2Q7VA

Crystal structure of deinococcus radiodurans thioredoxin reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
313
Chain Sequence
TAPTAHDYDVVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAKVEMDEVQGVQHDATSHPYPFTVRGYNGEYRAKAVILATGADPRKLGIPGEDNFWGKGVSTCATCDGFFYKGKKVVVIGGGDAAVEEGMFLTKFADEVTVIHRRDTLRANKVAQARAFANPKMKFIWDTAVEEIQGADSVSGVKLRNLKTGEVSELATDGVFIFIGHVPNTAFVKDTVSLRDDGYVDVRDEIYTNIPMLFAAGDVSDYIYRQLATSVGAGTRAAMMTERQLAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thioredoxin system from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 90
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q7vA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q7vA02
2IVEA 3AYLA 4FK1C 1S3EA 1TDKA 1O94A 1CJ2A 1DNCA 1GETA 2C67A 1DOEA 2DKHA 4MJWA 3VRBA 2YG3A 1L9DA 1LTXR 2NVKX 3FIMB 4EMWA 1DXLA 4RG3A 2XDOA 3KLJA 3P4QA 4LU6A 4ADWA 3NK1X 2JK6A 2X3NA 4CRTA 3DK4A 2GR3A 4DGKA 2YR6A 3BI4A 4GDPA 2Z5XA 4NEWA 3B6DA 4U2TA 3UKLA 1E7PA 1GRGA 2B7SA 3LADA 4OVIA 2YVJA 3Q6JA 2BC1A 3IWAA 3IHMA 3UKPA 3UKFA 3H8LA 4OPLA 4Z2RA 3EPTA 2GMHA 4K5RA 2BK3A 5BRTA 2XLSA 4J57A 1TDFA 4OCGA 1E1KA 1H86A 3ZYXA 2WDRA 2YLWA 1TDEA 4U8OA 3K7TA 3NLCA 2JAEA 1NG4A 1FOHA 1FCDA 2XLPA 4U8IA 4ZCCA 2VOUA 5IQ1A 5IQ4A 1ZX9A 2X99A 3K7MX 5ER0A 1E39A 4WX1A 4Z44A 1M6IA 3NH3X 2GR1A 4J56A 1CC4A 3VQRA 1P2EA 3CNPA 3QSEA 4NZHA 3AEFA 2I0ZA 3V76A 3NYEA 1H6VA 2XFNA 3CGCA 5JCIA 1DJNA 1XPQA 2JB2A 3PVCA 4H2QA 2YR5A 3ICRA 1EL9A 1ZOYA 3C4AA 3ICSA 4H2PA 1NPXA 4TM0A 2C3DA 3GMBA 3KKJA 1D4EA 1N4VA 4H4ZA 4Y4NA 1YQ4A 2QAEA 3AEGA 1DOBA 4M52A 1ZKQA 2UZZA 2GRTA 2RGJA 3DGZA 4B67A 3PO7A 2WPFA 3K30A 3DA1A 4D04A 3LB8A 3GMCA 3II4A 2QA2A 3WE0A 2WQYA 3RNMA 1P2HA 2Q0KA 2Q6UA 5CKUA 3GYJA 1AOGA 1B37A 4C3XA 3AECA 4EQRA 3G5RA 3QFBA 2YVGA 5BVAA 1W4XA 5KRQA 3ABVA 1HYUA 2R0PA 3UKKA 3QSMA 3H4KA 2VQ7A 3NHOX 3FPZA 1PJ7A 1YKJA 3ALMA 3IF9A 2X8CA 1JOAA 1YY5A 2VQBA 4OPIA 4YWOA 4U2SA 4B65A 1L0VA 1XDIA 3P4RA 4H2NA 2VZ2A 4J33A 4A7AA 2R45A 1OJDA 1CHUA 2BS2A 2FJEA 1QJDA 2FJBA 3QSSA 1TDNA 2GQFA 1K4QA 3NGCX 4HB9A 2GR2A 2XFUA 4X9NA 1IUWA 5KOWA 4OPDA 5HHFA 3ALLA 2NPXA 1VDCA 2C75A 1NG3A 4K2XA 1PXBA 4EIPA 1E6EA 4AOSA 2YLSA 1QO8A 1GESA 3P4SA 1CJ3A 4OPGA 1E1MA 2OALA 3ATQA 3AXBA 3IHGA 3SFEA 4A5LA 1LQUA 1MXTA 1DOCA 4C77A 4JN9A 3CGEA 5BULA 2A89A 3CNJA 1H83A 4K5SA 5BUKA 3HZLA 1Y56A 4Y4MA 3EAOA 1PXAA 1S3BA 2CDUA 3UKHA 1XANA 1S2QA 4K7ZA 1Y0PA 4LA1A 1Q9IA 3AB1A 3BHKA 4OPTA 4A6NA 1GTEA 2Y6QA 3QFAA 4YKFA 5M0ZA 4Z2TA 4GDEA 4Y4LA 5J60A 1ZMDA 4IA6A 2FBWA 3AYIA 1OJ9A 2WP5A 2YVFA 3DGHA 1KSUA 1O5WA 1NEKA 4WCTA 2GB0A 3GD4A 5KVIA 4U2LA 2XYOA 3ZDNA 1FECA 3AE5A 3S5WA 1K0IA 4CNKA 4GCMA 4UDRA 1IJHA 1VRQB 5JCMA 3AE4A 4BK1A 3I3LA 1H84A 3DH9A 1OJAA 1IUUA 3PS9A 3ALJA 4D03A 3RP6A 2BCGG 2BA9A 4H4QA 1XHCA 4O5UA 4JNQA 4JNAA 4TLZA 3QJ4A 4B1BA 4BURA 3RP8A 3VR8A 1GRFA 2EQ9A 3QVRA 1CL0A 2BXSA 2XVEA 3ADAB 4YTPA 4CY6A 1JU2A 4H7UA 4TM3A 2YLRA 2XCGA 4Z25A 5JCKA 2BABA 1H7XA 1REOA 3ICTA 4U8KA 5FS7A 4O5QA 5M10A 4YT0A 1JNRA 1CF3A 2E5VA 3CNTA 1CJ4A 2BXRA 1GALA 3ATRA 3KPFA 1BKWA 5U25A 1FEBA 1V59A 1GOSA 1GV4A 4X9MA 1IUVA 2GH5A 3M13A 1GT8A 2YG4A 1N4UA 2CVJA 2OAMA 3AE3A 3UP4A 4APNA 4B63A 2ACZA 2JB3A 3AE1A 2C70A 3CTYA 3C96A 1OJCA 3DK8A 5EB4A 1PS9A 4REKA 4A6NB 2IIDA 2RGHA 3NYCA 3NYFA 4BK2A 3LOVA 1D4DA 1GRAA 4YSXA 2R4JA 4H4TA 4XWZA 2YM1A 3AWIA 3S61A 2JB1A 2XFPA 1M64A 3AD9B 4JY3A 4H4UA 4DNAA 3P9UA 3UTEA 3NRNA 2WOVA 1EL7A 1PJ5A 3SGLA 3UOXA 1TYPA 3NNEA 4CCQA 4Z43A 3GWDA 3GRSA 4J31A 1H7WA 2FJDA 1RSGA 2GMJA 4EQSA 3CGBA 1OJTA 1PBFA 3NTAA 3SM8A 4U8NA 2GR0A 3L1RA 2WOWA 4H4PA 5FS9A 1S2YA 1VQWA 3QVPA 2YWLA 3CNSA 4KPRA 3LXDA 1TYTA 4I58A 4U8MA 4YTMA 4YTNA 4PAAA 1KF6A 2OA1A 3AYJA 2V3AA 4H2RA 2R0CA 2VVLA 3NK2X 2Q7VA 2ARDA 4ZCDA 2BS4A 3EANA 1LJ1A 2WU2A 4HA6A 2JBVA 2C3CA 4RSLA 1GEUA 4A9WA 2XLRA 4AOXA 1X31B 1D5TA 3M12A 4GUVA 4J34A 1B4VA 3P4PA 3NT6A 4CNJA 1UKVG 2F5ZA 2GAGB 4UDPA 5KOXA 4U8PA 1NHPA 5KXJA 4JQ9A 2GF3A 2XLUA 3UOZA 1NDAA 2WPEA 1L9CA 2XVJA 1YQZA 3NTDA 5HXIA 1JRXA 4H4RA 1H81A 1PBCA 1CBOA 1ZMCA 2C7GA 4FX9A 4B66A 5JCNA 2XVFA 4XWRA 5LV9A 1GNDA 4YKGA 3DJJA 3UTHA 1NAAA 2EQ6A 4EM3A 1MO9A 1Q1WA 5EOWA 1CJCA 3E1TA 1KNRA 2A8XA 2E4GA 3EF6A 5J7XA 1ZY8A 4YXDA 2XFOA 3GDPA 2JKCA 1FL2A 3CPJG 2HQMA 3F8RA 3L8KA 2YR4A 5KWFA 2WEUA 3BNUA 4K22A 4E0VA 2OLOA 4N9XA 2WESA 3Q9TA 3BI5A 3ISHA 3JSKA 4XXGA 3NIXA 1PXCA 3VRDB 4IA5A 3OC4A 2O9ZA 3AE7A 4DSHA 3DK9A 1PJ6A 1F8RA 4AT2A 3UTFA 2H89A 2XVHA 2DKIA 1CC2A 1E1LA 4U8JA 2GQWA 1D7LA 3GD3A 1GSNA 3G5SA 4Z24A 1H82A 3CNDA 4NTCA 2QCUA 5TR3A 3RP7A 4EMIA 3DMEA 1O95A 2RABA 3AEBA 2J3NA 4A79A 2C64A 1LV0A 2H88A 2BYBA 3AEEA 1TRBA 4NEVA 3SFDA 5C2TA 3CPIG 4B68A 1TDOA 2XLTA 1IUXA 3FBSA 4EMJA 5C3JA 1KNPA 1Y56B 3NN6X 1MOKA 1JEHA 3URHA 4ECHA 1LQTA 1IUSA 2TPRA 3CIRA 5GSNA 4ZN0A 4C5OA 2YG5A 4FDCB 4GR1A 1RP0A 3BI2A 2WDVA 1F8WA 4NTDA 1PDHA 3F8PA 3COXA 4ICYA 4EIQA 1F6MA 4H50A 4IVOB 1VG0A 1BGNA 2R4EA 3AE8A 4DSGA 2B76A 4I59A 3KVEA 4B64A 1LPFA 2Y6RA 4BV6A 4USRA 2AR8A 2IVDA 3OZ2A 2R0GA 1ONFA 4UDQA 1KDGA 2BC0A 4X4JA 1IUTA 4BJYA 4LIIA 2QA1A 2WETA 5L46A 1SEZA 3AE6A 3LZXA 5EB5A 4PABA 3DJGX 2V3BA 3NN0X 1PN0A 2WDQA 4JDRA 1KFYA 2YG6A 2X50A 4NTEA 1ZK7A 3GYIA 2BK4A 4H4XA 1GRTA 1ZP0A 3NK0X 3BNMA 2W0HA 3P1WA 3UKAA 4YSZA 4TM4A 3UTGA 3D1CA 2GVCA 5FS8A 3AEDA 1EL5A 4CY8A 1YQ3A 4CCRA 5JCLA 4H4YA 4BJZA 3M0OA 3AEAA 2YQUA 4USQA 1B5QA 1FEAA 1PBBA 1ZDLA 3UKQA 3UOYA 1L9EA 2Q0LA 1F8SA 2XFQA 3V3NA 3DJEA 2EQ8A 1CC6A 2VVMA 4JY2A 3FG2P 3UOVA 1GRBA 2XVIA 3AE9A 2B9XA 3I6DA 1GRHA 2B9YA 5HY5A 4BK3A 4EQWA 2C73A 5U63A 1QLBA 2X8GA 1VG9A 3C4NA 2WOIA 1GREA 3O0HA 4UP3A 5FMHA 3UP5A 4A65A 3DJDA 2WP9A 4H4SA 2BCPA 1Z6LA 1KSSA 2C65A 3LJPA 4J2WA 2WP6A 1JNZA 4H4VA 1D4CA 1GERA 3F8DA 5FS6A 1BWCA 3R9UA 1B8SA 2VRLA 3AE2A 2R9ZA 2GAHB 2WS3A 1N4WA 3VR9A 3KD9A 1GPEA 2B7RA 3GSIA 3GDNA 1EL8A 2GEWA 4OPCA 4YSYA 5DBJA 2TMDA 3FMWA 1PBDA 2ZZ0A 3REDA 1K0LA 3SQPA 2YM2A 4U8LA 2PHHA 2BACA 3AD7B 4B69A 4EQXA 3BHFA 1RYIA 4KX6A 4FK1A 1NHQA 1JRZA 1D7YA 4RG4A 2APGA 3V3OA 1E1NA 3NG7X 3NKSA 1K0JA 1EBDA 1NENA 4P9SA 1NHRA 2V6OA 2EQ7A 3K7QX 1N1PA 4K8DA 5GRTA 5IPYA 4GF7A 2YG7A 2WU5A 1JRYA 3H8IA 4TLXA 3B3RA 4AP1A 2A87A 2X8HA 4Z2UA 2ZZCA 4AP3A 1PHHA 3GRTA 4AT0A 2CULA 1PBEA 3UCLA 2RGOA 2V60A 1BZLA 3LZWA 4GRTA 5EBKA 5KVHA 1BGJA 2WPCA 2VRMA 2FJAA 2V61A 1NHSA 2OLNA 4CBQA 3CPHG 3KA7A 2YAUA 5HYMA 4OPUA 4H4WA 1GTHA 1COYA 1BF3A 2B9WA 4IV9A 2ZZBA 1GXFA 2CFYA 2R46A 2Z5YA 2E1MA 4J36A 5CQFA 3CGDA 4Z26A 2YLTA 1ZOVA 4YSHA 2PYXA 2AQJA 3KU9A 4TM1A 2C76A 3IC9A 1DODA 1F3PA 3D8XA 4IVMB 3ITJA 2AAQA 2GV8A 2BK5A 3RHAA 2V5ZA 2BS3A 4A99A 2ZBWA 1DJQA 5U1OA 3T37A 2WHDA 4EM4A 1ELIA 2YLZA 2YLXA 3VRAA 3CN8A 4C3YA 2C72A 2WBAA 3G5QA 1Q1RA 2VVLG 3GWFA 3AD8B 4C74A 1LVLA 2C66A
chains in the Genus database with same CATH superfamily
2IVEA 3AYLA 4FK1C 1S3EA 1TDKA 1O94A 1CJ2A 1DNCA 1GETA 2C67A 1DOEA 2DKHA 4MJWA 3VRBA 2YG3A 3SXIA 1L9DA 1LTXR 2NVKX 3FIMB 4EMWA 1DXLA 4RG3A 2XDOA 3KLJA 3P4QA 4LU6A 4ADWA 3NK1X 2JK6A 2X3NA 4CRTA 3DK4A 2GR3A 4DGKA 2YR6A 3BI4A 4GDPA 2Z5XA 4NEWA 3B6DA 4U2TA 3UKLA 1E7PA 1GRGA 2B7SA 3LADA 4OVIA 2YVJA 3Q6JA 2BC1A 3IWAA 3IHMA 3UKPA 3UKFA 3H8LA 4OPLA 4Z2RA 3EPTA 2GMHA 4K5RA 2BK3A 5BRTA 2XLSA 4J57A 1TDFA 4OCGA 1E1KA 1H86A 3ZYXA 2WDRA 2YLWA 1TDEA 4U8OA 3K7TA 3SZCA 3NLCA 2JAEA 1NG4A 1FOHA 1FCDA 2XLPA 4U8IA 4ZCCA 2VOUA 5IQ1A 5IQ4A 1ZX9A 2X99A 3K7MX 5ER0A 1E39A 4WX1A 4Z44A 1M6IA 3NH3X 2GR1A 4J56A 1CC4A 3VQRA 1P2EA 3CNPA 3QSEA 4NZHA 3AEFA 2I0ZA 3V76A 3NYEA 1H6VA 2XFNA 3CGCA 5JCIA 1DJNA 1XPQA 2JB2A 3PVCA 4H2QA 2YR5A 3ICRA 1EL9A 1ZOYA 3C4AA 3ICSA 4H2PA 1NPXA 4TM0A 2C3DA 3GMBA 3KKJA 1D4EA 1N4VA 4H4ZA 4Y4NA 1YQ4A 2QAEA 3AEGA 1DOBA 4M52A 1ZKQA 2UZZA 2GRTA 2RGJA 3DGZA 4B67A 3PO7A 2WPFA 3K30A 3DA1A 4D04A 3LB8A 3GMCA 3II4A 2QA2A 3WE0A 2WQYA 3RNMA 1P2HA 2Q0KA 2Q6UA 5CKUA 3GYJA 1AOGA 1B37A 4C3XA 3AECA 4EQRA 3G5RA 3QFBA 2YVGA 5BVAA 1W4XA 5KRQA 3ABVA 1HYUA 2R0PA 3UKKA 3QSMA 3H4KA 2VQ7A 3NHOX 3FPZA 1PJ7A 3HYWA 1YKJA 3ALMA 3IF9A 2X8CA 1JOAA 1YY5A 2VQBA 4OPIA 4YWOA 4U2SA 3SZWA 4B65A 1L0VA 1XDIA 3P4RA 4H2NA 2VZ2A 4J33A 4A7AA 2R45A 1OJDA 1CHUA 2BS2A 2FJEA 1QJDA 2FJBA 3QSSA 1TDNA 2GQFA 1K4QA 3NGCX 4HB9A 2GR2A 2XFUA 4X9NA 1IUWA 5KOWA 4OPDA 5HHFA 3ALLA 3SZFA 2NPXA 1VDCA 2C75A 1NG3A 4K2XA 1PXBA 4EIPA 1E6EA 4AOSA 2YLSA 1QO8A 4II3A 1GESA 3P4SA 3SX6A 1CJ3A 4OPGA 1E1MA 2OALA 3ATQA 3AXBA 3IHGA 3SFEA 4A5LA 1LQUA 1MXTA 1DOCA 4C77A 4JN9A 3CGEA 5BULA 2A89A 3CNJA 1H83A 4K5SA 5BUKA 3HZLA 1Y56A 4Y4MA 3EAOA 1PXAA 1S3BA 2CDUA 3UKHA 1XANA 1S2QA 4K7ZA 1Y0PA 4LA1A 1Q9IA 3AB1A 3BHKA 4OPTA 4A6NA 1GTEA 2Y6QA 3QFAA 4YKFA 5M0ZA 4Z2TA 4GDEA 4Y4LA 5J60A 1ZMDA 4IA6A 2FBWA 3AYIA 1OJ9A 2WP5A 2YVFA 3DGHA 1KSUA 1O5WA 1NEKA 4WCTA 2GB0A 3GD4A 5KVIA 4U2LA 2XYOA 3ZDNA 1FECA 3AE5A 3S5WA 2C4CA 1K0IA 4CNKA 3HYXA 4GCMA 1IJHA 4UDRA 1VRQB 5JCMA 3AE4A 4BK1A 3I3LA 1H84A 3DH9A 1OJAA 1IUUA 3PS9A 4II2A 5KNLA 4NWZA 3ALJA 4D03A 3RP6A 2BCGG 2BA9A 4H4QA 1XHCA 4O5UA 5KMQA 4JNQA 4JNAA 4TLZA 3QJ4A 4B1BA 4BURA 3RP8A 3VR8A 1GRFA 2EQ9A 3QVRA 1CL0A 2BXSA 2XVEA 3ADAB 4YTPA 4CY6A 1JU2A 4H7UA 4TM3A 2YLRA 2XCGA 4Z25A 5JCKA 2BABA 1H7XA 1REOA 3ICTA 4U8KA 5FS7A 4O5QA 5M10A 4YT0A 1JNRA 1CF3A 2E5VA 3CNTA 1CJ4A 2BXRA 1GALA 3ATRA 3KPFA 1BKWA 5U25A 1FEBA 1V59A 1GOSA 1GV4A 4X9MA 1IUVA 2GH5A 3M13A 1GT8A 2YG4A 1N4UA 2CVJA 2OAMA 3AE3A 3UP4A 4APNA 4B63A 2ACZA 4GAVA 2JB3A 3AE1A 2C70A 3CTYA 3C96A 1OJCA 3DK8A 5EB4A 1PS9A 4REKA 4A6NB 4G6HA 2IIDA 2RGHA 3NYCA 3NYFA 4BK2A 3LOVA 1D4DA 1GRAA 4YSXA 2R4JA 4H4TA 4XWZA 2YM1A 3AWIA 3S61A 2JB1A 2XFPA 1M64A 3AD9B 4JY3A 4H4UA 4DNAA 3P9UA 3UTEA 3NRNA 2WOVA 1EL7A 1PJ5A 3SGLA 3UOXA 1TYPA 3NNEA 4CCQA 4Z43A 3GWDA 3GRSA 4J31A 1H7WA 2FJDA 1RSGA 2GMJA 4EQSA 3CGBA 1OJTA 1PBFA 3NTAA 3SM8A 4U8NA 2GR0A 3L1RA 2WOWA 4H4PA 5FS9A 1S2YA 1VQWA 3QVPA 2YWLA 3CNSA 4KPRA 3LXDA 1TYTA 4I58A 4U8MA 4YTMA 4YTNA 4PAAA 1KF6A 2OA1A 3AYJA 2V3AA 4H2RA 3T2ZA 2R0CA 2VVLA 3NK2X 2Q7VA 2ARDA 4ZCDA 2BS4A 3EANA 1LJ1A 2WU2A 4HA6A 2JBVA 2C3CA 4RSLA 1GEUA 4A9WA 2XLRA 4AOXA 1X31B 1D5TA 3M12A 4GUVA 4J34A 1B4VA 3P4PA 3NT6A 4CNJA 1UKVG 2F5ZA 2GAGB 4UDPA 5KOXA 4U8PA 1NHPA 5KXJA 4JQ9A 2GF3A 2XLUA 3UOZA 1NDAA 2WPEA 1L9CA 2XVJA 1YQZA 3NTDA 5HXIA 1JRXA 4H4RA 1H81A 1PBCA 1CBOA 1ZMCA 2C7GA 4FX9A 4B66A 5JCNA 2XVFA 4XWRA 5LV9A 1GNDA 4YKGA 3DJJA 3UTHA 1NAAA 2EQ6A 4EM3A 1MO9A 1Q1WA 5EOWA 3SYIA 3T0KA 1CJCA 3E1TA 1KNRA 2A8XA 2E4GA 3EF6A 5J7XA 1ZY8A 4YXDA 2XFOA 3GDPA 2JKCA 1FL2A 3CPJG 2HQMA 3F8RA 3L8KA 2YR4A 5KWFA 3SZ0A 2WEUA 3BNUA 4K22A 4E0VA 2OLOA 4N9XA 2WESA 3Q9TA 3BI5A 3ISHA 3JSKA 4XXGA 3NIXA 1PXCA 3VRDB 4IA5A 3OC4A 2O9ZA 3AE7A 4DSHA 3DK9A 1PJ6A 1F8RA 4AT2A 3UTFA 2H89A 2XVHA 2DKIA 1CC2A 1E1LA 4U8JA 2GQWA 1D7LA 3GD3A 1GSNA 3G5SA 4Z24A 1H82A 3CNDA 4NTCA 2QCUA 5TR3A 3RP7A 4EMIA 5KMPA 3DMEA 1O95A 2RABA 3AEBA 2J3NA 4A79A 2C64A 1LV0A 2H88A 2BYBA 3AEEA 1TRBA 4NEVA 3SFDA 5C2TA 3CPIG 4B68A 1TDOA 2XLTA 1IUXA 3FBSA 4EMJA 5C3JA 1KNPA 1Y56B 3NN6X 1MOKA 1JEHA 3URHA 4ECHA 1LQTA 1IUSA 5KMRA 2TPRA 3CIRA 5GSNA 4ZN0A 4C5OA 2YG5A 4FDCB 4GR1A 4NNJA 1RP0A 3BI2A 2WDVA 1F8WA 4NTDA 1PDHA 3SY4A 3F8PA 3COXA 3HYVA 4ICYA 4EIQA 1F6MA 4H50A 4IVOB 1VG0A 1BGNA 2R4EA 3AE8A 3T2KA 4DSGA 2B76A 4I59A 3KVEA 4B64A 1LPFA 2Y6RA 4BV6A 4USRA 2AR8A 2IVDA 3OZ2A 2R0GA 1ONFA 4UDQA 1KDGA 2BC0A 4X4JA 1IUTA 4BJYA 4LIIA 2QA1A 2WETA 5L46A 1SEZA 3AE6A 3LZXA 5EB5A 4PABA 3DJGX 2V3BA 3NN0X 1PN0A 2WDQA 4G6GA 4JDRA 1KFYA 2YG6A 2X50A 4NTEA 1ZK7A 3GYIA 2BK4A 4H4XA 1GRTA 1ZP0A 3NK0X 3BNMA 2W0HA 3P1WA 4G74A 4GAPA 3KPKA 4TM4A 3T2YA 3UKAA 3UTGA 4YSZA 3T14A 3T31A 3D1CA 2GVCA 5FS8A 3AEDA 4G9KA 1EL5A 4CY8A 1YQ3A 4CCRA 5JCLA 4H4YA 4BJZA 3M0OA 3AEAA 2YQUA 4USQA 1B5QA 1FEAA 1PBBA 1ZDLA 3UKQA 3UOYA 1L9EA 2Q0LA 1F8SA 2XFQA 3V3NA 3DJEA 2EQ8A 1CC6A 2VVMA 4JY2A 3FG2P 3UOVA 1GRBA 2XVIA 3AE9A 2B9XA 3I6DA 1GRHA 2B9YA 5HY5A 4BK3A 4EQWA 2C73A 5U63A 1QLBA 2X8GA 1VG9A 3C4NA 2WOIA 1GREA 3O0HA 4UP3A 5FMHA 3UP5A 4A65A 3DJDA 2WP9A 4H4SA 2BCPA 1Z6LA 1KSSA 2C65A 3LJPA 4J2WA 2WP6A 1JNZA 4H4VA 1D4CA 1GERA 2BRAA 3F8DA 5FS6A 1BWCA 3R9UA 1B8SA 2VRLA 3AE2A 2R9ZA 2GAHB 2WS3A 1N4WA 3VR9A 3KD9A 1GPEA 2B7RA 3GSIA 3GDNA 1EL8A 2GEWA 2BRYA 4OPCA 4YSYA 5DBJA 2TMDA 3FMWA 1PBDA 2ZZ0A 3REDA 1K0LA 3SQPA 2YM2A 4U8LA 3GYXA 2PHHA 2BACA 3AD7B 4G73A 4B69A 4EQXA 3BHFA 1RYIA 4KX6A 4FK1A 1NHQA 1JRZA 5KMSA 1D7YA 4RG4A 2APGA 3V3OA 1E1NA 3NG7X 3NKSA 1K0JA 1EBDA 1NENA 4P9SA 1NHRA 2V6OA 2EQ7A 3K7QX 1N1PA 4K8DA 5GRTA 5IPYA 4GF7A 2YG7A 2WU5A 1JRYA 3H8IA 4TLXA 3B3RA 4AP1A 2A87A 2X8HA 4Z2UA 2ZZCA 4AP3A 1PHHA 3GRTA 4AT0A 2CULA 1PBEA 3UCLA 2RGOA 2V60A 1BZLA 3LZWA 4GRTA 5EBKA 5KVHA 1BGJA 2WPCA 2VRMA 2FJAA 2V61A 1NHSA 2OLNA 4CBQA 3CPHG 3CMMA 3KA7A 2YAUA 5HYMA 4OPUA 4H4WA 1GTHA 1COYA 1BF3A 2B9WA 4IV9A 2ZZBA 1GXFA 2CFYA 2R46A 2Z5YA 2E1MA 4J36A 5CQFA 3CGDA 4Z26A 2YLTA 1ZOVA 4YSHA 2PYXA 2AQJA 3KU9A 4TM1A 2C76A 3IC9A 1DODA 1F3PA 3D8XA 4IVMB 3ITJA 2AAQA 2GV8A 2BK5A 3RHAA 2V5ZA 2BS3A 4A99A 2ZBWA 1DJQA 5U1OA 3T37A 2WHDA 4EM4A 1ELIA 2YLZA 2YLXA 3VRAA 3CN8A 4C3YA 2C72A 2WBAA 3G5QA 1Q1RA 2VVLG 3GWFA 3AD8B 4C74A 1LVLA 2C66A
chains in the Genus database with same CATH topology
2IVEA 3AYLA 4FK1C 1S3EA 1TDKA 1O94A 1CJ2A 1DNCA 1GETA 2C67A 1DOEA 2DKHA 4MJWA 3VRBA 2YG3A 3SXIA 1L9DA 1LTXR 2NVKX 3FIMB 4EMWA 1DXLA 4RG3A 2XDOA 3KLJA 3P4QA 4LU6A 4ADWA 3NK1X 2JK6A 2X3NA 4CRTA 3DK4A 2GR3A 4DGKA 2YR6A 3BI4A 4GDPA 2Z5XA 4NEWA 3B6DA 4U2TA 3UKLA 1E7PA 1GRGA 2B7SA 3LADA 4OVIA 2YVJA 3Q6JA 2BC1A 3IWAA 3IHMA 3UKPA 3UKFA 3H8LA 4OPLA 4Z2RA 3EPTA 2GMHA 4K5RA 2BK3A 5BRTA 2XLSA 4J57A 1TDFA 4OCGA 1E1KA 1H86A 3ZYXA 2WDRA 2YLWA 1TDEA 4U8OA 3K7TA 3SZCA 3NLCA 2JAEA 1NG4A 1FOHA 1FCDA 2XLPA 4U8IA 4ZCCA 2VOUA 5IQ1A 5IQ4A 1ZX9A 2X99A 3K7MX 5ER0A 1E39A 4WX1A 4Z44A 1M6IA 3NH3X 2GR1A 4J56A 1CC4A 3VQRA 1P2EA 3CNPA 3QSEA 4NZHA 3AEFA 2I0ZA 3V76A 3NYEA 1H6VA 2XFNA 3CGCA 5JCIA 1DJNA 1XPQA 2JB2A 3PVCA 4H2QA 2YR5A 3ICRA 1EL9A 1ZOYA 3C4AA 3ICSA 4H2PA 1NPXA 4TM0A 2C3DA 3GMBA 3KKJA 1D4EA 1N4VA 4H4ZA 4Y4NA 1YQ4A 2QAEA 3AEGA 1DOBA 4M52A 1ZKQA 2UZZA 2GRTA 2RGJA 3DGZA 4B67A 3PO7A 2WPFA 3K30A 3DA1A 4D04A 3LB8A 3GMCA 3II4A 2QA2A 3WE0A 2WQYA 3RNMA 1P2HA 2Q0KA 2Q6UA 5CKUA 3GYJA 1AOGA 1B37A 4C3XA 3AECA 4EQRA 3G5RA 3QFBA 2YVGA 5BVAA 1W4XA 5KRQA 3ABVA 1HYUA 2R0PA 3UKKA 3QSMA 3H4KA 2VQ7A 3NHOX 3FPZA 1PJ7A 3HYWA 1YKJA 3ALMA 3IF9A 2X8CA 1JOAA 1YY5A 2VQBA 4OPIA 4YWOA 4U2SA 3SZWA 4B65A 1L0VA 1XDIA 3P4RA 4H2NA 2VZ2A 4J33A 4A7AA 2R45A 1OJDA 1CHUA 2BS2A 2FJEA 1QJDA 2FJBA 3QSSA 1TDNA 2GQFA 1K4QA 3NGCX 4HB9A 2GR2A 2XFUA 4X9NA 1IUWA 5KOWA 4OPDA 5HHFA 3ALLA 3SZFA 2NPXA 1VDCA 2C75A 1NG3A 4K2XA 1PXBA 4EIPA 1E6EA 4AOSA 2YLSA 1QO8A 4II3A 1GESA 3P4SA 3SX6A 1CJ3A 4OPGA 1E1MA 2OALA 3ATQA 3AXBA 3IHGA 3SFEA 4A5LA 1LQUA 1MXTA 1DOCA 4C77A 4JN9A 3CGEA 5BULA 2A89A 3CNJA 1H83A 4K5SA 5BUKA 3HZLA 1Y56A 4Y4MA 3EAOA 1PXAA 1S3BA 2CDUA 3UKHA 1XANA 1S2QA 4K7ZA 1Y0PA 4LA1A 1Q9IA 3AB1A 3BHKA 4OPTA 4A6NA 1GTEA 2Y6QA 3QFAA 4YKFA 5M0ZA 4Z2TA 4GDEA 4Y4LA 5J60A 1ZMDA 4IA6A 2FBWA 3AYIA 1OJ9A 2WP5A 2YVFA 3DGHA 1KSUA 1O5WA 1NEKA 4WCTA 2GB0A 3GD4A 5KVIA 4U2LA 2XYOA 3ZDNA 1FECA 3AE5A 3S5WA 2C4CA 1K0IA 4CNKA 3HYXA 4GCMA 1IJHA 4UDRA 1VRQB 5JCMA 3AE4A 4BK1A 3I3LA 1H84A 3DH9A 1OJAA 1IUUA 3PS9A 4II2A 5KNLA 4NWZA 3ALJA 4D03A 3RP6A 2BCGG 2BA9A 4H4QA 1XHCA 4O5UA 5KMQA 4JNQA 4JNAA 4TLZA 3QJ4A 4B1BA 4BURA 3RP8A 3VR8A 1GRFA 2EQ9A 3QVRA 1CL0A 2BXSA 2XVEA 3ADAB 4YTPA 4CY6A 1JU2A 4H7UA 4TM3A 2YLRA 2XCGA 4Z25A 5JCKA 2BABA 1H7XA 1REOA 3ICTA 4U8KA 5FS7A 4O5QA 5M10A 4YT0A 1JNRA 1CF3A 2E5VA 3CNTA 1CJ4A 2BXRA 1GALA 3ATRA 3KPFA 1BKWA 5U25A 1FEBA 1V59A 1GOSA 1GV4A 4X9MA 1IUVA 2GH5A 3M13A 1GT8A 2YG4A 1N4UA 2CVJA 2OAMA 3AE3A 3UP4A 4APNA 4B63A 2ACZA 4GAVA 2JB3A 3AE1A 2C70A 3CTYA 3C96A 1OJCA 3DK8A 5EB4A 1PS9A 4REKA 4A6NB 4G6HA 2IIDA 2RGHA 3NYCA 3NYFA 4BK2A 3LOVA 1D4DA 1GRAA 4YSXA 2R4JA 4H4TA 4XWZA 2YM1A 3AWIA 3S61A 2JB1A 2XFPA 1M64A 3AD9B 4JY3A 4H4UA 4DNAA 3P9UA 3UTEA 3NRNA 2WOVA 1EL7A 1PJ5A 3SGLA 3UOXA 1TYPA 3NNEA 4CCQA 4Z43A 3GWDA 3GRSA 4J31A 1H7WA 2FJDA 1RSGA 2GMJA 4EQSA 3CGBA 1OJTA 1PBFA 3NTAA 3SM8A 4U8NA 2GR0A 3L1RA 2WOWA 4H4PA 5FS9A 1S2YA 1VQWA 3QVPA 2YWLA 3CNSA 4KPRA 3LXDA 1TYTA 4I58A 4U8MA 4YTMA 4YTNA 4PAAA 1KF6A 2OA1A 3AYJA 2V3AA 4H2RA 3T2ZA 2R0CA 2VVLA 3NK2X 2Q7VA 2ARDA 4ZCDA 2BS4A 3EANA 1LJ1A 2WU2A 4HA6A 2JBVA 2C3CA 4RSLA 1GEUA 4A9WA 2XLRA 4AOXA 1X31B 1D5TA 3M12A 4GUVA 4J34A 1B4VA 3P4PA 3NT6A 4CNJA 1UKVG 2F5ZA 2GAGB 4UDPA 5KOXA 4U8PA 1NHPA 5KXJA 4JQ9A 2GF3A 2XLUA 3UOZA 1NDAA 2WPEA 1L9CA 2XVJA 1YQZA 3NTDA 5HXIA 1JRXA 4H4RA 1H81A 1PBCA 1CBOA 1ZMCA 2C7GA 4FX9A 4B66A 5JCNA 2XVFA 4XWRA 5LV9A 1GNDA 4YKGA 3DJJA 3UTHA 1NAAA 2EQ6A 4EM3A 1MO9A 1Q1WA 5EOWA 3SYIA 3T0KA 1CJCA 3E1TA 1KNRA 2A8XA 2E4GA 3EF6A 5J7XA 1ZY8A 4YXDA 2XFOA 3GDPA 2JKCA 1FL2A 3CPJG 2HQMA 3F8RA 3L8KA 2YR4A 5KWFA 3SZ0A 2WEUA 3BNUA 4K22A 4E0VA 2OLOA 4N9XA 2WESA 3Q9TA 3BI5A 3ISHA 3JSKA 4XXGA 3NIXA 1PXCA 3VRDB 4IA5A 3OC4A 2O9ZA 3AE7A 4DSHA 3DK9A 1PJ6A 1F8RA 4AT2A 3UTFA 2H89A 2XVHA 2DKIA 1CC2A 1E1LA 4U8JA 2GQWA 1D7LA 3GD3A 1GSNA 3G5SA 4Z24A 1H82A 3CNDA 4NTCA 2QCUA 5TR3A 3RP7A 4EMIA 5KMPA 3DMEA 1O95A 2RABA 3AEBA 2J3NA 4A79A 2C64A 1LV0A 2H88A 2BYBA 3AEEA 1TRBA 4NEVA 3SFDA 5C2TA 3CPIG 4B68A 1TDOA 2XLTA 1IUXA 3FBSA 4EMJA 5C3JA 1KNPA 1Y56B 3NN6X 1MOKA 1JEHA 3URHA 4ECHA 1LQTA 1IUSA 5KMRA 2TPRA 3CIRA 5GSNA 4ZN0A 4C5OA 2YG5A 4FDCB 4GR1A 4NNJA 1RP0A 3BI2A 2WDVA 1F8WA 4NTDA 1PDHA 3SY4A 3F8PA 3COXA 3HYVA 4ICYA 4EIQA 1F6MA 4H50A 4IVOB 1VG0A 1BGNA 2R4EA 3AE8A 3T2KA 4DSGA 2B76A 4I59A 3KVEA 4B64A 1LPFA 2Y6RA 4BV6A 4USRA 2AR8A 2IVDA 3OZ2A 2R0GA 1ONFA 4UDQA 1KDGA 2BC0A 4X4JA 1IUTA 4BJYA 4LIIA 2QA1A 2WETA 5L46A 1SEZA 3AE6A 3LZXA 5EB5A 4PABA 3DJGX 2V3BA 3NN0X 1PN0A 2WDQA 4G6GA 4JDRA 1KFYA 2YG6A 2X50A 4NTEA 1ZK7A 3GYIA 2BK4A 4H4XA 1GRTA 1ZP0A 3NK0X 3BNMA 2W0HA 3P1WA 4G74A 4GAPA 3KPKA 4TM4A 3T2YA 3UKAA 3UTGA 4YSZA 3T14A 3T31A 3D1CA 2GVCA 5FS8A 3AEDA 4G9KA 1EL5A 4CY8A 1YQ3A 4CCRA 5JCLA 4H4YA 4BJZA 3M0OA 3AEAA 2YQUA 4USQA 1B5QA 1FEAA 1PBBA 1ZDLA 3UKQA 3UOYA 1L9EA 2Q0LA 1F8SA 2XFQA 3V3NA 3DJEA 2EQ8A 1CC6A 2VVMA 4JY2A 3FG2P 3UOVA 1GRBA 2XVIA 3AE9A 2B9XA 3I6DA 1GRHA 2B9YA 5HY5A 4BK3A 4EQWA 2C73A 5U63A 1QLBA 2X8GA 1VG9A 3C4NA 2WOIA 1GREA 3O0HA 4UP3A 5FMHA 3UP5A 4A65A 3DJDA 2WP9A 4H4SA 2BCPA 1Z6LA 1KSSA 2C65A 3LJPA 4J2WA 2WP6A 1JNZA 4H4VA 1D4CA 1GERA 2BRAA 3F8DA 5FS6A 1BWCA 3R9UA 1B8SA 2VRLA 3AE2A 2R9ZA 2GAHB 2WS3A 1N4WA 3VR9A 3KD9A 1GPEA 2B7RA 3GSIA 3GDNA 1EL8A 2GEWA 2BRYA 4OPCA 4YSYA 5DBJA 2TMDA 3FMWA 1PBDA 2ZZ0A 3REDA 1K0LA 3SQPA 2YM2A 4U8LA 3GYXA 2PHHA 2BACA 3AD7B 4G73A 4B69A 4EQXA 3BHFA 1RYIA 4KX6A 4FK1A 1NHQA 1JRZA 5KMSA 1D7YA 4RG4A 2APGA 3V3OA 1E1NA 3NG7X 3NKSA 1K0JA 1EBDA 1NENA 4P9SA 1NHRA 2V6OA 2EQ7A 3K7QX 1N1PA 4K8DA 5GRTA 5IPYA 4GF7A 2YG7A 2WU5A 1JRYA 3H8IA 4TLXA 3B3RA 4AP1A 2A87A 2X8HA 4Z2UA 2ZZCA 4AP3A 1PHHA 3GRTA 4AT0A 2CULA 1PBEA 3UCLA 2RGOA 2V60A 1BZLA 3LZWA 4GRTA 5EBKA 5KVHA 1BGJA 2WPCA 2VRMA 2FJAA 2V61A 1NHSA 2OLNA 4CBQA 3CPHG 3CMMA 3KA7A 2YAUA 5HYMA 4OPUA 4H4WA 1GTHA 1COYA 1BF3A 2B9WA 4IV9A 2ZZBA 1GXFA 2CFYA 2R46A 2Z5YA 2E1MA 4J36A 5CQFA 3CGDA 4Z26A 2YLTA 1ZOVA 4YSHA 2PYXA 2AQJA 3KU9A 4TM1A 2C76A 3IC9A 1DODA 1F3PA 3D8XA 4IVMB 3ITJA 2AAQA 2GV8A 2BK5A 3RHAA 2V5ZA 2BS3A 4A99A 2ZBWA 1DJQA 5U1OA 3T37A 2WHDA 4EM4A 1ELIA 2YLZA 2YLXA 3VRAA 3CN8A 4C3YA 2C72A 2WBAA 3G5QA 1Q1RA 2VVLG 3GWFA 3AD8B 4C74A 1LVLA 2C66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVE A;  3AYL A;  4FK1 C;  1S3E A;  1TDK A;  1O94 A;  1CJ2 A;  1DNC A;  1GET A;  2C67 A;  1DOE A;  2DKH A;  4MJW A;  3VRB A;  2YG3 A;  1L9D A;  1LTX R;  2NVK X;  3FIM B;  4EMW A;  1DXL A;  4RG3 A;  2XDO A;  3KLJ A;  3P4Q A;  4LU6 A;  4ADW A;  3NK1 X;  2JK6 A;  2X3N A;  4CRT A;  3DK4 A;  2GR3 A;  4DGK A;  2YR6 A;  3BI4 A;  4GDP A;  2Z5X A;  4NEW A;  3B6D A;  4U2T A;  3UKL A;  1E7P A;  1GRG A;  2B7S A;  3LAD A;  4OVI A;  2YVJ A;  3Q6J A;  2BC1 A;  3IWA A;  3IHM A;  3UKP A;  3UKF A;  3H8L A;  4OPL A;  4Z2R A;  3EPT A;  2GMH A;  4K5R A;  2BK3 A;  5BRT A;  2XLS A;  4J57 A;  1TDF A;  4OCG A;  1E1K A;  1H86 A;  3ZYX A;  2WDR A;  2YLW A;  1TDE A;  4U8O A;  3K7T A;  3NLC A;  2JAE A;  1NG4 A;  1FOH A;  1FCD A;  2XLP A;  4U8I A;  4ZCC A;  2VOU A;  5IQ1 A;  5IQ4 A;  1ZX9 A;  2X99 A;  3K7M X;  5ER0 A;  1E39 A;  4WX1 A;  4Z44 A;  1M6I A;  3NH3 X;  2GR1 A;  4J56 A;  1CC4 A;  3VQR A;  1P2E A;  3CNP A;  3QSE A;  4NZH A;  3AEF A;  2I0Z A;  3V76 A;  3NYE A;  1H6V A;  2XFN A;  3CGC A;  5JCI A;  1DJN A;  1XPQ A;  2JB2 A;  3PVC A;  4H2Q A;  2YR5 A;  3ICR A;  1EL9 A;  1ZOY A;  3C4A A;  3ICS A;  4H2P A;  1NPX A;  4TM0 A;  2C3D A;  3GMB A;  3KKJ A;  1D4E A;  1N4V A;  4H4Z A;  4Y4N A;  1YQ4 A;  2QAE A;  3AEG A;  1DOB A;  4M52 A;  1ZKQ A;  2UZZ A;  2GRT A;  2RGJ A;  3DGZ A;  4B67 A;  3PO7 A;  2WPF A;  3K30 A;  3DA1 A;  4D04 A;  3LB8 A;  3GMC A;  3II4 A;  2QA2 A;  3WE0 A;  2WQY A;  3RNM A;  1P2H A;  2Q0K A;  2Q6U A;  5CKU A;  3GYJ A;  1AOG A;  1B37 A;  4C3X A;  3AEC A;  4EQR A;  3G5R A;  3QFB A;  2YVG A;  5BVA A;  1W4X A;  5KRQ A;  3ABV A;  1HYU A;  2R0P A;  3UKK A;  3QSM A;  3H4K A;  2VQ7 A;  3NHO X;  3FPZ A;  1PJ7 A;  1YKJ A;  3ALM A;  3IF9 A;  2X8C A;  1JOA A;  1YY5 A;  2VQB A;  4OPI A;  4YWO A;  4U2S A;  4B65 A;  1L0V A;  1XDI A;  3P4R A;  4H2N A;  2VZ2 A;  4J33 A;  4A7A A;  2R45 A;  1OJD A;  1CHU A;  2BS2 A;  2FJE A;  1QJD A;  2FJB A;  3QSS A;  1TDN A;  2GQF A;  1K4Q A;  3NGC X;  4HB9 A;  2GR2 A;  2XFU A;  4X9N A;  1IUW A;  5KOW A;  4OPD A;  5HHF A;  3ALL A;  2NPX A;  1VDC A;  2C75 A;  1NG3 A;  4K2X A;  1PXB A;  4EIP A;  1E6E A;  4AOS A;  2YLS A;  1QO8 A;  1GES A;  3P4S A;  1CJ3 A;  4OPG A;  1E1M A;  2OAL A;  3ATQ A;  3AXB A;  3IHG A;  3SFE A;  4A5L A;  1LQU A;  1MXT A;  1DOC A;  4C77 A;  4JN9 A;  3CGE A;  5BUL A;  2A89 A;  3CNJ A;  1H83 A;  4K5S A;  5BUK A;  3HZL A;  1Y56 A;  4Y4M A;  3EAO A;  1PXA A;  1S3B A;  2CDU A;  3UKH A;  1XAN A;  1S2Q A;  4K7Z A;  1Y0P A;  4LA1 A;  1Q9I A;  3AB1 A;  3BHK A;  4OPT A;  4A6N A;  1GTE A;  2Y6Q A;  3QFA A;  4YKF A;  5M0Z A;  4Z2T A;  4GDE A;  4Y4L A;  5J60 A;  1ZMD A;  4IA6 A;  2FBW A;  3AYI A;  1OJ9 A;  2WP5 A;  2YVF A;  3DGH A;  1KSU A;  1O5W A;  1NEK A;  4WCT A;  2GB0 A;  3GD4 A;  5KVI A;  4U2L A;  2XYO A;  3ZDN A;  1FEC A;  3AE5 A;  3S5W A;  1K0I A;  4CNK A;  4GCM A;  4UDR A;  1IJH A;  1VRQ B;  5JCM A;  3AE4 A;  4BK1 A;  3I3L A;  1H84 A;  3DH9 A;  1OJA A;  1IUU A;  3PS9 A;  3ALJ A;  4D03 A;  3RP6 A;  2BCG G;  2BA9 A;  4H4Q A;  1XHC A;  4O5U A;  4JNQ A;  4JNA A;  4TLZ A;  3QJ4 A;  4B1B A;  4BUR A;  3RP8 A;  3VR8 A;  1GRF A;  2EQ9 A;  3QVR A;  1CL0 A;  2BXS A;  2XVE A;  3ADA B;  4YTP A;  4CY6 A;  1JU2 A;  4H7U A;  4TM3 A;  2YLR A;  2XCG A;  4Z25 A;  5JCK A;  2BAB A;  1H7X A;  1REO A;  3ICT A;  4U8K A;  5FS7 A;  4O5Q A;  5M10 A;  4YT0 A;  1JNR A;  1CF3 A;  2E5V A;  3CNT A;  1CJ4 A;  2BXR A;  1GAL A;  3ATR A;  3KPF A;  1BKW A;  5U25 A;  1FEB A;  1V59 A;  1GOS A;  1GV4 A;  4X9M A;  1IUV A;  2GH5 A;  3M13 A;  1GT8 A;  2YG4 A;  1N4U A;  2CVJ A;  2OAM A;  3AE3 A;  3UP4 A;  4APN A;  4B63 A;  2ACZ A;  2JB3 A;  3AE1 A;  2C70 A;  3CTY A;  3C96 A;  1OJC A;  3DK8 A;  5EB4 A;  1PS9 A;  4REK A;  4A6N B;  2IID A;  2RGH A;  3NYC A;  3NYF A;  4BK2 A;  3LOV A;  1D4D A;  1GRA A;  4YSX A;  2R4J A;  4H4T A;  4XWZ A;  2YM1 A;  3AWI A;  3S61 A;  2JB1 A;  2XFP A;  1M64 A;  3AD9 B;  4JY3 A;  4H4U A;  4DNA A;  3P9U A;  3UTE A;  3NRN A;  2WOV A;  1EL7 A;  1PJ5 A;  3SGL A;  3UOX A;  1TYP A;  3NNE A;  4CCQ A;  4Z43 A;  3GWD A;  3GRS A;  4J31 A;  1H7W A;  2FJD A;  1RSG A;  2GMJ A;  4EQS A;  3CGB A;  1OJT A;  1PBF A;  3NTA A;  3SM8 A;  4U8N A;  2GR0 A;  3L1R A;  2WOW A;  4H4P A;  5FS9 A;  1S2Y A;  1VQW A;  3QVP A;  2YWL A;  3CNS A;  4KPR A;  3LXD A;  1TYT A;  4I58 A;  4U8M A;  4YTM A;  4YTN A;  4PAA A;  1KF6 A;  2OA1 A;  3AYJ A;  2V3A A;  4H2R A;  2R0C A;  2VVL A;  3NK2 X;  2Q7V A;  2ARD A;  4ZCD A;  2BS4 A;  3EAN A;  1LJ1 A;  2WU2 A;  4HA6 A;  2JBV A;  2C3C A;  4RSL A;  1GEU A;  4A9W A;  2XLR A;  4AOX A;  1X31 B;  1D5T A;  3M12 A;  4GUV A;  4J34 A;  1B4V A;  3P4P A;  3NT6 A;  4CNJ A;  1UKV G;  2F5Z A;  2GAG B;  4UDP A;  5KOX A;  4U8P A;  1NHP A;  5KXJ A;  4JQ9 A;  2GF3 A;  2XLU A;  3UOZ A;  1NDA A;  2WPE A;  1L9C A;  2XVJ A;  1YQZ A;  3NTD A;  5HXI A;  1JRX A;  4H4R A;  1H81 A;  1PBC A;  1CBO A;  1ZMC A;  2C7G A;  4FX9 A;  4B66 A;  5JCN A;  2XVF A;  4XWR A;  5LV9 A;  1GND A;  4YKG A;  3DJJ A;  3UTH A;  1NAA A;  2EQ6 A;  4EM3 A;  1MO9 A;  1Q1W A;  5EOW A;  1CJC A;  3E1T A;  1KNR A;  2A8X A;  2E4G A;  3EF6 A;  5J7X A;  1ZY8 A;  4YXD A;  2XFO A;  3GDP A;  2JKC A;  1FL2 A;  3CPJ G;  2HQM A;  3F8R A;  3L8K A;  2YR4 A;  5KWF A;  2WEU A;  3BNU A;  4K22 A;  4E0V A;  2OLO A;  4N9X A;  2WES A;  3Q9T A;  3BI5 A;  3ISH A;  3JSK A;  4XXG A;  3NIX A;  1PXC A;  3VRD B;  4IA5 A;  3OC4 A;  2O9Z A;  3AE7 A;  4DSH A;  3DK9 A;  1PJ6 A;  1F8R A;  4AT2 A;  3UTF A;  2H89 A;  2XVH A;  2DKI A;  1CC2 A;  1E1L A;  4U8J A;  2GQW A;  1D7L A;  3GD3 A;  1GSN A;  3G5S A;  4Z24 A;  1H82 A;  3CND A;  4NTC A;  2QCU A;  5TR3 A;  3RP7 A;  4EMI A;  3DME A;  1O95 A;  2RAB A;  3AEB A;  2J3N A;  4A79 A;  2C64 A;  1LV0 A;  2H88 A;  2BYB A;  3AEE A;  1TRB A;  4NEV A;  3SFD A;  5C2T A;  3CPI G;  4B68 A;  1TDO A;  2XLT A;  1IUX A;  3FBS A;  4EMJ A;  5C3J A;  1KNP A;  1Y56 B;  3NN6 X;  1MOK A;  1JEH A;  3URH A;  4ECH A;  1LQT A;  1IUS A;  2TPR A;  3CIR A;  5GSN A;  4ZN0 A;  4C5O A;  2YG5 A;  4FDC B;  4GR1 A;  1RP0 A;  3BI2 A;  2WDV A;  1F8W A;  4NTD A;  1PDH A;  3F8P A;  3COX A;  4ICY A;  4EIQ A;  1F6M A;  4H50 A;  4IVO B;  1VG0 A;  1BGN A;  2R4E A;  3AE8 A;  4DSG A;  2B76 A;  4I59 A;  3KVE A;  4B64 A;  1LPF A;  2Y6R A;  4BV6 A;  4USR A;  2AR8 A;  2IVD A;  3OZ2 A;  2R0G A;  1ONF A;  4UDQ A;  1KDG A;  2BC0 A;  4X4J A;  1IUT A;  4BJY A;  4LII A;  2QA1 A;  2WET A;  5L46 A;  1SEZ A;  3AE6 A;  3LZX A;  5EB5 A;  4PAB A;  3DJG X;  2V3B A;  3NN0 X;  1PN0 A;  2WDQ A;  4JDR A;  1KFY A;  2YG6 A;  2X50 A;  4NTE A;  1ZK7 A;  3GYI A;  2BK4 A;  4H4X A;  1GRT A;  1ZP0 A;  3NK0 X;  3BNM A;  2W0H A;  3P1W A;  3UKA A;  4YSZ A;  4TM4 A;  3UTG A;  3D1C A;  2GVC A;  5FS8 A;  3AED A;  1EL5 A;  4CY8 A;  1YQ3 A;  4CCR A;  5JCL A;  4H4Y A;  4BJZ A;  3M0O A;  3AEA A;  2YQU A;  4USQ A;  1B5Q A;  1FEA A;  1PBB A;  1ZDL A;  3UKQ A;  3UOY A;  1L9E A;  2Q0L A;  1F8S A;  2XFQ A;  3V3N A;  3DJE A;  2EQ8 A;  1CC6 A;  2VVM A;  4JY2 A;  3FG2 P;  3UOV A;  1GRB A;  2XVI A;  3AE9 A;  2B9X A;  3I6D A;  1GRH A;  2B9Y A;  5HY5 A;  4BK3 A;  4EQW A;  2C73 A;  5U63 A;  1QLB A;  2X8G A;  1VG9 A;  3C4N A;  2WOI A;  1GRE A;  3O0H A;  4UP3 A;  5FMH A;  3UP5 A;  4A65 A;  3DJD A;  2WP9 A;  4H4S A;  2BCP A;  1Z6L A;  1KSS A;  2C65 A;  3LJP A;  4J2W A;  2WP6 A;  1JNZ A;  4H4V A;  1D4C A;  1GER A;  3F8D A;  5FS6 A;  1BWC A;  3R9U A;  1B8S A;  2VRL A;  3AE2 A;  2R9Z A;  2GAH B;  2WS3 A;  1N4W A;  3VR9 A;  3KD9 A;  1GPE A;  2B7R A;  3GSI A;  3GDN A;  1EL8 A;  2GEW A;  4OPC A;  4YSY A;  5DBJ A;  2TMD A;  3FMW A;  1PBD A;  2ZZ0 A;  3RED A;  1K0L A;  3SQP A;  2YM2 A;  4U8L A;  2PHH A;  2BAC A;  3AD7 B;  4B69 A;  4EQX A;  3BHF A;  1RYI A;  4KX6 A;  4FK1 A;  1NHQ A;  1JRZ A;  1D7Y A;  4RG4 A;  2APG A;  3V3O A;  1E1N A;  3NG7 X;  3NKS A;  1K0J A;  1EBD A;  1NEN A;  4P9S A;  1NHR A;  2V6O A;  2EQ7 A;  3K7Q X;  1N1P A;  4K8D A;  5GRT A;  5IPY A;  4GF7 A;  2YG7 A;  2WU5 A;  1JRY A;  3H8I A;  4TLX A;  3B3R A;  4AP1 A;  2A87 A;  2X8H A;  4Z2U A;  2ZZC A;  4AP3 A;  1PHH A;  3GRT A;  4AT0 A;  2CUL A;  1PBE A;  3UCL A;  2RGO A;  2V60 A;  1BZL A;  3LZW A;  4GRT A;  5EBK A;  5KVH A;  1BGJ A;  2WPC A;  2VRM A;  2FJA A;  2V61 A;  1NHS A;  2OLN A;  4CBQ A;  3CPH G;  3KA7 A;  2YAU A;  5HYM A;  4OPU A;  4H4W A;  1GTH A;  1COY A;  1BF3 A;  2B9W A;  4IV9 A;  2ZZB A;  1GXF A;  2CFY A;  2R46 A;  2Z5Y A;  2E1M A;  4J36 A;  5CQF A;  3CGD A;  4Z26 A;  2YLT A;  1ZOV A;  4YSH A;  2PYX A;  2AQJ A;  3KU9 A;  4TM1 A;  2C76 A;  3IC9 A;  1DOD A;  1F3P A;  3D8X A;  4IVM B;  3ITJ A;  2AAQ A;  2GV8 A;  2BK5 A;  3RHA A;  2V5Z A;  2BS3 A;  4A99 A;  2ZBW A;  1DJQ A;  5U1O A;  3T37 A;  2WHD A;  4EM4 A;  1ELI A;  2YLZ A;  2YLX A;  3VRA A;  3CN8 A;  4C3Y A;  2C72 A;  2WBA A;  3G5Q A;  1Q1R A;  2VVL G;  3GWF A;  3AD8 B;  4C74 A;  1LVL A;  2C66 A; 
#chains in the Genus database with same CATH topology
 2IVE A;  3AYL A;  4FK1 C;  1S3E A;  1TDK A;  1O94 A;  1CJ2 A;  1DNC A;  1GET A;  2C67 A;  1DOE A;  2DKH A;  4MJW A;  3VRB A;  2YG3 A;  3SXI A;  1L9D A;  1LTX R;  2NVK X;  3FIM B;  4EMW A;  1DXL A;  4RG3 A;  2XDO A;  3KLJ A;  3P4Q A;  4LU6 A;  4ADW A;  3NK1 X;  2JK6 A;  2X3N A;  4CRT A;  3DK4 A;  2GR3 A;  4DGK A;  2YR6 A;  3BI4 A;  4GDP A;  2Z5X A;  4NEW A;  3B6D A;  4U2T A;  3UKL A;  1E7P A;  1GRG A;  2B7S A;  3LAD A;  4OVI A;  2YVJ A;  3Q6J A;  2BC1 A;  3IWA A;  3IHM A;  3UKP A;  3UKF A;  3H8L A;  4OPL A;  4Z2R A;  3EPT A;  2GMH A;  4K5R A;  2BK3 A;  5BRT A;  2XLS A;  4J57 A;  1TDF A;  4OCG A;  1E1K A;  1H86 A;  3ZYX A;  2WDR A;  2YLW A;  1TDE A;  4U8O A;  3K7T A;  3SZC A;  3NLC A;  2JAE A;  1NG4 A;  1FOH A;  1FCD A;  2XLP A;  4U8I A;  4ZCC A;  2VOU A;  5IQ1 A;  5IQ4 A;  1ZX9 A;  2X99 A;  3K7M X;  5ER0 A;  1E39 A;  4WX1 A;  4Z44 A;  1M6I A;  3NH3 X;  2GR1 A;  4J56 A;  1CC4 A;  3VQR A;  1P2E A;  3CNP A;  3QSE A;  4NZH A;  3AEF A;  2I0Z A;  3V76 A;  3NYE A;  1H6V A;  2XFN A;  3CGC A;  5JCI A;  1DJN A;  1XPQ A;  2JB2 A;  3PVC A;  4H2Q A;  2YR5 A;  3ICR A;  1EL9 A;  1ZOY A;  3C4A A;  3ICS A;  4H2P A;  1NPX A;  4TM0 A;  2C3D A;  3GMB A;  3KKJ A;  1D4E A;  1N4V A;  4H4Z A;  4Y4N A;  1YQ4 A;  2QAE A;  3AEG A;  1DOB A;  4M52 A;  1ZKQ A;  2UZZ A;  2GRT A;  2RGJ A;  3DGZ A;  4B67 A;  3PO7 A;  2WPF A;  3K30 A;  3DA1 A;  4D04 A;  3LB8 A;  3GMC A;  3II4 A;  2QA2 A;  3WE0 A;  2WQY A;  3RNM A;  1P2H A;  2Q0K A;  2Q6U A;  5CKU A;  3GYJ A;  1AOG A;  1B37 A;  4C3X A;  3AEC A;  4EQR A;  3G5R A;  3QFB A;  2YVG A;  5BVA A;  1W4X A;  5KRQ A;  3ABV A;  1HYU A;  2R0P A;  3UKK A;  3QSM A;  3H4K A;  2VQ7 A;  3NHO X;  3FPZ A;  1PJ7 A;  3HYW A;  1YKJ A;  3ALM A;  3IF9 A;  2X8C A;  1JOA A;  1YY5 A;  2VQB A;  4OPI A;  4YWO A;  4U2S A;  3SZW A;  4B65 A;  1L0V A;  1XDI A;  3P4R A;  4H2N A;  2VZ2 A;  4J33 A;  4A7A A;  2R45 A;  1OJD A;  1CHU A;  2BS2 A;  2FJE A;  1QJD A;  2FJB A;  3QSS A;  1TDN A;  2GQF A;  1K4Q A;  3NGC X;  4HB9 A;  2GR2 A;  2XFU A;  4X9N A;  1IUW A;  5KOW A;  4OPD A;  5HHF A;  3ALL A;  3SZF A;  2NPX A;  1VDC A;  2C75 A;  1NG3 A;  4K2X A;  1PXB A;  4EIP A;  1E6E A;  4AOS A;  2YLS A;  1QO8 A;  4II3 A;  1GES A;  3P4S A;  3SX6 A;  1CJ3 A;  4OPG A;  1E1M A;  2OAL A;  3ATQ A;  3AXB A;  3IHG A;  3SFE A;  4A5L A;  1LQU A;  1MXT A;  1DOC A;  4C77 A;  4JN9 A;  3CGE A;  5BUL A;  2A89 A;  3CNJ A;  1H83 A;  4K5S A;  5BUK A;  3HZL A;  1Y56 A;  4Y4M A;  3EAO A;  1PXA A;  1S3B A;  2CDU A;  3UKH A;  1XAN A;  1S2Q A;  4K7Z A;  1Y0P A;  4LA1 A;  1Q9I A;  3AB1 A;  3BHK A;  4OPT A;  4A6N A;  1GTE A;  2Y6Q A;  3QFA A;  4YKF A;  5M0Z A;  4Z2T A;  4GDE A;  4Y4L A;  5J60 A;  1ZMD A;  4IA6 A;  2FBW A;  3AYI A;  1OJ9 A;  2WP5 A;  2YVF A;  3DGH A;  1KSU A;  1O5W A;  1NEK A;  4WCT A;  2GB0 A;  3GD4 A;  5KVI A;  4U2L A;  2XYO A;  3ZDN A;  1FEC A;  3AE5 A;  3S5W A;  2C4C A;  1K0I A;  4CNK A;  3HYX A;  4GCM A;  1IJH A;  4UDR A;  1VRQ B;  5JCM A;  3AE4 A;  4BK1 A;  3I3L A;  1H84 A;  3DH9 A;  1OJA A;  1IUU A;  3PS9 A;  4II2 A;  5KNL A;  4NWZ A;  3ALJ A;  4D03 A;  3RP6 A;  2BCG G;  2BA9 A;  4H4Q A;  1XHC A;  4O5U A;  5KMQ A;  4JNQ A;  4JNA A;  4TLZ A;  3QJ4 A;  4B1B A;  4BUR A;  3RP8 A;  3VR8 A;  1GRF A;  2EQ9 A;  3QVR A;  1CL0 A;  2BXS A;  2XVE A;  3ADA B;  4YTP A;  4CY6 A;  1JU2 A;  4H7U A;  4TM3 A;  2YLR A;  2XCG A;  4Z25 A;  5JCK A;  2BAB A;  1H7X A;  1REO A;  3ICT A;  4U8K A;  5FS7 A;  4O5Q A;  5M10 A;  4YT0 A;  1JNR A;  1CF3 A;  2E5V A;  3CNT A;  1CJ4 A;  2BXR A;  1GAL A;  3ATR A;  3KPF A;  1BKW A;  5U25 A;  1FEB A;  1V59 A;  1GOS A;  1GV4 A;  4X9M A;  1IUV A;  2GH5 A;  3M13 A;  1GT8 A;  2YG4 A;  1N4U A;  2CVJ A;  2OAM A;  3AE3 A;  3UP4 A;  4APN A;  4B63 A;  2ACZ A;  4GAV A;  2JB3 A;  3AE1 A;  2C70 A;  3CTY A;  3C96 A;  1OJC A;  3DK8 A;  5EB4 A;  1PS9 A;  4REK A;  4A6N B;  4G6H A;  2IID A;  2RGH A;  3NYC A;  3NYF A;  4BK2 A;  3LOV A;  1D4D A;  1GRA A;  4YSX A;  2R4J A;  4H4T A;  4XWZ A;  2YM1 A;  3AWI A;  3S61 A;  2JB1 A;  2XFP A;  1M64 A;  3AD9 B;  4JY3 A;  4H4U A;  4DNA A;  3P9U A;  3UTE A;  3NRN A;  2WOV A;  1EL7 A;  1PJ5 A;  3SGL A;  3UOX A;  1TYP A;  3NNE A;  4CCQ A;  4Z43 A;  3GWD A;  3GRS A;  4J31 A;  1H7W A;  2FJD A;  1RSG A;  2GMJ A;  4EQS A;  3CGB A;  1OJT A;  1PBF A;  3NTA A;  3SM8 A;  4U8N A;  2GR0 A;  3L1R A;  2WOW A;  4H4P A;  5FS9 A;  1S2Y A;  1VQW A;  3QVP A;  2YWL A;  3CNS A;  4KPR A;  3LXD A;  1TYT A;  4I58 A;  4U8M A;  4YTM A;  4YTN A;  4PAA A;  1KF6 A;  2OA1 A;  3AYJ A;  2V3A A;  4H2R A;  3T2Z A;  2R0C A;  2VVL A;  3NK2 X;  2Q7V A;  2ARD A;  4ZCD A;  2BS4 A;  3EAN A;  1LJ1 A;  2WU2 A;  4HA6 A;  2JBV A;  2C3C A;  4RSL A;  1GEU A;  4A9W A;  2XLR A;  4AOX A;  1X31 B;  1D5T A;  3M12 A;  4GUV A;  4J34 A;  1B4V A;  3P4P A;  3NT6 A;  4CNJ A;  1UKV G;  2F5Z A;  2GAG B;  4UDP A;  5KOX A;  4U8P A;  1NHP A;  5KXJ A;  4JQ9 A;  2GF3 A;  2XLU A;  3UOZ A;  1NDA A;  2WPE A;  1L9C A;  2XVJ A;  1YQZ A;  3NTD A;  5HXI A;  1JRX A;  4H4R A;  1H81 A;  1PBC A;  1CBO A;  1ZMC A;  2C7G A;  4FX9 A;  4B66 A;  5JCN A;  2XVF A;  4XWR A;  5LV9 A;  1GND A;  4YKG A;  3DJJ A;  3UTH A;  1NAA A;  2EQ6 A;  4EM3 A;  1MO9 A;  1Q1W A;  5EOW A;  3SYI A;  3T0K A;  1CJC A;  3E1T A;  1KNR A;  2A8X A;  2E4G A;  3EF6 A;  5J7X A;  1ZY8 A;  4YXD A;  2XFO A;  3GDP A;  2JKC A;  1FL2 A;  3CPJ G;  2HQM A;  3F8R A;  3L8K A;  2YR4 A;  5KWF A;  3SZ0 A;  2WEU A;  3BNU A;  4K22 A;  4E0V A;  2OLO A;  4N9X A;  2WES A;  3Q9T A;  3BI5 A;  3ISH A;  3JSK A;  4XXG A;  3NIX A;  1PXC A;  3VRD B;  4IA5 A;  3OC4 A;  2O9Z A;  3AE7 A;  4DSH A;  3DK9 A;  1PJ6 A;  1F8R A;  4AT2 A;  3UTF A;  2H89 A;  2XVH A;  2DKI A;  1CC2 A;  1E1L A;  4U8J A;  2GQW A;  1D7L A;  3GD3 A;  1GSN A;  3G5S A;  4Z24 A;  1H82 A;  3CND A;  4NTC A;  2QCU A;  5TR3 A;  3RP7 A;  4EMI A;  5KMP A;  3DME A;  1O95 A;  2RAB A;  3AEB A;  2J3N A;  4A79 A;  2C64 A;  1LV0 A;  2H88 A;  2BYB A;  3AEE A;  1TRB A;  4NEV A;  3SFD A;  5C2T A;  3CPI G;  4B68 A;  1TDO A;  2XLT A;  1IUX A;  3FBS A;  4EMJ A;  5C3J A;  1KNP A;  1Y56 B;  3NN6 X;  1MOK A;  1JEH A;  3URH A;  4ECH A;  1LQT A;  1IUS A;  5KMR A;  2TPR A;  3CIR A;  5GSN A;  4ZN0 A;  4C5O A;  2YG5 A;  4FDC B;  4GR1 A;  4NNJ A;  1RP0 A;  3BI2 A;  2WDV A;  1F8W A;  4NTD A;  1PDH A;  3SY4 A;  3F8P A;  3COX A;  3HYV A;  4ICY A;  4EIQ A;  1F6M A;  4H50 A;  4IVO B;  1VG0 A;  1BGN A;  2R4E A;  3AE8 A;  3T2K A;  4DSG A;  2B76 A;  4I59 A;  3KVE A;  4B64 A;  1LPF A;  2Y6R A;  4BV6 A;  4USR A;  2AR8 A;  2IVD A;  3OZ2 A;  2R0G A;  1ONF A;  4UDQ A;  1KDG A;  2BC0 A;  4X4J A;  1IUT A;  4BJY A;  4LII A;  2QA1 A;  2WET A;  5L46 A;  1SEZ A;  3AE6 A;  3LZX A;  5EB5 A;  4PAB A;  3DJG X;  2V3B A;  3NN0 X;  1PN0 A;  2WDQ A;  4G6G A;  4JDR A;  1KFY A;  2YG6 A;  2X50 A;  4NTE A;  1ZK7 A;  3GYI A;  2BK4 A;  4H4X A;  1GRT A;  1ZP0 A;  3NK0 X;  3BNM A;  2W0H A;  3P1W A;  4G74 A;  4GAP A;  3KPK A;  4TM4 A;  3T2Y A;  3UKA A;  3UTG A;  4YSZ A;  3T14 A;  3T31 A;  3D1C A;  2GVC A;  5FS8 A;  3AED A;  4G9K A;  1EL5 A;  4CY8 A;  1YQ3 A;  4CCR A;  5JCL A;  4H4Y A;  4BJZ A;  3M0O A;  3AEA A;  2YQU A;  4USQ A;  1B5Q A;  1FEA A;  1PBB A;  1ZDL A;  3UKQ A;  3UOY A;  1L9E A;  2Q0L A;  1F8S A;  2XFQ A;  3V3N A;  3DJE A;  2EQ8 A;  1CC6 A;  2VVM A;  4JY2 A;  3FG2 P;  3UOV A;  1GRB A;  2XVI A;  3AE9 A;  2B9X A;  3I6D A;  1GRH A;  2B9Y A;  5HY5 A;  4BK3 A;  4EQW A;  2C73 A;  5U63 A;  1QLB A;  2X8G A;  1VG9 A;  3C4N A;  2WOI A;  1GRE A;  3O0H A;  4UP3 A;  5FMH A;  3UP5 A;  4A65 A;  3DJD A;  2WP9 A;  4H4S A;  2BCP A;  1Z6L A;  1KSS A;  2C65 A;  3LJP A;  4J2W A;  2WP6 A;  1JNZ A;  4H4V A;  1D4C A;  1GER A;  2BRA A;  3F8D A;  5FS6 A;  1BWC A;  3R9U A;  1B8S A;  2VRL A;  3AE2 A;  2R9Z A;  2GAH B;  2WS3 A;  1N4W A;  3VR9 A;  3KD9 A;  1GPE A;  2B7R A;  3GSI A;  3GDN A;  1EL8 A;  2GEW A;  2BRY A;  4OPC A;  4YSY A;  5DBJ A;  2TMD A;  3FMW A;  1PBD A;  2ZZ0 A;  3RED A;  1K0L A;  3SQP A;  2YM2 A;  4U8L A;  3GYX A;  2PHH A;  2BAC A;  3AD7 B;  4G73 A;  4B69 A;  4EQX A;  3BHF A;  1RYI A;  4KX6 A;  4FK1 A;  1NHQ A;  1JRZ A;  5KMS A;  1D7Y A;  4RG4 A;  2APG A;  3V3O A;  1E1N A;  3NG7 X;  3NKS A;  1K0J A;  1EBD A;  1NEN A;  4P9S A;  1NHR A;  2V6O A;  2EQ7 A;  3K7Q X;  1N1P A;  4K8D A;  5GRT A;  5IPY A;  4GF7 A;  2YG7 A;  2WU5 A;  1JRY A;  3H8I A;  4TLX A;  3B3R A;  4AP1 A;  2A87 A;  2X8H A;  4Z2U A;  2ZZC A;  4AP3 A;  1PHH A;  3GRT A;  4AT0 A;  2CUL A;  1PBE A;  3UCL A;  2RGO A;  2V60 A;  1BZL A;  3LZW A;  4GRT A;  5EBK A;  5KVH A;  1BGJ A;  2WPC A;  2VRM A;  2FJA A;  2V61 A;  1NHS A;  2OLN A;  4CBQ A;  3CPH G;  3CMM A;  3KA7 A;  2YAU A;  5HYM A;  4OPU A;  4H4W A;  1GTH A;  1COY A;  1BF3 A;  2B9W A;  4IV9 A;  2ZZB A;  1GXF A;  2CFY A;  2R46 A;  2Z5Y A;  2E1M A;  4J36 A;  5CQF A;  3CGD A;  4Z26 A;  2YLT A;  1ZOV A;  4YSH A;  2PYX A;  2AQJ A;  3KU9 A;  4TM1 A;  2C76 A;  3IC9 A;  1DOD A;  1F3P A;  3D8X A;  4IVM B;  3ITJ A;  2AAQ A;  2GV8 A;  2BK5 A;  3RHA A;  2V5Z A;  2BS3 A;  4A99 A;  2ZBW A;  1DJQ A;  5U1O A;  3T37 A;  2WHD A;  4EM4 A;  1ELI A;  2YLZ A;  2YLX A;  3VRA A;  3CN8 A;  4C3Y A;  2C72 A;  2WBA A;  3G5Q A;  1Q1R A;  2VVL G;  3GWF A;  3AD8 B;  4C74 A;  1LVL A;  2C66 A; 
#chains in the Genus database with same CATH homology
 2IVE A;  3AYL A;  4FK1 C;  1S3E A;  1TDK A;  1O94 A;  1CJ2 A;  1DNC A;  1GET A;  2C67 A;  1DOE A;  2DKH A;  4MJW A;  3VRB A;  2YG3 A;  3SXI A;  1L9D A;  1LTX R;  2NVK X;  3FIM B;  4EMW A;  1DXL A;  4RG3 A;  2XDO A;  3KLJ A;  3P4Q A;  4LU6 A;  4ADW A;  3NK1 X;  2JK6 A;  2X3N A;  4CRT A;  3DK4 A;  2GR3 A;  4DGK A;  2YR6 A;  3BI4 A;  4GDP A;  2Z5X A;  4NEW A;  3B6D A;  4U2T A;  3UKL A;  1E7P A;  1GRG A;  2B7S A;  3LAD A;  4OVI A;  2YVJ A;  3Q6J A;  2BC1 A;  3IWA A;  3IHM A;  3UKP A;  3UKF A;  3H8L A;  4OPL A;  4Z2R A;  3EPT A;  2GMH A;  4K5R A;  2BK3 A;  5BRT A;  2XLS A;  4J57 A;  1TDF A;  4OCG A;  1E1K A;  1H86 A;  3ZYX A;  2WDR A;  2YLW A;  1TDE A;  4U8O A;  3K7T A;  3SZC A;  3NLC A;  2JAE A;  1NG4 A;  1FOH A;  1FCD A;  2XLP A;  4U8I A;  4ZCC A;  2VOU A;  5IQ1 A;  5IQ4 A;  1ZX9 A;  2X99 A;  3K7M X;  5ER0 A;  1E39 A;  4WX1 A;  4Z44 A;  1M6I A;  3NH3 X;  2GR1 A;  4J56 A;  1CC4 A;  3VQR A;  1P2E A;  3CNP A;  3QSE A;  4NZH A;  3AEF A;  2I0Z A;  3V76 A;  3NYE A;  1H6V A;  2XFN A;  3CGC A;  5JCI A;  1DJN A;  1XPQ A;  2JB2 A;  3PVC A;  4H2Q A;  2YR5 A;  3ICR A;  1EL9 A;  1ZOY A;  3C4A A;  3ICS A;  4H2P A;  1NPX A;  4TM0 A;  2C3D A;  3GMB A;  3KKJ A;  1D4E A;  1N4V A;  4H4Z A;  4Y4N A;  1YQ4 A;  2QAE A;  3AEG A;  1DOB A;  4M52 A;  1ZKQ A;  2UZZ A;  2GRT A;  2RGJ A;  3DGZ A;  4B67 A;  3PO7 A;  2WPF A;  3K30 A;  3DA1 A;  4D04 A;  3LB8 A;  3GMC A;  3II4 A;  2QA2 A;  3WE0 A;  2WQY A;  3RNM A;  1P2H A;  2Q0K A;  2Q6U A;  5CKU A;  3GYJ A;  1AOG A;  1B37 A;  4C3X A;  3AEC A;  4EQR A;  3G5R A;  3QFB A;  2YVG A;  5BVA A;  1W4X A;  5KRQ A;  3ABV A;  1HYU A;  2R0P A;  3UKK A;  3QSM A;  3H4K A;  2VQ7 A;  3NHO X;  3FPZ A;  1PJ7 A;  3HYW A;  1YKJ A;  3ALM A;  3IF9 A;  2X8C A;  1JOA A;  1YY5 A;  2VQB A;  4OPI A;  4YWO A;  4U2S A;  3SZW A;  4B65 A;  1L0V A;  1XDI A;  3P4R A;  4H2N A;  2VZ2 A;  4J33 A;  4A7A A;  2R45 A;  1OJD A;  1CHU A;  2BS2 A;  2FJE A;  1QJD A;  2FJB A;  3QSS A;  1TDN A;  2GQF A;  1K4Q A;  3NGC X;  4HB9 A;  2GR2 A;  2XFU A;  4X9N A;  1IUW A;  5KOW A;  4OPD A;  5HHF A;  3ALL A;  3SZF A;  2NPX A;  1VDC A;  2C75 A;  1NG3 A;  4K2X A;  1PXB A;  4EIP A;  1E6E A;  4AOS A;  2YLS A;  1QO8 A;  4II3 A;  1GES A;  3P4S A;  3SX6 A;  1CJ3 A;  4OPG A;  1E1M A;  2OAL A;  3ATQ A;  3AXB A;  3IHG A;  3SFE A;  4A5L A;  1LQU A;  1MXT A;  1DOC A;  4C77 A;  4JN9 A;  3CGE A;  5BUL A;  2A89 A;  3CNJ A;  1H83 A;  4K5S A;  5BUK A;  3HZL A;  1Y56 A;  4Y4M A;  3EAO A;  1PXA A;  1S3B A;  2CDU A;  3UKH A;  1XAN A;  1S2Q A;  4K7Z A;  1Y0P A;  4LA1 A;  1Q9I A;  3AB1 A;  3BHK A;  4OPT A;  4A6N A;  1GTE A;  2Y6Q A;  3QFA A;  4YKF A;  5M0Z A;  4Z2T A;  4GDE A;  4Y4L A;  5J60 A;  1ZMD A;  4IA6 A;  2FBW A;  3AYI A;  1OJ9 A;  2WP5 A;  2YVF A;  3DGH A;  1KSU A;  1O5W A;  1NEK A;  4WCT A;  2GB0 A;  3GD4 A;  5KVI A;  4U2L A;  2XYO A;  3ZDN A;  1FEC A;  3AE5 A;  3S5W A;  2C4C A;  1K0I A;  4CNK A;  3HYX A;  4GCM A;  1IJH A;  4UDR A;  1VRQ B;  5JCM A;  3AE4 A;  4BK1 A;  3I3L A;  1H84 A;  3DH9 A;  1OJA A;  1IUU A;  3PS9 A;  4II2 A;  5KNL A;  4NWZ A;  3ALJ A;  4D03 A;  3RP6 A;  2BCG G;  2BA9 A;  4H4Q A;  1XHC A;  4O5U A;  5KMQ A;  4JNQ A;  4JNA A;  4TLZ A;  3QJ4 A;  4B1B A;  4BUR A;  3RP8 A;  3VR8 A;  1GRF A;  2EQ9 A;  3QVR A;  1CL0 A;  2BXS A;  2XVE A;  3ADA B;  4YTP A;  4CY6 A;  1JU2 A;  4H7U A;  4TM3 A;  2YLR A;  2XCG A;  4Z25 A;  5JCK A;  2BAB A;  1H7X A;  1REO A;  3ICT A;  4U8K A;  5FS7 A;  4O5Q A;  5M10 A;  4YT0 A;  1JNR A;  1CF3 A;  2E5V A;  3CNT A;  1CJ4 A;  2BXR A;  1GAL A;  3ATR A;  3KPF A;  1BKW A;  5U25 A;  1FEB A;  1V59 A;  1GOS A;  1GV4 A;  4X9M A;  1IUV A;  2GH5 A;  3M13 A;  1GT8 A;  2YG4 A;  1N4U A;  2CVJ A;  2OAM A;  3AE3 A;  3UP4 A;  4APN A;  4B63 A;  2ACZ A;  4GAV A;  2JB3 A;  3AE1 A;  2C70 A;  3CTY A;  3C96 A;  1OJC A;  3DK8 A;  5EB4 A;  1PS9 A;  4REK A;  4A6N B;  4G6H A;  2IID A;  2RGH A;  3NYC A;  3NYF A;  4BK2 A;  3LOV A;  1D4D A;  1GRA A;  4YSX A;  2R4J A;  4H4T A;  4XWZ A;  2YM1 A;  3AWI A;  3S61 A;  2JB1 A;  2XFP A;  1M64 A;  3AD9 B;  4JY3 A;  4H4U A;  4DNA A;  3P9U A;  3UTE A;  3NRN A;  2WOV A;  1EL7 A;  1PJ5 A;  3SGL A;  3UOX A;  1TYP A;  3NNE A;  4CCQ A;  4Z43 A;  3GWD A;  3GRS A;  4J31 A;  1H7W A;  2FJD A;  1RSG A;  2GMJ A;  4EQS A;  3CGB A;  1OJT A;  1PBF A;  3NTA A;  3SM8 A;  4U8N A;  2GR0 A;  3L1R A;  2WOW A;  4H4P A;  5FS9 A;  1S2Y A;  1VQW A;  3QVP A;  2YWL A;  3CNS A;  4KPR A;  3LXD A;  1TYT A;  4I58 A;  4U8M A;  4YTM A;  4YTN A;  4PAA A;  1KF6 A;  2OA1 A;  3AYJ A;  2V3A A;  4H2R A;  3T2Z A;  2R0C A;  2VVL A;  3NK2 X;  2Q7V A;  2ARD A;  4ZCD A;  2BS4 A;  3EAN A;  1LJ1 A;  2WU2 A;  4HA6 A;  2JBV A;  2C3C A;  4RSL A;  1GEU A;  4A9W A;  2XLR A;  4AOX A;  1X31 B;  1D5T A;  3M12 A;  4GUV A;  4J34 A;  1B4V A;  3P4P A;  3NT6 A;  4CNJ A;  1UKV G;  2F5Z A;  2GAG B;  4UDP A;  5KOX A;  4U8P A;  1NHP A;  5KXJ A;  4JQ9 A;  2GF3 A;  2XLU A;  3UOZ A;  1NDA A;  2WPE A;  1L9C A;  2XVJ A;  1YQZ A;  3NTD A;  5HXI A;  1JRX A;  4H4R A;  1H81 A;  1PBC A;  1CBO A;  1ZMC A;  2C7G A;  4FX9 A;  4B66 A;  5JCN A;  2XVF A;  4XWR A;  5LV9 A;  1GND A;  4YKG A;  3DJJ A;  3UTH A;  1NAA A;  2EQ6 A;  4EM3 A;  1MO9 A;  1Q1W A;  5EOW A;  3SYI A;  3T0K A;  1CJC A;  3E1T A;  1KNR A;  2A8X A;  2E4G A;  3EF6 A;  5J7X A;  1ZY8 A;  4YXD A;  2XFO A;  3GDP A;  2JKC A;  1FL2 A;  3CPJ G;  2HQM A;  3F8R A;  3L8K A;  2YR4 A;  5KWF A;  3SZ0 A;  2WEU A;  3BNU A;  4K22 A;  4E0V A;  2OLO A;  4N9X A;  2WES A;  3Q9T A;  3BI5 A;  3ISH A;  3JSK A;  4XXG A;  3NIX A;  1PXC A;  3VRD B;  4IA5 A;  3OC4 A;  2O9Z A;  3AE7 A;  4DSH A;  3DK9 A;  1PJ6 A;  1F8R A;  4AT2 A;  3UTF A;  2H89 A;  2XVH A;  2DKI A;  1CC2 A;  1E1L A;  4U8J A;  2GQW A;  1D7L A;  3GD3 A;  1GSN A;  3G5S A;  4Z24 A;  1H82 A;  3CND A;  4NTC A;  2QCU A;  5TR3 A;  3RP7 A;  4EMI A;  5KMP A;  3DME A;  1O95 A;  2RAB A;  3AEB A;  2J3N A;  4A79 A;  2C64 A;  1LV0 A;  2H88 A;  2BYB A;  3AEE A;  1TRB A;  4NEV A;  3SFD A;  5C2T A;  3CPI G;  4B68 A;  1TDO A;  2XLT A;  1IUX A;  3FBS A;  4EMJ A;  5C3J A;  1KNP A;  1Y56 B;  3NN6 X;  1MOK A;  1JEH A;  3URH A;  4ECH A;  1LQT A;  1IUS A;  5KMR A;  2TPR A;  3CIR A;  5GSN A;  4ZN0 A;  4C5O A;  2YG5 A;  4FDC B;  4GR1 A;  4NNJ A;  1RP0 A;  3BI2 A;  2WDV A;  1F8W A;  4NTD A;  1PDH A;  3SY4 A;  3F8P A;  3COX A;  3HYV A;  4ICY A;  4EIQ A;  1F6M A;  4H50 A;  4IVO B;  1VG0 A;  1BGN A;  2R4E A;  3AE8 A;  3T2K A;  4DSG A;  2B76 A;  4I59 A;  3KVE A;  4B64 A;  1LPF A;  2Y6R A;  4BV6 A;  4USR A;  2AR8 A;  2IVD A;  3OZ2 A;  2R0G A;  1ONF A;  4UDQ A;  1KDG A;  2BC0 A;  4X4J A;  1IUT A;  4BJY A;  4LII A;  2QA1 A;  2WET A;  5L46 A;  1SEZ A;  3AE6 A;  3LZX A;  5EB5 A;  4PAB A;  3DJG X;  2V3B A;  3NN0 X;  1PN0 A;  2WDQ A;  4G6G A;  4JDR A;  1KFY A;  2YG6 A;  2X50 A;  4NTE A;  1ZK7 A;  3GYI A;  2BK4 A;  4H4X A;  1GRT A;  1ZP0 A;  3NK0 X;  3BNM A;  2W0H A;  3P1W A;  4G74 A;  4GAP A;  3KPK A;  4TM4 A;  3T2Y A;  3UKA A;  3UTG A;  4YSZ A;  3T14 A;  3T31 A;  3D1C A;  2GVC A;  5FS8 A;  3AED A;  4G9K A;  1EL5 A;  4CY8 A;  1YQ3 A;  4CCR A;  5JCL A;  4H4Y A;  4BJZ A;  3M0O A;  3AEA A;  2YQU A;  4USQ A;  1B5Q A;  1FEA A;  1PBB A;  1ZDL A;  3UKQ A;  3UOY A;  1L9E A;  2Q0L A;  1F8S A;  2XFQ A;  3V3N A;  3DJE A;  2EQ8 A;  1CC6 A;  2VVM A;  4JY2 A;  3FG2 P;  3UOV A;  1GRB A;  2XVI A;  3AE9 A;  2B9X A;  3I6D A;  1GRH A;  2B9Y A;  5HY5 A;  4BK3 A;  4EQW A;  2C73 A;  5U63 A;  1QLB A;  2X8G A;  1VG9 A;  3C4N A;  2WOI A;  1GRE A;  3O0H A;  4UP3 A;  5FMH A;  3UP5 A;  4A65 A;  3DJD A;  2WP9 A;  4H4S A;  2BCP A;  1Z6L A;  1KSS A;  2C65 A;  3LJP A;  4J2W A;  2WP6 A;  1JNZ A;  4H4V A;  1D4C A;  1GER A;  2BRA A;  3F8D A;  5FS6 A;  1BWC A;  3R9U A;  1B8S A;  2VRL A;  3AE2 A;  2R9Z A;  2GAH B;  2WS3 A;  1N4W A;  3VR9 A;  3KD9 A;  1GPE A;  2B7R A;  3GSI A;  3GDN A;  1EL8 A;  2GEW A;  2BRY A;  4OPC A;  4YSY A;  5DBJ A;  2TMD A;  3FMW A;  1PBD A;  2ZZ0 A;  3RED A;  1K0L A;  3SQP A;  2YM2 A;  4U8L A;  3GYX A;  2PHH A;  2BAC A;  3AD7 B;  4G73 A;  4B69 A;  4EQX A;  3BHF A;  1RYI A;  4KX6 A;  4FK1 A;  1NHQ A;  1JRZ A;  5KMS A;  1D7Y A;  4RG4 A;  2APG A;  3V3O A;  1E1N A;  3NG7 X;  3NKS A;  1K0J A;  1EBD A;  1NEN A;  4P9S A;  1NHR A;  2V6O A;  2EQ7 A;  3K7Q X;  1N1P A;  4K8D A;  5GRT A;  5IPY A;  4GF7 A;  2YG7 A;  2WU5 A;  1JRY A;  3H8I A;  4TLX A;  3B3R A;  4AP1 A;  2A87 A;  2X8H A;  4Z2U A;  2ZZC A;  4AP3 A;  1PHH A;  3GRT A;  4AT0 A;  2CUL A;  1PBE A;  3UCL A;  2RGO A;  2V60 A;  1BZL A;  3LZW A;  4GRT A;  5EBK A;  5KVH A;  1BGJ A;  2WPC A;  2VRM A;  2FJA A;  2V61 A;  1NHS A;  2OLN A;  4CBQ A;  3CPH G;  3CMM A;  3KA7 A;  2YAU A;  5HYM A;  4OPU A;  4H4W A;  1GTH A;  1COY A;  1BF3 A;  2B9W A;  4IV9 A;  2ZZB A;  1GXF A;  2CFY A;  2R46 A;  2Z5Y A;  2E1M A;  4J36 A;  5CQF A;  3CGD A;  4Z26 A;  2YLT A;  1ZOV A;  4YSH A;  2PYX A;  2AQJ A;  3KU9 A;  4TM1 A;  2C76 A;  3IC9 A;  1DOD A;  1F3P A;  3D8X A;  4IVM B;  3ITJ A;  2AAQ A;  2GV8 A;  2BK5 A;  3RHA A;  2V5Z A;  2BS3 A;  4A99 A;  2ZBW A;  1DJQ A;  5U1O A;  3T37 A;  2WHD A;  4EM4 A;  1ELI A;  2YLZ A;  2YLX A;  3VRA A;  3CN8 A;  4C3Y A;  2C72 A;  2WBA A;  3G5Q A;  1Q1R A;  2VVL G;  3GWF A;  3AD8 B;  4C74 A;  1LVL A;  2C66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...