A;  3IV0 A;  3CHR A;  2GGF A;  4LER A;  4L23 A;  3LJ3 A;  3R9A B;  5T8I A;  4N2S A;  3D9L A;  4XKC A;  5BW8 C;  2X6H A;  1LF8 A;  4E85 A;  1IQU A;  2ZU6 B;  3PRE A;  3CK9 A;  3ZGQ A;  1FVH A;  1KT0 A;  1E8W A;  4WNG A;  3ZVV A;  5BV1 A;  3R7R A;  4K03 A;  5D0Q D;  3ASF A;  4JPS A;  4EPZ A;  1PY1 A;  2I1J A;  3L17 A;  3G2S A;  3LVQ E;  3OXG A;  4WWP A;  5KJK A;  4JL0 A;  5ARF A;  5A23 A;  2HO1 A;  3PZD A;  5EKQ D;  4TRQ A;  4WWO A;  3TGO A;  4F7A A;  4ANX A;  4L2Y A;  2I6H A;  3ZEF A;  4AV7 A;  5EX3 A;  3S7F A;  2YQ8 A;  3RK6 A;  4G2V A;  5C1D A;  3EJN A;  3CK8 A;  3JQ1 A;  4BT8 A;  5LX8 A;  2X38 A;  4XX5 A;  4UI9 K;  2QFC A;  4GU5 A;  2JLB A;  2VTB A;  2YNQ A;  2XGS A;  4I1M A;  3LDZ A;  3CHS A;  3OXL A;  3FUD A;  3IEG A;  4GA1 A;  1E96 B;  1TJC A;  4GAA A;  3P1U A;  4M3O A;  4B8C B;  1XNF A;  2WXR A;  3U3W A;  1H2V C;  3QNK A;  2J9Q A;  2VSX E;  3GYZ A;  4PUC A;  2BTD A;  4IRU A;  1WM5 A;  4B8A A;  1ZBP A;  3OAW A;  4FC8 A;  1PC2 A;  1KLX A;  4WWN A;  3GZS A;  4L1B A;  3HIZ A;  2UY1 B;  3MX3 A;  5G55 A;  4GZ3 A;  2AW6 A;  3CR3 A;  3HVE A;  4BX8 A;  4OVU A;  2FUL A;  4H7Y A;  3SI5 A;  1E90 A;  3BG1 B;  4NRH B;  5HQ8 A;  3FP3 A;  1E8Y A;  4C9B B;  3ESL A;  3CSF A;  4I9C A;  3UPV A;  3ZYL A;  5FJY A;  1EPU A;  4C0E A;  2XGM A;  2WPV A;  5G04 J;  3SD5 A;  3FU3 A;  1GW6 A;  3L16 A;  3I4G A;  3CVU A;  1B89 A;  3BG0 B;  3E4B A;  2E0I A;  4QFV A;  4A3V A;  4CGW A;  4LCT A;  2WM9 A;  2LAH A;  2OVF A;  3HYM B;  3PDN A;  3ZIM A;  1FVF A;  4YVQ C;  1NZN A;  5DIZ A;  3MCX A;  3B7R L;  1EF1 C;  3FTY A;  4PS8 A;  3FH5 A;  4FUL A;  4B0Z A;  4JHJ A;  4NUR A;  4ATG A;  1QNF A;  3G2U A;  3B7T A;  2WB2 A;  4DJA A;  4UQX A;  4E6H A;  3AS4 A;  3D9P A;  2OOE A;  2CHW A;  3OTN A;  1HH8 A;  2VSN A;  1HF8 A;  3NF1 A;  3QJZ A;  4HOU A;  4U8H A;  2XCB A;  3Q49 B;  2PQN A;  2CHX A;  1Y6I A;  3HVE B;  4MRU A;  4HOT A;  1IHG A;  2LO6 A;  1TEZ A;  4DK5 A;  4Q94 A;  5BV0 A;  4B94 A;  1HXI A;  4GZD A;  4XIF A;  4AY5 A;  3MKQ A;  4RSY A;  3FUF A;  3SFZ A;  1Y8M A;  4G25 A;  3K9I A;  4ACL A;  3L13 A;  5CMW A;  3PH0 C;  5FWQ A;  4H7X A;  4PH4 B;  3D9I A;  4IYP A;  2CFZ A;  3SBS A;  3FTZ A;  3ZXS A;  4Y6W A;  4OVV A;  2XRZ A;  4WNF A;  1H6K A;  1UG3 A;  4J6I A;  1UN8 A;  4KVM A;  5FQ8 A;  2MRI A;  3TXN A;  4FU3 A;  4I1O B;  4ILG A;  4KMO A;  4EZL A;  2XCC A;  1H19 A;  4J8E A;  1SZA A;  5FQ4 A;  4AEZ C;  3TAX A;  4RG9 A;  3HHM A;  5LOZ A;  3G2T A;  4A3T A;  4G1T A;  3JYS A;  4URK A;  4FJZ A;  1HX8 A;  3VTX A;  1NA3 A;  3UT7 A;  5LFA A;  3ZPJ A;  3LS8 A;  4NAC A;  3EDT B;  5C2Y A;  4WUY A;  4BY6 A;  1U3C A;  3G2V A;  3IHV A;  3RIB A;  2Y4U A;  1JWF A;  3ZRH A;  3JUI A;  3PEV B;  4BFR A;  1MHQ A;  4APO A;  4FA6 A;  3T5X A;  4RVB A;  1NP7 A;  4FHJ A;  1UJK A;  4KBQ A;  3Q5M A;  3ZYQ A;  3TJP A;  4GZC A;  4JW1 A;  3ONK A;  2P58 C;  3L08 A;  2AXV A;  3PEU B;  4U63 A;  5FQ7 A;  4HVB A;  2OND A;  5A6C A;  4U07 A;  4CGV A;  3RU0 A;  2WXG A;  2L9B A;  4IUL A;  4UWL A;  4IN3 B;  4GMJ A;  4KYO B;  2UY1 A;  2NC9 A;  3P2B A;  2Q7F A;  3FUJ A;  4UWK A;  3TL5 A;  4JHR A;  4C0M A;  3B13 A;  3VLF A;  2X6K A;  3VLD A;  3I4R B;  2WXO A;  3C98 A;  4AM9 A;  1HFA A;  3URZ A;  2X6I A;  3EHM A;  3LPZ A;  3JQ0 A;  3DBS A;  2CHZ A;  1QZ2 A;  3T8M A;  1XGW A;  2GW1 A;  2ION A;  4KXK B;  1ELK A;  1YA0 A;  4PS7 A;  3QAQ A;  2A5U A;  2X6J A;  1UJJ A;  4HS2 A;  1SQM A;  1HO8 A;  4HXI A;  4JEH A;  5G05 C;  3B7S A;  2FBN A;  3ULQ A;  2JEK A;  4JEU A;  4LEU A;  2V8S E;  3CQG B;  2IF4 A;  3AS5 A;  4UI9 C;  2I9C A;  5DBK A;  3MYV A;  3ASH A;  2C0L A;  4NQ0 A;  3VLE A;  2ILR A;  4TV3 A;  3AU5 A;  3PRZ A;  1OWN A;  5EDS A;  3FUI A;  2NXP A;  4I17 A;  3ZHE B;  4AOF A;  2IJG X;  1IQR A;  4UWG A;  3HDX A;  4WNE A;  4CT0 A;  3ZFW A;  3CHO A;  3FTS A;  3S7J A;  2J49 A;  1HG2 A;  5CMY A;  3VTY A;  1L5J A;  3ZN3 A;  3EHN A;  4JHK A;  4XZ4 A;  4U04 A;  2VQ2 A;  4I6E A;  3QDN A;  4EBA G;  4JXT A;  4XKB A;  5CHE E;  5LCW J;  2V0P A;  2X3M A;  3RRN B;  4TUU A;  2R59 A;  3U66 A;  3CHP A;  4CDR A;  3KD7 A;  1E7V A;  3S7B A;  1Z3X A;  3CIA A;  3FUE A;  4APF A;  4O6F A;  4UWF A;  1OWM A;  1EYH A;  3SGH A;  3BEE A;  2KCL A;  3SZ7 A;  3LXU X;  3AU4 A;  2KZT B;  4ME2 A;  4YVO A;  4N3A A;  1NA0 A;  1N54 A;  3CHQ A;  4LUN U;  2RG8 A;  3LY9 A;  4G23 A;  3LYA A;  3UX4 A;  3ZW3 A;  1N52 A;  3FTW A;  3GZ2 A;  4AVX A;  3CVY A;  2DIW A;  4G11 A;  4EZJ A;  3ONL A;  1E7U A;  1BPO A;  4N5C A;  1ELR A;  3FUM A;  4JC8 A;  3G2W A;  2J08 A;  3MA5 A;  4I9E A;  4FLH A;  4GB9 A;  3CLJ A;  2PQR A;  4LRZ A;  2AXU A;  3O48 A;  4FJY A;  1H2T C;  2LSU A;  2HR2 A;  3MGB A;  1QQE A;  4GML A;  4MS6 A;  3D9O A;  3L6A A;  3N71 A;  5JJ7 A;  3FU5 A;  3ENE A;  5FZR A;  4AIF A;  4AP2 A;  1ZU2 A;  5KJN A;  1OWO A;  3D3M A;  3FTX A;  2BF0 X;  3B7U X;  3QKY A;  4GCO A;  4HOR A;  4DI4 A;  4ACK A;  1X5B A;  2AVP A;  1TJF A;  3FWV A;  5EX0 A;  4AY6 A;  2WXL A;  4HOS A;  3TG4 A;  3U64 A;  5G2N A;  5FZQ A;  3CST A;  3CVW A;  4BSX A;  3SF4 A;  1PAQ A;  4BX9 A;  3CVL A;  5G04 C;  3DPD A;  3PVL A;  2XPY A;  5BT1 A;  3CVQ A;  3FFL A;  2KAT A;  4GA2 A;  4ANW A;  3QWP A;  5JHB A;  2GRM A;  2IOL A;  3ML8 A;  5BUZ A;  1WAO 1;  3Q4A B;  4HOQ A;  4CEM A;  5JJT A;  1DNP A;  2XGO A;  3T5V A;  2KCK A;  2NSZ A;  5AJL A;  1KT1 A;  3IKO B;  3PS6 A;  4GCN A;  3CEQ A;  5ANL A;  3ASG A;  2PM6 A;  1FCH A;  2M63 A;  4J8S A;  4L2L A;  4OYS A;  2VGX B;  2WXN A;  4CT4 A;  3GW4 A;  3I3N A;  2CG2 A;  2R17 C;  4EEC A;  3TG5 A;  3FDH A;  1HZ4 A;  2WQ7 A;  3JCK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...