2Q7VA

Crystal structure of deinococcus radiodurans thioredoxin reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
313
Chain Sequence
TAPTAHDYDVVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAKVEMDEVQGVQHDATSHPYPFTVRGYNGEYRAKAVILATGADPRKLGIPGEDNFWGKGVSTCATCDGFFYKGKKVVVIGGGDAAVEEGMFLTKFADEVTVIHRRDTLRANKVAQARAFANPKMKFIWDTAVEEIQGADSVSGVKLRNLKTGEVSELATDGVFIFIGHVPNTAFVKDTVSLRDDGYVDVRDEIYTNIPMLFAAGDVSDYIYRQLATSVGAGTRAAMMTERQLAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thioredoxin system from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 90
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q7vA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q7vA02
2BC0A 1H83A 1SEZA 3LB8A 2JAEA 4AOXA 1CC6A 2R46A 1S2QA 2UZZA 4H50A 3V76A 1ZKQA 1CJ2A 4YSYA 1D7YA 2FJBA 4N9XA 2R4EA 4GDPA 1P2EA 1H81A 1GT8A 5JCNA 1F8SA 2OLOA 3DK9A 2JB1A 4ADWA 1MO9A 1XPQA 2GR2A 2R0GA 3RP7A 4USRA 4H2NA 1BGJA 3CNPA 1QJDA 4O5QA 1BKWA 2X3NA 1TRBA 4J2WA 2FJAA 4DNAA 3QFAA 1H82A 2JKCA 4OPTA 1GPEA 4U2SA 1H86A 3KA7A 1BZLA 3M0OA 2VQ7A 4C3YA 2R45A 5C3JA 4LA1A 2E1MA 1D7LA 1O95A 4Z44A 2ZZCA 2Y6RA 3NIXA 2GMJA 3UOXA 3UTFA 1S3EA 4TM3A 2XLSA 4JY2A 1N4UA 4YKFA 1NHQA 2YG7A 3KU9A 2H88A 4JDRA 4K22A 4TM0A 2WETA 1XDIA 4U8IA 2TMDA 4NEWA 4Y4NA 1K0LA 2GRTA 1E1NA 2WP6A 3CNSA 1PBCA 3AE9A 4U2TA 1ZK7A 2PHHA 1CHUA 2C72A 2CDUA 3AXBA 2C75A 4NZHA 3AEFA 2GH5A 2XCGA 4K8DA 2Q0KA 2BACA 3GSIA 3RP8A 4EM3A 4YWOA 3UP5A 1XANA 2YVJA 2WDVA 3FPZA 3UKHA 1CC2A 2EQ8A 2WS3A 1E1KA 3BI5A 4Z2RA 4B64A 1GNDA 1PXBA 2BYBA 4DGKA 5KXJA 3QVPA 3H8IA 5KOXA 2FBWA 1K0IA 1GRBA 2WDRA 4IVMB 3L1RA 2WP5A 3NYEA 2XDOA 1LJ1A 5KVIA 1ELIA 3ALJA 3AE6A 3AEAA 3DK8A 5FS6A 4ZN0A 4Z25A 4AOSA 2DKIA 3UTHA 3V3OA 4H7UA 1VG9A 3LXDA 1DOBA 4KX6A 2XVJA 2TPRA 1W4XA 1PS9A 1PDHA 3R9UA 2RABA 3AEEA 5HYMA 4I59A 1PBBA 2XFNA 4GDEA 2Q0LA 2R0CA 4C3XA 3KLJA 3NN6X 2GVCA 3DA1A 3ATQA 2VRMA 4CY8A 4IV9A 1B5QA 2Q7VA 3AE8A 3GD4A 2B76A 3NKSA 3GRTA 2YR4A 3UKFA 1O94A 1PBEA 1NG3A 1VDCA 1VRQB 2EQ7A 5HXIA 5DBJA 3CGCA 2XFUA 1BWCA 2BS3A 3KVEA 2VVMA 3CGBA 3REDA 1ONFA 1PXAA 1B8SA 1GSNA 3CGEA 2XLPA 4KPRA 2R4JA 1N1PA 1BF3A 3IHMA 4H4VA 5EB5A 3H4KA 3CTYA 4CNKA 1VG0A 2XVEA 1ZX9A 2VZ2A 1GV4A 2YM2A 1DODA 1GRGA 4UDQA 1Q9IA 5JCIA 1NPXA 3HZLA 4MJWA 4CY6A 3WE0A 2GQWA 4C74A 1DJNA 1K0JA 2YG3A 2FJEA 4IA5A 4B69A 2DKHA 3G5RA 1EL7A 1XHCA 1FCDA 4CCRA 2WEUA 1Y0PA 1RP0A 2H89A 4XWRA 2RGHA 1Z6LA 3COXA 1L9CA 3GWDA 5BVAA 1PN0A 1ZDLA 4EQXA 1GRAA 3NGCX 5EOWA 2AR8A 1S2YA 4WCTA 1TYPA 2O9ZA 3M13A 3UOVA 5JCLA 2QA2A 1GALA 1REOA 2IVEA 1CL0A 2JB3A 1GERA 3IC9A 4HA6A 4Z2TA 4H4YA 4UP3A 4EQRA 1BGNA 1QLBA 2A89A 1F6MA 3EAOA 4FK1A 3G5SA 4TLXA 5U25A 3VR9A 2YG5A 4YSXA 5IQ4A 3F8RA 3NTAA 2C73A 4U8JA 4Z26A 2YLWA 4DSHA 4H4QA 2VVLA 3VRAA 2Y6QA 3CPHG 2QAEA 3Q6JA 2BK3A 2GQFA 2A8XA 2YLXA 4GF7A 3SFEA 2VOUA 1PJ6A 2R9ZA 2WDQA 2ZZ0A 3CPIG 4B65A 4APNA 2GAGB 2GV8A 3DGZA 3GRSA 1TDNA 1B37A 4LU6A 4OVIA 1KSSA 4AP1A 3I3LA 3IHGA 4ZCCA 4PABA 2WPEA 3BI2A 2XVFA 1F8RA 2XLUA 4ECHA 3IWAA 1YY5A 2RGOA 1IUUA 2W0HA 3EANA 1GTHA 2C70A 3NK1X 1MXTA 2ZZBA 2Z5XA 3GDPA 3P4RA 1S3BA 3FG2P 1V59A 4H2PA 2YLSA 3GWFA 3K7TA 4JN9A 2R0PA 2BC1A 3F8PA 3KPFA 5EBKA 2CVJA 3AYJA 1N4VA 2VQBA 3FBSA 1KFYA 5M0ZA 4YTMA 4RG4A 4BJYA 1M64A 1GRFA 5BRTA 1JNZA 2YM1A 4C77A 1OJCA 2WOIA 1E39A 1OJTA 3BNUA 2VVLG 2EQ9A 1Y56B 3GYJA 2WHDA 3OZ2A 5FS7A 1EBDA 3O0HA 5L46A 4YT0A 3DJEA 2VRLA 4YXDA 2BCGG 1H7WA 1KDGA 3BHKA 3L8KA 3FIMB 3AEBA 4YSHA 4GUVA 1H84A 3RP6A 4NTDA 4TLZA 1FEBA 3Q9TA 1PXCA 4WX1A 4TM1A 2C7GA 4AP3A 4EQWA 2BXSA 2PYXA 3C4AA 3F8DA 3CNJA 1ZMDA 3CIRA 2YVGA 1JRYA 1O5WA 3ICRA 2I0ZA 4J36A 4J57A 4OPCA 2GF3A 3UTEA 2V3BA 4FDCB 3CNTA 1KNRA 1IUSA 3PVCA 5FS8A 1LVLA 4RSLA 4U8KA 3ITJA 2JBVA 2BCPA 3AD7B 4O5UA 4X9NA 3UKQA 1NDAA 4PAAA 1D4DA 4EQSA 3CN8A 2WPCA 3LZXA 1F3PA 2X8CA 3ALLA 3DJJA 1GOSA 1IUXA 1NHSA 4EM4A 3GDNA 5BULA 2OA1A 2J3NA 1LTXR 2OALA 5JCKA 4LIIA 1CBOA 1F8WA 3PS9A 4BK2A 1UKVG 1NHPA 1TDOA 3P4QA 3UKAA 4A5LA 1GEUA 1EL5A 3DJGX 3LJPA 3NLCA 3AE5A 4CNJA 2WU5A 2XLRA 5TR3A 4IVOB 4H2RA 4E0VA 3AYIA 4RG3A 2YG4A 3CGDA 4BK1A 2V3AA 3BHFA 1DNCA 3K30A 4Y4LA 3DK4A 4YSZA 1Q1RA 2ARDA 3NTDA 5HHFA 3SFDA 3AEGA 4K2XA 4D03A 3NHOX 3ALMA 2V5ZA 3SGLA 1P2HA 2YLTA 4FK1C 1LPFA 1L9EA 1DXLA 1FEAA 4UDRA 3PO7A 3C4NA 2X8GA 4CBQA 3ABVA 4P9SA 1NG4A 5BUKA 4J34A 3AE3A 1PBFA 4AT2A 2WP9A 1Q1WA 2OLNA 3S61A 2GB0A 2XYOA 4OPDA 1DJQA 4C5OA 4NEVA 4ICYA 4K5SA 4X9MA 1KF6A 1QO8A 5FS9A 5CKUA 3AB1A 3S5WA 4B66A 1NAAA 4CCQA 2B9WA 2XLTA 3NRNA 3DMEA 4U8PA 2X50A 4AT0A 1LQUA 3GYIA 2XFOA 1GRHA 3D1CA 3T37A 2BABA 1EL9A 1JRXA 4JY3A 4A79A 1NEKA 4H4XA 2BA9A 5ER0A 1ZOYA 1GTEA 2BK4A 3NH3X 3AE1A 3VRBA 2GAHB 2BXRA 2GR0A 1JEHA 1PJ7A 4JQ9A 1JRZA 3LZWA 3SQPA 2GR3A 1PHHA 4NTCA 1EL8A 4U8NA 3RNMA 3ADAB 3EPTA 3P4SA 4H4ZA 3GMCA 2JK6A 2X99A 1E1LA 3OC4A 4Z24A 2BS4A 2HQMA 2B9YA 3B3RA 3ISHA 4BK3A 2ACZA 1D4CA 2WBAA 1LQTA 3II4A 1DOCA 3AWIA 1YKJA 4OPLA 1YQ3A 3AEDA 1CJCA 3UKKA 5KVHA 2XVIA 1IUVA 4H4WA 5J60A 1FECA 1TDFA 1TDKA 1ZOVA 4H4TA 4OPUA 4K5RA 4DSGA 1N4WA 4OPGA 2CULA 2FJDA 4H2QA 4U8LA 2C64A 2IIDA 4A6NB 5LV9A 2A87A 4J56A 2OAMA 2BS2A 2WOWA 4USQA 4BV6A 3UKPA 3UCLA 1PJ5A 2WESA 3DJDA 3NK2X 3H8LA 1E7PA 2AQJA 4EMIA 2YQUA 4Y4MA 1TYTA 4BJZA 4UDPA 4OPIA 2IVDA 3LADA 4GR1A 2F5ZA 3CNDA 1E1MA 3SM8A 4HB9A 3ICTA 3I6DA 2YAUA 5KRQA 5KOWA 1IJHA 4XXGA 4Z43A 2V6OA 4B63A 3B6DA 1GXFA 3NT6A 3VR8A 2YLZA 5U63A 1YQ4A 2B9XA 3AECA 4A9WA 2X8HA 3FMWA 3UP4A 3QFBA 2C66A 4H4PA 4XWZA 4JNAA 3AE4A 2AAQA 3BI4A 1Y56A 4U8OA 5CQFA 3QSEA 1M6IA 5GSNA 2C65A 3IF9A 1CJ3A 4YKGA 1L9DA 1RYIA 1CC4A 2C76A 4TM4A 4EMJA 2Q6UA 4GCMA 3CPJG 5C2TA 3ZDNA 1JOAA 2WU2A 1YQZA 1HYUA 1H7XA 3E1TA 4Z2UA 4A65A 1OJ9A 4U8MA 1KSUA 4EMWA 3G5QA 3AD8B 3C96A 3M12A 1IUWA 2QCUA 3QJ4A 3UKLA 3UTGA 3NNEA 5IPYA 2CFYA 4K7ZA 4A99A 4B1BA 5JCMA 3VRDB 3AYLA 4REKA 1OJAA 1D5TA 1FOHA 2RGJA 1CF3A 2YR5A 3AE2A 3DH9A 3KD9A 4FX9A 4ZCDA 2WQYA 1AOGA 1RSGA 3K7QX 3KKJA 3NYCA 3QVRA 3NN0X 3RHAA 1JU2A 3DGHA 4I58A 1COYA 2Z5YA 4J33A 1NHRA 1PBDA 2B7SA 3QSMA 4JNQA 4D04A 4A6NA 2EQ6A 1GRTA 4IA6A 2QA1A 1LV0A 1GESA 5HY5A 1KNPA 1IUTA 1E6EA 1NENA 5GRTA 2WPFA 1JNRA 2BK5A 2ZBWA 1FL2A 3LOVA 3NYFA 2C67A 4M52A 5J7XA 2XVHA 4CRTA 1H6VA 2JB2A 4YTPA 1ZMCA 1MOKA 3P4PA 3QSSA 2YWLA 3UOZA 1X31B 4U2LA 1GREA 2YLRA 4BURA 2WOVA 3K7MX 2C3CA 5U1OA 3UOYA 4B68A 3AE7A 2GMHA 5FMHA 2E4GA 4EIPA 4NTEA 4H4SA 1D4EA 2NVKX 3GD3A 4GRTA 3VQRA 3D8XA 1ZY8A 3P9UA 4H4RA 4A7AA 3EF6A 3NK0X 2C3DA 4X4JA 2GEWA 4EIQA 2APGA 2GR1A 2NPXA 2YG6A 3GMBA 3JSKA 4OCGA 3AD9B 2V60A 2V61A 3V3NA 4J31A 1B4VA 2E5VA 2YVFA 3ICSA 5KWFA 5EB4A 1L0VA 2XFQA 4B67A 1VQWA 1ZP0A 3NG7X 3P1WA 3ATRA 5M10A 1GETA 1TDEA 3BNMA 3URHA 2XFPA 5IQ1A 1CJ4A 1K4QA 4H4UA 3ZYXA 1DOEA 2B7RA 4YTNA 1OJDA 2YR6A
chains in the Genus database with same CATH superfamily
2BC0A 1H83A 1SEZA 3LB8A 4NNJA 2JAEA 4AOXA 1CC6A 2R46A 1S2QA 2UZZA 4H50A 3V76A 1ZKQA 1CJ2A 4YSYA 1D7YA 2C4CA 2FJBA 4N9XA 2R4EA 4GDPA 1P2EA 1H81A 1GT8A 5JCNA 1F8SA 2OLOA 3DK9A 2JB1A 4ADWA 1MO9A 1XPQA 2GR2A 2R0GA 3RP7A 4USRA 4H2NA 1BGJA 3CNPA 1QJDA 4O5QA 1BKWA 2X3NA 1TRBA 4J2WA 2FJAA 4DNAA 3QFAA 1H82A 2JKCA 4OPTA 1GPEA 3T2ZA 4U2SA 1H86A 3KA7A 1BZLA 3M0OA 2VQ7A 4C3YA 2R45A 5C3JA 4LA1A 2E1MA 1D7LA 1O95A 4Z44A 2ZZCA 2Y6RA 3NIXA 2GMJA 3UOXA 3UTFA 1S3EA 4TM3A 2XLSA 4JY2A 1N4UA 4YKFA 1NHQA 2YG7A 3KU9A 2H88A 4JDRA 4K22A 4TM0A 2WETA 1XDIA 4U8IA 2TMDA 4NEWA 4Y4NA 1K0LA 2GRTA 1E1NA 2WP6A 3CNSA 1PBCA 3AE9A 4U2TA 1ZK7A 2PHHA 1CHUA 2C72A 2CDUA 3AXBA 2C75A 4NZHA 3AEFA 2GH5A 2XCGA 4K8DA 2Q0KA 2BACA 3GSIA 3RP8A 4EM3A 4YWOA 3UP5A 1XANA 2YVJA 2WDVA 3FPZA 3UKHA 1CC2A 2EQ8A 2WS3A 1E1KA 3BI5A 4Z2RA 4B64A 1GNDA 1PXBA 2BYBA 4DGKA 5KXJA 3QVPA 3H8IA 3GYXA 5KOXA 2FBWA 1K0IA 1GRBA 2WDRA 4IVMB 3L1RA 2WP5A 3NYEA 2XDOA 1LJ1A 5KVIA 1ELIA 3ALJA 3AE6A 3AEAA 3DK8A 5FS6A 4ZN0A 4Z25A 3CMMA 4AOSA 2DKIA 3UTHA 3V3OA 4H7UA 1VG9A 2BRAA 3LXDA 1DOBA 4KX6A 2XVJA 2TPRA 1W4XA 1PS9A 1PDHA 3HYWA 3R9UA 2RABA 3AEEA 5HYMA 4I59A 3SZFA 1PBBA 2XFNA 4GDEA 2Q0LA 2R0CA 4C3XA 3KLJA 3NN6X 3KPKA 2GVCA 3DA1A 3ATQA 2VRMA 3SY4A 4CY8A 4IV9A 1B5QA 2Q7VA 3AE8A 3GD4A 2B76A 3NKSA 3GRTA 2YR4A 3UKFA 5KMSA 1O94A 1PBEA 1NG3A 1VDCA 1VRQB 2EQ7A 5HXIA 5DBJA 3CGCA 2XFUA 1BWCA 2BS3A 3KVEA 2VVMA 4G6HA 3CGBA 3REDA 1ONFA 1PXAA 1B8SA 1GSNA 3CGEA 2XLPA 4KPRA 2R4JA 1N1PA 1BF3A 3IHMA 4H4VA 5EB5A 3H4KA 3CTYA 4CNKA 1VG0A 2XVEA 1ZX9A 2VZ2A 1GV4A 2YM2A 1DODA 1GRGA 4UDQA 1Q9IA 5JCIA 1NPXA 3HZLA 4MJWA 4CY6A 3WE0A 2GQWA 4C74A 1DJNA 1K0JA 2YG3A 2FJEA 4IA5A 4B69A 2DKHA 3G5RA 1EL7A 1XHCA 1FCDA 4CCRA 2WEUA 1Y0PA 1RP0A 2H89A 4G6GA 2RGHA 4XWRA 1Z6LA 3HYVA 3COXA 1L9CA 3GWDA 5BVAA 1PN0A 1ZDLA 4EQXA 1GRAA 3NGCX 5EOWA 2AR8A 1S2YA 4WCTA 1TYPA 2O9ZA 3M13A 3UOVA 5JCLA 2QA2A 3SXIA 1GALA 1REOA 2IVEA 1CL0A 2JB3A 1GERA 3IC9A 4HA6A 4Z2TA 4H4YA 4UP3A 4EQRA 1BGNA 1QLBA 2A89A 1F6MA 3EAOA 4FK1A 3G5SA 4TLXA 5U25A 3VR9A 2YG5A 4YSXA 5IQ4A 3F8RA 3NTAA 2C73A 4U8JA 4Z26A 5KMRA 2YLWA 4DSHA 4H4QA 3SZCA 2VVLA 3VRAA 2Y6QA 3CPHG 2QAEA 3Q6JA 2BK3A 2GQFA 2A8XA 2YLXA 4GF7A 3SFEA 2VOUA 1PJ6A 2R9ZA 2WDQA 2ZZ0A 3CPIG 4B65A 4APNA 2GAGB 2GV8A 3DGZA 3GRSA 1TDNA 1B37A 4II2A 4LU6A 1KSSA 4OVIA 4AP1A 3I3LA 3IHGA 4ZCCA 4PABA 2WPEA 3BI2A 2XVFA 1F8RA 2XLUA 4G9KA 4ECHA 3IWAA 1YY5A 4G74A 2RGOA 1IUUA 2W0HA 3EANA 1GTHA 2C70A 3NK1X 3T31A 1MXTA 2ZZBA 2Z5XA 3GDPA 3P4RA 1S3BA 3FG2P 1V59A 4H2PA 2YLSA 3GWFA 3K7TA 4JN9A 2R0PA 2BC1A 3F8PA 3KPFA 5EBKA 3SZ0A 2CVJA 3AYJA 1N4VA 2VQBA 3FBSA 1KFYA 5M0ZA 4YTMA 4RG4A 4BJYA 1M64A 1GRFA 5BRTA 1JNZA 2YM1A 4C77A 1OJCA 2WOIA 1E39A 1OJTA 3BNUA 2VVLG 2EQ9A 1Y56B 3GYJA 2WHDA 3OZ2A 5FS7A 1EBDA 3O0HA 5L46A 4YT0A 3DJEA 2VRLA 4YXDA 2BCGG 1H7WA 1KDGA 3BHKA 3L8KA 3FIMB 3AEBA 4YSHA 4GUVA 4GAVA 1H84A 3RP6A 4NTDA 4TLZA 1FEBA 3Q9TA 1PXCA 4WX1A 4TM1A 2C7GA 4AP3A 4EQWA 2BXSA 2PYXA 3C4AA 3F8DA 3CNJA 1ZMDA 3CIRA 2YVGA 1JRYA 1O5WA 3ICRA 2I0ZA 4J36A 4J57A 4OPCA 2GF3A 3UTEA 2V3BA 4FDCB 3CNTA 1KNRA 1IUSA 3PVCA 5FS8A 1LVLA 4RSLA 4U8KA 3ITJA 2JBVA 2BCPA 3AD7B 4O5UA 4X9NA 3UKQA 1NDAA 4PAAA 1D4DA 4EQSA 3CN8A 2WPCA 3LZXA 1F3PA 2X8CA 3ALLA 3SZWA 3DJJA 1GOSA 1IUXA 3T0KA 1NHSA 4EM4A 3GDNA 5BULA 2OA1A 2J3NA 1LTXR 2OALA 5JCKA 4LIIA 1CBOA 1F8WA 3PS9A 4BK2A 1UKVG 1NHPA 1TDOA 3P4QA 3UKAA 4A5LA 1GEUA 1EL5A 3DJGX 3LJPA 3NLCA 3AE5A 4CNJA 2WU5A 2XLRA 5TR3A 4IVOB 4H2RA 4E0VA 3AYIA 4RG3A 3T14A 2YG4A 3CGDA 4BK1A 2V3AA 3BHFA 1DNCA 3K30A 4Y4LA 3DK4A 4YSZA 1Q1RA 2ARDA 3NTDA 5HHFA 3SFDA 3AEGA 4K2XA 4D03A 3NHOX 3ALMA 2V5ZA 3SGLA 1P2HA 2YLTA 4FK1C 1LPFA 1L9EA 1DXLA 1FEAA 4UDRA 3PO7A 3T2YA 3C4NA 2X8GA 4CBQA 3ABVA 4P9SA 1NG4A 5BUKA 4J34A 3AE3A 1PBFA 4AT2A 2WP9A 1Q1WA 2OLNA 3S61A 2GB0A 2XYOA 4OPDA 1DJQA 4C5OA 4NEVA 4ICYA 4K5SA 4X9MA 1KF6A 1QO8A 5FS9A 5CKUA 3AB1A 3S5WA 4B66A 1NAAA 4CCQA 2B9WA 2XLTA 3NRNA 3DMEA 4U8PA 2X50A 4AT0A 1LQUA 3GYIA 2XFOA 1GRHA 3D1CA 3T37A 2BABA 1EL9A 1JRXA 4JY3A 4A79A 1NEKA 4H4XA 2BA9A 5ER0A 1ZOYA 1GTEA 2BK4A 3NH3X 3SYIA 3AE1A 3VRBA 2GAHB 2BXRA 2GR0A 1JEHA 1PJ7A 4JQ9A 1JRZA 3LZWA 3SQPA 2GR3A 1PHHA 4NTCA 1EL8A 4U8NA 3RNMA 3ADAB 3EPTA 3P4SA 4G73A 4H4ZA 3GMCA 2JK6A 2X99A 1E1LA 3OC4A 4Z24A 2BS4A 2HQMA 2B9YA 3B3RA 3ISHA 4BK3A 2ACZA 1D4CA 2WBAA 1LQTA 3II4A 1DOCA 3AWIA 1YKJA 4OPLA 1YQ3A 3AEDA 4II3A 1CJCA 3UKKA 5KVHA 2XVIA 1IUVA 4H4WA 5J60A 1FECA 1TDFA 1TDKA 1ZOVA 4H4TA 4OPUA 4K5RA 4DSGA 1N4WA 4OPGA 2CULA 2FJDA 4H2QA 4U8LA 2C64A 2IIDA 4A6NB 5LV9A 3SX6A 2A87A 4J56A 2OAMA 2BS2A 2WOWA 4USQA 4BV6A 3UKPA 3UCLA 1PJ5A 2WESA 3DJDA 3NK2X 3H8LA 1E7PA 2AQJA 4EMIA 2YQUA 4Y4MA 1TYTA 4BJZA 5KMQA 4UDPA 4OPIA 2IVDA 5KNLA 3LADA 4GR1A 2F5ZA 3CNDA 1E1MA 3SM8A 4HB9A 3ICTA 3I6DA 2YAUA 5KRQA 5KOWA 1IJHA 4XXGA 4Z43A 2V6OA 4B63A 3B6DA 1GXFA 3NT6A 4NWZA 3VR8A 2YLZA 5U63A 1YQ4A 2B9XA 3AECA 4A9WA 2X8HA 3FMWA 3UP4A 3QFBA 2C66A 4H4PA 4XWZA 4JNAA 3AE4A 2AAQA 3BI4A 1Y56A 4U8OA 5CQFA 3QSEA 1M6IA 5GSNA 2C65A 3IF9A 1CJ3A 4YKGA 1L9DA 1RYIA 1CC4A 2C76A 4TM4A 4EMJA 2Q6UA 4GCMA 3CPJG 5C2TA 3ZDNA 1JOAA 2WU2A 4GAPA 1YQZA 1HYUA 1H7XA 3E1TA 4Z2UA 4A65A 1OJ9A 4U8MA 1KSUA 4EMWA 3G5QA 3AD8B 3C96A 3M12A 1IUWA 2QCUA 3QJ4A 3UKLA 3UTGA 3NNEA 5IPYA 3HYXA 2CFYA 4K7ZA 4A99A 4B1BA 5JCMA 3VRDB 3AYLA 4REKA 1OJAA 1D5TA 1FOHA 2RGJA 1CF3A 2YR5A 3AE2A 3DH9A 3KD9A 4FX9A 4ZCDA 2WQYA 1AOGA 1RSGA 3K7QX 3KKJA 3NYCA 3QVRA 3NN0X 3RHAA 1JU2A 3DGHA 4I58A 1COYA 2Z5YA 4J33A 1NHRA 1PBDA 2B7SA 3QSMA 4JNQA 4D04A 4A6NA 2EQ6A 1GRTA 4IA6A 2QA1A 1LV0A 1GESA 5HY5A 1KNPA 1IUTA 3T2KA 1E6EA 1NENA 5GRTA 2WPFA 2BRYA 1JNRA 2BK5A 2ZBWA 1FL2A 3LOVA 3NYFA 2C67A 4M52A 5J7XA 2XVHA 4CRTA 1H6VA 2JB2A 4YTPA 1ZMCA 1MOKA 3P4PA 3QSSA 2YWLA 3UOZA 1X31B 4U2LA 1GREA 2YLRA 4BURA 2WOVA 3K7MX 2C3CA 5U1OA 3UOYA 4B68A 3AE7A 2GMHA 5FMHA 2E4GA 4EIPA 4NTEA 4H4SA 1D4EA 2NVKX 3GD3A 5KMPA 4GRTA 3VQRA 3D8XA 1ZY8A 3P9UA 4H4RA 4A7AA 3EF6A 3NK0X 2C3DA 4X4JA 2GEWA 4EIQA 2APGA 2GR1A 2NPXA 2YG6A 3GMBA 3JSKA 4OCGA 3AD9B 2V60A 2V61A 3V3NA 4J31A 1B4VA 2E5VA 2YVFA 3ICSA 5KWFA 5EB4A 1L0VA 2XFQA 4B67A 1VQWA 1ZP0A 3NG7X 3P1WA 3ATRA 5M10A 1GETA 1TDEA 3BNMA 3URHA 2XFPA 5IQ1A 1CJ4A 1K4QA 4H4UA 3ZYXA 1DOEA 2B7RA 4YTNA 1OJDA 2YR6A
chains in the Genus database with same CATH topology
2BC0A 1H83A 1SEZA 3LB8A 4NNJA 2JAEA 4AOXA 1CC6A 2R46A 1S2QA 2UZZA 4H50A 3V76A 1ZKQA 1CJ2A 4YSYA 1D7YA 2C4CA 2FJBA 4N9XA 2R4EA 4GDPA 1P2EA 1H81A 1GT8A 5JCNA 1F8SA 2OLOA 3DK9A 2JB1A 4ADWA 1MO9A 1XPQA 2GR2A 2R0GA 3RP7A 4USRA 4H2NA 1BGJA 3CNPA 1QJDA 4O5QA 1BKWA 2X3NA 1TRBA 4J2WA 2FJAA 4DNAA 3QFAA 1H82A 2JKCA 4OPTA 1GPEA 3T2ZA 4U2SA 1H86A 3KA7A 1BZLA 3M0OA 2VQ7A 4C3YA 2R45A 5C3JA 4LA1A 2E1MA 1D7LA 1O95A 4Z44A 2ZZCA 2Y6RA 3NIXA 2GMJA 3UOXA 3UTFA 1S3EA 4TM3A 2XLSA 4JY2A 1N4UA 4YKFA 1NHQA 2YG7A 3KU9A 2H88A 4JDRA 4K22A 4TM0A 2WETA 1XDIA 4U8IA 2TMDA 4NEWA 4Y4NA 1K0LA 2GRTA 1E1NA 2WP6A 3CNSA 1PBCA 3AE9A 4U2TA 1ZK7A 2PHHA 1CHUA 2C72A 2CDUA 3AXBA 2C75A 4NZHA 3AEFA 2GH5A 2XCGA 4K8DA 2Q0KA 2BACA 3GSIA 3RP8A 4EM3A 4YWOA 3UP5A 1XANA 2YVJA 2WDVA 3FPZA 3UKHA 1CC2A 2EQ8A 2WS3A 1E1KA 3BI5A 4Z2RA 4B64A 1GNDA 1PXBA 2BYBA 4DGKA 5KXJA 3QVPA 3H8IA 3GYXA 5KOXA 2FBWA 1K0IA 1GRBA 2WDRA 4IVMB 3L1RA 2WP5A 3NYEA 2XDOA 1LJ1A 5KVIA 1ELIA 3ALJA 3AE6A 3AEAA 3DK8A 5FS6A 4ZN0A 4Z25A 3CMMA 4AOSA 2DKIA 3UTHA 3V3OA 4H7UA 1VG9A 2BRAA 3LXDA 1DOBA 4KX6A 2XVJA 2TPRA 1W4XA 1PS9A 1PDHA 3HYWA 3R9UA 2RABA 3AEEA 5HYMA 4I59A 3SZFA 1PBBA 2XFNA 4GDEA 2Q0LA 2R0CA 4C3XA 3KLJA 3NN6X 3KPKA 2GVCA 3DA1A 3ATQA 2VRMA 3SY4A 4CY8A 4IV9A 1B5QA 2Q7VA 3AE8A 3GD4A 2B76A 3NKSA 3GRTA 2YR4A 3UKFA 5KMSA 1O94A 1PBEA 1NG3A 1VDCA 1VRQB 2EQ7A 5HXIA 5DBJA 3CGCA 2XFUA 1BWCA 2BS3A 3KVEA 2VVMA 4G6HA 3CGBA 3REDA 1ONFA 1PXAA 1B8SA 1GSNA 3CGEA 2XLPA 4KPRA 2R4JA 1N1PA 1BF3A 3IHMA 4H4VA 5EB5A 3H4KA 3CTYA 4CNKA 1VG0A 2XVEA 1ZX9A 2VZ2A 1GV4A 2YM2A 1DODA 1GRGA 4UDQA 1Q9IA 5JCIA 1NPXA 3HZLA 4MJWA 4CY6A 3WE0A 2GQWA 4C74A 1DJNA 1K0JA 2YG3A 2FJEA 4IA5A 4B69A 2DKHA 3G5RA 1EL7A 1XHCA 1FCDA 4CCRA 2WEUA 1Y0PA 1RP0A 2H89A 4G6GA 2RGHA 4XWRA 1Z6LA 3HYVA 3COXA 1L9CA 3GWDA 5BVAA 1PN0A 1ZDLA 4EQXA 1GRAA 3NGCX 5EOWA 2AR8A 1S2YA 4WCTA 1TYPA 2O9ZA 3M13A 3UOVA 5JCLA 2QA2A 3SXIA 1GALA 1REOA 2IVEA 1CL0A 2JB3A 1GERA 3IC9A 4HA6A 4Z2TA 4H4YA 4UP3A 4EQRA 1BGNA 1QLBA 2A89A 1F6MA 3EAOA 4FK1A 3G5SA 4TLXA 5U25A 3VR9A 2YG5A 4YSXA 5IQ4A 3F8RA 3NTAA 2C73A 4U8JA 4Z26A 5KMRA 2YLWA 4DSHA 4H4QA 3SZCA 2VVLA 3VRAA 2Y6QA 3CPHG 2QAEA 3Q6JA 2BK3A 2GQFA 2A8XA 2YLXA 4GF7A 3SFEA 2VOUA 1PJ6A 2R9ZA 2WDQA 2ZZ0A 3CPIG 4B65A 4APNA 2GAGB 2GV8A 3DGZA 3GRSA 1TDNA 1B37A 4II2A 4LU6A 1KSSA 4OVIA 4AP1A 3I3LA 3IHGA 4ZCCA 4PABA 2WPEA 3BI2A 2XVFA 1F8RA 2XLUA 4G9KA 4ECHA 3IWAA 1YY5A 4G74A 2RGOA 1IUUA 2W0HA 3EANA 1GTHA 2C70A 3NK1X 3T31A 1MXTA 2ZZBA 2Z5XA 3GDPA 3P4RA 1S3BA 3FG2P 1V59A 4H2PA 2YLSA 3GWFA 3K7TA 4JN9A 2R0PA 2BC1A 3F8PA 3KPFA 5EBKA 3SZ0A 2CVJA 3AYJA 1N4VA 2VQBA 3FBSA 1KFYA 5M0ZA 4YTMA 4RG4A 4BJYA 1M64A 1GRFA 5BRTA 1JNZA 2YM1A 4C77A 1OJCA 2WOIA 1E39A 1OJTA 3BNUA 2VVLG 2EQ9A 1Y56B 3GYJA 2WHDA 3OZ2A 5FS7A 1EBDA 3O0HA 5L46A 4YT0A 3DJEA 2VRLA 4YXDA 2BCGG 1H7WA 1KDGA 3BHKA 3L8KA 3FIMB 3AEBA 4YSHA 4GUVA 4GAVA 1H84A 3RP6A 4NTDA 4TLZA 1FEBA 3Q9TA 1PXCA 4WX1A 4TM1A 2C7GA 4AP3A 4EQWA 2BXSA 2PYXA 3C4AA 3F8DA 3CNJA 1ZMDA 3CIRA 2YVGA 1JRYA 1O5WA 3ICRA 2I0ZA 4J36A 4J57A 4OPCA 2GF3A 3UTEA 2V3BA 4FDCB 3CNTA 1KNRA 1IUSA 3PVCA 5FS8A 1LVLA 4RSLA 4U8KA 3ITJA 2JBVA 2BCPA 3AD7B 4O5UA 4X9NA 3UKQA 1NDAA 4PAAA 1D4DA 4EQSA 3CN8A 2WPCA 3LZXA 1F3PA 2X8CA 3ALLA 3SZWA 3DJJA 1GOSA 1IUXA 3T0KA 1NHSA 4EM4A 3GDNA 5BULA 2OA1A 2J3NA 1LTXR 2OALA 5JCKA 4LIIA 1CBOA 1F8WA 3PS9A 4BK2A 1UKVG 1NHPA 1TDOA 3P4QA 3UKAA 4A5LA 1GEUA 1EL5A 3DJGX 3LJPA 3NLCA 3AE5A 4CNJA 2WU5A 2XLRA 5TR3A 4IVOB 4H2RA 4E0VA 3AYIA 4RG3A 3T14A 2YG4A 3CGDA 4BK1A 2V3AA 3BHFA 1DNCA 3K30A 4Y4LA 3DK4A 4YSZA 1Q1RA 2ARDA 3NTDA 5HHFA 3SFDA 3AEGA 4K2XA 4D03A 3NHOX 3ALMA 2V5ZA 3SGLA 1P2HA 2YLTA 4FK1C 1LPFA 1L9EA 1DXLA 1FEAA 4UDRA 3PO7A 3T2YA 3C4NA 2X8GA 4CBQA 3ABVA 4P9SA 1NG4A 5BUKA 4J34A 3AE3A 1PBFA 4AT2A 2WP9A 1Q1WA 2OLNA 3S61A 2GB0A 2XYOA 4OPDA 1DJQA 4C5OA 4NEVA 4ICYA 4K5SA 4X9MA 1KF6A 1QO8A 5FS9A 5CKUA 3AB1A 3S5WA 4B66A 1NAAA 4CCQA 2B9WA 2XLTA 3NRNA 3DMEA 4U8PA 2X50A 4AT0A 1LQUA 3GYIA 2XFOA 1GRHA 3D1CA 3T37A 2BABA 1EL9A 1JRXA 4JY3A 4A79A 1NEKA 4H4XA 2BA9A 5ER0A 1ZOYA 1GTEA 2BK4A 3NH3X 3SYIA 3AE1A 3VRBA 2GAHB 2BXRA 2GR0A 1JEHA 1PJ7A 4JQ9A 1JRZA 3LZWA 3SQPA 2GR3A 1PHHA 4NTCA 1EL8A 4U8NA 3RNMA 3ADAB 3EPTA 3P4SA 4G73A 4H4ZA 3GMCA 2JK6A 2X99A 1E1LA 3OC4A 4Z24A 2BS4A 2HQMA 2B9YA 3B3RA 3ISHA 4BK3A 2ACZA 1D4CA 2WBAA 1LQTA 3II4A 1DOCA 3AWIA 1YKJA 4OPLA 1YQ3A 3AEDA 4II3A 1CJCA 3UKKA 5KVHA 2XVIA 1IUVA 4H4WA 5J60A 1FECA 1TDFA 1TDKA 1ZOVA 4H4TA 4OPUA 4K5RA 4DSGA 1N4WA 4OPGA 2CULA 2FJDA 4H2QA 4U8LA 2C64A 2IIDA 4A6NB 5LV9A 3SX6A 2A87A 4J56A 2OAMA 2BS2A 2WOWA 4USQA 4BV6A 3UKPA 3UCLA 1PJ5A 2WESA 3DJDA 3NK2X 3H8LA 1E7PA 2AQJA 4EMIA 2YQUA 4Y4MA 1TYTA 4BJZA 5KMQA 4UDPA 4OPIA 2IVDA 5KNLA 3LADA 4GR1A 2F5ZA 3CNDA 1E1MA 3SM8A 4HB9A 3ICTA 3I6DA 2YAUA 5KRQA 5KOWA 1IJHA 4XXGA 4Z43A 2V6OA 4B63A 3B6DA 1GXFA 3NT6A 4NWZA 3VR8A 2YLZA 5U63A 1YQ4A 2B9XA 3AECA 4A9WA 2X8HA 3FMWA 3UP4A 3QFBA 2C66A 4H4PA 4XWZA 4JNAA 3AE4A 2AAQA 3BI4A 1Y56A 4U8OA 5CQFA 3QSEA 1M6IA 5GSNA 2C65A 3IF9A 1CJ3A 4YKGA 1L9DA 1RYIA 1CC4A 2C76A 4TM4A 4EMJA 2Q6UA 4GCMA 3CPJG 5C2TA 3ZDNA 1JOAA 2WU2A 4GAPA 1YQZA 1HYUA 1H7XA 3E1TA 4Z2UA 4A65A 1OJ9A 4U8MA 1KSUA 4EMWA 3G5QA 3AD8B 3C96A 3M12A 1IUWA 2QCUA 3QJ4A 3UKLA 3UTGA 3NNEA 5IPYA 3HYXA 2CFYA 4K7ZA 4A99A 4B1BA 5JCMA 3VRDB 3AYLA 4REKA 1OJAA 1D5TA 1FOHA 2RGJA 1CF3A 2YR5A 3AE2A 3DH9A 3KD9A 4FX9A 4ZCDA 2WQYA 1AOGA 1RSGA 3K7QX 3KKJA 3NYCA 3QVRA 3NN0X 3RHAA 1JU2A 3DGHA 4I58A 1COYA 2Z5YA 4J33A 1NHRA 1PBDA 2B7SA 3QSMA 4JNQA 4D04A 4A6NA 2EQ6A 1GRTA 4IA6A 2QA1A 1LV0A 1GESA 5HY5A 1KNPA 1IUTA 3T2KA 1E6EA 1NENA 5GRTA 2WPFA 2BRYA 1JNRA 2BK5A 2ZBWA 1FL2A 3LOVA 3NYFA 2C67A 4M52A 5J7XA 2XVHA 4CRTA 1H6VA 2JB2A 4YTPA 1ZMCA 1MOKA 3P4PA 3QSSA 2YWLA 3UOZA 1X31B 4U2LA 1GREA 2YLRA 4BURA 2WOVA 3K7MX 2C3CA 5U1OA 3UOYA 4B68A 3AE7A 2GMHA 5FMHA 2E4GA 4EIPA 4NTEA 4H4SA 1D4EA 2NVKX 3GD3A 5KMPA 4GRTA 3VQRA 3D8XA 1ZY8A 3P9UA 4H4RA 4A7AA 3EF6A 3NK0X 2C3DA 4X4JA 2GEWA 4EIQA 2APGA 2GR1A 2NPXA 2YG6A 3GMBA 3JSKA 4OCGA 3AD9B 2V60A 2V61A 3V3NA 4J31A 1B4VA 2E5VA 2YVFA 3ICSA 5KWFA 5EB4A 1L0VA 2XFQA 4B67A 1VQWA 1ZP0A 3NG7X 3P1WA 3ATRA 5M10A 1GETA 1TDEA 3BNMA 3URHA 2XFPA 5IQ1A 1CJ4A 1K4QA 4H4UA 3ZYXA 1DOEA 2B7RA 4YTNA 1OJDA 2YR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BC0 A;  1H83 A;  1SEZ A;  3LB8 A;  2JAE A;  4AOX A;  1CC6 A;  2R46 A;  1S2Q A;  2UZZ A;  4H50 A;  3V76 A;  1ZKQ A;  1CJ2 A;  4YSY A;  1D7Y A;  2FJB A;  4N9X A;  2R4E A;  4GDP A;  1P2E A;  1H81 A;  1GT8 A;  5JCN A;  1F8S A;  2OLO A;  3DK9 A;  2JB1 A;  4ADW A;  1MO9 A;  1XPQ A;  2GR2 A;  2R0G A;  3RP7 A;  4USR A;  4H2N A;  1BGJ A;  3CNP A;  1QJD A;  4O5Q A;  1BKW A;  2X3N A;  1TRB A;  4J2W A;  2FJA A;  4DNA A;  3QFA A;  1H82 A;  2JKC A;  4OPT A;  1GPE A;  4U2S A;  1H86 A;  3KA7 A;  1BZL A;  3M0O A;  2VQ7 A;  4C3Y A;  2R45 A;  5C3J A;  4LA1 A;  2E1M A;  1D7L A;  1O95 A;  4Z44 A;  2ZZC A;  2Y6R A;  3NIX A;  2GMJ A;  3UOX A;  3UTF A;  1S3E A;  4TM3 A;  2XLS A;  4JY2 A;  1N4U A;  4YKF A;  1NHQ A;  2YG7 A;  3KU9 A;  2H88 A;  4JDR A;  4K22 A;  4TM0 A;  2WET A;  1XDI A;  4U8I A;  2TMD A;  4NEW A;  4Y4N A;  1K0L A;  2GRT A;  1E1N A;  2WP6 A;  3CNS A;  1PBC A;  3AE9 A;  4U2T A;  1ZK7 A;  2PHH A;  1CHU A;  2C72 A;  2CDU A;  3AXB A;  2C75 A;  4NZH A;  3AEF A;  2GH5 A;  2XCG A;  4K8D A;  2Q0K A;  2BAC A;  3GSI A;  3RP8 A;  4EM3 A;  4YWO A;  3UP5 A;  1XAN A;  2YVJ A;  2WDV A;  3FPZ A;  3UKH A;  1CC2 A;  2EQ8 A;  2WS3 A;  1E1K A;  3BI5 A;  4Z2R A;  4B64 A;  1GND A;  1PXB A;  2BYB A;  4DGK A;  5KXJ A;  3QVP A;  3H8I A;  5KOX A;  2FBW A;  1K0I A;  1GRB A;  2WDR A;  4IVM B;  3L1R A;  2WP5 A;  3NYE A;  2XDO A;  1LJ1 A;  5KVI A;  1ELI A;  3ALJ A;  3AE6 A;  3AEA A;  3DK8 A;  5FS6 A;  4ZN0 A;  4Z25 A;  4AOS A;  2DKI A;  3UTH A;  3V3O A;  4H7U A;  1VG9 A;  3LXD A;  1DOB A;  4KX6 A;  2XVJ A;  2TPR A;  1W4X A;  1PS9 A;  1PDH A;  3R9U A;  2RAB A;  3AEE A;  5HYM A;  4I59 A;  1PBB A;  2XFN A;  4GDE A;  2Q0L A;  2R0C A;  4C3X A;  3KLJ A;  3NN6 X;  2GVC A;  3DA1 A;  3ATQ A;  2VRM A;  4CY8 A;  4IV9 A;  1B5Q A;  2Q7V A;  3AE8 A;  3GD4 A;  2B76 A;  3NKS A;  3GRT A;  2YR4 A;  3UKF A;  1O94 A;  1PBE A;  1NG3 A;  1VDC A;  1VRQ B;  2EQ7 A;  5HXI A;  5DBJ A;  3CGC A;  2XFU A;  1BWC A;  2BS3 A;  3KVE A;  2VVM A;  3CGB A;  3RED A;  1ONF A;  1PXA A;  1B8S A;  1GSN A;  3CGE A;  2XLP A;  4KPR A;  2R4J A;  1N1P A;  1BF3 A;  3IHM A;  4H4V A;  5EB5 A;  3H4K A;  3CTY A;  4CNK A;  1VG0 A;  2XVE A;  1ZX9 A;  2VZ2 A;  1GV4 A;  2YM2 A;  1DOD A;  1GRG A;  4UDQ A;  1Q9I A;  5JCI A;  1NPX A;  3HZL A;  4MJW A;  4CY6 A;  3WE0 A;  2GQW A;  4C74 A;  1DJN A;  1K0J A;  2YG3 A;  2FJE A;  4IA5 A;  4B69 A;  2DKH A;  3G5R A;  1EL7 A;  1XHC A;  1FCD A;  4CCR A;  2WEU A;  1Y0P A;  1RP0 A;  2H89 A;  4XWR A;  2RGH A;  1Z6L A;  3COX A;  1L9C A;  3GWD A;  5BVA A;  1PN0 A;  1ZDL A;  4EQX A;  1GRA A;  3NGC X;  5EOW A;  2AR8 A;  1S2Y A;  4WCT A;  1TYP A;  2O9Z A;  3M13 A;  3UOV A;  5JCL A;  2QA2 A;  1GAL A;  1REO A;  2IVE A;  1CL0 A;  2JB3 A;  1GER A;  3IC9 A;  4HA6 A;  4Z2T A;  4H4Y A;  4UP3 A;  4EQR A;  1BGN A;  1QLB A;  2A89 A;  1F6M A;  3EAO A;  4FK1 A;  3G5S A;  4TLX A;  5U25 A;  3VR9 A;  2YG5 A;  4YSX A;  5IQ4 A;  3F8R A;  3NTA A;  2C73 A;  4U8J A;  4Z26 A;  2YLW A;  4DSH A;  4H4Q A;  2VVL A;  3VRA A;  2Y6Q A;  3CPH G;  2QAE A;  3Q6J A;  2BK3 A;  2GQF A;  2A8X A;  2YLX A;  4GF7 A;  3SFE A;  2VOU A;  1PJ6 A;  2R9Z A;  2WDQ A;  2ZZ0 A;  3CPI G;  4B65 A;  4APN A;  2GAG B;  2GV8 A;  3DGZ A;  3GRS A;  1TDN A;  1B37 A;  4LU6 A;  4OVI A;  1KSS A;  4AP1 A;  3I3L A;  3IHG A;  4ZCC A;  4PAB A;  2WPE A;  3BI2 A;  2XVF A;  1F8R A;  2XLU A;  4ECH A;  3IWA A;  1YY5 A;  2RGO A;  1IUU A;  2W0H A;  3EAN A;  1GTH A;  2C70 A;  3NK1 X;  1MXT A;  2ZZB A;  2Z5X A;  3GDP A;  3P4R A;  1S3B A;  3FG2 P;  1V59 A;  4H2P A;  2YLS A;  3GWF A;  3K7T A;  4JN9 A;  2R0P A;  2BC1 A;  3F8P A;  3KPF A;  5EBK A;  2CVJ A;  3AYJ A;  1N4V A;  2VQB A;  3FBS A;  1KFY A;  5M0Z A;  4YTM A;  4RG4 A;  4BJY A;  1M64 A;  1GRF A;  5BRT A;  1JNZ A;  2YM1 A;  4C77 A;  1OJC A;  2WOI A;  1E39 A;  1OJT A;  3BNU A;  2VVL G;  2EQ9 A;  1Y56 B;  3GYJ A;  2WHD A;  3OZ2 A;  5FS7 A;  1EBD A;  3O0H A;  5L46 A;  4YT0 A;  3DJE A;  2VRL A;  4YXD A;  2BCG G;  1H7W A;  1KDG A;  3BHK A;  3L8K A;  3FIM B;  3AEB A;  4YSH A;  4GUV A;  1H84 A;  3RP6 A;  4NTD A;  4TLZ A;  1FEB A;  3Q9T A;  1PXC A;  4WX1 A;  4TM1 A;  2C7G A;  4AP3 A;  4EQW A;  2BXS A;  2PYX A;  3C4A A;  3F8D A;  3CNJ A;  1ZMD A;  3CIR A;  2YVG A;  1JRY A;  1O5W A;  3ICR A;  2I0Z A;  4J36 A;  4J57 A;  4OPC A;  2GF3 A;  3UTE A;  2V3B A;  4FDC B;  3CNT A;  1KNR A;  1IUS A;  3PVC A;  5FS8 A;  1LVL A;  4RSL A;  4U8K A;  3ITJ A;  2JBV A;  2BCP A;  3AD7 B;  4O5U A;  4X9N A;  3UKQ A;  1NDA A;  4PAA A;  1D4D A;  4EQS A;  3CN8 A;  2WPC A;  3LZX A;  1F3P A;  2X8C A;  3ALL A;  3DJJ A;  1GOS A;  1IUX A;  1NHS A;  4EM4 A;  3GDN A;  5BUL A;  2OA1 A;  2J3N A;  1LTX R;  2OAL A;  5JCK A;  4LII A;  1CBO A;  1F8W A;  3PS9 A;  4BK2 A;  1UKV G;  1NHP A;  1TDO A;  3P4Q A;  3UKA A;  4A5L A;  1GEU A;  1EL5 A;  3DJG X;  3LJP A;  3NLC A;  3AE5 A;  4CNJ A;  2WU5 A;  2XLR A;  5TR3 A;  4IVO B;  4H2R A;  4E0V A;  3AYI A;  4RG3 A;  2YG4 A;  3CGD A;  4BK1 A;  2V3A A;  3BHF A;  1DNC A;  3K30 A;  4Y4L A;  3DK4 A;  4YSZ A;  1Q1R A;  2ARD A;  3NTD A;  5HHF A;  3SFD A;  3AEG A;  4K2X A;  4D03 A;  3NHO X;  3ALM A;  2V5Z A;  3SGL A;  1P2H A;  2YLT A;  4FK1 C;  1LPF A;  1L9E A;  1DXL A;  1FEA A;  4UDR A;  3PO7 A;  3C4N A;  2X8G A;  4CBQ A;  3ABV A;  4P9S A;  1NG4 A;  5BUK A;  4J34 A;  3AE3 A;  1PBF A;  4AT2 A;  2WP9 A;  1Q1W A;  2OLN A;  3S61 A;  2GB0 A;  2XYO A;  4OPD A;  1DJQ A;  4C5O A;  4NEV A;  4ICY A;  4K5S A;  4X9M A;  1KF6 A;  1QO8 A;  5FS9 A;  5CKU A;  3AB1 A;  3S5W A;  4B66 A;  1NAA A;  4CCQ A;  2B9W A;  2XLT A;  3NRN A;  3DME A;  4U8P A;  2X50 A;  4AT0 A;  1LQU A;  3GYI A;  2XFO A;  1GRH A;  3D1C A;  3T37 A;  2BAB A;  1EL9 A;  1JRX A;  4JY3 A;  4A79 A;  1NEK A;  4H4X A;  2BA9 A;  5ER0 A;  1ZOY A;  1GTE A;  2BK4 A;  3NH3 X;  3AE1 A;  3VRB A;  2GAH B;  2BXR A;  2GR0 A;  1JEH A;  1PJ7 A;  4JQ9 A;  1JRZ A;  3LZW A;  3SQP A;  2GR3 A;  1PHH A;  4NTC A;  1EL8 A;  4U8N A;  3RNM A;  3ADA B;  3EPT A;  3P4S A;  4H4Z A;  3GMC A;  2JK6 A;  2X99 A;  1E1L A;  3OC4 A;  4Z24 A;  2BS4 A;  2HQM A;  2B9Y A;  3B3R A;  3ISH A;  4BK3 A;  2ACZ A;  1D4C A;  2WBA A;  1LQT A;  3II4 A;  1DOC A;  3AWI A;  1YKJ A;  4OPL A;  1YQ3 A;  3AED A;  1CJC A;  3UKK A;  5KVH A;  2XVI A;  1IUV A;  4H4W A;  5J60 A;  1FEC A;  1TDF A;  1TDK A;  1ZOV A;  4H4T A;  4OPU A;  4K5R A;  4DSG A;  1N4W A;  4OPG A;  2CUL A;  2FJD A;  4H2Q A;  4U8L A;  2C64 A;  2IID A;  4A6N B;  5LV9 A;  2A87 A;  4J56 A;  2OAM A;  2BS2 A;  2WOW A;  4USQ A;  4BV6 A;  3UKP A;  3UCL A;  1PJ5 A;  2WES A;  3DJD A;  3NK2 X;  3H8L A;  1E7P A;  2AQJ A;  4EMI A;  2YQU A;  4Y4M A;  1TYT A;  4BJZ A;  4UDP A;  4OPI A;  2IVD A;  3LAD A;  4GR1 A;  2F5Z A;  3CND A;  1E1M A;  3SM8 A;  4HB9 A;  3ICT A;  3I6D A;  2YAU A;  5KRQ A;  5KOW A;  1IJH A;  4XXG A;  4Z43 A;  2V6O A;  4B63 A;  3B6D A;  1GXF A;  3NT6 A;  3VR8 A;  2YLZ A;  5U63 A;  1YQ4 A;  2B9X A;  3AEC A;  4A9W A;  2X8H A;  3FMW A;  3UP4 A;  3QFB A;  2C66 A;  4H4P A;  4XWZ A;  4JNA A;  3AE4 A;  2AAQ A;  3BI4 A;  1Y56 A;  4U8O A;  5CQF A;  3QSE A;  1M6I A;  5GSN A;  2C65 A;  3IF9 A;  1CJ3 A;  4YKG A;  1L9D A;  1RYI A;  1CC4 A;  2C76 A;  4TM4 A;  4EMJ A;  2Q6U A;  4GCM A;  3CPJ G;  5C2T A;  3ZDN A;  1JOA A;  2WU2 A;  1YQZ A;  1HYU A;  1H7X A;  3E1T A;  4Z2U A;  4A65 A;  1OJ9 A;  4U8M A;  1KSU A;  4EMW A;  3G5Q A;  3AD8 B;  3C96 A;  3M12 A;  1IUW A;  2QCU A;  3QJ4 A;  3UKL A;  3UTG A;  3NNE A;  5IPY A;  2CFY A;  4K7Z A;  4A99 A;  4B1B A;  5JCM A;  3VRD B;  3AYL A;  4REK A;  1OJA A;  1D5T A;  1FOH A;  2RGJ A;  1CF3 A;  2YR5 A;  3AE2 A;  3DH9 A;  3KD9 A;  4FX9 A;  4ZCD A;  2WQY A;  1AOG A;  1RSG A;  3K7Q X;  3KKJ A;  3NYC A;  3QVR A;  3NN0 X;  3RHA A;  1JU2 A;  3DGH A;  4I58 A;  1COY A;  2Z5Y A;  4J33 A;  1NHR A;  1PBD A;  2B7S A;  3QSM A;  4JNQ A;  4D04 A;  4A6N A;  2EQ6 A;  1GRT A;  4IA6 A;  2QA1 A;  1LV0 A;  1GES A;  5HY5 A;  1KNP A;  1IUT A;  1E6E A;  1NEN A;  5GRT A;  2WPF A;  1JNR A;  2BK5 A;  2ZBW A;  1FL2 A;  3LOV A;  3NYF A;  2C67 A;  4M52 A;  5J7X A;  2XVH A;  4CRT A;  1H6V A;  2JB2 A;  4YTP A;  1ZMC A;  1MOK A;  3P4P A;  3QSS A;  2YWL A;  3UOZ A;  1X31 B;  4U2L A;  1GRE A;  2YLR A;  4BUR A;  2WOV A;  3K7M X;  2C3C A;  5U1O A;  3UOY A;  4B68 A;  3AE7 A;  2GMH A;  5FMH A;  2E4G A;  4EIP A;  4NTE A;  4H4S A;  1D4E A;  2NVK X;  3GD3 A;  4GRT A;  3VQR A;  3D8X A;  1ZY8 A;  3P9U A;  4H4R A;  4A7A A;  3EF6 A;  3NK0 X;  2C3D A;  4X4J A;  2GEW A;  4EIQ A;  2APG A;  2GR1 A;  2NPX A;  2YG6 A;  3GMB A;  3JSK A;  4OCG A;  3AD9 B;  2V60 A;  2V61 A;  3V3N A;  4J31 A;  1B4V A;  2E5V A;  2YVF A;  3ICS A;  5KWF A;  5EB4 A;  1L0V A;  2XFQ A;  4B67 A;  1VQW A;  1ZP0 A;  3NG7 X;  3P1W A;  3ATR A;  5M10 A;  1GET A;  1TDE A;  3BNM A;  3URH A;  2XFP A;  5IQ1 A;  1CJ4 A;  1K4Q A;  4H4U A;  3ZYX A;  1DOE A;  2B7R A;  4YTN A;  1OJD A;  2YR6 A; 
#chains in the Genus database with same CATH topology
 2BC0 A;  1H83 A;  1SEZ A;  3LB8 A;  4NNJ A;  2JAE A;  4AOX A;  1CC6 A;  2R46 A;  1S2Q A;  2UZZ A;  4H50 A;  3V76 A;  1ZKQ A;  1CJ2 A;  4YSY A;  1D7Y A;  2C4C A;  2FJB A;  4N9X A;  2R4E A;  4GDP A;  1P2E A;  1H81 A;  1GT8 A;  5JCN A;  1F8S A;  2OLO A;  3DK9 A;  2JB1 A;  4ADW A;  1MO9 A;  1XPQ A;  2GR2 A;  2R0G A;  3RP7 A;  4USR A;  4H2N A;  1BGJ A;  3CNP A;  1QJD A;  4O5Q A;  1BKW A;  2X3N A;  1TRB A;  4J2W A;  2FJA A;  4DNA A;  3QFA A;  1H82 A;  2JKC A;  4OPT A;  1GPE A;  3T2Z A;  4U2S A;  1H86 A;  3KA7 A;  1BZL A;  3M0O A;  2VQ7 A;  4C3Y A;  2R45 A;  5C3J A;  4LA1 A;  2E1M A;  1D7L A;  1O95 A;  4Z44 A;  2ZZC A;  2Y6R A;  3NIX A;  2GMJ A;  3UOX A;  3UTF A;  1S3E A;  4TM3 A;  2XLS A;  4JY2 A;  1N4U A;  4YKF A;  1NHQ A;  2YG7 A;  3KU9 A;  2H88 A;  4JDR A;  4K22 A;  4TM0 A;  2WET A;  1XDI A;  4U8I A;  2TMD A;  4NEW A;  4Y4N A;  1K0L A;  2GRT A;  1E1N A;  2WP6 A;  3CNS A;  1PBC A;  3AE9 A;  4U2T A;  1ZK7 A;  2PHH A;  1CHU A;  2C72 A;  2CDU A;  3AXB A;  2C75 A;  4NZH A;  3AEF A;  2GH5 A;  2XCG A;  4K8D A;  2Q0K A;  2BAC A;  3GSI A;  3RP8 A;  4EM3 A;  4YWO A;  3UP5 A;  1XAN A;  2YVJ A;  2WDV A;  3FPZ A;  3UKH A;  1CC2 A;  2EQ8 A;  2WS3 A;  1E1K A;  3BI5 A;  4Z2R A;  4B64 A;  1GND A;  1PXB A;  2BYB A;  4DGK A;  5KXJ A;  3QVP A;  3H8I A;  3GYX A;  5KOX A;  2FBW A;  1K0I A;  1GRB A;  2WDR A;  4IVM B;  3L1R A;  2WP5 A;  3NYE A;  2XDO A;  1LJ1 A;  5KVI A;  1ELI A;  3ALJ A;  3AE6 A;  3AEA A;  3DK8 A;  5FS6 A;  4ZN0 A;  4Z25 A;  3CMM A;  4AOS A;  2DKI A;  3UTH A;  3V3O A;  4H7U A;  1VG9 A;  2BRA A;  3LXD A;  1DOB A;  4KX6 A;  2XVJ A;  2TPR A;  1W4X A;  1PS9 A;  1PDH A;  3HYW A;  3R9U A;  2RAB A;  3AEE A;  5HYM A;  4I59 A;  3SZF A;  1PBB A;  2XFN A;  4GDE A;  2Q0L A;  2R0C A;  4C3X A;  3KLJ A;  3NN6 X;  3KPK A;  2GVC A;  3DA1 A;  3ATQ A;  2VRM A;  3SY4 A;  4CY8 A;  4IV9 A;  1B5Q A;  2Q7V A;  3AE8 A;  3GD4 A;  2B76 A;  3NKS A;  3GRT A;  2YR4 A;  3UKF A;  5KMS A;  1O94 A;  1PBE A;  1NG3 A;  1VDC A;  1VRQ B;  2EQ7 A;  5HXI A;  5DBJ A;  3CGC A;  2XFU A;  1BWC A;  2BS3 A;  3KVE A;  2VVM A;  4G6H A;  3CGB A;  3RED A;  1ONF A;  1PXA A;  1B8S A;  1GSN A;  3CGE A;  2XLP A;  4KPR A;  2R4J A;  1N1P A;  1BF3 A;  3IHM A;  4H4V A;  5EB5 A;  3H4K A;  3CTY A;  4CNK A;  1VG0 A;  2XVE A;  1ZX9 A;  2VZ2 A;  1GV4 A;  2YM2 A;  1DOD A;  1GRG A;  4UDQ A;  1Q9I A;  5JCI A;  1NPX A;  3HZL A;  4MJW A;  4CY6 A;  3WE0 A;  2GQW A;  4C74 A;  1DJN A;  1K0J A;  2YG3 A;  2FJE A;  4IA5 A;  4B69 A;  2DKH A;  3G5R A;  1EL7 A;  1XHC A;  1FCD A;  4CCR A;  2WEU A;  1Y0P A;  1RP0 A;  2H89 A;  4G6G A;  2RGH A;  4XWR A;  1Z6L A;  3HYV A;  3COX A;  1L9C A;  3GWD A;  5BVA A;  1PN0 A;  1ZDL A;  4EQX A;  1GRA A;  3NGC X;  5EOW A;  2AR8 A;  1S2Y A;  4WCT A;  1TYP A;  2O9Z A;  3M13 A;  3UOV A;  5JCL A;  2QA2 A;  3SXI A;  1GAL A;  1REO A;  2IVE A;  1CL0 A;  2JB3 A;  1GER A;  3IC9 A;  4HA6 A;  4Z2T A;  4H4Y A;  4UP3 A;  4EQR A;  1BGN A;  1QLB A;  2A89 A;  1F6M A;  3EAO A;  4FK1 A;  3G5S A;  4TLX A;  5U25 A;  3VR9 A;  2YG5 A;  4YSX A;  5IQ4 A;  3F8R A;  3NTA A;  2C73 A;  4U8J A;  4Z26 A;  5KMR A;  2YLW A;  4DSH A;  4H4Q A;  3SZC A;  2VVL A;  3VRA A;  2Y6Q A;  3CPH G;  2QAE A;  3Q6J A;  2BK3 A;  2GQF A;  2A8X A;  2YLX A;  4GF7 A;  3SFE A;  2VOU A;  1PJ6 A;  2R9Z A;  2WDQ A;  2ZZ0 A;  3CPI G;  4B65 A;  4APN A;  2GAG B;  2GV8 A;  3DGZ A;  3GRS A;  1TDN A;  1B37 A;  4II2 A;  4LU6 A;  1KSS A;  4OVI A;  4AP1 A;  3I3L A;  3IHG A;  4ZCC A;  4PAB A;  2WPE A;  3BI2 A;  2XVF A;  1F8R A;  2XLU A;  4G9K A;  4ECH A;  3IWA A;  1YY5 A;  4G74 A;  2RGO A;  1IUU A;  2W0H A;  3EAN A;  1GTH A;  2C70 A;  3NK1 X;  3T31 A;  1MXT A;  2ZZB A;  2Z5X A;  3GDP A;  3P4R A;  1S3B A;  3FG2 P;  1V59 A;  4H2P A;  2YLS A;  3GWF A;  3K7T A;  4JN9 A;  2R0P A;  2BC1 A;  3F8P A;  3KPF A;  5EBK A;  3SZ0 A;  2CVJ A;  3AYJ A;  1N4V A;  2VQB A;  3FBS A;  1KFY A;  5M0Z A;  4YTM A;  4RG4 A;  4BJY A;  1M64 A;  1GRF A;  5BRT A;  1JNZ A;  2YM1 A;  4C77 A;  1OJC A;  2WOI A;  1E39 A;  1OJT A;  3BNU A;  2VVL G;  2EQ9 A;  1Y56 B;  3GYJ A;  2WHD A;  3OZ2 A;  5FS7 A;  1EBD A;  3O0H A;  5L46 A;  4YT0 A;  3DJE A;  2VRL A;  4YXD A;  2BCG G;  1H7W A;  1KDG A;  3BHK A;  3L8K A;  3FIM B;  3AEB A;  4YSH A;  4GUV A;  4GAV A;  1H84 A;  3RP6 A;  4NTD A;  4TLZ A;  1FEB A;  3Q9T A;  1PXC A;  4WX1 A;  4TM1 A;  2C7G A;  4AP3 A;  4EQW A;  2BXS A;  2PYX A;  3C4A A;  3F8D A;  3CNJ A;  1ZMD A;  3CIR A;  2YVG A;  1JRY A;  1O5W A;  3ICR A;  2I0Z A;  4J36 A;  4J57 A;  4OPC A;  2GF3 A;  3UTE A;  2V3B A;  4FDC B;  3CNT A;  1KNR A;  1IUS A;  3PVC A;  5FS8 A;  1LVL A;  4RSL A;  4U8K A;  3ITJ A;  2JBV A;  2BCP A;  3AD7 B;  4O5U A;  4X9N A;  3UKQ A;  1NDA A;  4PAA A;  1D4D A;  4EQS A;  3CN8 A;  2WPC A;  3LZX A;  1F3P A;  2X8C A;  3ALL A;  3SZW A;  3DJJ A;  1GOS A;  1IUX A;  3T0K A;  1NHS A;  4EM4 A;  3GDN A;  5BUL A;  2OA1 A;  2J3N A;  1LTX R;  2OAL A;  5JCK A;  4LII A;  1CBO A;  1F8W A;  3PS9 A;  4BK2 A;  1UKV G;  1NHP A;  1TDO A;  3P4Q A;  3UKA A;  4A5L A;  1GEU A;  1EL5 A;  3DJG X;  3LJP A;  3NLC A;  3AE5 A;  4CNJ A;  2WU5 A;  2XLR A;  5TR3 A;  4IVO B;  4H2R A;  4E0V A;  3AYI A;  4RG3 A;  3T14 A;  2YG4 A;  3CGD A;  4BK1 A;  2V3A A;  3BHF A;  1DNC A;  3K30 A;  4Y4L A;  3DK4 A;  4YSZ A;  1Q1R A;  2ARD A;  3NTD A;  5HHF A;  3SFD A;  3AEG A;  4K2X A;  4D03 A;  3NHO X;  3ALM A;  2V5Z A;  3SGL A;  1P2H A;  2YLT A;  4FK1 C;  1LPF A;  1L9E A;  1DXL A;  1FEA A;  4UDR A;  3PO7 A;  3T2Y A;  3C4N A;  2X8G A;  4CBQ A;  3ABV A;  4P9S A;  1NG4 A;  5BUK A;  4J34 A;  3AE3 A;  1PBF A;  4AT2 A;  2WP9 A;  1Q1W A;  2OLN A;  3S61 A;  2GB0 A;  2XYO A;  4OPD A;  1DJQ A;  4C5O A;  4NEV A;  4ICY A;  4K5S A;  4X9M A;  1KF6 A;  1QO8 A;  5FS9 A;  5CKU A;  3AB1 A;  3S5W A;  4B66 A;  1NAA A;  4CCQ A;  2B9W A;  2XLT A;  3NRN A;  3DME A;  4U8P A;  2X50 A;  4AT0 A;  1LQU A;  3GYI A;  2XFO A;  1GRH A;  3D1C A;  3T37 A;  2BAB A;  1EL9 A;  1JRX A;  4JY3 A;  4A79 A;  1NEK A;  4H4X A;  2BA9 A;  5ER0 A;  1ZOY A;  1GTE A;  2BK4 A;  3NH3 X;  3SYI A;  3AE1 A;  3VRB A;  2GAH B;  2BXR A;  2GR0 A;  1JEH A;  1PJ7 A;  4JQ9 A;  1JRZ A;  3LZW A;  3SQP A;  2GR3 A;  1PHH A;  4NTC A;  1EL8 A;  4U8N A;  3RNM A;  3ADA B;  3EPT A;  3P4S A;  4G73 A;  4H4Z A;  3GMC A;  2JK6 A;  2X99 A;  1E1L A;  3OC4 A;  4Z24 A;  2BS4 A;  2HQM A;  2B9Y A;  3B3R A;  3ISH A;  4BK3 A;  2ACZ A;  1D4C A;  2WBA A;  1LQT A;  3II4 A;  1DOC A;  3AWI A;  1YKJ A;  4OPL A;  1YQ3 A;  3AED A;  4II3 A;  1CJC A;  3UKK A;  5KVH A;  2XVI A;  1IUV A;  4H4W A;  5J60 A;  1FEC A;  1TDF A;  1TDK A;  1ZOV A;  4H4T A;  4OPU A;  4K5R A;  4DSG A;  1N4W A;  4OPG A;  2CUL A;  2FJD A;  4H2Q A;  4U8L A;  2C64 A;  2IID A;  4A6N B;  5LV9 A;  3SX6 A;  2A87 A;  4J56 A;  2OAM A;  2BS2 A;  2WOW A;  4USQ A;  4BV6 A;  3UKP A;  3UCL A;  1PJ5 A;  2WES A;  3DJD A;  3NK2 X;  3H8L A;  1E7P A;  2AQJ A;  4EMI A;  2YQU A;  4Y4M A;  1TYT A;  4BJZ A;  5KMQ A;  4UDP A;  4OPI A;  2IVD A;  5KNL A;  3LAD A;  4GR1 A;  2F5Z A;  3CND A;  1E1M A;  3SM8 A;  4HB9 A;  3ICT A;  3I6D A;  2YAU A;  5KRQ A;  5KOW A;  1IJH A;  4XXG A;  4Z43 A;  2V6O A;  4B63 A;  3B6D A;  1GXF A;  3NT6 A;  4NWZ A;  3VR8 A;  2YLZ A;  5U63 A;  1YQ4 A;  2B9X A;  3AEC A;  4A9W A;  2X8H A;  3FMW A;  3UP4 A;  3QFB A;  2C66 A;  4H4P A;  4XWZ A;  4JNA A;  3AE4 A;  2AAQ A;  3BI4 A;  1Y56 A;  4U8O A;  5CQF A;  3QSE A;  1M6I A;  5GSN A;  2C65 A;  3IF9 A;  1CJ3 A;  4YKG A;  1L9D A;  1RYI A;  1CC4 A;  2C76 A;  4TM4 A;  4EMJ A;  2Q6U A;  4GCM A;  3CPJ G;  5C2T A;  3ZDN A;  1JOA A;  2WU2 A;  4GAP A;  1YQZ A;  1HYU A;  1H7X A;  3E1T A;  4Z2U A;  4A65 A;  1OJ9 A;  4U8M A;  1KSU A;  4EMW A;  3G5Q A;  3AD8 B;  3C96 A;  3M12 A;  1IUW A;  2QCU A;  3QJ4 A;  3UKL A;  3UTG A;  3NNE A;  5IPY A;  3HYX A;  2CFY A;  4K7Z A;  4A99 A;  4B1B A;  5JCM A;  3VRD B;  3AYL A;  4REK A;  1OJA A;  1D5T A;  1FOH A;  2RGJ A;  1CF3 A;  2YR5 A;  3AE2 A;  3DH9 A;  3KD9 A;  4FX9 A;  4ZCD A;  2WQY A;  1AOG A;  1RSG A;  3K7Q X;  3KKJ A;  3NYC A;  3QVR A;  3NN0 X;  3RHA A;  1JU2 A;  3DGH A;  4I58 A;  1COY A;  2Z5Y A;  4J33 A;  1NHR A;  1PBD A;  2B7S A;  3QSM A;  4JNQ A;  4D04 A;  4A6N A;  2EQ6 A;  1GRT A;  4IA6 A;  2QA1 A;  1LV0 A;  1GES A;  5HY5 A;  1KNP A;  1IUT A;  3T2K A;  1E6E A;  1NEN A;  5GRT A;  2WPF A;  2BRY A;  1JNR A;  2BK5 A;  2ZBW A;  1FL2 A;  3LOV A;  3NYF A;  2C67 A;  4M52 A;  5J7X A;  2XVH A;  4CRT A;  1H6V A;  2JB2 A;  4YTP A;  1ZMC A;  1MOK A;  3P4P A;  3QSS A;  2YWL A;  3UOZ A;  1X31 B;  4U2L A;  1GRE A;  2YLR A;  4BUR A;  2WOV A;  3K7M X;  2C3C A;  5U1O A;  3UOY A;  4B68 A;  3AE7 A;  2GMH A;  5FMH A;  2E4G A;  4EIP A;  4NTE A;  4H4S A;  1D4E A;  2NVK X;  3GD3 A;  5KMP A;  4GRT A;  3VQR A;  3D8X A;  1ZY8 A;  3P9U A;  4H4R A;  4A7A A;  3EF6 A;  3NK0 X;  2C3D A;  4X4J A;  2GEW A;  4EIQ A;  2APG A;  2GR1 A;  2NPX A;  2YG6 A;  3GMB A;  3JSK A;  4OCG A;  3AD9 B;  2V60 A;  2V61 A;  3V3N A;  4J31 A;  1B4V A;  2E5V A;  2YVF A;  3ICS A;  5KWF A;  5EB4 A;  1L0V A;  2XFQ A;  4B67 A;  1VQW A;  1ZP0 A;  3NG7 X;  3P1W A;  3ATR A;  5M10 A;  1GET A;  1TDE A;  3BNM A;  3URH A;  2XFP A;  5IQ1 A;  1CJ4 A;  1K4Q A;  4H4U A;  3ZYX A;  1DOE A;  2B7R A;  4YTN A;  1OJD A;  2YR6 A; 
#chains in the Genus database with same CATH homology
 2BC0 A;  1H83 A;  1SEZ A;  3LB8 A;  4NNJ A;  2JAE A;  4AOX A;  1CC6 A;  2R46 A;  1S2Q A;  2UZZ A;  4H50 A;  3V76 A;  1ZKQ A;  1CJ2 A;  4YSY A;  1D7Y A;  2C4C A;  2FJB A;  4N9X A;  2R4E A;  4GDP A;  1P2E A;  1H81 A;  1GT8 A;  5JCN A;  1F8S A;  2OLO A;  3DK9 A;  2JB1 A;  4ADW A;  1MO9 A;  1XPQ A;  2GR2 A;  2R0G A;  3RP7 A;  4USR A;  4H2N A;  1BGJ A;  3CNP A;  1QJD A;  4O5Q A;  1BKW A;  2X3N A;  1TRB A;  4J2W A;  2FJA A;  4DNA A;  3QFA A;  1H82 A;  2JKC A;  4OPT A;  1GPE A;  3T2Z A;  4U2S A;  1H86 A;  3KA7 A;  1BZL A;  3M0O A;  2VQ7 A;  4C3Y A;  2R45 A;  5C3J A;  4LA1 A;  2E1M A;  1D7L A;  1O95 A;  4Z44 A;  2ZZC A;  2Y6R A;  3NIX A;  2GMJ A;  3UOX A;  3UTF A;  1S3E A;  4TM3 A;  2XLS A;  4JY2 A;  1N4U A;  4YKF A;  1NHQ A;  2YG7 A;  3KU9 A;  2H88 A;  4JDR A;  4K22 A;  4TM0 A;  2WET A;  1XDI A;  4U8I A;  2TMD A;  4NEW A;  4Y4N A;  1K0L A;  2GRT A;  1E1N A;  2WP6 A;  3CNS A;  1PBC A;  3AE9 A;  4U2T A;  1ZK7 A;  2PHH A;  1CHU A;  2C72 A;  2CDU A;  3AXB A;  2C75 A;  4NZH A;  3AEF A;  2GH5 A;  2XCG A;  4K8D A;  2Q0K A;  2BAC A;  3GSI A;  3RP8 A;  4EM3 A;  4YWO A;  3UP5 A;  1XAN A;  2YVJ A;  2WDV A;  3FPZ A;  3UKH A;  1CC2 A;  2EQ8 A;  2WS3 A;  1E1K A;  3BI5 A;  4Z2R A;  4B64 A;  1GND A;  1PXB A;  2BYB A;  4DGK A;  5KXJ A;  3QVP A;  3H8I A;  3GYX A;  5KOX A;  2FBW A;  1K0I A;  1GRB A;  2WDR A;  4IVM B;  3L1R A;  2WP5 A;  3NYE A;  2XDO A;  1LJ1 A;  5KVI A;  1ELI A;  3ALJ A;  3AE6 A;  3AEA A;  3DK8 A;  5FS6 A;  4ZN0 A;  4Z25 A;  3CMM A;  4AOS A;  2DKI A;  3UTH A;  3V3O A;  4H7U A;  1VG9 A;  2BRA A;  3LXD A;  1DOB A;  4KX6 A;  2XVJ A;  2TPR A;  1W4X A;  1PS9 A;  1PDH A;  3HYW A;  3R9U A;  2RAB A;  3AEE A;  5HYM A;  4I59 A;  3SZF A;  1PBB A;  2XFN A;  4GDE A;  2Q0L A;  2R0C A;  4C3X A;  3KLJ A;  3NN6 X;  3KPK A;  2GVC A;  3DA1 A;  3ATQ A;  2VRM A;  3SY4 A;  4CY8 A;  4IV9 A;  1B5Q A;  2Q7V A;  3AE8 A;  3GD4 A;  2B76 A;  3NKS A;  3GRT A;  2YR4 A;  3UKF A;  5KMS A;  1O94 A;  1PBE A;  1NG3 A;  1VDC A;  1VRQ B;  2EQ7 A;  5HXI A;  5DBJ A;  3CGC A;  2XFU A;  1BWC A;  2BS3 A;  3KVE A;  2VVM A;  4G6H A;  3CGB A;  3RED A;  1ONF A;  1PXA A;  1B8S A;  1GSN A;  3CGE A;  2XLP A;  4KPR A;  2R4J A;  1N1P A;  1BF3 A;  3IHM A;  4H4V A;  5EB5 A;  3H4K A;  3CTY A;  4CNK A;  1VG0 A;  2XVE A;  1ZX9 A;  2VZ2 A;  1GV4 A;  2YM2 A;  1DOD A;  1GRG A;  4UDQ A;  1Q9I A;  5JCI A;  1NPX A;  3HZL A;  4MJW A;  4CY6 A;  3WE0 A;  2GQW A;  4C74 A;  1DJN A;  1K0J A;  2YG3 A;  2FJE A;  4IA5 A;  4B69 A;  2DKH A;  3G5R A;  1EL7 A;  1XHC A;  1FCD A;  4CCR A;  2WEU A;  1Y0P A;  1RP0 A;  2H89 A;  4G6G A;  2RGH A;  4XWR A;  1Z6L A;  3HYV A;  3COX A;  1L9C A;  3GWD A;  5BVA A;  1PN0 A;  1ZDL A;  4EQX A;  1GRA A;  3NGC X;  5EOW A;  2AR8 A;  1S2Y A;  4WCT A;  1TYP A;  2O9Z A;  3M13 A;  3UOV A;  5JCL A;  2QA2 A;  3SXI A;  1GAL A;  1REO A;  2IVE A;  1CL0 A;  2JB3 A;  1GER A;  3IC9 A;  4HA6 A;  4Z2T A;  4H4Y A;  4UP3 A;  4EQR A;  1BGN A;  1QLB A;  2A89 A;  1F6M A;  3EAO A;  4FK1 A;  3G5S A;  4TLX A;  5U25 A;  3VR9 A;  2YG5 A;  4YSX A;  5IQ4 A;  3F8R A;  3NTA A;  2C73 A;  4U8J A;  4Z26 A;  5KMR A;  2YLW A;  4DSH A;  4H4Q A;  3SZC A;  2VVL A;  3VRA A;  2Y6Q A;  3CPH G;  2QAE A;  3Q6J A;  2BK3 A;  2GQF A;  2A8X A;  2YLX A;  4GF7 A;  3SFE A;  2VOU A;  1PJ6 A;  2R9Z A;  2WDQ A;  2ZZ0 A;  3CPI G;  4B65 A;  4APN A;  2GAG B;  2GV8 A;  3DGZ A;  3GRS A;  1TDN A;  1B37 A;  4II2 A;  4LU6 A;  1KSS A;  4OVI A;  4AP1 A;  3I3L A;  3IHG A;  4ZCC A;  4PAB A;  2WPE A;  3BI2 A;  2XVF A;  1F8R A;  2XLU A;  4G9K A;  4ECH A;  3IWA A;  1YY5 A;  4G74 A;  2RGO A;  1IUU A;  2W0H A;  3EAN A;  1GTH A;  2C70 A;  3NK1 X;  3T31 A;  1MXT A;  2ZZB A;  2Z5X A;  3GDP A;  3P4R A;  1S3B A;  3FG2 P;  1V59 A;  4H2P A;  2YLS A;  3GWF A;  3K7T A;  4JN9 A;  2R0P A;  2BC1 A;  3F8P A;  3KPF A;  5EBK A;  3SZ0 A;  2CVJ A;  3AYJ A;  1N4V A;  2VQB A;  3FBS A;  1KFY A;  5M0Z A;  4YTM A;  4RG4 A;  4BJY A;  1M64 A;  1GRF A;  5BRT A;  1JNZ A;  2YM1 A;  4C77 A;  1OJC A;  2WOI A;  1E39 A;  1OJT A;  3BNU A;  2VVL G;  2EQ9 A;  1Y56 B;  3GYJ A;  2WHD A;  3OZ2 A;  5FS7 A;  1EBD A;  3O0H A;  5L46 A;  4YT0 A;  3DJE A;  2VRL A;  4YXD A;  2BCG G;  1H7W A;  1KDG A;  3BHK A;  3L8K A;  3FIM B;  3AEB A;  4YSH A;  4GUV A;  4GAV A;  1H84 A;  3RP6 A;  4NTD A;  4TLZ A;  1FEB A;  3Q9T A;  1PXC A;  4WX1 A;  4TM1 A;  2C7G A;  4AP3 A;  4EQW A;  2BXS A;  2PYX A;  3C4A A;  3F8D A;  3CNJ A;  1ZMD A;  3CIR A;  2YVG A;  1JRY A;  1O5W A;  3ICR A;  2I0Z A;  4J36 A;  4J57 A;  4OPC A;  2GF3 A;  3UTE A;  2V3B A;  4FDC B;  3CNT A;  1KNR A;  1IUS A;  3PVC A;  5FS8 A;  1LVL A;  4RSL A;  4U8K A;  3ITJ A;  2JBV A;  2BCP A;  3AD7 B;  4O5U A;  4X9N A;  3UKQ A;  1NDA A;  4PAA A;  1D4D A;  4EQS A;  3CN8 A;  2WPC A;  3LZX A;  1F3P A;  2X8C A;  3ALL A;  3SZW A;  3DJJ A;  1GOS A;  1IUX A;  3T0K A;  1NHS A;  4EM4 A;  3GDN A;  5BUL A;  2OA1 A;  2J3N A;  1LTX R;  2OAL A;  5JCK A;  4LII A;  1CBO A;  1F8W A;  3PS9 A;  4BK2 A;  1UKV G;  1NHP A;  1TDO A;  3P4Q A;  3UKA A;  4A5L A;  1GEU A;  1EL5 A;  3DJG X;  3LJP A;  3NLC A;  3AE5 A;  4CNJ A;  2WU5 A;  2XLR A;  5TR3 A;  4IVO B;  4H2R A;  4E0V A;  3AYI A;  4RG3 A;  3T14 A;  2YG4 A;  3CGD A;  4BK1 A;  2V3A A;  3BHF A;  1DNC A;  3K30 A;  4Y4L A;  3DK4 A;  4YSZ A;  1Q1R A;  2ARD A;  3NTD A;  5HHF A;  3SFD A;  3AEG A;  4K2X A;  4D03 A;  3NHO X;  3ALM A;  2V5Z A;  3SGL A;  1P2H A;  2YLT A;  4FK1 C;  1LPF A;  1L9E A;  1DXL A;  1FEA A;  4UDR A;  3PO7 A;  3T2Y A;  3C4N A;  2X8G A;  4CBQ A;  3ABV A;  4P9S A;  1NG4 A;  5BUK A;  4J34 A;  3AE3 A;  1PBF A;  4AT2 A;  2WP9 A;  1Q1W A;  2OLN A;  3S61 A;  2GB0 A;  2XYO A;  4OPD A;  1DJQ A;  4C5O A;  4NEV A;  4ICY A;  4K5S A;  4X9M A;  1KF6 A;  1QO8 A;  5FS9 A;  5CKU A;  3AB1 A;  3S5W A;  4B66 A;  1NAA A;  4CCQ A;  2B9W A;  2XLT A;  3NRN A;  3DME A;  4U8P A;  2X50 A;  4AT0 A;  1LQU A;  3GYI A;  2XFO A;  1GRH A;  3D1C A;  3T37 A;  2BAB A;  1EL9 A;  1JRX A;  4JY3 A;  4A79 A;  1NEK A;  4H4X A;  2BA9 A;  5ER0 A;  1ZOY A;  1GTE A;  2BK4 A;  3NH3 X;  3SYI A;  3AE1 A;  3VRB A;  2GAH B;  2BXR A;  2GR0 A;  1JEH A;  1PJ7 A;  4JQ9 A;  1JRZ A;  3LZW A;  3SQP A;  2GR3 A;  1PHH A;  4NTC A;  1EL8 A;  4U8N A;  3RNM A;  3ADA B;  3EPT A;  3P4S A;  4G73 A;  4H4Z A;  3GMC A;  2JK6 A;  2X99 A;  1E1L A;  3OC4 A;  4Z24 A;  2BS4 A;  2HQM A;  2B9Y A;  3B3R A;  3ISH A;  4BK3 A;  2ACZ A;  1D4C A;  2WBA A;  1LQT A;  3II4 A;  1DOC A;  3AWI A;  1YKJ A;  4OPL A;  1YQ3 A;  3AED A;  4II3 A;  1CJC A;  3UKK A;  5KVH A;  2XVI A;  1IUV A;  4H4W A;  5J60 A;  1FEC A;  1TDF A;  1TDK A;  1ZOV A;  4H4T A;  4OPU A;  4K5R A;  4DSG A;  1N4W A;  4OPG A;  2CUL A;  2FJD A;  4H2Q A;  4U8L A;  2C64 A;  2IID A;  4A6N B;  5LV9 A;  3SX6 A;  2A87 A;  4J56 A;  2OAM A;  2BS2 A;  2WOW A;  4USQ A;  4BV6 A;  3UKP A;  3UCL A;  1PJ5 A;  2WES A;  3DJD A;  3NK2 X;  3H8L A;  1E7P A;  2AQJ A;  4EMI A;  2YQU A;  4Y4M A;  1TYT A;  4BJZ A;  5KMQ A;  4UDP A;  4OPI A;  2IVD A;  5KNL A;  3LAD A;  4GR1 A;  2F5Z A;  3CND A;  1E1M A;  3SM8 A;  4HB9 A;  3ICT A;  3I6D A;  2YAU A;  5KRQ A;  5KOW A;  1IJH A;  4XXG A;  4Z43 A;  2V6O A;  4B63 A;  3B6D A;  1GXF A;  3NT6 A;  4NWZ A;  3VR8 A;  2YLZ A;  5U63 A;  1YQ4 A;  2B9X A;  3AEC A;  4A9W A;  2X8H A;  3FMW A;  3UP4 A;  3QFB A;  2C66 A;  4H4P A;  4XWZ A;  4JNA A;  3AE4 A;  2AAQ A;  3BI4 A;  1Y56 A;  4U8O A;  5CQF A;  3QSE A;  1M6I A;  5GSN A;  2C65 A;  3IF9 A;  1CJ3 A;  4YKG A;  1L9D A;  1RYI A;  1CC4 A;  2C76 A;  4TM4 A;  4EMJ A;  2Q6U A;  4GCM A;  3CPJ G;  5C2T A;  3ZDN A;  1JOA A;  2WU2 A;  4GAP A;  1YQZ A;  1HYU A;  1H7X A;  3E1T A;  4Z2U A;  4A65 A;  1OJ9 A;  4U8M A;  1KSU A;  4EMW A;  3G5Q A;  3AD8 B;  3C96 A;  3M12 A;  1IUW A;  2QCU A;  3QJ4 A;  3UKL A;  3UTG A;  3NNE A;  5IPY A;  3HYX A;  2CFY A;  4K7Z A;  4A99 A;  4B1B A;  5JCM A;  3VRD B;  3AYL A;  4REK A;  1OJA A;  1D5T A;  1FOH A;  2RGJ A;  1CF3 A;  2YR5 A;  3AE2 A;  3DH9 A;  3KD9 A;  4FX9 A;  4ZCD A;  2WQY A;  1AOG A;  1RSG A;  3K7Q X;  3KKJ A;  3NYC A;  3QVR A;  3NN0 X;  3RHA A;  1JU2 A;  3DGH A;  4I58 A;  1COY A;  2Z5Y A;  4J33 A;  1NHR A;  1PBD A;  2B7S A;  3QSM A;  4JNQ A;  4D04 A;  4A6N A;  2EQ6 A;  1GRT A;  4IA6 A;  2QA1 A;  1LV0 A;  1GES A;  5HY5 A;  1KNP A;  1IUT A;  3T2K A;  1E6E A;  1NEN A;  5GRT A;  2WPF A;  2BRY A;  1JNR A;  2BK5 A;  2ZBW A;  1FL2 A;  3LOV A;  3NYF A;  2C67 A;  4M52 A;  5J7X A;  2XVH A;  4CRT A;  1H6V A;  2JB2 A;  4YTP A;  1ZMC A;  1MOK A;  3P4P A;  3QSS A;  2YWL A;  3UOZ A;  1X31 B;  4U2L A;  1GRE A;  2YLR A;  4BUR A;  2WOV A;  3K7M X;  2C3C A;  5U1O A;  3UOY A;  4B68 A;  3AE7 A;  2GMH A;  5FMH A;  2E4G A;  4EIP A;  4NTE A;  4H4S A;  1D4E A;  2NVK X;  3GD3 A;  5KMP A;  4GRT A;  3VQR A;  3D8X A;  1ZY8 A;  3P9U A;  4H4R A;  4A7A A;  3EF6 A;  3NK0 X;  2C3D A;  4X4J A;  2GEW A;  4EIQ A;  2APG A;  2GR1 A;  2NPX A;  2YG6 A;  3GMB A;  3JSK A;  4OCG A;  3AD9 B;  2V60 A;  2V61 A;  3V3N A;  4J31 A;  1B4V A;  2E5V A;  2YVF A;  3ICS A;  5KWF A;  5EB4 A;  1L0V A;  2XFQ A;  4B67 A;  1VQW A;  1ZP0 A;  3NG7 X;  3P1W A;  3ATR A;  5M10 A;  1GET A;  1TDE A;  3BNM A;  3URH A;  2XFP A;  5IQ1 A;  1CJ4 A;  1K4Q A;  4H4U A;  3ZYX A;  1DOE A;  2B7R A;  4YTN A;  1OJD A;  2YR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...