2Q7VA

Crystal structure of deinococcus radiodurans thioredoxin reductase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
313
Chain Sequence
TAPTAHDYDVVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVENFPGFPEPIAGMELAQRMHQQAEKFGAKVEMDEVQGVQHDATSHPYPFTVRGYNGEYRAKAVILATGADPRKLGIPGEDNFWGKGVSTCATCDGFFYKGKKVVVIGGGDAAVEEGMFLTKFADEVTVIHRRDTLRANKVAQARAFANPKMKFIWDTAVEEIQGADSVSGVKLRNLKTGEVSELATDGVFIFIGHVPNTAFVKDTVSLRDDGYVDVRDEIYTNIPMLFAAGDVSDYIYRQLATSVGAGTRAAMMTERQLAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Thioredoxin system from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Oxidoreductase
total genus 90
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q7vA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2q7vA02
5M10A 4YSZA 4BK2A 5KXJA 1DJNA 5BULA 4U8KA 4JY2A 4UDPA 4CRTA 1DNCA 1L9EA 3II4A 3NK0X 1RP0A 2J3NA 2JKCA 1CHUA 1CC2A 2RGJA 3G5SA 4AT2A 2DKHA 3UOYA 5J60A 3EF6A 4FX9A 2QAEA 4BJYA 1DOEA 1MXTA 1XHCA 4I58A 2Z5YA 3DA1A 2PHHA 1TDNA 1ZP0A 4TM4A 3UKQA 3BI5A 1FECA 4NTEA 3UP4A 2GV8A 3GD3A 3UKFA 2RABA 3WE0A 3CNPA 3SGLA 3BI4A 3CGBA 4DNAA 3UKLA 1JRZA 4OPUA 4A79A 3NLCA 2IVEA 4U2SA 4H4TA 4DSGA 3COXA 3DH9A 4H4YA 2A87A 4U8PA 4C77A 4A65A 2R46A 3T37A 3BHKA 5BRTA 4H4ZA 2XVJA 1MO9A 2Q0KA 4D04A 3F8DA 2YAUA 3NT6A 3NYCA 1H7XA 3AD7B 3QVPA 1GRHA 2Z5XA 5HHFA 2B9XA 1IUSA 3SFEA 3BNMA 1PBEA 3ICTA 3NKSA 1IUWA 3CNJA 4H4QA 3V3OA 4EMJA 4CY8A 5HY5A 2GVCA 2B9YA 1PHHA 2X8GA 2V60A 2VVLG 2JK6A 1ZDLA 2E5VA 4A5LA 1GRGA 3NN6X 3LB8A 2XFQA 4CCQA 1DODA 2WQYA 2BABA 2O9ZA 1PXBA 1OJ9A 3P1WA 3LZWA 1O94A 1L0VA 4BJZA 3GYIA 4USRA 4OPLA 4ICYA 1KDGA 3DK4A 1Y56A 2ZZCA 2F5ZA 3AE7A 1GNDA 3GDPA 3LJPA 1SEZA 4DSHA 2WP5A 1O5WA 4Y4MA 5J7XA 3ABVA 3ATRA 4A99A 2GB0A 4YSHA 2A89A 3ITJA 3ICRA 1GXFA 5FS7A 3M0OA 3L8KA 4A9WA 4IVOB 4NZHA 5C2TA 2C72A 5FS9A 3CNSA 2R0GA 3C96A 4IVMB 2WPEA 3AEGA 1M6IA 1L9CA 2X3NA 3KD9A 3UKKA 1GERA 4K5RA 1BKWA 4UDRA 3RHAA 3ALJA 4X9NA 3CNTA 1KF6A 1IUUA 3GMCA 2RGHA 3K7MX 3URHA 5DBJA 1FEAA 2TPRA 2E1MA 2X99A 2WU5A 3GWDA 3FG2P 3DJJA 1O95A 3GRTA 1BGNA 3F8RA 4JNQA 2YLZA 2YLSA 2QA2A 1GALA 3AD8B 3RNMA 2B7SA 1E1NA 4EQSA 3CGEA 4NEVA 4YXDA 1JOAA 2WPFA 4Z2RA 2YG4A 1K4QA 1PJ7A 1CBOA 1QLBA 3AB1A 3ZDNA 1EL7A 1Y0PA 4K5SA 1IUTA 3NNEA 1E39A 1H6VA 3NRNA 1GRTA 2WOWA 4H4SA 3H4KA 5U25A 3UKPA 4EMWA 4YKGA 1XDIA 4J34A 1PJ6A 3AYJA 3M13A 2X8HA 2XLRA 4OVIA 3GWFA 1GEUA 3ALLA 3UKAA 4RSLA 1ONFA 3NH3X 3JSKA 4A6NA 4C3XA 1K0LA 1UKVG 3IWAA 5EOWA 1BZLA 3AE8A 3R9UA 2WBAA 2XVFA 1NHPA 3AEEA 3QJ4A 1TDKA 1P2EA 1YQ3A 4CY6A 2C66A 4YSXA 1N4WA 2VOUA 3O0HA 5FS6A 1JNRA 1FEBA 4H7UA 4Z44A 2NVKX 1JNZA 2XFPA 4H4RA 4UDQA 2A8XA 1H84A 1D4EA 1LJ1A 3FMWA 4IV9A 3FIMB 4EIPA 5JCMA 4OCGA 1GPEA 3P4QA 1ZKQA 3NIXA 3P4PA 1GESA 1L9DA 2E4GA 1FL2A 2VRMA 4Z2TA 2GEWA 3G5RA 5U1OA 1VG0A 3DGHA 1LQUA 1CJ3A 2YG7A 2JB2A 2WU2A 1CC6A 1XPQA 1F8RA 4U2LA 1NHSA 1TDEA 3BNUA 4J31A 1N4VA 1NAAA 2BCGG 2R0CA 1DJQA 4BK1A 1COYA 4CNJA 2GMHA 3V76A 1GSNA 3VRAA 3ADAB 1VRQB 3S61A 4B69A 1GRFA 1Q1WA 4EQXA 4EM4A 4Z43A 3NK2X 4GF7A 3AYLA 4AOSA 3E1TA 2H88A 1Q1RA 2ZBWA 2IIDA 3AECA 3DK9A 5EB5A 2XCGA 4OPGA 4P9SA 4OPCA 1H82A 2QCUA 2WDQA 4EM3A 3CNDA 2CVJA 5KRQA 2BC0A 2YQUA 3KVEA 3P9UA 5IPYA 4PAAA 4B1BA 3QVRA 1W4XA 2BCPA 3K7TA 5HYMA 4YKFA 1CJCA 4K7ZA 3QSSA 1D5TA 1ZK7A 2GH5A 5GSNA 2YM1A 2V3BA 1RYIA 4H4PA 3KKJA 1BGJA 2C65A 4H2RA 3NHOX 3LZXA 4CCRA 5BUKA 3LADA 1EL5A 2OLOA 2AQJA 2V6OA 2BK4A 1K0IA 2YG6A 2GQFA 3NYEA 2GAHB 4YT0A 4H4VA 1F6MA 4O5QA 1QJDA 3UTHA 4WCTA 2RGOA 2YR5A 1TYPA 5JCNA 2XDOA 1NHRA 2EQ8A 1PXCA 1JU2A 4OPTA 1LTXR 1KFYA 1PXAA 3GRSA 3FBSA 4H2NA 1PBDA 2BXSA 4EQWA 4JQ9A 4H4UA 2QA1A 5EB4A 2C7GA 4LIIA 2AR8A 4Z24A 4B68A 2VZ2A 4GCMA 5JCIA 2YLTA 1E1LA 1S2QA 1N1PA 2UZZA 2Q7VA 2JB1A 2YVGA 3IC9A 3AE3A 1BF3A 3CPJG 2YR6A 3CIRA 3UOVA 1H7WA 1S3BA 1ZY8A 3ZYXA 3UTEA 2CFYA 1H83A 1VG9A 4O5UA 4B67A 4B65A 3AXBA 4USQA 2C76A 2C75A 2XLTA 3OC4A 4H4XA 5EBKA 2EQ7A 3REDA 2ARDA 1H81A 2YLRA 2V3AA 1FOHA 3AE1A 4EQRA 3B6DA 4TM3A 4U8NA 2B7RA 4AOXA 3M12A 3AEAA 1PDHA 2BK5A 1F8WA 3BHFA 3B3RA 1NG3A 3VRDB 5ER0A 3Q9TA 2YM2A 3RP8A 5CKUA 2BYBA 4IA5A 4U8LA 1B5QA 1OJAA 2BS3A 3IHMA 2WDVA 3CGCA 4J2WA 1NDAA 1TRBA 5KWFA 2GR3A 1GRAA 3AE2A 3EAOA 1D7YA 4CBQA 4ADWA 3DJGX 4J33A 4K2XA 4FDCB 4TLXA 4C74A 1ZMCA 1ZOYA 2C73A 1PN0A 3ATQA 2GR1A 4U8IA 4XXGA 2YG5A 4H2PA 1IUVA 1DXLA 3AE4A 1EBDA 2VVLA 4C3YA 1REOA 5HXIA 4H2QA 4XWRA 2R0PA 1S3EA 2B9WA 5KOXA 4PABA 4REKA 4NEWA 2XFUA 2B76A 4D03A 5C3JA 1ZX9A 3RP6A 2XFOA 1LQTA 3NYFA 3VR9A 4JNAA 1JEHA 3V3NA 1K0JA 2OA1A 1TYTA 1VDCA 4WX1A 4GRTA 3DMEA 1EL8A 5IQ4A 1B37A 1E6EA 2GRTA 1GRBA 1NEKA 1X31B 2Q6UA 4UP3A 2X8CA 4Y4LA 3AYIA 4BK3A 1KSSA 3S5WA 4GR1A 1MOKA 2CULA 3UCLA 5LV9A 4NTCA 3AEFA 3NK1X 1F8SA 3DJDA 4J57A 2XLSA 2FJEA 3QSMA 4IA6A 4ECHA 1OJTA 1FCDA 1JRXA 3ISHA 1GTHA 4U8JA 3OZ2A 1Q9IA 3KA7A 1CJ4A 2WDRA 4I59A 1EL9A 3I3LA 4J36A 5CQFA 3QFBA 2C3CA 4GDPA 4AT0A 2JBVA 2BS4A 2Y6QA 4E0VA 4B64A 3GMBA 4ZCCA 2W0HA 3KPFA 1PBFA 2XVHA 1YKJA 2HQMA 3BI2A 2ZZ0A 4RG4A 3HZLA 2R4EA 1JRYA 1NHQA 1B4VA 1H86A 1KNPA 1E1KA 1N4UA 4Z26A 3ICSA 4K22A 4K8DA 2H89A 3KLJA 2OAMA 4ZN0A 2IVDA 3G5QA 3DGZA 3UKHA 1D4CA 1D4DA 3KU9A 2JAEA 4H50A 5KOWA 2R4JA 2FJBA 3CGDA 3GD4A 4A7AA 3ALMA 5TR3A 5FMHA 3K7QX 3P4SA 3EANA 4YTPA 3L1RA 4H4WA 4X4JA 3VQRA 2YR4A 1F3PA 3SQPA 5KVHA 4A6NB 1YQ4A 3H8LA 4JN9A 1PBCA 4OPDA 1IUXA 4TM0A 3DJEA 2R45A 4ZCDA 1GV4A 2EQ9A 4FK1A 2V5ZA 4GDEA 1B8SA 1NPXA 4YWOA 2GF3A 1TDOA 3VRBA 1AOGA 1NG4A 3K30A 4AP1A 1XANA 4X9MA 1KSUA 2XLUA 1ZOVA 2GMJA 3CPIG 1CC4A 5IQ1A 3DK8A 2YLXA 1KNRA 5BVAA 3CN8A 3AE9A 1ZMDA 4CNKA 4BURA 3D1CA 1LV0A 3AE5A 2JB3A 1VQWA 2YLWA 3LXDA 4TM1A 1DOCA 2YWLA 3EPTA 2VVMA 2YG3A 5JCLA 1PS9A 4HB9A 3H8IA 5JCKA 1GTEA 4N9XA 2GR0A 1NENA 3AEBA 2TMDA 3PVCA 3GYJA 4B66A 1IJHA 3GDNA 2WS3A 2Q0LA 2BXRA 1CF3A 2ZZBA 2BC1A 4HA6A 2WETA 3SFDA 3AE6A 4NTDA 4EIQA 1E1MA 4AP3A 2Y6RA 4YTNA 2WP9A 2YVJA 4JDRA 2WP6A 3GSIA 4EMIA 1PJ5A 4YSYA 2WOVA 3NTAA 2XYOA 2FJAA 3UP5A 2XVEA 1RSGA 3VR8A 1M64A 2VRLA 4MJWA 3PS9A 1Z6LA 2C67A 2FBWA 3UOXA 4FK1C 4B63A 4Z2UA 2PYXA 4TLZA 1TDFA 2WEUA 3LOVA 2DKIA 2WESA 1GREA 4JY3A 1YY5A 2CDUA 4M52A 1GETA 2BK3A 1GOSA 3IF9A 4LA1A 2BS2A 3C4NA 1BWCA 1OJCA 4RG3A 2WOIA 3UTGA 2VQBA 1GT8A 4Y4NA 3QSEA 4KX6A 4KPRA 5FS8A 1DOBA 2GR2A 5U63A 5L46A 4J56A 2FJDA 3CTYA 4U8OA 3FPZA 4APNA 2ACZA 4YTMA 3PO7A 3NN0X 3CPHG 2AAQA 1LPFA 3I6DA 3NG7X 2BA9A 2WPCA 3AWIA 4U8MA 2GQWA 1LVLA 1S2YA 3P4RA 2OLNA 3UOZA 3NTDA 4DGKA 4LU6A 1QO8A 2BACA 4GUVA 2NPXA 5M0ZA 5GRTA 2C3DA 3QFAA 1CL0A 2APGA 2C70A 1Y56B 2VQ7A 3AD9B 1P2HA 3UTFA 4Z25A 3IHGA 2WHDA 2XVIA 4XWZA 3RP7A 2I0ZA 1ELIA 3NGCX 2C64A 1HYUA 3F8PA 4OPIA 4BV6A 4U2TA 2V61A 4C5OA 1OJDA 2X50A 2GAGB 5KVIA 1D7LA 2R9ZA 2EQ6A 2XFNA 2YVFA 3AEDA 2OALA 2XLPA 3SM8A 1CJ2A 1PBBA 1V59A 3C4AA 1E7PA 1YQZA 3D8XA 3Q6JA
chains in the Genus database with same CATH superfamily
5M10A 4YSZA 4BK2A 5KXJA 1DJNA 5BULA 3SYIA 2BRAA 4U8KA 4JY2A 4UDPA 4CRTA 1DNCA 1L9EA 3II4A 3NK0X 1RP0A 2J3NA 2JKCA 1CHUA 1CC2A 2RGJA 3G5SA 4AT2A 2DKHA 3UOYA 3HYVA 3EF6A 4FX9A 2QAEA 4BJYA 1DOEA 1MXTA 1XHCA 4I58A 2Z5YA 3DA1A 2PHHA 1TDNA 1ZP0A 4TM4A 3UKQA 3BI5A 1FECA 4NTEA 3UP4A 2GV8A 3GD3A 3UKFA 2RABA 3WE0A 3CNPA 3SGLA 3BI4A 3CGBA 3T2KA 3UKLA 4DNAA 1JRZA 4OPUA 4A79A 3NLCA 2IVEA 4U2SA 4H4TA 4DSGA 3COXA 3DH9A 4H4YA 2A87A 4U8PA 4C77A 4A65A 2R46A 3T37A 3BHKA 5BRTA 4H4ZA 2XVJA 1MO9A 2Q0KA 4D04A 3F8DA 2YAUA 3NT6A 3NYCA 1H7XA 4G6GA 3AD7B 3QVPA 1GRHA 2Z5XA 5HHFA 2B9XA 1IUSA 3SFEA 3BNMA 1PBEA 3ICTA 3NKSA 1IUWA 3CNJA 4H4QA 3V3OA 4EMJA 3SZCA 4CY8A 2GVCA 5HY5A 2B9YA 1PHHA 2X8GA 2V60A 2VVLG 2JK6A 1ZDLA 2E5VA 4A5LA 1GRGA 3NN6X 3LB8A 2XFQA 3CMMA 1DODA 3SZWA 2WQYA 4CCQA 2BABA 2O9ZA 1PXBA 1OJ9A 3P1WA 3LZWA 1O94A 1L0VA 4BJZA 3GYIA 4USRA 4OPLA 4ICYA 1KDGA 3DK4A 1Y56A 2ZZCA 2F5ZA 3AE7A 1GNDA 3GDPA 3LJPA 1SEZA 4DSHA 2WP5A 1O5WA 4Y4MA 5J7XA 3ABVA 3ATRA 5KMQA 4A99A 2GB0A 4YSHA 2A89A 3ITJA 3ICRA 1GXFA 5FS7A 3M0OA 3L8KA 4A9WA 4IVOB 4NZHA 5C2TA 2C72A 5FS9A 3CNSA 2R0GA 3C96A 4IVMB 2WPEA 3AEGA 1M6IA 1L9CA 2X3NA 3HYXA 3KD9A 3UKKA 1GERA 4K5RA 1BKWA 4UDRA 3RHAA 3ALJA 4X9NA 3CNTA 1KF6A 1IUUA 3GMCA 2RGHA 3K7MX 3URHA 5DBJA 1FEAA 2TPRA 2E1MA 2X99A 2WU5A 3GWDA 3FG2P 3DJJA 1O95A 3GRTA 1BGNA 3F8RA 4JNQA 2YLZA 2YLSA 2QA2A 1GALA 3AD8B 3RNMA 2B7SA 1E1NA 5KMPA 4EQSA 3CGEA 4NEVA 4YXDA 1JOAA 2WPFA 4Z2RA 2YG4A 1K4QA 1PJ7A 1CBOA 1QLBA 3AB1A 3ZDNA 1EL7A 1Y0PA 4K5SA 5KNLA 1IUTA 3NNEA 1E39A 1H6VA 3NRNA 1GRTA 2WOWA 4H4SA 3H4KA 5U25A 3UKPA 4EMWA 4YKGA 1XDIA 4J34A 1PJ6A 3AYJA 3M13A 2X8HA 2XLRA 4OVIA 3GWFA 1GEUA 3ALLA 3UKAA 4RSLA 1ONFA 3NH3X 3JSKA 4A6NA 4C3XA 1K0LA 1UKVG 3IWAA 5EOWA 1BZLA 3AE8A 3R9UA 2WBAA 2XVFA 1NHPA 3AEEA 3QJ4A 1TDKA 1P2EA 1YQ3A 4CY6A 2C66A 4YSXA 1N4WA 2VOUA 3O0HA 5FS6A 1JNRA 1FEBA 4H7UA 4G73A 4Z44A 2NVKX 1JNZA 2XFPA 4H4RA 4UDQA 3SY4A 3SZFA 2A8XA 1H84A 1D4EA 1LJ1A 3FMWA 4IV9A 3FIMB 4EIPA 5JCMA 4OCGA 1GPEA 3P4QA 1ZKQA 3NIXA 3P4PA 1GESA 1L9DA 2E4GA 1FL2A 2VRMA 4Z2TA 2GEWA 3G5RA 5U1OA 1VG0A 3DGHA 1LQUA 1CJ3A 2YG7A 2JB2A 2WU2A 1CC6A 1XPQA 1F8RA 4U2LA 1NHSA 1TDEA 3BNUA 4J31A 1N4VA 1NAAA 2BCGG 2R0CA 1DJQA 4BK1A 1COYA 4CNJA 2GMHA 3V76A 1GSNA 3VRAA 3ADAB 1VRQB 3S61A 4B69A 1GRFA 1Q1WA 4EQXA 4EM4A 4Z43A 3NK2X 4GF7A 3AYLA 4AOSA 3E1TA 2H88A 1Q1RA 2ZBWA 2IIDA 3AECA 3DK9A 5EB5A 2XCGA 4OPGA 4P9SA 4OPCA 1H82A 2QCUA 2WDQA 4EM3A 3CNDA 2CVJA 5KRQA 2BC0A 2YQUA 3KVEA 3P9UA 5IPYA 4PAAA 4B1BA 3QVRA 5KMSA 1W4XA 2BCPA 3K7TA 5HYMA 4YKFA 1CJCA 4K7ZA 3QSSA 1D5TA 1ZK7A 2GH5A 5GSNA 2YM1A 2V3BA 1RYIA 4H4PA 3KKJA 4GAVA 1BGJA 2C65A 4H2RA 3NHOX 3LZXA 4CCRA 5BUKA 3LADA 1EL5A 2OLOA 2AQJA 2V6OA 2BK4A 1K0IA 2YG6A 2GQFA 3NYEA 2GAHB 4YT0A 4II3A 4H4VA 1F6MA 4O5QA 1QJDA 3UTHA 4WCTA 2RGOA 2YR5A 1TYPA 5JCNA 2XDOA 1NHRA 2EQ8A 1PXCA 3T2YA 2BRYA 1JU2A 4OPTA 4G74A 1LTXR 1KFYA 1PXAA 3GRSA 3FBSA 4H2NA 1PBDA 2BXSA 4EQWA 4JQ9A 4H4UA 2QA1A 5EB4A 2C7GA 4LIIA 2AR8A 4Z24A 4B68A 2VZ2A 4GCMA 5JCIA 2YLTA 4NWZA 1E1LA 1S2QA 1N1PA 2UZZA 2Q7VA 2JB1A 2YVGA 3IC9A 3AE3A 1BF3A 3CPJG 2YR6A 3CIRA 3KPKA 3UOVA 1H7WA 1S3BA 1ZY8A 3ZYXA 3UTEA 2CFYA 1H83A 1VG9A 4O5UA 4B67A 4B65A 4G9KA 3AXBA 4USQA 2C76A 2C75A 2XLTA 3OC4A 4H4XA 5EBKA 2EQ7A 3REDA 2ARDA 1H81A 2YLRA 2V3AA 1FOHA 2C4CA 3AE1A 4EQRA 3B6DA 4TM3A 4U8NA 2B7RA 4AOXA 3M12A 3AEAA 1PDHA 2BK5A 1F8WA 3BHFA 3B3RA 1NG3A 3VRDB 5ER0A 3Q9TA 2YM2A 3RP8A 5CKUA 2BYBA 4IA5A 4U8LA 1B5QA 1OJAA 2BS3A 3IHMA 2WDVA 3CGCA 4J2WA 1NDAA 1TRBA 5KWFA 2GR3A 1GRAA 3AE2A 3EAOA 1D7YA 4CBQA 4ADWA 3DJGX 4J33A 4K2XA 4FDCB 4TLXA 4C74A 1ZMCA 1ZOYA 2C73A 1PN0A 3ATQA 2GR1A 4U8IA 4XXGA 2YG5A 4H2PA 1IUVA 1DXLA 3AE4A 1EBDA 2VVLA 4C3YA 1REOA 5HXIA 4H2QA 4XWRA 2R0PA 1S3EA 2B9WA 5KOXA 4PABA 4REKA 4NEWA 2XFUA 2B76A 4D03A 5C3JA 1ZX9A 3RP6A 2XFOA 1LQTA 3NYFA 3VR9A 4JNAA 1JEHA 3V3NA 1K0JA 2OA1A 1TYTA 1VDCA 4WX1A 4GRTA 3DMEA 1EL8A 5IQ4A 4GAPA 1B37A 1E6EA 2GRTA 1GRBA 1NEKA 1X31B 2Q6UA 4UP3A 2X8CA 4Y4LA 3AYIA 4BK3A 1KSSA 3S5WA 4GR1A 1MOKA 2CULA 3UCLA 5LV9A 4NTCA 3AEFA 3NK1X 1F8SA 3DJDA 4J57A 2XLSA 2FJEA 3QSMA 4IA6A 4ECHA 1OJTA 1FCDA 3GYXA 1JRXA 3ISHA 1GTHA 4U8JA 3OZ2A 1Q9IA 3KA7A 1CJ4A 2WDRA 4I59A 1EL9A 3I3LA 4J36A 5CQFA 3QFBA 2C3CA 4GDPA 4AT0A 2JBVA 2BS4A 2Y6QA 4E0VA 4B64A 3GMBA 4ZCCA 2W0HA 3KPFA 1PBFA 2XVHA 1YKJA 3SZ0A 2HQMA 3BI2A 2ZZ0A 4RG4A 3HZLA 2R4EA 1JRYA 1NHQA 1B4VA 1H86A 1KNPA 1E1KA 1N4UA 4Z26A 4NNJA 3ICSA 4K22A 4K8DA 2H89A 3KLJA 2OAMA 4ZN0A 2IVDA 3G5QA 3SXIA 3DGZA 3UKHA 1D4CA 1D4DA 3KU9A 2JAEA 4H50A 5KOWA 3T0KA 2R4JA 2FJBA 3CGDA 3GD4A 4A7AA 3ALMA 5TR3A 5FMHA 3K7QX 3P4SA 3EANA 4YTPA 3L1RA 4H4WA 4X4JA 3VQRA 2YR4A 1F3PA 3SQPA 5KVHA 4A6NB 1YQ4A 3H8LA 4JN9A 1PBCA 4OPDA 1IUXA 4TM0A 3DJEA 2R45A 4ZCDA 1GV4A 2EQ9A 4FK1A 2V5ZA 4GDEA 1B8SA 1NPXA 4YWOA 2GF3A 1TDOA 3VRBA 1AOGA 1NG4A 3K30A 4AP1A 1XANA 4X9MA 1KSUA 2XLUA 1ZOVA 2GMJA 3CPIG 1CC4A 5IQ1A 3DK8A 2YLXA 1KNRA 5BVAA 3CN8A 3AE9A 1ZMDA 4CNKA 4BURA 3D1CA 1LV0A 3AE5A 2JB3A 1VQWA 2YLWA 3LXDA 4TM1A 1DOCA 2YWLA 3EPTA 2VVMA 2YG3A 5JCLA 1PS9A 4HB9A 3H8IA 5JCKA 1GTEA 4N9XA 2GR0A 1NENA 3AEBA 2TMDA 3PVCA 3GYJA 3HYWA 3T14A 1IJHA 4B66A 3GDNA 2WS3A 2Q0LA 2BXRA 1CF3A 2ZZBA 2BC1A 4HA6A 2WETA 3SFDA 3AE6A 4NTDA 4EIQA 1E1MA 4AP3A 2Y6RA 4YTNA 2WP9A 2YVJA 4JDRA 2WP6A 3GSIA 4EMIA 1PJ5A 4YSYA 2WOVA 3NTAA 2XYOA 2FJAA 3UP5A 2XVEA 1RSGA 3VR8A 1M64A 5KMRA 2VRLA 4MJWA 3PS9A 1Z6LA 2C67A 2FBWA 3UOXA 4FK1C 4B63A 4Z2UA 2PYXA 4TLZA 1TDFA 4II2A 2WEUA 3LOVA 2DKIA 2WESA 1GREA 4JY3A 1YY5A 2CDUA 4M52A 1GETA 2BK3A 3SX6A 1GOSA 3IF9A 4LA1A 2BS2A 3C4NA 1BWCA 1OJCA 4RG3A 3T2ZA 2WOIA 4G6HA 2VQBA 3UTGA 1GT8A 4Y4NA 3QSEA 4KX6A 4KPRA 5FS8A 1DOBA 2GR2A 5U63A 5L46A 4J56A 2FJDA 3CTYA 4U8OA 3FPZA 4APNA 2ACZA 4YTMA 3PO7A 3NN0X 3CPHG 2AAQA 1LPFA 3I6DA 3NG7X 2BA9A 2WPCA 3AWIA 4U8MA 2GQWA 1LVLA 1S2YA 3P4RA 2OLNA 3UOZA 3NTDA 4DGKA 4LU6A 1QO8A 2BACA 4GUVA 2NPXA 5M0ZA 5GRTA 2C3DA 3QFAA 1CL0A 2APGA 2C70A 1Y56B 2VQ7A 3AD9B 1P2HA 3UTFA 4Z25A 3IHGA 2WHDA 2XVIA 4XWZA 3RP7A 2I0ZA 1ELIA 3NGCX 2C64A 1HYUA 3F8PA 4OPIA 4BV6A 4U2TA 5J60A 2V61A 4C5OA 1OJDA 2X50A 2GAGB 5KVIA 1D7LA 2R9ZA 2EQ6A 2XFNA 2YVFA 3AEDA 2OALA 3T31A 2XLPA 3SM8A 1CJ2A 1PBBA 1V59A 3C4AA 1E7PA 1YQZA 3D8XA 3Q6JA
chains in the Genus database with same CATH topology
5M10A 4YSZA 4BK2A 5KXJA 1DJNA 5BULA 3SYIA 2BRAA 4U8KA 4JY2A 4UDPA 4CRTA 1DNCA 1L9EA 3II4A 3NK0X 1RP0A 2J3NA 2JKCA 1CHUA 1CC2A 2RGJA 3G5SA 4AT2A 2DKHA 3UOYA 3HYVA 3EF6A 4FX9A 2QAEA 4BJYA 1DOEA 1MXTA 1XHCA 4I58A 2Z5YA 3DA1A 2PHHA 1TDNA 1ZP0A 4TM4A 3UKQA 3BI5A 1FECA 4NTEA 3UP4A 2GV8A 3GD3A 3UKFA 2RABA 3WE0A 3CNPA 3SGLA 3BI4A 3CGBA 3T2KA 3UKLA 4DNAA 1JRZA 4OPUA 4A79A 3NLCA 2IVEA 4U2SA 4H4TA 4DSGA 3COXA 3DH9A 4H4YA 2A87A 4U8PA 4C77A 4A65A 2R46A 3T37A 3BHKA 5BRTA 4H4ZA 2XVJA 1MO9A 2Q0KA 4D04A 3F8DA 2YAUA 3NT6A 3NYCA 1H7XA 4G6GA 3AD7B 3QVPA 1GRHA 2Z5XA 5HHFA 2B9XA 1IUSA 3SFEA 3BNMA 1PBEA 3ICTA 3NKSA 1IUWA 3CNJA 4H4QA 3V3OA 4EMJA 3SZCA 4CY8A 2GVCA 5HY5A 2B9YA 1PHHA 2X8GA 2V60A 2VVLG 2JK6A 1ZDLA 2E5VA 4A5LA 1GRGA 3NN6X 3LB8A 2XFQA 3CMMA 1DODA 3SZWA 2WQYA 4CCQA 2BABA 2O9ZA 1PXBA 1OJ9A 3P1WA 3LZWA 1O94A 1L0VA 4BJZA 3GYIA 4USRA 4OPLA 4ICYA 1KDGA 3DK4A 1Y56A 2ZZCA 2F5ZA 3AE7A 1GNDA 3GDPA 3LJPA 1SEZA 4DSHA 2WP5A 1O5WA 4Y4MA 5J7XA 3ABVA 3ATRA 5KMQA 4A99A 2GB0A 4YSHA 2A89A 3ITJA 3ICRA 1GXFA 5FS7A 3M0OA 3L8KA 4A9WA 4IVOB 4NZHA 5C2TA 2C72A 5FS9A 3CNSA 2R0GA 3C96A 4IVMB 2WPEA 3AEGA 1M6IA 1L9CA 2X3NA 3HYXA 3KD9A 3UKKA 1GERA 4K5RA 1BKWA 4UDRA 3RHAA 3ALJA 4X9NA 3CNTA 1KF6A 1IUUA 3GMCA 2RGHA 3K7MX 3URHA 5DBJA 1FEAA 2TPRA 2E1MA 2X99A 2WU5A 3GWDA 3FG2P 3DJJA 1O95A 3GRTA 1BGNA 3F8RA 4JNQA 2YLZA 2YLSA 2QA2A 1GALA 3AD8B 3RNMA 2B7SA 1E1NA 5KMPA 4EQSA 3CGEA 4NEVA 4YXDA 1JOAA 2WPFA 4Z2RA 2YG4A 1K4QA 1PJ7A 1CBOA 1QLBA 3AB1A 3ZDNA 1EL7A 1Y0PA 4K5SA 5KNLA 1IUTA 3NNEA 1E39A 1H6VA 3NRNA 1GRTA 2WOWA 4H4SA 3H4KA 5U25A 3UKPA 4EMWA 4YKGA 1XDIA 4J34A 1PJ6A 3AYJA 3M13A 2X8HA 2XLRA 4OVIA 3GWFA 1GEUA 3ALLA 3UKAA 4RSLA 1ONFA 3NH3X 3JSKA 4A6NA 4C3XA 1K0LA 1UKVG 3IWAA 5EOWA 1BZLA 3AE8A 3R9UA 2WBAA 2XVFA 1NHPA 3AEEA 3QJ4A 1TDKA 1P2EA 1YQ3A 4CY6A 2C66A 4YSXA 1N4WA 2VOUA 3O0HA 5FS6A 1JNRA 1FEBA 4H7UA 4G73A 4Z44A 2NVKX 1JNZA 2XFPA 4H4RA 4UDQA 3SY4A 3SZFA 2A8XA 1H84A 1D4EA 1LJ1A 3FMWA 4IV9A 3FIMB 4EIPA 5JCMA 4OCGA 1GPEA 3P4QA 1ZKQA 3NIXA 3P4PA 1GESA 1L9DA 2E4GA 1FL2A 2VRMA 4Z2TA 2GEWA 3G5RA 5U1OA 1VG0A 3DGHA 1LQUA 1CJ3A 2YG7A 2JB2A 2WU2A 1CC6A 1XPQA 1F8RA 4U2LA 1NHSA 1TDEA 3BNUA 4J31A 1N4VA 1NAAA 2BCGG 2R0CA 1DJQA 4BK1A 1COYA 4CNJA 2GMHA 3V76A 1GSNA 3VRAA 3ADAB 1VRQB 3S61A 4B69A 1GRFA 1Q1WA 4EQXA 4EM4A 4Z43A 3NK2X 4GF7A 3AYLA 4AOSA 3E1TA 2H88A 1Q1RA 2ZBWA 2IIDA 3AECA 3DK9A 5EB5A 2XCGA 4OPGA 4P9SA 4OPCA 1H82A 2QCUA 2WDQA 4EM3A 3CNDA 2CVJA 5KRQA 2BC0A 2YQUA 3KVEA 3P9UA 5IPYA 4PAAA 4B1BA 3QVRA 5KMSA 1W4XA 2BCPA 3K7TA 5HYMA 4YKFA 1CJCA 4K7ZA 3QSSA 1D5TA 1ZK7A 2GH5A 5GSNA 2YM1A 2V3BA 1RYIA 4H4PA 3KKJA 4GAVA 1BGJA 2C65A 4H2RA 3NHOX 3LZXA 4CCRA 5BUKA 3LADA 1EL5A 2OLOA 2AQJA 2V6OA 2BK4A 1K0IA 2YG6A 2GQFA 3NYEA 2GAHB 4YT0A 4II3A 4H4VA 1F6MA 4O5QA 1QJDA 3UTHA 4WCTA 2RGOA 2YR5A 1TYPA 5JCNA 2XDOA 1NHRA 2EQ8A 1PXCA 3T2YA 2BRYA 1JU2A 4OPTA 4G74A 1LTXR 1KFYA 1PXAA 3GRSA 3FBSA 4H2NA 1PBDA 2BXSA 4EQWA 4JQ9A 4H4UA 2QA1A 5EB4A 2C7GA 4LIIA 2AR8A 4Z24A 4B68A 2VZ2A 4GCMA 5JCIA 2YLTA 4NWZA 1E1LA 1S2QA 1N1PA 2UZZA 2Q7VA 2JB1A 2YVGA 3IC9A 3AE3A 1BF3A 3CPJG 2YR6A 3CIRA 3KPKA 3UOVA 1H7WA 1S3BA 1ZY8A 3ZYXA 3UTEA 2CFYA 1H83A 1VG9A 4O5UA 4B67A 4B65A 4G9KA 3AXBA 4USQA 2C76A 2C75A 2XLTA 3OC4A 4H4XA 5EBKA 2EQ7A 3REDA 2ARDA 1H81A 2YLRA 2V3AA 1FOHA 2C4CA 3AE1A 4EQRA 3B6DA 4TM3A 4U8NA 2B7RA 4AOXA 3M12A 3AEAA 1PDHA 2BK5A 1F8WA 3BHFA 3B3RA 1NG3A 3VRDB 5ER0A 3Q9TA 2YM2A 3RP8A 5CKUA 2BYBA 4IA5A 4U8LA 1B5QA 1OJAA 2BS3A 3IHMA 2WDVA 3CGCA 4J2WA 1NDAA 1TRBA 5KWFA 2GR3A 1GRAA 3AE2A 3EAOA 1D7YA 4CBQA 4ADWA 3DJGX 4J33A 4K2XA 4FDCB 4TLXA 4C74A 1ZMCA 1ZOYA 2C73A 1PN0A 3ATQA 2GR1A 4U8IA 4XXGA 2YG5A 4H2PA 1IUVA 1DXLA 3AE4A 1EBDA 2VVLA 4C3YA 1REOA 5HXIA 4H2QA 4XWRA 2R0PA 1S3EA 2B9WA 5KOXA 4PABA 4REKA 4NEWA 2XFUA 2B76A 4D03A 5C3JA 1ZX9A 3RP6A 2XFOA 1LQTA 3NYFA 3VR9A 4JNAA 1JEHA 3V3NA 1K0JA 2OA1A 1TYTA 1VDCA 4WX1A 4GRTA 3DMEA 1EL8A 5IQ4A 4GAPA 1B37A 1E6EA 2GRTA 1GRBA 1NEKA 1X31B 2Q6UA 4UP3A 2X8CA 4Y4LA 3AYIA 4BK3A 1KSSA 3S5WA 4GR1A 1MOKA 2CULA 3UCLA 5LV9A 4NTCA 3AEFA 3NK1X 1F8SA 3DJDA 4J57A 2XLSA 2FJEA 3QSMA 4IA6A 4ECHA 1OJTA 1FCDA 3GYXA 1JRXA 3ISHA 1GTHA 4U8JA 3OZ2A 1Q9IA 3KA7A 1CJ4A 2WDRA 4I59A 1EL9A 3I3LA 4J36A 5CQFA 3QFBA 2C3CA 4GDPA 4AT0A 2JBVA 2BS4A 2Y6QA 4E0VA 4B64A 3GMBA 4ZCCA 2W0HA 3KPFA 1PBFA 2XVHA 1YKJA 3SZ0A 2HQMA 3BI2A 2ZZ0A 4RG4A 3HZLA 2R4EA 1JRYA 1NHQA 1B4VA 1H86A 1KNPA 1E1KA 1N4UA 4Z26A 4NNJA 3ICSA 4K22A 4K8DA 2H89A 3KLJA 2OAMA 4ZN0A 2IVDA 3G5QA 3SXIA 3DGZA 3UKHA 1D4CA 1D4DA 3KU9A 2JAEA 4H50A 5KOWA 3T0KA 2R4JA 2FJBA 3CGDA 3GD4A 4A7AA 3ALMA 5TR3A 5FMHA 3K7QX 3P4SA 3EANA 4YTPA 3L1RA 4H4WA 4X4JA 3VQRA 2YR4A 1F3PA 3SQPA 5KVHA 4A6NB 1YQ4A 3H8LA 4JN9A 1PBCA 4OPDA 1IUXA 4TM0A 3DJEA 2R45A 4ZCDA 1GV4A 2EQ9A 4FK1A 2V5ZA 4GDEA 1B8SA 1NPXA 4YWOA 2GF3A 1TDOA 3VRBA 1AOGA 1NG4A 3K30A 4AP1A 1XANA 4X9MA 1KSUA 2XLUA 1ZOVA 2GMJA 3CPIG 1CC4A 5IQ1A 3DK8A 2YLXA 1KNRA 5BVAA 3CN8A 3AE9A 1ZMDA 4CNKA 4BURA 3D1CA 1LV0A 3AE5A 2JB3A 1VQWA 2YLWA 3LXDA 4TM1A 1DOCA 2YWLA 3EPTA 2VVMA 2YG3A 5JCLA 1PS9A 4HB9A 3H8IA 5JCKA 1GTEA 4N9XA 2GR0A 1NENA 3AEBA 2TMDA 3PVCA 3GYJA 3HYWA 3T14A 1IJHA 4B66A 3GDNA 2WS3A 2Q0LA 2BXRA 1CF3A 2ZZBA 2BC1A 4HA6A 2WETA 3SFDA 3AE6A 4NTDA 4EIQA 1E1MA 4AP3A 2Y6RA 4YTNA 2WP9A 2YVJA 4JDRA 2WP6A 3GSIA 4EMIA 1PJ5A 4YSYA 2WOVA 3NTAA 2XYOA 2FJAA 3UP5A 2XVEA 1RSGA 3VR8A 1M64A 5KMRA 2VRLA 4MJWA 3PS9A 1Z6LA 2C67A 2FBWA 3UOXA 4FK1C 4B63A 4Z2UA 2PYXA 4TLZA 1TDFA 4II2A 2WEUA 3LOVA 2DKIA 2WESA 1GREA 4JY3A 1YY5A 2CDUA 4M52A 1GETA 2BK3A 3SX6A 1GOSA 3IF9A 4LA1A 2BS2A 3C4NA 1BWCA 1OJCA 4RG3A 3T2ZA 2WOIA 4G6HA 2VQBA 3UTGA 1GT8A 4Y4NA 3QSEA 4KX6A 4KPRA 5FS8A 1DOBA 2GR2A 5U63A 5L46A 4J56A 2FJDA 3CTYA 4U8OA 3FPZA 4APNA 2ACZA 4YTMA 3PO7A 3NN0X 3CPHG 2AAQA 1LPFA 3I6DA 3NG7X 2BA9A 2WPCA 3AWIA 4U8MA 2GQWA 1LVLA 1S2YA 3P4RA 2OLNA 3UOZA 3NTDA 4DGKA 4LU6A 1QO8A 2BACA 4GUVA 2NPXA 5M0ZA 5GRTA 2C3DA 3QFAA 1CL0A 2APGA 2C70A 1Y56B 2VQ7A 3AD9B 1P2HA 3UTFA 4Z25A 3IHGA 2WHDA 2XVIA 4XWZA 3RP7A 2I0ZA 1ELIA 3NGCX 2C64A 1HYUA 3F8PA 4OPIA 4BV6A 4U2TA 5J60A 2V61A 4C5OA 1OJDA 2X50A 2GAGB 5KVIA 1D7LA 2R9ZA 2EQ6A 2XFNA 2YVFA 3AEDA 2OALA 3T31A 2XLPA 3SM8A 1CJ2A 1PBBA 1V59A 3C4AA 1E7PA 1YQZA 3D8XA 3Q6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M10 A;  4YSZ A;  4BK2 A;  5KXJ A;  1DJN A;  5BUL A;  4U8K A;  4JY2 A;  4UDP A;  4CRT A;  1DNC A;  1L9E A;  3II4 A;  3NK0 X;  1RP0 A;  2J3N A;  2JKC A;  1CHU A;  1CC2 A;  2RGJ A;  3G5S A;  4AT2 A;  2DKH A;  3UOY A;  5J60 A;  3EF6 A;  4FX9 A;  2QAE A;  4BJY A;  1DOE A;  1MXT A;  1XHC A;  4I58 A;  2Z5Y A;  3DA1 A;  2PHH A;  1TDN A;  1ZP0 A;  4TM4 A;  3UKQ A;  3BI5 A;  1FEC A;  4NTE A;  3UP4 A;  2GV8 A;  3GD3 A;  3UKF A;  2RAB A;  3WE0 A;  3CNP A;  3SGL A;  3BI4 A;  3CGB A;  4DNA A;  3UKL A;  1JRZ A;  4OPU A;  4A79 A;  3NLC A;  2IVE A;  4U2S A;  4H4T A;  4DSG A;  3COX A;  3DH9 A;  4H4Y A;  2A87 A;  4U8P A;  4C77 A;  4A65 A;  2R46 A;  3T37 A;  3BHK A;  5BRT A;  4H4Z A;  2XVJ A;  1MO9 A;  2Q0K A;  4D04 A;  3F8D A;  2YAU A;  3NT6 A;  3NYC A;  1H7X A;  3AD7 B;  3QVP A;  1GRH A;  2Z5X A;  5HHF A;  2B9X A;  1IUS A;  3SFE A;  3BNM A;  1PBE A;  3ICT A;  3NKS A;  1IUW A;  3CNJ A;  4H4Q A;  3V3O A;  4EMJ A;  4CY8 A;  5HY5 A;  2GVC A;  2B9Y A;  1PHH A;  2X8G A;  2V60 A;  2VVL G;  2JK6 A;  1ZDL A;  2E5V A;  4A5L A;  1GRG A;  3NN6 X;  3LB8 A;  2XFQ A;  4CCQ A;  1DOD A;  2WQY A;  2BAB A;  2O9Z A;  1PXB A;  1OJ9 A;  3P1W A;  3LZW A;  1O94 A;  1L0V A;  4BJZ A;  3GYI A;  4USR A;  4OPL A;  4ICY A;  1KDG A;  3DK4 A;  1Y56 A;  2ZZC A;  2F5Z A;  3AE7 A;  1GND A;  3GDP A;  3LJP A;  1SEZ A;  4DSH A;  2WP5 A;  1O5W A;  4Y4M A;  5J7X A;  3ABV A;  3ATR A;  4A99 A;  2GB0 A;  4YSH A;  2A89 A;  3ITJ A;  3ICR A;  1GXF A;  5FS7 A;  3M0O A;  3L8K A;  4A9W A;  4IVO B;  4NZH A;  5C2T A;  2C72 A;  5FS9 A;  3CNS A;  2R0G A;  3C96 A;  4IVM B;  2WPE A;  3AEG A;  1M6I A;  1L9C A;  2X3N A;  3KD9 A;  3UKK A;  1GER A;  4K5R A;  1BKW A;  4UDR A;  3RHA A;  3ALJ A;  4X9N A;  3CNT A;  1KF6 A;  1IUU A;  3GMC A;  2RGH A;  3K7M X;  3URH A;  5DBJ A;  1FEA A;  2TPR A;  2E1M A;  2X99 A;  2WU5 A;  3GWD A;  3FG2 P;  3DJJ A;  1O95 A;  3GRT A;  1BGN A;  3F8R A;  4JNQ A;  2YLZ A;  2YLS A;  2QA2 A;  1GAL A;  3AD8 B;  3RNM A;  2B7S A;  1E1N A;  4EQS A;  3CGE A;  4NEV A;  4YXD A;  1JOA A;  2WPF A;  4Z2R A;  2YG4 A;  1K4Q A;  1PJ7 A;  1CBO A;  1QLB A;  3AB1 A;  3ZDN A;  1EL7 A;  1Y0P A;  4K5S A;  1IUT A;  3NNE A;  1E39 A;  1H6V A;  3NRN A;  1GRT A;  2WOW A;  4H4S A;  3H4K A;  5U25 A;  3UKP A;  4EMW A;  4YKG A;  1XDI A;  4J34 A;  1PJ6 A;  3AYJ A;  3M13 A;  2X8H A;  2XLR A;  4OVI A;  3GWF A;  1GEU A;  3ALL A;  3UKA A;  4RSL A;  1ONF A;  3NH3 X;  3JSK A;  4A6N A;  4C3X A;  1K0L A;  1UKV G;  3IWA A;  5EOW A;  1BZL A;  3AE8 A;  3R9U A;  2WBA A;  2XVF A;  1NHP A;  3AEE A;  3QJ4 A;  1TDK A;  1P2E A;  1YQ3 A;  4CY6 A;  2C66 A;  4YSX A;  1N4W A;  2VOU A;  3O0H A;  5FS6 A;  1JNR A;  1FEB A;  4H7U A;  4Z44 A;  2NVK X;  1JNZ A;  2XFP A;  4H4R A;  4UDQ A;  2A8X A;  1H84 A;  1D4E A;  1LJ1 A;  3FMW A;  4IV9 A;  3FIM B;  4EIP A;  5JCM A;  4OCG A;  1GPE A;  3P4Q A;  1ZKQ A;  3NIX A;  3P4P A;  1GES A;  1L9D A;  2E4G A;  1FL2 A;  2VRM A;  4Z2T A;  2GEW A;  3G5R A;  5U1O A;  1VG0 A;  3DGH A;  1LQU A;  1CJ3 A;  2YG7 A;  2JB2 A;  2WU2 A;  1CC6 A;  1XPQ A;  1F8R A;  4U2L A;  1NHS A;  1TDE A;  3BNU A;  4J31 A;  1N4V A;  1NAA A;  2BCG G;  2R0C A;  1DJQ A;  4BK1 A;  1COY A;  4CNJ A;  2GMH A;  3V76 A;  1GSN A;  3VRA A;  3ADA B;  1VRQ B;  3S61 A;  4B69 A;  1GRF A;  1Q1W A;  4EQX A;  4EM4 A;  4Z43 A;  3NK2 X;  4GF7 A;  3AYL A;  4AOS A;  3E1T A;  2H88 A;  1Q1R A;  2ZBW A;  2IID A;  3AEC A;  3DK9 A;  5EB5 A;  2XCG A;  4OPG A;  4P9S A;  4OPC A;  1H82 A;  2QCU A;  2WDQ A;  4EM3 A;  3CND A;  2CVJ A;  5KRQ A;  2BC0 A;  2YQU A;  3KVE A;  3P9U A;  5IPY A;  4PAA A;  4B1B A;  3QVR A;  1W4X A;  2BCP A;  3K7T A;  5HYM A;  4YKF A;  1CJC A;  4K7Z A;  3QSS A;  1D5T A;  1ZK7 A;  2GH5 A;  5GSN A;  2YM1 A;  2V3B A;  1RYI A;  4H4P A;  3KKJ A;  1BGJ A;  2C65 A;  4H2R A;  3NHO X;  3LZX A;  4CCR A;  5BUK A;  3LAD A;  1EL5 A;  2OLO A;  2AQJ A;  2V6O A;  2BK4 A;  1K0I A;  2YG6 A;  2GQF A;  3NYE A;  2GAH B;  4YT0 A;  4H4V A;  1F6M A;  4O5Q A;  1QJD A;  3UTH A;  4WCT A;  2RGO A;  2YR5 A;  1TYP A;  5JCN A;  2XDO A;  1NHR A;  2EQ8 A;  1PXC A;  1JU2 A;  4OPT A;  1LTX R;  1KFY A;  1PXA A;  3GRS A;  3FBS A;  4H2N A;  1PBD A;  2BXS A;  4EQW A;  4JQ9 A;  4H4U A;  2QA1 A;  5EB4 A;  2C7G A;  4LII A;  2AR8 A;  4Z24 A;  4B68 A;  2VZ2 A;  4GCM A;  5JCI A;  2YLT A;  1E1L A;  1S2Q A;  1N1P A;  2UZZ A;  2Q7V A;  2JB1 A;  2YVG A;  3IC9 A;  3AE3 A;  1BF3 A;  3CPJ G;  2YR6 A;  3CIR A;  3UOV A;  1H7W A;  1S3B A;  1ZY8 A;  3ZYX A;  3UTE A;  2CFY A;  1H83 A;  1VG9 A;  4O5U A;  4B67 A;  4B65 A;  3AXB A;  4USQ A;  2C76 A;  2C75 A;  2XLT A;  3OC4 A;  4H4X A;  5EBK A;  2EQ7 A;  3RED A;  2ARD A;  1H81 A;  2YLR A;  2V3A A;  1FOH A;  3AE1 A;  4EQR A;  3B6D A;  4TM3 A;  4U8N A;  2B7R A;  4AOX A;  3M12 A;  3AEA A;  1PDH A;  2BK5 A;  1F8W A;  3BHF A;  3B3R A;  1NG3 A;  3VRD B;  5ER0 A;  3Q9T A;  2YM2 A;  3RP8 A;  5CKU A;  2BYB A;  4IA5 A;  4U8L A;  1B5Q A;  1OJA A;  2BS3 A;  3IHM A;  2WDV A;  3CGC A;  4J2W A;  1NDA A;  1TRB A;  5KWF A;  2GR3 A;  1GRA A;  3AE2 A;  3EAO A;  1D7Y A;  4CBQ A;  4ADW A;  3DJG X;  4J33 A;  4K2X A;  4FDC B;  4TLX A;  4C74 A;  1ZMC A;  1ZOY A;  2C73 A;  1PN0 A;  3ATQ A;  2GR1 A;  4U8I A;  4XXG A;  2YG5 A;  4H2P A;  1IUV A;  1DXL A;  3AE4 A;  1EBD A;  2VVL A;  4C3Y A;  1REO A;  5HXI A;  4H2Q A;  4XWR A;  2R0P A;  1S3E A;  2B9W A;  5KOX A;  4PAB A;  4REK A;  4NEW A;  2XFU A;  2B76 A;  4D03 A;  5C3J A;  1ZX9 A;  3RP6 A;  2XFO A;  1LQT A;  3NYF A;  3VR9 A;  4JNA A;  1JEH A;  3V3N A;  1K0J A;  2OA1 A;  1TYT A;  1VDC A;  4WX1 A;  4GRT A;  3DME A;  1EL8 A;  5IQ4 A;  1B37 A;  1E6E A;  2GRT A;  1GRB A;  1NEK A;  1X31 B;  2Q6U A;  4UP3 A;  2X8C A;  4Y4L A;  3AYI A;  4BK3 A;  1KSS A;  3S5W A;  4GR1 A;  1MOK A;  2CUL A;  3UCL A;  5LV9 A;  4NTC A;  3AEF A;  3NK1 X;  1F8S A;  3DJD A;  4J57 A;  2XLS A;  2FJE A;  3QSM A;  4IA6 A;  4ECH A;  1OJT A;  1FCD A;  1JRX A;  3ISH A;  1GTH A;  4U8J A;  3OZ2 A;  1Q9I A;  3KA7 A;  1CJ4 A;  2WDR A;  4I59 A;  1EL9 A;  3I3L A;  4J36 A;  5CQF A;  3QFB A;  2C3C A;  4GDP A;  4AT0 A;  2JBV A;  2BS4 A;  2Y6Q A;  4E0V A;  4B64 A;  3GMB A;  4ZCC A;  2W0H A;  3KPF A;  1PBF A;  2XVH A;  1YKJ A;  2HQM A;  3BI2 A;  2ZZ0 A;  4RG4 A;  3HZL A;  2R4E A;  1JRY A;  1NHQ A;  1B4V A;  1H86 A;  1KNP A;  1E1K A;  1N4U A;  4Z26 A;  3ICS A;  4K22 A;  4K8D A;  2H89 A;  3KLJ A;  2OAM A;  4ZN0 A;  2IVD A;  3G5Q A;  3DGZ A;  3UKH A;  1D4C A;  1D4D A;  3KU9 A;  2JAE A;  4H50 A;  5KOW A;  2R4J A;  2FJB A;  3CGD A;  3GD4 A;  4A7A A;  3ALM A;  5TR3 A;  5FMH A;  3K7Q X;  3P4S A;  3EAN A;  4YTP A;  3L1R A;  4H4W A;  4X4J A;  3VQR A;  2YR4 A;  1F3P A;  3SQP A;  5KVH A;  4A6N B;  1YQ4 A;  3H8L A;  4JN9 A;  1PBC A;  4OPD A;  1IUX A;  4TM0 A;  3DJE A;  2R45 A;  4ZCD A;  1GV4 A;  2EQ9 A;  4FK1 A;  2V5Z A;  4GDE A;  1B8S A;  1NPX A;  4YWO A;  2GF3 A;  1TDO A;  3VRB A;  1AOG A;  1NG4 A;  3K30 A;  4AP1 A;  1XAN A;  4X9M A;  1KSU A;  2XLU A;  1ZOV A;  2GMJ A;  3CPI G;  1CC4 A;  5IQ1 A;  3DK8 A;  2YLX A;  1KNR A;  5BVA A;  3CN8 A;  3AE9 A;  1ZMD A;  4CNK A;  4BUR A;  3D1C A;  1LV0 A;  3AE5 A;  2JB3 A;  1VQW A;  2YLW A;  3LXD A;  4TM1 A;  1DOC A;  2YWL A;  3EPT A;  2VVM A;  2YG3 A;  5JCL A;  1PS9 A;  4HB9 A;  3H8I A;  5JCK A;  1GTE A;  4N9X A;  2GR0 A;  1NEN A;  3AEB A;  2TMD A;  3PVC A;  3GYJ A;  4B66 A;  1IJH A;  3GDN A;  2WS3 A;  2Q0L A;  2BXR A;  1CF3 A;  2ZZB A;  2BC1 A;  4HA6 A;  2WET A;  3SFD A;  3AE6 A;  4NTD A;  4EIQ A;  1E1M A;  4AP3 A;  2Y6R A;  4YTN A;  2WP9 A;  2YVJ A;  4JDR A;  2WP6 A;  3GSI A;  4EMI A;  1PJ5 A;  4YSY A;  2WOV A;  3NTA A;  2XYO A;  2FJA A;  3UP5 A;  2XVE A;  1RSG A;  3VR8 A;  1M64 A;  2VRL A;  4MJW A;  3PS9 A;  1Z6L A;  2C67 A;  2FBW A;  3UOX A;  4FK1 C;  4B63 A;  4Z2U A;  2PYX A;  4TLZ A;  1TDF A;  2WEU A;  3LOV A;  2DKI A;  2WES A;  1GRE A;  4JY3 A;  1YY5 A;  2CDU A;  4M52 A;  1GET A;  2BK3 A;  1GOS A;  3IF9 A;  4LA1 A;  2BS2 A;  3C4N A;  1BWC A;  1OJC A;  4RG3 A;  2WOI A;  3UTG A;  2VQB A;  1GT8 A;  4Y4N A;  3QSE A;  4KX6 A;  4KPR A;  5FS8 A;  1DOB A;  2GR2 A;  5U63 A;  5L46 A;  4J56 A;  2FJD A;  3CTY A;  4U8O A;  3FPZ A;  4APN A;  2ACZ A;  4YTM A;  3PO7 A;  3NN0 X;  3CPH G;  2AAQ A;  1LPF A;  3I6D A;  3NG7 X;  2BA9 A;  2WPC A;  3AWI A;  4U8M A;  2GQW A;  1LVL A;  1S2Y A;  3P4R A;  2OLN A;  3UOZ A;  3NTD A;  4DGK A;  4LU6 A;  1QO8 A;  2BAC A;  4GUV A;  2NPX A;  5M0Z A;  5GRT A;  2C3D A;  3QFA A;  1CL0 A;  2APG A;  2C70 A;  1Y56 B;  2VQ7 A;  3AD9 B;  1P2H A;  3UTF A;  4Z25 A;  3IHG A;  2WHD A;  2XVI A;  4XWZ A;  3RP7 A;  2I0Z A;  1ELI A;  3NGC X;  2C64 A;  1HYU A;  3F8P A;  4OPI A;  4BV6 A;  4U2T A;  2V61 A;  4C5O A;  1OJD A;  2X50 A;  2GAG B;  5KVI A;  1D7L A;  2R9Z A;  2EQ6 A;  2XFN A;  2YVF A;  3AED A;  2OAL A;  2XLP A;  3SM8 A;  1CJ2 A;  1PBB A;  1V59 A;  3C4A A;  1E7P A;  1YQZ A;  3D8X A;  3Q6J A; 
#chains in the Genus database with same CATH topology
 5M10 A;  4YSZ A;  4BK2 A;  5KXJ A;  1DJN A;  5BUL A;  3SYI A;  2BRA A;  4U8K A;  4JY2 A;  4UDP A;  4CRT A;  1DNC A;  1L9E A;  3II4 A;  3NK0 X;  1RP0 A;  2J3N A;  2JKC A;  1CHU A;  1CC2 A;  2RGJ A;  3G5S A;  4AT2 A;  2DKH A;  3UOY A;  3HYV A;  3EF6 A;  4FX9 A;  2QAE A;  4BJY A;  1DOE A;  1MXT A;  1XHC A;  4I58 A;  2Z5Y A;  3DA1 A;  2PHH A;  1TDN A;  1ZP0 A;  4TM4 A;  3UKQ A;  3BI5 A;  1FEC A;  4NTE A;  3UP4 A;  2GV8 A;  3GD3 A;  3UKF A;  2RAB A;  3WE0 A;  3CNP A;  3SGL A;  3BI4 A;  3CGB A;  3T2K A;  3UKL A;  4DNA A;  1JRZ A;  4OPU A;  4A79 A;  3NLC A;  2IVE A;  4U2S A;  4H4T A;  4DSG A;  3COX A;  3DH9 A;  4H4Y A;  2A87 A;  4U8P A;  4C77 A;  4A65 A;  2R46 A;  3T37 A;  3BHK A;  5BRT A;  4H4Z A;  2XVJ A;  1MO9 A;  2Q0K A;  4D04 A;  3F8D A;  2YAU A;  3NT6 A;  3NYC A;  1H7X A;  4G6G A;  3AD7 B;  3QVP A;  1GRH A;  2Z5X A;  5HHF A;  2B9X A;  1IUS A;  3SFE A;  3BNM A;  1PBE A;  3ICT A;  3NKS A;  1IUW A;  3CNJ A;  4H4Q A;  3V3O A;  4EMJ A;  3SZC A;  4CY8 A;  2GVC A;  5HY5 A;  2B9Y A;  1PHH A;  2X8G A;  2V60 A;  2VVL G;  2JK6 A;  1ZDL A;  2E5V A;  4A5L A;  1GRG A;  3NN6 X;  3LB8 A;  2XFQ A;  3CMM A;  1DOD A;  3SZW A;  2WQY A;  4CCQ A;  2BAB A;  2O9Z A;  1PXB A;  1OJ9 A;  3P1W A;  3LZW A;  1O94 A;  1L0V A;  4BJZ A;  3GYI A;  4USR A;  4OPL A;  4ICY A;  1KDG A;  3DK4 A;  1Y56 A;  2ZZC A;  2F5Z A;  3AE7 A;  1GND A;  3GDP A;  3LJP A;  1SEZ A;  4DSH A;  2WP5 A;  1O5W A;  4Y4M A;  5J7X A;  3ABV A;  3ATR A;  5KMQ A;  4A99 A;  2GB0 A;  4YSH A;  2A89 A;  3ITJ A;  3ICR A;  1GXF A;  5FS7 A;  3M0O A;  3L8K A;  4A9W A;  4IVO B;  4NZH A;  5C2T A;  2C72 A;  5FS9 A;  3CNS A;  2R0G A;  3C96 A;  4IVM B;  2WPE A;  3AEG A;  1M6I A;  1L9C A;  2X3N A;  3HYX A;  3KD9 A;  3UKK A;  1GER A;  4K5R A;  1BKW A;  4UDR A;  3RHA A;  3ALJ A;  4X9N A;  3CNT A;  1KF6 A;  1IUU A;  3GMC A;  2RGH A;  3K7M X;  3URH A;  5DBJ A;  1FEA A;  2TPR A;  2E1M A;  2X99 A;  2WU5 A;  3GWD A;  3FG2 P;  3DJJ A;  1O95 A;  3GRT A;  1BGN A;  3F8R A;  4JNQ A;  2YLZ A;  2YLS A;  2QA2 A;  1GAL A;  3AD8 B;  3RNM A;  2B7S A;  1E1N A;  5KMP A;  4EQS A;  3CGE A;  4NEV A;  4YXD A;  1JOA A;  2WPF A;  4Z2R A;  2YG4 A;  1K4Q A;  1PJ7 A;  1CBO A;  1QLB A;  3AB1 A;  3ZDN A;  1EL7 A;  1Y0P A;  4K5S A;  5KNL A;  1IUT A;  3NNE A;  1E39 A;  1H6V A;  3NRN A;  1GRT A;  2WOW A;  4H4S A;  3H4K A;  5U25 A;  3UKP A;  4EMW A;  4YKG A;  1XDI A;  4J34 A;  1PJ6 A;  3AYJ A;  3M13 A;  2X8H A;  2XLR A;  4OVI A;  3GWF A;  1GEU A;  3ALL A;  3UKA A;  4RSL A;  1ONF A;  3NH3 X;  3JSK A;  4A6N A;  4C3X A;  1K0L A;  1UKV G;  3IWA A;  5EOW A;  1BZL A;  3AE8 A;  3R9U A;  2WBA A;  2XVF A;  1NHP A;  3AEE A;  3QJ4 A;  1TDK A;  1P2E A;  1YQ3 A;  4CY6 A;  2C66 A;  4YSX A;  1N4W A;  2VOU A;  3O0H A;  5FS6 A;  1JNR A;  1FEB A;  4H7U A;  4G73 A;  4Z44 A;  2NVK X;  1JNZ A;  2XFP A;  4H4R A;  4UDQ A;  3SY4 A;  3SZF A;  2A8X A;  1H84 A;  1D4E A;  1LJ1 A;  3FMW A;  4IV9 A;  3FIM B;  4EIP A;  5JCM A;  4OCG A;  1GPE A;  3P4Q A;  1ZKQ A;  3NIX A;  3P4P A;  1GES A;  1L9D A;  2E4G A;  1FL2 A;  2VRM A;  4Z2T A;  2GEW A;  3G5R A;  5U1O A;  1VG0 A;  3DGH A;  1LQU A;  1CJ3 A;  2YG7 A;  2JB2 A;  2WU2 A;  1CC6 A;  1XPQ A;  1F8R A;  4U2L A;  1NHS A;  1TDE A;  3BNU A;  4J31 A;  1N4V A;  1NAA A;  2BCG G;  2R0C A;  1DJQ A;  4BK1 A;  1COY A;  4CNJ A;  2GMH A;  3V76 A;  1GSN A;  3VRA A;  3ADA B;  1VRQ B;  3S61 A;  4B69 A;  1GRF A;  1Q1W A;  4EQX A;  4EM4 A;  4Z43 A;  3NK2 X;  4GF7 A;  3AYL A;  4AOS A;  3E1T A;  2H88 A;  1Q1R A;  2ZBW A;  2IID A;  3AEC A;  3DK9 A;  5EB5 A;  2XCG A;  4OPG A;  4P9S A;  4OPC A;  1H82 A;  2QCU A;  2WDQ A;  4EM3 A;  3CND A;  2CVJ A;  5KRQ A;  2BC0 A;  2YQU A;  3KVE A;  3P9U A;  5IPY A;  4PAA A;  4B1B A;  3QVR A;  5KMS A;  1W4X A;  2BCP A;  3K7T A;  5HYM A;  4YKF A;  1CJC A;  4K7Z A;  3QSS A;  1D5T A;  1ZK7 A;  2GH5 A;  5GSN A;  2YM1 A;  2V3B A;  1RYI A;  4H4P A;  3KKJ A;  4GAV A;  1BGJ A;  2C65 A;  4H2R A;  3NHO X;  3LZX A;  4CCR A;  5BUK A;  3LAD A;  1EL5 A;  2OLO A;  2AQJ A;  2V6O A;  2BK4 A;  1K0I A;  2YG6 A;  2GQF A;  3NYE A;  2GAH B;  4YT0 A;  4II3 A;  4H4V A;  1F6M A;  4O5Q A;  1QJD A;  3UTH A;  4WCT A;  2RGO A;  2YR5 A;  1TYP A;  5JCN A;  2XDO A;  1NHR A;  2EQ8 A;  1PXC A;  3T2Y A;  2BRY A;  1JU2 A;  4OPT A;  4G74 A;  1LTX R;  1KFY A;  1PXA A;  3GRS A;  3FBS A;  4H2N A;  1PBD A;  2BXS A;  4EQW A;  4JQ9 A;  4H4U A;  2QA1 A;  5EB4 A;  2C7G A;  4LII A;  2AR8 A;  4Z24 A;  4B68 A;  2VZ2 A;  4GCM A;  5JCI A;  2YLT A;  4NWZ A;  1E1L A;  1S2Q A;  1N1P A;  2UZZ A;  2Q7V A;  2JB1 A;  2YVG A;  3IC9 A;  3AE3 A;  1BF3 A;  3CPJ G;  2YR6 A;  3CIR A;  3KPK A;  3UOV A;  1H7W A;  1S3B A;  1ZY8 A;  3ZYX A;  3UTE A;  2CFY A;  1H83 A;  1VG9 A;  4O5U A;  4B67 A;  4B65 A;  4G9K A;  3AXB A;  4USQ A;  2C76 A;  2C75 A;  2XLT A;  3OC4 A;  4H4X A;  5EBK A;  2EQ7 A;  3RED A;  2ARD A;  1H81 A;  2YLR A;  2V3A A;  1FOH A;  2C4C A;  3AE1 A;  4EQR A;  3B6D A;  4TM3 A;  4U8N A;  2B7R A;  4AOX A;  3M12 A;  3AEA A;  1PDH A;  2BK5 A;  1F8W A;  3BHF A;  3B3R A;  1NG3 A;  3VRD B;  5ER0 A;  3Q9T A;  2YM2 A;  3RP8 A;  5CKU A;  2BYB A;  4IA5 A;  4U8L A;  1B5Q A;  1OJA A;  2BS3 A;  3IHM A;  2WDV A;  3CGC A;  4J2W A;  1NDA A;  1TRB A;  5KWF A;  2GR3 A;  1GRA A;  3AE2 A;  3EAO A;  1D7Y A;  4CBQ A;  4ADW A;  3DJG X;  4J33 A;  4K2X A;  4FDC B;  4TLX A;  4C74 A;  1ZMC A;  1ZOY A;  2C73 A;  1PN0 A;  3ATQ A;  2GR1 A;  4U8I A;  4XXG A;  2YG5 A;  4H2P A;  1IUV A;  1DXL A;  3AE4 A;  1EBD A;  2VVL A;  4C3Y A;  1REO A;  5HXI A;  4H2Q A;  4XWR A;  2R0P A;  1S3E A;  2B9W A;  5KOX A;  4PAB A;  4REK A;  4NEW A;  2XFU A;  2B76 A;  4D03 A;  5C3J A;  1ZX9 A;  3RP6 A;  2XFO A;  1LQT A;  3NYF A;  3VR9 A;  4JNA A;  1JEH A;  3V3N A;  1K0J A;  2OA1 A;  1TYT A;  1VDC A;  4WX1 A;  4GRT A;  3DME A;  1EL8 A;  5IQ4 A;  4GAP A;  1B37 A;  1E6E A;  2GRT A;  1GRB A;  1NEK A;  1X31 B;  2Q6U A;  4UP3 A;  2X8C A;  4Y4L A;  3AYI A;  4BK3 A;  1KSS A;  3S5W A;  4GR1 A;  1MOK A;  2CUL A;  3UCL A;  5LV9 A;  4NTC A;  3AEF A;  3NK1 X;  1F8S A;  3DJD A;  4J57 A;  2XLS A;  2FJE A;  3QSM A;  4IA6 A;  4ECH A;  1OJT A;  1FCD A;  3GYX A;  1JRX A;  3ISH A;  1GTH A;  4U8J A;  3OZ2 A;  1Q9I A;  3KA7 A;  1CJ4 A;  2WDR A;  4I59 A;  1EL9 A;  3I3L A;  4J36 A;  5CQF A;  3QFB A;  2C3C A;  4GDP A;  4AT0 A;  2JBV A;  2BS4 A;  2Y6Q A;  4E0V A;  4B64 A;  3GMB A;  4ZCC A;  2W0H A;  3KPF A;  1PBF A;  2XVH A;  1YKJ A;  3SZ0 A;  2HQM A;  3BI2 A;  2ZZ0 A;  4RG4 A;  3HZL A;  2R4E A;  1JRY A;  1NHQ A;  1B4V A;  1H86 A;  1KNP A;  1E1K A;  1N4U A;  4Z26 A;  4NNJ A;  3ICS A;  4K22 A;  4K8D A;  2H89 A;  3KLJ A;  2OAM A;  4ZN0 A;  2IVD A;  3G5Q A;  3SXI A;  3DGZ A;  3UKH A;  1D4C A;  1D4D A;  3KU9 A;  2JAE A;  4H50 A;  5KOW A;  3T0K A;  2R4J A;  2FJB A;  3CGD A;  3GD4 A;  4A7A A;  3ALM A;  5TR3 A;  5FMH A;  3K7Q X;  3P4S A;  3EAN A;  4YTP A;  3L1R A;  4H4W A;  4X4J A;  3VQR A;  2YR4 A;  1F3P A;  3SQP A;  5KVH A;  4A6N B;  1YQ4 A;  3H8L A;  4JN9 A;  1PBC A;  4OPD A;  1IUX A;  4TM0 A;  3DJE A;  2R45 A;  4ZCD A;  1GV4 A;  2EQ9 A;  4FK1 A;  2V5Z A;  4GDE A;  1B8S A;  1NPX A;  4YWO A;  2GF3 A;  1TDO A;  3VRB A;  1AOG A;  1NG4 A;  3K30 A;  4AP1 A;  1XAN A;  4X9M A;  1KSU A;  2XLU A;  1ZOV A;  2GMJ A;  3CPI G;  1CC4 A;  5IQ1 A;  3DK8 A;  2YLX A;  1KNR A;  5BVA A;  3CN8 A;  3AE9 A;  1ZMD A;  4CNK A;  4BUR A;  3D1C A;  1LV0 A;  3AE5 A;  2JB3 A;  1VQW A;  2YLW A;  3LXD A;  4TM1 A;  1DOC A;  2YWL A;  3EPT A;  2VVM A;  2YG3 A;  5JCL A;  1PS9 A;  4HB9 A;  3H8I A;  5JCK A;  1GTE A;  4N9X A;  2GR0 A;  1NEN A;  3AEB A;  2TMD A;  3PVC A;  3GYJ A;  3HYW A;  3T14 A;  1IJH A;  4B66 A;  3GDN A;  2WS3 A;  2Q0L A;  2BXR A;  1CF3 A;  2ZZB A;  2BC1 A;  4HA6 A;  2WET A;  3SFD A;  3AE6 A;  4NTD A;  4EIQ A;  1E1M A;  4AP3 A;  2Y6R A;  4YTN A;  2WP9 A;  2YVJ A;  4JDR A;  2WP6 A;  3GSI A;  4EMI A;  1PJ5 A;  4YSY A;  2WOV A;  3NTA A;  2XYO A;  2FJA A;  3UP5 A;  2XVE A;  1RSG A;  3VR8 A;  1M64 A;  5KMR A;  2VRL A;  4MJW A;  3PS9 A;  1Z6L A;  2C67 A;  2FBW A;  3UOX A;  4FK1 C;  4B63 A;  4Z2U A;  2PYX A;  4TLZ A;  1TDF A;  4II2 A;  2WEU A;  3LOV A;  2DKI A;  2WES A;  1GRE A;  4JY3 A;  1YY5 A;  2CDU A;  4M52 A;  1GET A;  2BK3 A;  3SX6 A;  1GOS A;  3IF9 A;  4LA1 A;  2BS2 A;  3C4N A;  1BWC A;  1OJC A;  4RG3 A;  3T2Z A;  2WOI A;  4G6H A;  2VQB A;  3UTG A;  1GT8 A;  4Y4N A;  3QSE A;  4KX6 A;  4KPR A;  5FS8 A;  1DOB A;  2GR2 A;  5U63 A;  5L46 A;  4J56 A;  2FJD A;  3CTY A;  4U8O A;  3FPZ A;  4APN A;  2ACZ A;  4YTM A;  3PO7 A;  3NN0 X;  3CPH G;  2AAQ A;  1LPF A;  3I6D A;  3NG7 X;  2BA9 A;  2WPC A;  3AWI A;  4U8M A;  2GQW A;  1LVL A;  1S2Y A;  3P4R A;  2OLN A;  3UOZ A;  3NTD A;  4DGK A;  4LU6 A;  1QO8 A;  2BAC A;  4GUV A;  2NPX A;  5M0Z A;  5GRT A;  2C3D A;  3QFA A;  1CL0 A;  2APG A;  2C70 A;  1Y56 B;  2VQ7 A;  3AD9 B;  1P2H A;  3UTF A;  4Z25 A;  3IHG A;  2WHD A;  2XVI A;  4XWZ A;  3RP7 A;  2I0Z A;  1ELI A;  3NGC X;  2C64 A;  1HYU A;  3F8P A;  4OPI A;  4BV6 A;  4U2T A;  5J60 A;  2V61 A;  4C5O A;  1OJD A;  2X50 A;  2GAG B;  5KVI A;  1D7L A;  2R9Z A;  2EQ6 A;  2XFN A;  2YVF A;  3AED A;  2OAL A;  3T31 A;  2XLP A;  3SM8 A;  1CJ2 A;  1PBB A;  1V59 A;  3C4A A;  1E7P A;  1YQZ A;  3D8X A;  3Q6J A; 
#chains in the Genus database with same CATH homology
 5M10 A;  4YSZ A;  4BK2 A;  5KXJ A;  1DJN A;  5BUL A;  3SYI A;  2BRA A;  4U8K A;  4JY2 A;  4UDP A;  4CRT A;  1DNC A;  1L9E A;  3II4 A;  3NK0 X;  1RP0 A;  2J3N A;  2JKC A;  1CHU A;  1CC2 A;  2RGJ A;  3G5S A;  4AT2 A;  2DKH A;  3UOY A;  3HYV A;  3EF6 A;  4FX9 A;  2QAE A;  4BJY A;  1DOE A;  1MXT A;  1XHC A;  4I58 A;  2Z5Y A;  3DA1 A;  2PHH A;  1TDN A;  1ZP0 A;  4TM4 A;  3UKQ A;  3BI5 A;  1FEC A;  4NTE A;  3UP4 A;  2GV8 A;  3GD3 A;  3UKF A;  2RAB A;  3WE0 A;  3CNP A;  3SGL A;  3BI4 A;  3CGB A;  3T2K A;  3UKL A;  4DNA A;  1JRZ A;  4OPU A;  4A79 A;  3NLC A;  2IVE A;  4U2S A;  4H4T A;  4DSG A;  3COX A;  3DH9 A;  4H4Y A;  2A87 A;  4U8P A;  4C77 A;  4A65 A;  2R46 A;  3T37 A;  3BHK A;  5BRT A;  4H4Z A;  2XVJ A;  1MO9 A;  2Q0K A;  4D04 A;  3F8D A;  2YAU A;  3NT6 A;  3NYC A;  1H7X A;  4G6G A;  3AD7 B;  3QVP A;  1GRH A;  2Z5X A;  5HHF A;  2B9X A;  1IUS A;  3SFE A;  3BNM A;  1PBE A;  3ICT A;  3NKS A;  1IUW A;  3CNJ A;  4H4Q A;  3V3O A;  4EMJ A;  3SZC A;  4CY8 A;  2GVC A;  5HY5 A;  2B9Y A;  1PHH A;  2X8G A;  2V60 A;  2VVL G;  2JK6 A;  1ZDL A;  2E5V A;  4A5L A;  1GRG A;  3NN6 X;  3LB8 A;  2XFQ A;  3CMM A;  1DOD A;  3SZW A;  2WQY A;  4CCQ A;  2BAB A;  2O9Z A;  1PXB A;  1OJ9 A;  3P1W A;  3LZW A;  1O94 A;  1L0V A;  4BJZ A;  3GYI A;  4USR A;  4OPL A;  4ICY A;  1KDG A;  3DK4 A;  1Y56 A;  2ZZC A;  2F5Z A;  3AE7 A;  1GND A;  3GDP A;  3LJP A;  1SEZ A;  4DSH A;  2WP5 A;  1O5W A;  4Y4M A;  5J7X A;  3ABV A;  3ATR A;  5KMQ A;  4A99 A;  2GB0 A;  4YSH A;  2A89 A;  3ITJ A;  3ICR A;  1GXF A;  5FS7 A;  3M0O A;  3L8K A;  4A9W A;  4IVO B;  4NZH A;  5C2T A;  2C72 A;  5FS9 A;  3CNS A;  2R0G A;  3C96 A;  4IVM B;  2WPE A;  3AEG A;  1M6I A;  1L9C A;  2X3N A;  3HYX A;  3KD9 A;  3UKK A;  1GER A;  4K5R A;  1BKW A;  4UDR A;  3RHA A;  3ALJ A;  4X9N A;  3CNT A;  1KF6 A;  1IUU A;  3GMC A;  2RGH A;  3K7M X;  3URH A;  5DBJ A;  1FEA A;  2TPR A;  2E1M A;  2X99 A;  2WU5 A;  3GWD A;  3FG2 P;  3DJJ A;  1O95 A;  3GRT A;  1BGN A;  3F8R A;  4JNQ A;  2YLZ A;  2YLS A;  2QA2 A;  1GAL A;  3AD8 B;  3RNM A;  2B7S A;  1E1N A;  5KMP A;  4EQS A;  3CGE A;  4NEV A;  4YXD A;  1JOA A;  2WPF A;  4Z2R A;  2YG4 A;  1K4Q A;  1PJ7 A;  1CBO A;  1QLB A;  3AB1 A;  3ZDN A;  1EL7 A;  1Y0P A;  4K5S A;  5KNL A;  1IUT A;  3NNE A;  1E39 A;  1H6V A;  3NRN A;  1GRT A;  2WOW A;  4H4S A;  3H4K A;  5U25 A;  3UKP A;  4EMW A;  4YKG A;  1XDI A;  4J34 A;  1PJ6 A;  3AYJ A;  3M13 A;  2X8H A;  2XLR A;  4OVI A;  3GWF A;  1GEU A;  3ALL A;  3UKA A;  4RSL A;  1ONF A;  3NH3 X;  3JSK A;  4A6N A;  4C3X A;  1K0L A;  1UKV G;  3IWA A;  5EOW A;  1BZL A;  3AE8 A;  3R9U A;  2WBA A;  2XVF A;  1NHP A;  3AEE A;  3QJ4 A;  1TDK A;  1P2E A;  1YQ3 A;  4CY6 A;  2C66 A;  4YSX A;  1N4W A;  2VOU A;  3O0H A;  5FS6 A;  1JNR A;  1FEB A;  4H7U A;  4G73 A;  4Z44 A;  2NVK X;  1JNZ A;  2XFP A;  4H4R A;  4UDQ A;  3SY4 A;  3SZF A;  2A8X A;  1H84 A;  1D4E A;  1LJ1 A;  3FMW A;  4IV9 A;  3FIM B;  4EIP A;  5JCM A;  4OCG A;  1GPE A;  3P4Q A;  1ZKQ A;  3NIX A;  3P4P A;  1GES A;  1L9D A;  2E4G A;  1FL2 A;  2VRM A;  4Z2T A;  2GEW A;  3G5R A;  5U1O A;  1VG0 A;  3DGH A;  1LQU A;  1CJ3 A;  2YG7 A;  2JB2 A;  2WU2 A;  1CC6 A;  1XPQ A;  1F8R A;  4U2L A;  1NHS A;  1TDE A;  3BNU A;  4J31 A;  1N4V A;  1NAA A;  2BCG G;  2R0C A;  1DJQ A;  4BK1 A;  1COY A;  4CNJ A;  2GMH A;  3V76 A;  1GSN A;  3VRA A;  3ADA B;  1VRQ B;  3S61 A;  4B69 A;  1GRF A;  1Q1W A;  4EQX A;  4EM4 A;  4Z43 A;  3NK2 X;  4GF7 A;  3AYL A;  4AOS A;  3E1T A;  2H88 A;  1Q1R A;  2ZBW A;  2IID A;  3AEC A;  3DK9 A;  5EB5 A;  2XCG A;  4OPG A;  4P9S A;  4OPC A;  1H82 A;  2QCU A;  2WDQ A;  4EM3 A;  3CND A;  2CVJ A;  5KRQ A;  2BC0 A;  2YQU A;  3KVE A;  3P9U A;  5IPY A;  4PAA A;  4B1B A;  3QVR A;  5KMS A;  1W4X A;  2BCP A;  3K7T A;  5HYM A;  4YKF A;  1CJC A;  4K7Z A;  3QSS A;  1D5T A;  1ZK7 A;  2GH5 A;  5GSN A;  2YM1 A;  2V3B A;  1RYI A;  4H4P A;  3KKJ A;  4GAV A;  1BGJ A;  2C65 A;  4H2R A;  3NHO X;  3LZX A;  4CCR A;  5BUK A;  3LAD A;  1EL5 A;  2OLO A;  2AQJ A;  2V6O A;  2BK4 A;  1K0I A;  2YG6 A;  2GQF A;  3NYE A;  2GAH B;  4YT0 A;  4II3 A;  4H4V A;  1F6M A;  4O5Q A;  1QJD A;  3UTH A;  4WCT A;  2RGO A;  2YR5 A;  1TYP A;  5JCN A;  2XDO A;  1NHR A;  2EQ8 A;  1PXC A;  3T2Y A;  2BRY A;  1JU2 A;  4OPT A;  4G74 A;  1LTX R;  1KFY A;  1PXA A;  3GRS A;  3FBS A;  4H2N A;  1PBD A;  2BXS A;  4EQW A;  4JQ9 A;  4H4U A;  2QA1 A;  5EB4 A;  2C7G A;  4LII A;  2AR8 A;  4Z24 A;  4B68 A;  2VZ2 A;  4GCM A;  5JCI A;  2YLT A;  4NWZ A;  1E1L A;  1S2Q A;  1N1P A;  2UZZ A;  2Q7V A;  2JB1 A;  2YVG A;  3IC9 A;  3AE3 A;  1BF3 A;  3CPJ G;  2YR6 A;  3CIR A;  3KPK A;  3UOV A;  1H7W A;  1S3B A;  1ZY8 A;  3ZYX A;  3UTE A;  2CFY A;  1H83 A;  1VG9 A;  4O5U A;  4B67 A;  4B65 A;  4G9K A;  3AXB A;  4USQ A;  2C76 A;  2C75 A;  2XLT A;  3OC4 A;  4H4X A;  5EBK A;  2EQ7 A;  3RED A;  2ARD A;  1H81 A;  2YLR A;  2V3A A;  1FOH A;  2C4C A;  3AE1 A;  4EQR A;  3B6D A;  4TM3 A;  4U8N A;  2B7R A;  4AOX A;  3M12 A;  3AEA A;  1PDH A;  2BK5 A;  1F8W A;  3BHF A;  3B3R A;  1NG3 A;  3VRD B;  5ER0 A;  3Q9T A;  2YM2 A;  3RP8 A;  5CKU A;  2BYB A;  4IA5 A;  4U8L A;  1B5Q A;  1OJA A;  2BS3 A;  3IHM A;  2WDV A;  3CGC A;  4J2W A;  1NDA A;  1TRB A;  5KWF A;  2GR3 A;  1GRA A;  3AE2 A;  3EAO A;  1D7Y A;  4CBQ A;  4ADW A;  3DJG X;  4J33 A;  4K2X A;  4FDC B;  4TLX A;  4C74 A;  1ZMC A;  1ZOY A;  2C73 A;  1PN0 A;  3ATQ A;  2GR1 A;  4U8I A;  4XXG A;  2YG5 A;  4H2P A;  1IUV A;  1DXL A;  3AE4 A;  1EBD A;  2VVL A;  4C3Y A;  1REO A;  5HXI A;  4H2Q A;  4XWR A;  2R0P A;  1S3E A;  2B9W A;  5KOX A;  4PAB A;  4REK A;  4NEW A;  2XFU A;  2B76 A;  4D03 A;  5C3J A;  1ZX9 A;  3RP6 A;  2XFO A;  1LQT A;  3NYF A;  3VR9 A;  4JNA A;  1JEH A;  3V3N A;  1K0J A;  2OA1 A;  1TYT A;  1VDC A;  4WX1 A;  4GRT A;  3DME A;  1EL8 A;  5IQ4 A;  4GAP A;  1B37 A;  1E6E A;  2GRT A;  1GRB A;  1NEK A;  1X31 B;  2Q6U A;  4UP3 A;  2X8C A;  4Y4L A;  3AYI A;  4BK3 A;  1KSS A;  3S5W A;  4GR1 A;  1MOK A;  2CUL A;  3UCL A;  5LV9 A;  4NTC A;  3AEF A;  3NK1 X;  1F8S A;  3DJD A;  4J57 A;  2XLS A;  2FJE A;  3QSM A;  4IA6 A;  4ECH A;  1OJT A;  1FCD A;  3GYX A;  1JRX A;  3ISH A;  1GTH A;  4U8J A;  3OZ2 A;  1Q9I A;  3KA7 A;  1CJ4 A;  2WDR A;  4I59 A;  1EL9 A;  3I3L A;  4J36 A;  5CQF A;  3QFB A;  2C3C A;  4GDP A;  4AT0 A;  2JBV A;  2BS4 A;  2Y6Q A;  4E0V A;  4B64 A;  3GMB A;  4ZCC A;  2W0H A;  3KPF A;  1PBF A;  2XVH A;  1YKJ A;  3SZ0 A;  2HQM A;  3BI2 A;  2ZZ0 A;  4RG4 A;  3HZL A;  2R4E A;  1JRY A;  1NHQ A;  1B4V A;  1H86 A;  1KNP A;  1E1K A;  1N4U A;  4Z26 A;  4NNJ A;  3ICS A;  4K22 A;  4K8D A;  2H89 A;  3KLJ A;  2OAM A;  4ZN0 A;  2IVD A;  3G5Q A;  3SXI A;  3DGZ A;  3UKH A;  1D4C A;  1D4D A;  3KU9 A;  2JAE A;  4H50 A;  5KOW A;  3T0K A;  2R4J A;  2FJB A;  3CGD A;  3GD4 A;  4A7A A;  3ALM A;  5TR3 A;  5FMH A;  3K7Q X;  3P4S A;  3EAN A;  4YTP A;  3L1R A;  4H4W A;  4X4J A;  3VQR A;  2YR4 A;  1F3P A;  3SQP A;  5KVH A;  4A6N B;  1YQ4 A;  3H8L A;  4JN9 A;  1PBC A;  4OPD A;  1IUX A;  4TM0 A;  3DJE A;  2R45 A;  4ZCD A;  1GV4 A;  2EQ9 A;  4FK1 A;  2V5Z A;  4GDE A;  1B8S A;  1NPX A;  4YWO A;  2GF3 A;  1TDO A;  3VRB A;  1AOG A;  1NG4 A;  3K30 A;  4AP1 A;  1XAN A;  4X9M A;  1KSU A;  2XLU A;  1ZOV A;  2GMJ A;  3CPI G;  1CC4 A;  5IQ1 A;  3DK8 A;  2YLX A;  1KNR A;  5BVA A;  3CN8 A;  3AE9 A;  1ZMD A;  4CNK A;  4BUR A;  3D1C A;  1LV0 A;  3AE5 A;  2JB3 A;  1VQW A;  2YLW A;  3LXD A;  4TM1 A;  1DOC A;  2YWL A;  3EPT A;  2VVM A;  2YG3 A;  5JCL A;  1PS9 A;  4HB9 A;  3H8I A;  5JCK A;  1GTE A;  4N9X A;  2GR0 A;  1NEN A;  3AEB A;  2TMD A;  3PVC A;  3GYJ A;  3HYW A;  3T14 A;  1IJH A;  4B66 A;  3GDN A;  2WS3 A;  2Q0L A;  2BXR A;  1CF3 A;  2ZZB A;  2BC1 A;  4HA6 A;  2WET A;  3SFD A;  3AE6 A;  4NTD A;  4EIQ A;  1E1M A;  4AP3 A;  2Y6R A;  4YTN A;  2WP9 A;  2YVJ A;  4JDR A;  2WP6 A;  3GSI A;  4EMI A;  1PJ5 A;  4YSY A;  2WOV A;  3NTA A;  2XYO A;  2FJA A;  3UP5 A;  2XVE A;  1RSG A;  3VR8 A;  1M64 A;  5KMR A;  2VRL A;  4MJW A;  3PS9 A;  1Z6L A;  2C67 A;  2FBW A;  3UOX A;  4FK1 C;  4B63 A;  4Z2U A;  2PYX A;  4TLZ A;  1TDF A;  4II2 A;  2WEU A;  3LOV A;  2DKI A;  2WES A;  1GRE A;  4JY3 A;  1YY5 A;  2CDU A;  4M52 A;  1GET A;  2BK3 A;  3SX6 A;  1GOS A;  3IF9 A;  4LA1 A;  2BS2 A;  3C4N A;  1BWC A;  1OJC A;  4RG3 A;  3T2Z A;  2WOI A;  4G6H A;  2VQB A;  3UTG A;  1GT8 A;  4Y4N A;  3QSE A;  4KX6 A;  4KPR A;  5FS8 A;  1DOB A;  2GR2 A;  5U63 A;  5L46 A;  4J56 A;  2FJD A;  3CTY A;  4U8O A;  3FPZ A;  4APN A;  2ACZ A;  4YTM A;  3PO7 A;  3NN0 X;  3CPH G;  2AAQ A;  1LPF A;  3I6D A;  3NG7 X;  2BA9 A;  2WPC A;  3AWI A;  4U8M A;  2GQW A;  1LVL A;  1S2Y A;  3P4R A;  2OLN A;  3UOZ A;  3NTD A;  4DGK A;  4LU6 A;  1QO8 A;  2BAC A;  4GUV A;  2NPX A;  5M0Z A;  5GRT A;  2C3D A;  3QFA A;  1CL0 A;  2APG A;  2C70 A;  1Y56 B;  2VQ7 A;  3AD9 B;  1P2H A;  3UTF A;  4Z25 A;  3IHG A;  2WHD A;  2XVI A;  4XWZ A;  3RP7 A;  2I0Z A;  1ELI A;  3NGC X;  2C64 A;  1HYU A;  3F8P A;  4OPI A;  4BV6 A;  4U2T A;  5J60 A;  2V61 A;  4C5O A;  1OJD A;  2X50 A;  2GAG B;  5KVI A;  1D7L A;  2R9Z A;  2EQ6 A;  2XFN A;  2YVF A;  3AED A;  2OAL A;  3T31 A;  2XLP A;  3SM8 A;  1CJ2 A;  1PBB A;  1V59 A;  3C4A A;  1E7P A;  1YQZ A;  3D8X A;  3Q6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...