2Q7WA

Structural studies reveals the inactivation of e. coli l-aspartate aminotransferase (s)-4,5-amino-dihydro-2-thiophenecarboxylic acid (sadta) via two mechanisms at ph 6.0
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
395
structure length
376
Chain Sequence
FENITAAPAKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Inactivation of Escherichia coli l-Aspartate Aminotransferase by (S)-4-Amino-4,5-dihydro-2-thiophenecarboxylic Acid Reveals "A Tale of Two Mechanisms".
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 141
structure length 376
sequence length 395
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2q7wA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2q7wA01
4WLJA 1KMJA 1ZOBA 3A9ZA 1JG8A 2VMYA 3FKDA 4IXOA 4XK1A 2W7KA 4IY7A 4F5JA 4GE4A 4ZM3A 3EZ1A 1AIBA 4L0OA 1AHGA 3DXWA 3E2YA 3I4JA 4P3MA 4ZWVA 4Y0HA 2VLFA 3BWOA 2AY7A 1WYTB 3ASBA 4W1VA 1ELUA 2QMAA 2WK7A 3AEMA 5EIGB 3FVSA 1AJRA 3NDNA 1BJOA 1RV3A 3AENB 3GZDA 4WYFA 5F8VA 3W1IA 5HHYA 3L44A 2CSTA 2CJHA 2VGVA 4U2HA 1ASDA 2FNUA 2W7GA 5DB5A 3W1HA 1AJSB 3M5UA 4ZM4A 1BJ4A 3AV7A 1J04A 2R2NA 3VK2A 2PB2A 4A0GA 1QJ3A 1WYVB 3K28A 3FZ7A 1G7XA 1N8PA 3P6KA 1I29A 1ASAA 2EGYA 1ASMA 4XJMA 5FT8A 4DGTA 4ZAHA 5BJ4A 4WBTA 5E3KA 3HVYA 3RBFA 2ORDA 4OC9A 3A2BA 2WK8A 4MQPA 5M4DA 2ZY2A 2GSAA 4XAUA 5DJ9A 4M2KA 3BWNA 4MY5A 4ADEA 5EAVA 1AKBA 4PFFA 5EUEA 2CJGA 4M2JA 3QM2A 4FFCA 4E77A 1GEYA 1OHVA 3B1DA 3PPLA 4UHMA 3W1JA 1WKGA 3E77A 4ITGA 4P7YA 4LC3A 3G8MA 1KKJA 2C7TA 5BJ3A 1OHYA 4ZSWA 5FT6A 2W7LA 1SF2A 2VMZA 3MC6C 3TCMA 2D5YA 1WYTA 3GETA 1LC8A 2VMTA 4GDYA 2Z9VA 1N31A 3A9XA 2AY4A 3BCAA 1TOGA 4OMAA 3WCNA 5G4JA 2HUFA 4A72A 2W8JA 4F5HA 4ADBA 3NYUA 3AENA 1KMKA 1DGDA 3NTJA 4GE9A 2AATA 3FSLA 2VIAA 3DXVA 1I48A 2BIEA 4ITXA 3EIAA 4RIZA 4AO4A 2D64A 4F5MA 1DJEA 2W7EA 4MKKA 4JEVA 4W5KA 3B1CA 2JJGA 1YJYA 2X5FA 4W1WA 3NX3A 3PD6B 1ASFA 2D66A 3ZZKA 1BT4A 4AO9A 2HUUA 4A6TA 3CQ4A 2E7JA 2QB3A 3BB8A 3OP7A 4Q76A 2HUIA 1AY8A 3B46A 1IJIA 3G0TA 4J8LA 3GR9A 3WGBA 4OBUA 3E9KA 2GQNA 3HBXA 3USFA 4F5LA 4M2MA 5M46A 5K8BA 3AOWA 1MAQA 4BQ0A 2OGEA 2OKJA 1JS6A 4K2IA 2AY1A 3NU8A 1D7SA 3ZZJA 2OGAA 3ELEA 1M32A 2ZSLA 4MQQA 2HZPA 3PDBA 4MGRA 2FQ6A 2Z9UA 1LC7A 4EMYA 1WKHA 2D7YA 1ASBA 4GSAA 1BS0A 1OXPA 1ZC9A 3AEJC 5E5IA 3G7QA 4UOYA 4Y0DA 4ATPA 5FT4A 5G2PA 2ZY5A 1GEXA 1U08A 3TATA 4IXSA 1AMSA 2VMVA 4QGRA 2HOZA 2DOUA 3PD6A 2W7HA 1TPLA 2EZ2A 1D7UA 3ATHA 1G4VA 1BJOB 1OXOA 2WK9A 4OTLA 1V2EA 2R0TA 2Z9WA 2BIAA 2VI9A 2VMQA 8AATA 2AY9A 1ARSA 2BIGA 2YKXA 1ASEA 3AEPA 2BWOA 3L8AA 1SZSA 2JG2A 4N0BA 5M49A 3NU7A 3GBXA 1QISA 3ZRRA 2W7FA 1M0OA 3H7FA 1S07A 3WKSA 1QIRA 4O6ZA 3VOMA 2V1PA 4Q6RA 1VEFA 2PB0A 3JTXA 5DJ1A 1QJ5A 3EIBA 2W8VA 3BS8A 3CBFA 1Z3ZA 1W3UA 1O69A 3NUBA 3QBOA 4ZDPA 2G6WA 2JISA 1AICA 3PGYA 3ZRPA 4GE7A 3UWCA 1GCKA 2W7DA 3BN1A 1W7LA 2NMPA 4OBVA 4F5GA 4ZWMA 1AAWA 1O61A 2D65A 2C44A 2EO5A 2GB3A 3GWPA 3N0LA 4RJ0A 5TF5A 3MADA 9AATA 1ELQA 4WP0A 1SZKA 3FDBA 4A6RA 2Z67A 1C7GA 3NRAA 4WXBA 3FQ7A 2CFBA 3RUYA 3I16A 4XQ2A 1CZEA 3AEMC 4WYGA 1KKPA 2D61A 1GBNA 1S06A 1W7NA 1Z7DA 4MSOA 4UQVA 3VAXA 3WGCA 1MDZA 1IBJA 5AX8A 1X29A 1GC0A 2PO3A 4B98A 1TOEA 2Z9XA 5G2QA 1AY5A 2Z20A 1GC4A 3PA9A 4W8IA 3GZCA 3JWBA 1IAYA 2BYLA 1Y4IA 4OT8A 1IUGA 4WYCA 1BW0A 3ASAA 1P3WA 4Q75A 2W7IA 3EZSA 3R9AA 1T3IA 2BI3A 1D7RA 2BYJA 2YKYA 2O7CA 3P1TA 3DU4A 4TMRA 1CQ6A 2VMOA 1OHWA 4N0WA 1MAPA 1DTYA 1LW5A 1DKAA 1RVUA 2JGTA 2OKKA 2VGTA 4F4EA 3HDOA 2BKWA 2HOYA 4B9BA 4LNLA 4EU1A 1AMRA 1KL1A 3RCHB 5M4BA 2V0YA 3RBLA 5J8QA 2YHKA 3DRDA 4HVKA 3ECDA 3WLXA 1B5PA 2CH2A 4IXZA 4IYOA 3WKRA 2ZUKA 4XEWA 3T32A 3VK4A 3PDBB 4WXFA 1I43A 3A9YA 4XJOA 2W8WA 2QA3A 2VYCA 1V72A 2X5DA 4OCAA 5JAYA 2AY5A 2VGUA 4RKCA 1X2AA 3IHJA 1TOJA 4NOGA 3EI6A 1ASLA 1J32A 5LHAA 2E7IA 2EH6A 3UAKA 5F9SA 2VMXA 1UU0A 1DJUA 2ZY4A 1C7OA 1O4SA 4HF8A 5EQCA 4JEWA 1CL1A 3EI9A 4Q31A 3E6GA 5G4IA 1C9CA 3FFHA 4MKJA 1ASNA 3CQ6A 1JS3A 1EQBA 1N2TA 3JW9A 4OYTA 3BV0A 1AAMA 4GRXA 2O0RA 1BKGA 1B4XA 3FD0A 2DR1A 4DQ6A 2EPJA 2JJHA 2AEVA 2AEUA 4WB0B 3NYSA 1UU1A 3RCHA 1CS1A 3N5MA 3QGUA 4WYEA 1W7MA 3FQAA 2TPLA 4E1OA 1H1CA 1MLZA 1C7NA 3PAAA 2Z61A 4ZSYA 4EFFA 1M7YA 2VMRA 3JWAA 2VMPA 2VLHA 4AZKA 1GDEA 1SZUA 5DX5A 1ARGA 2BI2A 4Y0IA 1E5FA 1OATA 2VGZA 2HP1A 3DYDA 2D7ZA 4R2NA 2YCTA 1WSTA 2HORA 4DBCA 3FQ8A 3TFUA 1AIAA 3COGA 3CQ5A 2VGSA 1TOIA 2E54A 3FDDA 1AMAA 2RFVA 1B9IA 3VP6A 1RV4A 2DGMA 3Q8NA 3BCBA 4KXKA 2YRIA 3DR4A 4BMKA 4JE5D 2C0RA 3GSBA 4MQRA 4ZDLA 3OKSA 4ISYA 3EI8A 1LK9A 1ARTA 1ORDA 3LVLB 3PJ0A 3FZ6A 2JJFA 3DZZA 4LNJA 4PVFA 3HT4A 3LY1A 4CBSA 2GMSA 2FNIA 1DJ9A 2X8UA 4WB0A 1FG3A 1ASGA 7AATA 1ASCA 1D2FA 3LG0A 2R5EA 2AY3A 1PFFA 3II0A 2BWPA 2OQXA 4R8DA 1YIYA 1YOOA 3DODA 4J5UA 1SVVA 1PG8A 2CJDA 2DKBA 3TFTA 1MGVA 3KE3A 2AY8A 5EUNA 2YCNA 4LW2A 4A00A 2ZP7A 3NNKA 4WD2A 3RI6A 5D5SA 1SPAA 3DC1A 2XBNA 4IYOB 4JF1A 1AMQA 4ADCA 3K7YA 1AKAA 2CINA 2W7JA 4CXQA 3A8UX 3GZDC 3MAUA 4CBRA 1YJSA 2CH1A 1X0MA 1G7WA 1YJZA 3EI7A 3HLMA 1S08A 4JEYA 4F5FA 4UHOA 4GEBA 4IW7A 3UE8A 2Q7WA 3AELA 1CJ0A 4F5KA 1H0CA 4K2MA 4ADDA 3D6KA 3FFRA 3FCRA 3HMUA 1ECXA 1VJOA 2CTZA 3FVUA 4XJLA 3MKJA 1IX6A 2YRRA 4JE5A 4UHNA 3I5TA 3HQTA 1CQ7A 4BA4A 1M4NA 4RLGA 2VIBA 3BWNC 1RVYA 2ZY3A 4R5ZA 4IX8A 4LW4A 1EG5A 1S09A 5I92A 2HP2A 1BJWA 1M6SA 2BI1A 5C6UA 2W8TA 3ZRQA 4WLHA 3PDXA 1MLYA 2JJEA 2CANA 3QN6A 1IVRA 2ZC0A 4KAMA 3DR7A 1VP4A 1O62A 3ISLA 1IX8A 1IX7A 1KL2A 1I41A 4WXGA 2D63A 3E2ZA 2YCPA 2O1BA 2FYFA 3LWSA 5IWQA 3WY7A 1QGNA 3JU7A 4XJPA 1XEYA 1XI9A 1AY4A 3N75A 2QLRA 2Z1ZA 1WYUA 1MDOA 2CB1A 1PMMA 1C0NA 1ARIA 1QZ9A 3FRKA 4AH3A 2VMSA 1DGEA 1YNUA 1B9HA 2CY8A 1AHEA 3NYTA 3PIUA 4LNMA 3LVMA 2GMUA 4ZLVA 1AHYA 4A0HA 1FC4A 4CVQA 2VMWA 3H14A 3LVKA 3MC6A 1M0QA 2OATA 2ZYJA 4KYOA 3RQ1A 4CXRA 1V2FA 2C81A 5HXXA 2BHXA 4ATQA 3QHXA 4RM1A 2DGLA 2R5CB 5EIGA 1G4XA 5LH9A 2DGKA 3VK3A 4JEZA 1MDXA 2HOXA 4EB7A 4EB5A 1TATA 3JZLA 5G0AA 3K40A 1AJSA 4H51A 1AHXA 4AOAA 3NUIA 4BA5A 1BJNA 2VMUA 4E3QA 2AY6A 4WYAA 2VI8A 4ZDOA 3BCXA 4TN4A 2ZSMA 1WYVA 3ACZA 3R4TA 1LS3A 4JEXA 2VGWA 1W23A 1D7VA 2YKVA 2EZ1A 4K2BA 1ARHA 3WX9A 1S0AA 3EI5A 5G09A 3AATA 4AZJA 2FN6A 2X3LA 4JF0A 1FG7A 5EUDA 1QITA 1C4KA 2W7MA 4A0RA 1LKCA 3IF2A 4TV7A 1B5OA 3AEOA 2ZJGA 4RJYA 1UU2A 3EUCA 1GC3A 2WKAA 3KKIA 1GEWA 1LW4A 3KGXA 2FM1A 3FZ8A 3KGWA 3MAFB 5FT5A 4RITA 5HDMA 3WCOA 3LV2A 2BI5A 2BI9A 3E2FA 3F6TA 5E4ZA 1BQAA 5EAAA 2QB2A 1AKCA 2R5CA 4F5IA 1UKJA 3AOVA 5EFSA 2W8UA 1B8GA 3BC8A 1JF9A 1GC2A 3AEJA 1BQDA 1YIZA 1AHFA 2QBTA 3CAIA 3MEBA 3LVJA 3GJUA 4WYDA 1TASA 1M0NA 4RKDA 1PMOA 2BWNA 3FTBA 1DFOA 1GD9A 3ELPA 3QI6A 3MBBA 4W91A 4ZASA 4A0FA 3TQXA 2F8JA 2XH1A 4FL0A 4I8AA 4BHDA 4R5FA 3B8XA 4A6UA 1LC5A 4RAEA 1YAAA 3B1EA 1X28A 1CQ8A 2Z1YA 1V2DA 2YKUA 1AX4A 1E5EA 1EJIA 4E3RA 1CL2A 1IAXA 2VMNA 1CZCA 2E7UA 2DKJA 3E2ZB 4U1TA 3F9TA 2AY2A 1TARA 3FVXA 3MAFA 4W1XA 3HL2A 4PFNA 1ZODA 3WZFA 3F0HA 4PIWA 5D95A 1WYUB 3QPGA 1TOKA 1SFFA 1M0PA 2YOBA
chains in the Genus database with same CATH superfamily
4WLJA 1KMJA 1ZOBA 3A9ZA 1JG8A 2VMYA 3FKDA 4IXOA 4XK1A 2W7KA 4IY7A 4F5JA 4GE4A 4ZM3A 3EZ1A 1AIBA 4L0OA 1AHGA 3DXWA 3E2YA 3I4JA 4P3MA 4ZWVA 4Y0HA 2VLFA 3BWOA 2AY7A 1WYTB 3ASBA 4W1VA 1ELUA 2QMAA 2WK7A 3AEMA 5EIGB 3FVSA 1AJRA 3NDNA 1BJOA 1RV3A 3AENB 3GZDA 4WYFA 5F8VA 3W1IA 5HHYA 3L44A 2CSTA 2CJHA 2VGVA 4U2HA 1ASDA 2FNUA 2W7GA 5DB5A 3W1HA 1AJSB 3M5UA 4ZM4A 1BJ4A 3AV7A 3N7NA 1J04A 2R2NA 3VK2A 2PB2A 4A0GA 1KAFA 1QJ3A 1WYVB 3K28A 3FZ7A 1G7XA 1N8PA 3P6KA 1I29A 1ASAA 2EGYA 1ASMA 4XJMA 5FT8A 4DGTA 4ZAHA 5BJ4A 4WBTA 5E3KA 3HVYA 3RBFA 2ORDA 4OC9A 3A2BA 2WK8A 4MQPA 5M4DA 2ZY2A 2GSAA 4XAUA 5DJ9A 4M2KA 3BWNA 4MY5A 4ADEA 5EAVA 1AKBA 4PFFA 5EUEA 2CJGA 4M2JA 3QM2A 4FFCA 4E77A 1GEYA 1OHVA 3B1DA 3PPLA 4UHMA 3W1JA 1WKGA 3E77A 4ITGA 4P7YA 4LC3A 3G8MA 1KKJA 2C7TA 5BJ3A 1OHYA 4ZSWA 5FT6A 2W7LA 1SF2A 2VMZA 3MC6C 3TCMA 2D5YA 1WYTA 3GETA 1LC8A 2VMTA 4GDYA 2Z9VA 1N31A 3A9XA 2AY4A 3BCAA 1TOGA 4OMAA 3WCNA 5G4JA 2HUFA 4A72A 2W8JA 4F5HA 4ADBA 3NYUA 3AENA 1KMKA 1DGDA 3NTJA 4GE9A 2AATA 3FSLA 2VIAA 3DXVA 1I48A 2BIEA 4ITXA 3EIAA 4RIZA 4AO4A 2D64A 4F5MA 1DJEA 2W7EA 4MKKA 4JEVA 4W5KA 3B1CA 2JJGA 1YJYA 2X5FA 4W1WA 3NX3A 3PD6B 1ASFA 2D66A 3ZZKA 1BT4A 4AO9A 2HUUA 4A6TA 3CQ4A 2E7JA 2QB3A 3BB8A 3OP7A 4Q76A 2HUIA 1AY8A 3B46A 1IJIA 3G0TA 4J8LA 3GR9A 3WGBA 4OBUA 3E9KA 2GQNA 3HBXA 3USFA 4F5LA 4M2MA 5M46A 5K8BA 3AOWA 1MAQA 4BQ0A 2OGEA 2OKJA 1JS6A 4K2IA 2AY1A 3NU8A 1D7SA 3ZZJA 2OGAA 3ELEA 1M32A 2ZSLA 3N4XA 4MQQA 2HZPA 3PDBA 4MGRA 2FQ6A 2Z9UA 1LC7A 4EMYA 1WKHA 2D7YA 1ASBA 4GSAA 1BS0A 1OXPA 1ZC9A 3AEJC 5E5IA 3G7QA 4UOYA 4Y0DA 4ATPA 5FT4A 5G2PA 2ZY5A 1GEXA 1U08A 3TATA 4IXSA 1AMSA 2VMVA 4QGRA 2HOZA 2DOUA 3PD6A 2W7HA 1TPLA 2EZ2A 1D7UA 3ATHA 1G4VA 1BJOB 1OXOA 2WK9A 4OTLA 1V2EA 2R0TA 2Z9WA 2BIAA 2VI9A 2VMQA 8AATA 2AY9A 1ARSA 2BIGA 2YKXA 1ASEA 3AEPA 2BWOA 3L8AA 1SZSA 2JG2A 4N0BA 5M49A 3NU7A 3GBXA 1QISA 3ZRRA 2W7FA 1M0OA 3H7FA 1S07A 3WKSA 3H9XA 1QIRA 4O6ZA 3VOMA 2V1PA 4Q6RA 1VEFA 2PB0A 3JTXA 5DJ1A 1QJ5A 3EIBA 2W8VA 3BS8A 3CBFA 1Z3ZA 1W3UA 1O69A 3NUBA 3QBOA 4ZDPA 2G6WA 2JISA 1AICA 3PGYA 3ZRPA 4GE7A 3UWCA 1GCKA 2W7DA 3BN1A 1W7LA 2NMPA 4OBVA 4F5GA 4ZWMA 1AAWA 1O61A 2D65A 2C44A 2EO5A 2GB3A 3GWPA 3N0LA 4RJ0A 5TF5A 2FKIA 3MADA 9AATA 1ELQA 4WP0A 1SZKA 3FDBA 4A6RA 3N4SA 2Z67A 1C7GA 3NRAA 4WXBA 3FQ7A 2CFBA 3RUYA 3I16A 4XQ2A 1CZEA 3AEMC 4WYGA 1KKPA 2D61A 1GBNA 1S06A 1W7NA 1Z7DA 4MSOA 4UQVA 3VAXA 3WGCA 1MDZA 1IBJA 5AX8A 1X29A 1GC0A 2PO3A 4B98A 1TOEA 2Z9XA 5G2QA 1AY5A 2Z20A 1GC4A 3PA9A 4W8IA 3GZCA 3JWBA 1IAYA 2BYLA 1Y4IA 4OT8A 1IUGA 4WYCA 1BW0A 3ASAA 1P3WA 4Q75A 2W7IA 2KFPA 3EZSA 3R9AA 1T3IA 2BI3A 1D7RA 2BYJA 2YKYA 2O7CA 3P1TA 3DU4A 4TMRA 1CQ6A 2VMOA 1OHWA 4N0WA 1MAPA 1DTYA 1LW5A 1DKAA 1RVUA 2JGTA 2OKKA 2VGTA 4F4EA 3HDOA 2BKWA 2HOYA 4B9BA 4LNLA 4EU1A 1AMRA 1KL1A 3RCHB 5M4BA 2V0YA 3RBLA 5J8QA 2YHKA 3DRDA 4HVKA 3ECDA 3WLXA 1B5PA 2CH2A 4IXZA 4IYOA 3WKRA 2ZUKA 4XEWA 3T32A 3VK4A 3PDBB 4WXFA 1I43A 3A9YA 4XJOA 2W8WA 2QA3A 2VYCA 1V72A 2X5DA 4OCAA 5JAYA 2AY5A 2VGUA 4RKCA 1X2AA 3IHJA 1TOJA 4NOGA 3EI6A 1ASLA 1J32A 5LHAA 2E7IA 2EH6A 3UAKA 5F9SA 2VMXA 1UU0A 1DJUA 2ZY4A 1C7OA 1O4SA 4HF8A 5EQCA 4JEWA 1CL1A 3EI9A 4Q31A 3E6GA 5G4IA 1C9CA 3FFHA 4MKJA 1ASNA 3CQ6A 1JS3A 1EQBA 1N2TA 3JW9A 4OYTA 3BV0A 1AAMA 4GRXA 2O0RA 1BKGA 1B4XA 3FD0A 2DR1A 4DQ6A 2EPJA 2JJHA 2AEVA 2AEUA 4WB0B 3NYSA 1UU1A 3RCHA 1CS1A 3N5MA 3QGUA 4WYEA 1W7MA 3FQAA 2TPLA 4E1OA 1H1CA 1MLZA 1C7NA 3PAAA 2Z61A 4ZSYA 4EFFA 1M7YA 2VMRA 3JWAA 2VMPA 2VLHA 4AZKA 1GDEA 1SZUA 5DX5A 1ARGA 2BI2A 4Y0IA 1E5FA 1OATA 2VGZA 2HP1A 3DYDA 2D7ZA 4R2NA 2YCTA 1WSTA 2HORA 4DBCA 3FQ8A 3TFUA 1AIAA 3COGA 3CQ5A 2VGSA 1TOIA 2E54A 3FDDA 1AMAA 2RFVA 1B9IA 3VP6A 1RV4A 2DGMA 3Q8NA 3BCBA 4KXKA 2YRIA 3DR4A 4BMKA 4JE5D 2C0RA 3GSBA 4MQRA 4ZDLA 3OKSA 4ISYA 3EI8A 1LK9A 1ARTA 1ORDA 3LVLB 3PJ0A 3FZ6A 2JJFA 3DZZA 4LNJA 4PVFA 3HT4A 3LY1A 4CBSA 2GMSA 2FNIA 1DJ9A 2X8UA 4WB0A 1FG3A 1ASGA 7AATA 3N4RA 1ASCA 1D2FA 3LG0A 2R5EA 2AY3A 1PFFA 3II0A 2BWPA 2OQXA 4R8DA 1YIYA 1YOOA 3DODA 4J5UA 1SVVA 1PG8A 2CJDA 2DKBA 3TFTA 1MGVA 2EYQA 3KE3A 2AY8A 5EUNA 2YCNA 4LW2A 4A00A 2ZP7A 3NNKA 4WD2A 3RI6A 5D5SA 1SPAA 3DC1A 2XBNA 4IYOB 4JF1A 1AMQA 4ADCA 3K7YA 1AKAA 2CINA 2W7JA 4CXQA 3A8UX 3GZDC 3MAUA 4CBRA 1YJSA 2CH1A 1X0MA 1G7WA 1YJZA 3EI7A 3HLMA 1S08A 4JEYA 4F5FA 4UHOA 4GEBA 4IW7A 3UE8A 2Q7WA 3AELA 1CJ0A 4F5KA 1H0CA 4K2MA 4ADDA 3D6KA 3FFRA 3FCRA 3HMUA 1ECXA 1VJOA 2CTZA 3FVUA 4XJLA 3MKJA 1IX6A 2YRRA 4JE5A 4UHNA 3I5TA 3HQTA 1CQ7A 4BA4A 2A1VA 1M4NA 4RLGA 2VIBA 3BWNC 1RVYA 2ZY3A 4R5ZA 4IX8A 4LW4A 1EG5A 1S09A 5I92A 2HP2A 1BJWA 1M6SA 2BI1A 5C6UA 2W8TA 3ZRQA 4WLHA 3PDXA 1MLYA 2JJEA 2CANA 3QN6A 1IVRA 2ZC0A 4KAMA 3DR7A 1VP4A 1O62A 3ISLA 2WB6A 1IX8A 1IX7A 1KL2A 1I41A 4WXGA 2D63A 4K05A 3E2ZA 5KTBA 2YCPA 2O1BA 2FYFA 3LWSA 5IWQA 3WY7A 1QGNA 3JU7A 4XJPA 1XEYA 1XI9A 1AY4A 3N75A 2QLRA 2Z1ZA 1WYUA 1MDOA 2CB1A 1PMMA 1C0NA 1ARIA 1QZ9A 3FRKA 4AH3A 2VMSA 1DGEA 1YNUA 1B9HA 2CY8A 1AHEA 3NYTA 3PIUA 4LNMA 3LVMA 2GMUA 4ZLVA 1AHYA 4A0HA 1FC4A 4CVQA 2VMWA 2G7JA 3H14A 3LVKA 3MC6A 1M0QA 2OATA 2ZYJA 4KYOA 3RQ1A 4CXRA 1V2FA 2C81A 5HXXA 2BHXA 4ATQA 3QHXA 4RM1A 2DGLA 2R5CB 5EIGA 1G4XA 5LH9A 2DGKA 3VK3A 4JEZA 1MDXA 2HOXA 4EB7A 4EB5A 1TATA 3JZLA 5G0AA 3K40A 1AJSA 4H51A 1AHXA 4AOAA 3NUIA 4BA5A 1BJNA 2VMUA 4E3QA 2AY6A 4WYAA 2VI8A 4ZDOA 3BCXA 4TN4A 2ZSMA 1WYVA 3ACZA 3R4TA 1LS3A 4JEXA 2VGWA 1W23A 1D7VA 2YKVA 2EZ1A 4K2BA 1ARHA 3WX9A 1S0AA 3EI5A 5G09A 3AATA 4AZJA 2FN6A 2X3LA 4JF0A 1FG7A 5EUDA 1QITA 1C4KA 2W7MA 4A0RA 1LKCA 3IF2A 4TV7A 1B5OA 3AEOA 2ZJGA 4RJYA 1UU2A 3EUCA 1GC3A 2WKAA 3KKIA 1GEWA 1LW4A 3KGXA 2FM1A 3FZ8A 3KGWA 3MAFB 5FT5A 4RITA 5HDMA 3WCOA 3LV2A 2BI5A 2BI9A 3E2FA 3F6TA 5E4ZA 1BQAA 5EAAA 2QB2A 1AKCA 2R5CA 4F5IA 1UKJA 3AOVA 5EFSA 2W8UA 1B8GA 3BC8A 4H63Q 1JF9A 1GC2A 3AEJA 1BQDA 1YIZA 1AHFA 2QSRA 2QBTA 3CAIA 3MEBA 3LVJA 3GJUA 4WYDA 1TASA 1M0NA 4RKDA 1PMOA 2BWNA 3FTBA 1DFOA 1GD9A 3ELPA 3QI6A 3MBBA 4W91A 4ZASA 4A0FA 3TQXA 2F8JA 2XH1A 4FL0A 4I8AA 4BHDA 4R5FA 3B8XA 4A6UA 1LC5A 4RAEA 1YAAA 3B1EA 1X28A 1CQ8A 2Z1YA 1V2DA 2YKUA 1AX4A 1E5EA 1EJIA 4E3RA 1CL2A 1IAXA 2VMNA 1CZCA 2E7UA 2DKJA 3E2ZB 4U1TA 3F9TA 2AY2A 1TARA 3FVXA 3MAFA 4W1XA 3HL2A 4PFNA 1ZODA 3WZFA 3F0HA 4PIWA 5D95A 1WYUB 3QPGA 1TOKA 1SFFA 1M0PA 2YOBA
chains in the Genus database with same CATH topology
4WLJA 1KMJA 1ZOBA 3A9ZA 1JG8A 2VMYA 3FKDA 4IXOA 4XK1A 2W7KA 4IY7A 4F5JA 4GE4A 4ZM3A 3EZ1A 1AIBA 4L0OA 1AHGA 3DXWA 3E2YA 3I4JA 4P3MA 4ZWVA 4Y0HA 2VLFA 3BWOA 2AY7A 1WYTB 3ASBA 4W1VA 1ELUA 2QMAA 2WK7A 3AEMA 5EIGB 3FVSA 1AJRA 3NDNA 1BJOA 1RV3A 3AENB 3GZDA 4WYFA 5F8VA 3W1IA 5HHYA 3L44A 2CSTA 2CJHA 2VGVA 4U2HA 1ASDA 2FNUA 2W7GA 5DB5A 3W1HA 1AJSB 3M5UA 4ZM4A 1BJ4A 3AV7A 3N7NA 1J04A 2R2NA 3VK2A 2PB2A 4A0GA 1QJ3A 1WYVB 3K28A 3FZ7A 1G7XA 1N8PA 3P6KA 1I29A 1ASAA 2EGYA 1ASMA 4XJMA 5FT8A 4DGTA 4ZAHA 5BJ4A 4WBTA 5E3KA 3HVYA 3RBFA 2ORDA 4OC9A 3A2BA 2WK8A 4MQPA 5M4DA 2ZY2A 2GSAA 4XAUA 5DJ9A 4M2KA 3BWNA 4MY5A 4ADEA 5EAVA 1AKBA 4PFFA 5EUEA 2CJGA 4M2JA 3QM2A 4FFCA 4E77A 1GEYA 1OHVA 3B1DA 3PPLA 4UHMA 3W1JA 1WKGA 3E77A 4ITGA 4P7YA 4LC3A 3G8MA 1KKJA 2C7TA 5BJ3A 1OHYA 4ZSWA 5FT6A 2W7LA 1SF2A 2VMZA 3MC6C 3TCMA 2D5YA 1WYTA 3GETA 1LC8A 2VMTA 4GDYA 2Z9VA 1N31A 3A9XA 2AY4A 3BCAA 1TOGA 4OMAA 3WCNA 5G4JA 2HUFA 4A72A 2W8JA 4F5HA 4ADBA 3NYUA 3AENA 1KMKA 1DGDA 3NTJA 4GE9A 2AATA 3FSLA 2VIAA 3DXVA 1I48A 2BIEA 4ITXA 3EIAA 4RIZA 4AO4A 2D64A 4F5MA 1DJEA 2W7EA 4MKKA 4JEVA 4W5KA 3B1CA 2JJGA 1YJYA 2X5FA 4W1WA 3NX3A 3PD6B 1ASFA 2D66A 3ZZKA 1BT4A 4AO9A 2HUUA 4A6TA 3CQ4A 2E7JA 2QB3A 3BB8A 3OP7A 4Q76A 2HUIA 1AY8A 3B46A 1IJIA 3G0TA 4J8LA 3GR9A 3WGBA 4OBUA 3E9KA 2GQNA 3HBXA 3USFA 4F5LA 4M2MA 5M46A 5K8BA 3AOWA 1MAQA 4BQ0A 2OGEA 2OKJA 1JS6A 4K2IA 2AY1A 3NU8A 1D7SA 3ZZJA 2OGAA 3ELEA 1M32A 2ZSLA 3N4XA 4MQQA 2HZPA 3PDBA 4MGRA 2FQ6A 2Z9UA 1LC7A 4EMYA 1WKHA 2D7YA 1ASBA 4GSAA 1BS0A 1OXPA 1ZC9A 3AEJC 5E5IA 3G7QA 4UOYA 4Y0DA 4ATPA 5FT4A 5G2PA 2ZY5A 1GEXA 1U08A 3TATA 4IXSA 1AMSA 2VMVA 4QGRA 2HOZA 2DOUA 3PD6A 2W7HA 1TPLA 2EZ2A 1D7UA 3ATHA 1G4VA 1BJOB 1OXOA 2WK9A 4OTLA 1V2EA 2R0TA 2Z9WA 2BIAA 2VI9A 2VMQA 8AATA 2AY9A 1ARSA 2BIGA 2YKXA 1ASEA 3AEPA 2BWOA 3L8AA 1SZSA 2JG2A 4N0BA 5M49A 3NU7A 3GBXA 1QISA 3ZRRA 2W7FA 1M0OA 3H7FA 1S07A 3WKSA 3H9XA 1QIRA 4O6ZA 3VOMA 2V1PA 4Q6RA 1VEFA 2PB0A 3JTXA 5DJ1A 1QJ5A 3EIBA 2W8VA 3BS8A 3CBFA 1Z3ZA 1W3UA 1O69A 3NUBA 3QBOA 4ZDPA 2G6WA 2JISA 1AICA 3PGYA 3ZRPA 4GE7A 3UWCA 1GCKA 2W7DA 3BN1A 1W7LA 2NMPA 4OBVA 4F5GA 4ZWMA 1AAWA 1O61A 2D65A 2C44A 2EO5A 2GB3A 3GWPA 3N0LA 4RJ0A 5TF5A 2FKIA 3MADA 9AATA 1ELQA 4WP0A 1SZKA 3FDBA 4A6RA 3N4SA 2Z67A 1C7GA 3NRAA 4WXBA 3FQ7A 2CFBA 3RUYA 3I16A 4XQ2A 1CZEA 3AEMC 4WYGA 1KKPA 2D61A 1GBNA 1S06A 1W7NA 1Z7DA 4MSOA 4UQVA 3VAXA 3WGCA 1MDZA 1IBJA 5AX8A 1X29A 1GC0A 2PO3A 4B98A 1TOEA 2Z9XA 5G2QA 1AY5A 2Z20A 1GC4A 3PA9A 4W8IA 3GZCA 3JWBA 1IAYA 2BYLA 1Y4IA 4OT8A 1IUGA 4WYCA 1BW0A 3ASAA 1P3WA 4Q75A 2W7IA 2KFPA 3EZSA 3R9AA 1T3IA 2BI3A 1D7RA 2BYJA 2YKYA 2O7CA 3P1TA 3DU4A 4TMRA 1CQ6A 2VMOA 1OHWA 4N0WA 1MAPA 1DTYA 1LW5A 1DKAA 1RVUA 2JGTA 2OKKA 2VGTA 4F4EA 3HDOA 2BKWA 2HOYA 4B9BA 4LNLA 4EU1A 1AMRA 1KL1A 3RCHB 5M4BA 2V0YA 3RBLA 5J8QA 2YHKA 3DRDA 4HVKA 3ECDA 3WLXA 1B5PA 2CH2A 4IXZA 4IYOA 3WKRA 2ZUKA 4XEWA 3T32A 3VK4A 3PDBB 4WXFA 1I43A 3A9YA 4XJOA 2W8WA 2QA3A 2VYCA 1V72A 2X5DA 4OCAA 5JAYA 2AY5A 2VGUA 4RKCA 1X2AA 3IHJA 1TOJA 4NOGA 3EI6A 1ASLA 1J32A 5LHAA 2E7IA 2EH6A 3UAKA 5F9SA 2VMXA 1UU0A 1DJUA 2ZY4A 1C7OA 1O4SA 4HF8A 5EQCA 4JEWA 1CL1A 3EI9A 4Q31A 3E6GA 5G4IA 1C9CA 3FFHA 4MKJA 1ASNA 3CQ6A 1JS3A 1EQBA 1N2TA 3JW9A 4OYTA 3BV0A 1AAMA 4GRXA 2O0RA 1BKGA 1B4XA 3FD0A 2DR1A 4DQ6A 2EPJA 2JJHA 2AEVA 2AEUA 4WB0B 3NYSA 1UU1A 3RCHA 1CS1A 3N5MA 3QGUA 4WYEA 1W7MA 3FQAA 2TPLA 4E1OA 1H1CA 1MLZA 1C7NA 3PAAA 2Z61A 4ZSYA 4EFFA 1M7YA 2VMRA 3JWAA 2VMPA 2VLHA 4AZKA 1GDEA 1SZUA 5DX5A 1ARGA 2BI2A 4Y0IA 1E5FA 1OATA 2VGZA 2HP1A 3DYDA 2D7ZA 4R2NA 2YCTA 1WSTA 2HORA 4DBCA 3FQ8A 3TFUA 1AIAA 3COGA 3CQ5A 2VGSA 1TOIA 2E54A 3FDDA 1AMAA 2RFVA 1B9IA 3VP6A 1RV4A 2DGMA 3Q8NA 3BCBA 4KXKA 2YRIA 3DR4A 4BMKA 4JE5D 2C0RA 3GSBA 4MQRA 4ZDLA 3OKSA 4ISYA 3EI8A 1LK9A 1ARTA 1ORDA 3LVLB 3PJ0A 3FZ6A 2JJFA 3DZZA 4LNJA 4PVFA 3HT4A 3LY1A 4CBSA 2GMSA 2FNIA 1DJ9A 2X8UA 4WB0A 1FG3A 1ASGA 7AATA 3N4RA 1ASCA 1D2FA 3LG0A 2R5EA 2AY3A 1PFFA 3II0A 2BWPA 2OQXA 4R8DA 1YIYA 1YOOA 3DODA 4J5UA 1SVVA 1PG8A 2CJDA 2DKBA 3TFTA 1MGVA 2EYQA 3KE3A 2AY8A 5EUNA 2YCNA 4LW2A 4A00A 2ZP7A 3NNKA 4WD2A 3RI6A 5D5SA 1SPAA 3DC1A 2XBNA 4IYOB 4JF1A 1AMQA 4ADCA 3K7YA 1AKAA 2CINA 2W7JA 4CXQA 3A8UX 3GZDC 3MAUA 4CBRA 1YJSA 2CH1A 1X0MA 1G7WA 1YJZA 3EI7A 3HLMA 1S08A 4JEYA 4F5FA 4UHOA 4GEBA 4IW7A 3UE8A 2Q7WA 3AELA 1CJ0A 4F5KA 1H0CA 4K2MA 4ADDA 3D6KA 3FFRA 3FCRA 3HMUA 1ECXA 1VJOA 2CTZA 3FVUA 4XJLA 3MKJA 1IX6A 2YRRA 4JE5A 4UHNA 3I5TA 3HQTA 1CQ7A 4BA4A 2A1VA 1M4NA 4RLGA 2VIBA 3BWNC 1RVYA 2ZY3A 4R5ZA 4IX8A 4LW4A 1EG5A 1S09A 5I92A 2HP2A 1BJWA 1M6SA 2BI1A 5C6UA 2W8TA 3ZRQA 4WLHA 3PDXA 1MLYA 2JJEA 2CANA 3QN6A 1IVRA 2ZC0A 4KAMA 3DR7A 1VP4A 1O62A 3ISLA 2WB6A 1IX8A 1IX7A 1KL2A 1I41A 4WXGA 2D63A 4K05A 3E2ZA 5KTBA 2YCPA 2O1BA 2FYFA 3LWSA 5IWQA 3WY7A 1QGNA 3JU7A 4XJPA 1XEYA 1XI9A 1AY4A 3N75A 2QLRA 2Z1ZA 1WYUA 1MDOA 2CB1A 1PMMA 1C0NA 1ARIA 1QZ9A 3FRKA 4AH3A 2VMSA 1DGEA 1YNUA 1B9HA 2CY8A 1AHEA 3NYTA 3PIUA 4LNMA 3LVMA 2GMUA 4ZLVA 1AHYA 4A0HA 1FC4A 4CVQA 2VMWA 2G7JA 3H14A 3LVKA 3MC6A 1M0QA 2OATA 2ZYJA 4KYOA 3RQ1A 4CXRA 1V2FA 2C81A 5HXXA 2BHXA 4ATQA 3QHXA 4RM1A 2DGLA 2R5CB 5EIGA 1G4XA 5LH9A 2DGKA 3VK3A 4JEZA 1MDXA 2HOXA 4EB7A 4EB5A 1TATA 3JZLA 5G0AA 3K40A 1AJSA 4H51A 1AHXA 4AOAA 3NUIA 4BA5A 1BJNA 2VMUA 4E3QA 2AY6A 4WYAA 2VI8A 4ZDOA 3BCXA 4TN4A 2ZSMA 1WYVA 3ACZA 3R4TA 1LS3A 4JEXA 2VGWA 1W23A 1D7VA 2YKVA 2EZ1A 4K2BA 1ARHA 3WX9A 1S0AA 3EI5A 5G09A 3AATA 4AZJA 2FN6A 2X3LA 4JF0A 1FG7A 5EUDA 1QITA 1C4KA 2W7MA 4A0RA 1LKCA 3IF2A 4TV7A 1B5OA 3AEOA 2ZJGA 4RJYA 1UU2A 3EUCA 1GC3A 2WKAA 3KKIA 1GEWA 1LW4A 3KGXA 2FM1A 3FZ8A 3KGWA 3MAFB 5FT5A 4RITA 5HDMA 3WCOA 3LV2A 2BI5A 2BI9A 3E2FA 3F6TA 5E4ZA 1BQAA 5EAAA 2QB2A 1AKCA 2R5CA 4F5IA 1UKJA 3AOVA 5EFSA 2W8UA 1B8GA 3BC8A 4H63Q 1JF9A 1GC2A 3AEJA 1BQDA 1YIZA 1AHFA 2QSRA 2QBTA 3CAIA 3MEBA 3LVJA 3GJUA 4WYDA 1TASA 1M0NA 4RKDA 1PMOA 2BWNA 3FTBA 1DFOA 1GD9A 3ELPA 3QI6A 3MBBA 4W91A 4ZASA 4A0FA 3TQXA 2F8JA 2XH1A 4FL0A 4I8AA 4BHDA 4R5FA 3B8XA 4A6UA 1LC5A 4RAEA 1YAAA 3B1EA 1X28A 1CQ8A 2Z1YA 1V2DA 2YKUA 1AX4A 1E5EA 1EJIA 4E3RA 1CL2A 1IAXA 2VMNA 1CZCA 2E7UA 2DKJA 3E2ZB 4U1TA 3F9TA 2AY2A 1TARA 3FVXA 3MAFA 4W1XA 3HL2A 4PFNA 1ZODA 3WZFA 3F0HA 4PIWA 5D95A 1WYUB 3QPGA 1TOKA 1SFFA 1M0PA 2YOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WLJ A;  1KMJ A;  1ZOB A;  3A9Z A;  1JG8 A;  2VMY A;  3FKD A;  4IXO A;  4XK1 A;  2W7K A;  4IY7 A;  4F5J A;  4GE4 A;  4ZM3 A;  3EZ1 A;  1AIB A;  4L0O A;  1AHG A;  3DXW A;  3E2Y A;  3I4J A;  4P3M A;  4ZWV A;  4Y0H A;  2VLF A;  3BWO A;  2AY7 A;  1WYT B;  3ASB A;  4W1V A;  1ELU A;  2QMA A;  2WK7 A;  3AEM A;  5EIG B;  3FVS A;  1AJR A;  3NDN A;  1BJO A;  1RV3 A;  3AEN B;  3GZD A;  4WYF A;  5F8V A;  3W1I A;  5HHY A;  3L44 A;  2CST A;  2CJH A;  2VGV A;  4U2H A;  1ASD A;  2FNU A;  2W7G A;  5DB5 A;  3W1H A;  1AJS B;  3M5U A;  4ZM4 A;  1BJ4 A;  3AV7 A;  1J04 A;  2R2N A;  3VK2 A;  2PB2 A;  4A0G A;  1QJ3 A;  1WYV B;  3K28 A;  3FZ7 A;  1G7X A;  1N8P A;  3P6K A;  1I29 A;  1ASA A;  2EGY A;  1ASM A;  4XJM A;  5FT8 A;  4DGT A;  4ZAH A;  5BJ4 A;  4WBT A;  5E3K A;  3HVY A;  3RBF A;  2ORD A;  4OC9 A;  3A2B A;  2WK8 A;  4MQP A;  5M4D A;  2ZY2 A;  2GSA A;  4XAU A;  5DJ9 A;  4M2K A;  3BWN A;  4MY5 A;  4ADE A;  5EAV A;  1AKB A;  4PFF A;  5EUE A;  2CJG A;  4M2J A;  3QM2 A;  4FFC A;  4E77 A;  1GEY A;  1OHV A;  3B1D A;  3PPL A;  4UHM A;  3W1J A;  1WKG A;  3E77 A;  4ITG A;  4P7Y A;  4LC3 A;  3G8M A;  1KKJ A;  2C7T A;  5BJ3 A;  1OHY A;  4ZSW A;  5FT6 A;  2W7L A;  1SF2 A;  2VMZ A;  3MC6 C;  3TCM A;  2D5Y A;  1WYT A;  3GET A;  1LC8 A;  2VMT A;  4GDY A;  2Z9V A;  1N31 A;  3A9X A;  2AY4 A;  3BCA A;  1TOG A;  4OMA A;  3WCN A;  5G4J A;  2HUF A;  4A72 A;  2W8J A;  4F5H A;  4ADB A;  3NYU A;  3AEN A;  1KMK A;  1DGD A;  3NTJ A;  4GE9 A;  2AAT A;  3FSL A;  2VIA A;  3DXV A;  1I48 A;  2BIE A;  4ITX A;  3EIA A;  4RIZ A;  4AO4 A;  2D64 A;  4F5M A;  1DJE A;  2W7E A;  4MKK A;  4JEV A;  4W5K A;  3B1C A;  2JJG A;  1YJY A;  2X5F A;  4W1W A;  3NX3 A;  3PD6 B;  1ASF A;  2D66 A;  3ZZK A;  1BT4 A;  4AO9 A;  2HUU A;  4A6T A;  3CQ4 A;  2E7J A;  2QB3 A;  3BB8 A;  3OP7 A;  4Q76 A;  2HUI A;  1AY8 A;  3B46 A;  1IJI A;  3G0T A;  4J8L A;  3GR9 A;  3WGB A;  4OBU A;  3E9K A;  2GQN A;  3HBX A;  3USF A;  4F5L A;  4M2M A;  5M46 A;  5K8B A;  3AOW A;  1MAQ A;  4BQ0 A;  2OGE A;  2OKJ A;  1JS6 A;  4K2I A;  2AY1 A;  3NU8 A;  1D7S A;  3ZZJ A;  2OGA A;  3ELE A;  1M32 A;  2ZSL A;  4MQQ A;  2HZP A;  3PDB A;  4MGR A;  2FQ6 A;  2Z9U A;  1LC7 A;  4EMY A;  1WKH A;  2D7Y A;  1ASB A;  4GSA A;  1BS0 A;  1OXP A;  1ZC9 A;  3AEJ C;  5E5I A;  3G7Q A;  4UOY A;  4Y0D A;  4ATP A;  5FT4 A;  5G2P A;  2ZY5 A;  1GEX A;  1U08 A;  3TAT A;  4IXS A;  1AMS A;  2VMV A;  4QGR A;  2HOZ A;  2DOU A;  3PD6 A;  2W7H A;  1TPL A;  2EZ2 A;  1D7U A;  3ATH A;  1G4V A;  1BJO B;  1OXO A;  2WK9 A;  4OTL A;  1V2E A;  2R0T A;  2Z9W A;  2BIA A;  2VI9 A;  2VMQ A;  8AAT A;  2AY9 A;  1ARS A;  2BIG A;  2YKX A;  1ASE A;  3AEP A;  2BWO A;  3L8A A;  1SZS A;  2JG2 A;  4N0B A;  5M49 A;  3NU7 A;  3GBX A;  1QIS A;  3ZRR A;  2W7F A;  1M0O A;  3H7F A;  1S07 A;  3WKS A;  1QIR A;  4O6Z A;  3VOM A;  2V1P A;  4Q6R A;  1VEF A;  2PB0 A;  3JTX A;  5DJ1 A;  1QJ5 A;  3EIB A;  2W8V A;  3BS8 A;  3CBF A;  1Z3Z A;  1W3U A;  1O69 A;  3NUB A;  3QBO A;  4ZDP A;  2G6W A;  2JIS A;  1AIC A;  3PGY A;  3ZRP A;  4GE7 A;  3UWC A;  1GCK A;  2W7D A;  3BN1 A;  1W7L A;  2NMP A;  4OBV A;  4F5G A;  4ZWM A;  1AAW A;  1O61 A;  2D65 A;  2C44 A;  2EO5 A;  2GB3 A;  3GWP A;  3N0L A;  4RJ0 A;  5TF5 A;  3MAD A;  9AAT A;  1ELQ A;  4WP0 A;  1SZK A;  3FDB A;  4A6R A;  2Z67 A;  1C7G A;  3NRA A;  4WXB A;  3FQ7 A;  2CFB A;  3RUY A;  3I16 A;  4XQ2 A;  1CZE A;  3AEM C;  4WYG A;  1KKP A;  2D61 A;  1GBN A;  1S06 A;  1W7N A;  1Z7D A;  4MSO A;  4UQV A;  3VAX A;  3WGC A;  1MDZ A;  1IBJ A;  5AX8 A;  1X29 A;  1GC0 A;  2PO3 A;  4B98 A;  1TOE A;  2Z9X A;  5G2Q A;  1AY5 A;  2Z20 A;  1GC4 A;  3PA9 A;  4W8I A;  3GZC A;  3JWB A;  1IAY A;  2BYL A;  1Y4I A;  4OT8 A;  1IUG A;  4WYC A;  1BW0 A;  3ASA A;  1P3W A;  4Q75 A;  2W7I A;  3EZS A;  3R9A A;  1T3I A;  2BI3 A;  1D7R A;  2BYJ A;  2YKY A;  2O7C A;  3P1T A;  3DU4 A;  4TMR A;  1CQ6 A;  2VMO A;  1OHW A;  4N0W A;  1MAP A;  1DTY A;  1LW5 A;  1DKA A;  1RVU A;  2JGT A;  2OKK A;  2VGT A;  4F4E A;  3HDO A;  2BKW A;  2HOY A;  4B9B A;  4LNL A;  4EU1 A;  1AMR A;  1KL1 A;  3RCH B;  5M4B A;  2V0Y A;  3RBL A;  5J8Q A;  2YHK A;  3DRD A;  4HVK A;  3ECD A;  3WLX A;  1B5P A;  2CH2 A;  4IXZ A;  4IYO A;  3WKR A;  2ZUK A;  4XEW A;  3T32 A;  3VK4 A;  3PDB B;  4WXF A;  1I43 A;  3A9Y A;  4XJO A;  2W8W A;  2QA3 A;  2VYC A;  1V72 A;  2X5D A;  4OCA A;  5JAY A;  2AY5 A;  2VGU A;  4RKC A;  1X2A A;  3IHJ A;  1TOJ A;  4NOG A;  3EI6 A;  1ASL A;  1J32 A;  5LHA A;  2E7I A;  2EH6 A;  3UAK A;  5F9S A;  2VMX A;  1UU0 A;  1DJU A;  2ZY4 A;  1C7O A;  1O4S A;  4HF8 A;  5EQC A;  4JEW A;  1CL1 A;  3EI9 A;  4Q31 A;  3E6G A;  5G4I A;  1C9C A;  3FFH A;  4MKJ A;  1ASN A;  3CQ6 A;  1JS3 A;  1EQB A;  1N2T A;  3JW9 A;  4OYT A;  3BV0 A;  1AAM A;  4GRX A;  2O0R A;  1BKG A;  1B4X A;  3FD0 A;  2DR1 A;  4DQ6 A;  2EPJ A;  2JJH A;  2AEV A;  2AEU A;  4WB0 B;  3NYS A;  1UU1 A;  3RCH A;  1CS1 A;  3N5M A;  3QGU A;  4WYE A;  1W7M A;  3FQA A;  2TPL A;  4E1O A;  1H1C A;  1MLZ A;  1C7N A;  3PAA A;  2Z61 A;  4ZSY A;  4EFF A;  1M7Y A;  2VMR A;  3JWA A;  2VMP A;  2VLH A;  4AZK A;  1GDE A;  1SZU A;  5DX5 A;  1ARG A;  2BI2 A;  4Y0I A;  1E5F A;  1OAT A;  2VGZ A;  2HP1 A;  3DYD A;  2D7Z A;  4R2N A;  2YCT A;  1WST A;  2HOR A;  4DBC A;  3FQ8 A;  3TFU A;  1AIA A;  3COG A;  3CQ5 A;  2VGS A;  1TOI A;  2E54 A;  3FDD A;  1AMA A;  2RFV A;  1B9I A;  3VP6 A;  1RV4 A;  2DGM A;  3Q8N A;  3BCB A;  4KXK A;  2YRI A;  3DR4 A;  4BMK A;  4JE5 D;  2C0R A;  3GSB A;  4MQR A;  4ZDL A;  3OKS A;  4ISY A;  3EI8 A;  1LK9 A;  1ART A;  1ORD A;  3LVL B;  3PJ0 A;  3FZ6 A;  2JJF A;  3DZZ A;  4LNJ A;  4PVF A;  3HT4 A;  3LY1 A;  4CBS A;  2GMS A;  2FNI A;  1DJ9 A;  2X8U A;  4WB0 A;  1FG3 A;  1ASG A;  7AAT A;  1ASC A;  1D2F A;  3LG0 A;  2R5E A;  2AY3 A;  1PFF A;  3II0 A;  2BWP A;  2OQX A;  4R8D A;  1YIY A;  1YOO A;  3DOD A;  4J5U A;  1SVV A;  1PG8 A;  2CJD A;  2DKB A;  3TFT A;  1MGV A;  3KE3 A;  2AY8 A;  5EUN A;  2YCN A;  4LW2 A;  4A00 A;  2ZP7 A;  3NNK A;  4WD2 A;  3RI6 A;  5D5S A;  1SPA A;  3DC1 A;  2XBN A;  4IYO B;  4JF1 A;  1AMQ A;  4ADC A;  3K7Y A;  1AKA A;  2CIN A;  2W7J A;  4CXQ A;  3A8U X;  3GZD C;  3MAU A;  4CBR A;  1YJS A;  2CH1 A;  1X0M A;  1G7W A;  1YJZ A;  3EI7 A;  3HLM A;  1S08 A;  4JEY A;  4F5F A;  4UHO A;  4GEB A;  4IW7 A;  3UE8 A;  2Q7W A;  3AEL A;  1CJ0 A;  4F5K A;  1H0C A;  4K2M A;  4ADD A;  3D6K A;  3FFR A;  3FCR A;  3HMU A;  1ECX A;  1VJO A;  2CTZ A;  3FVU A;  4XJL A;  3MKJ A;  1IX6 A;  2YRR A;  4JE5 A;  4UHN A;  3I5T A;  3HQT A;  1CQ7 A;  4BA4 A;  1M4N A;  4RLG A;  2VIB A;  3BWN C;  1RVY A;  2ZY3 A;  4R5Z A;  4IX8 A;  4LW4 A;  1EG5 A;  1S09 A;  5I92 A;  2HP2 A;  1BJW A;  1M6S A;  2BI1 A;  5C6U A;  2W8T A;  3ZRQ A;  4WLH A;  3PDX A;  1MLY A;  2JJE A;  2CAN A;  3QN6 A;  1IVR A;  2ZC0 A;  4KAM A;  3DR7 A;  1VP4 A;  1O62 A;  3ISL A;  1IX8 A;  1IX7 A;  1KL2 A;  1I41 A;  4WXG A;  2D63 A;  3E2Z A;  2YCP A;  2O1B A;  2FYF A;  3LWS A;  5IWQ A;  3WY7 A;  1QGN A;  3JU7 A;  4XJP A;  1XEY A;  1XI9 A;  1AY4 A;  3N75 A;  2QLR A;  2Z1Z A;  1WYU A;  1MDO A;  2CB1 A;  1PMM A;  1C0N A;  1ARI A;  1QZ9 A;  3FRK A;  4AH3 A;  2VMS A;  1DGE A;  1YNU A;  1B9H A;  2CY8 A;  1AHE A;  3NYT A;  3PIU A;  4LNM A;  3LVM A;  2GMU A;  4ZLV A;  1AHY A;  4A0H A;  1FC4 A;  4CVQ A;  2VMW A;  3H14 A;  3LVK A;  3MC6 A;  1M0Q A;  2OAT A;  2ZYJ A;  4KYO A;  3RQ1 A;  4CXR A;  1V2F A;  2C81 A;  5HXX A;  2BHX A;  4ATQ A;  3QHX A;  4RM1 A;  2DGL A;  2R5C B;  5EIG A;  1G4X A;  5LH9 A;  2DGK A;  3VK3 A;  4JEZ A;  1MDX A;  2HOX A;  4EB7 A;  4EB5 A;  1TAT A;  3JZL A;  5G0A A;  3K40 A;  1AJS A;  4H51 A;  1AHX A;  4AOA A;  3NUI A;  4BA5 A;  1BJN A;  2VMU A;  4E3Q A;  2AY6 A;  4WYA A;  2VI8 A;  4ZDO A;  3BCX A;  4TN4 A;  2ZSM A;  1WYV A;  3ACZ A;  3R4T A;  1LS3 A;  4JEX A;  2VGW A;  1W23 A;  1D7V A;  2YKV A;  2EZ1 A;  4K2B A;  1ARH A;  3WX9 A;  1S0A A;  3EI5 A;  5G09 A;  3AAT A;  4AZJ A;  2FN6 A;  2X3L A;  4JF0 A;  1FG7 A;  5EUD A;  1QIT A;  1C4K A;  2W7M A;  4A0R A;  1LKC A;  3IF2 A;  4TV7 A;  1B5O A;  3AEO A;  2ZJG A;  4RJY A;  1UU2 A;  3EUC A;  1GC3 A;  2WKA A;  3KKI A;  1GEW A;  1LW4 A;  3KGX A;  2FM1 A;  3FZ8 A;  3KGW A;  3MAF B;  5FT5 A;  4RIT A;  5HDM A;  3WCO A;  3LV2 A;  2BI5 A;  2BI9 A;  3E2F A;  3F6T A;  5E4Z A;  1BQA A;  5EAA A;  2QB2 A;  1AKC A;  2R5C A;  4F5I A;  1UKJ A;  3AOV A;  5EFS A;  2W8U A;  1B8G A;  3BC8 A;  1JF9 A;  1GC2 A;  3AEJ A;  1BQD A;  1YIZ A;  1AHF A;  2QBT A;  3CAI A;  3MEB A;  3LVJ A;  3GJU A;  4WYD A;  1TAS A;  1M0N A;  4RKD A;  1PMO A;  2BWN A;  3FTB A;  1DFO A;  1GD9 A;  3ELP A;  3QI6 A;  3MBB A;  4W91 A;  4ZAS A;  4A0F A;  3TQX A;  2F8J A;  2XH1 A;  4FL0 A;  4I8A A;  4BHD A;  4R5F A;  3B8X A;  4A6U A;  1LC5 A;  4RAE A;  1YAA A;  3B1E A;  1X28 A;  1CQ8 A;  2Z1Y A;  1V2D A;  2YKU A;  1AX4 A;  1E5E A;  1EJI A;  4E3R A;  1CL2 A;  1IAX A;  2VMN A;  1CZC A;  2E7U A;  2DKJ A;  3E2Z B;  4U1T A;  3F9T A;  2AY2 A;  1TAR A;  3FVX A;  3MAF A;  4W1X A;  3HL2 A;  4PFN A;  1ZOD A;  3WZF A;  3F0H A;  4PIW A;  5D95 A;  1WYU B;  3QPG A;  1TOK A;  1SFF A;  1M0P A;  2YOB A; 
#chains in the Genus database with same CATH topology
 4WLJ A;  1KMJ A;  1ZOB A;  3A9Z A;  1JG8 A;  2VMY A;  3FKD A;  4IXO A;  4XK1 A;  2W7K A;  4IY7 A;  4F5J A;  4GE4 A;  4ZM3 A;  3EZ1 A;  1AIB A;  4L0O A;  1AHG A;  3DXW A;  3E2Y A;  3I4J A;  4P3M A;  4ZWV A;  4Y0H A;  2VLF A;  3BWO A;  2AY7 A;  1WYT B;  3ASB A;  4W1V A;  1ELU A;  2QMA A;  2WK7 A;  3AEM A;  5EIG B;  3FVS A;  1AJR A;  3NDN A;  1BJO A;  1RV3 A;  3AEN B;  3GZD A;  4WYF A;  5F8V A;  3W1I A;  5HHY A;  3L44 A;  2CST A;  2CJH A;  2VGV A;  4U2H A;  1ASD A;  2FNU A;  2W7G A;  5DB5 A;  3W1H A;  1AJS B;  3M5U A;  4ZM4 A;  1BJ4 A;  3AV7 A;  3N7N A;  1J04 A;  2R2N A;  3VK2 A;  2PB2 A;  4A0G A;  1KAF A;  1QJ3 A;  1WYV B;  3K28 A;  3FZ7 A;  1G7X A;  1N8P A;  3P6K A;  1I29 A;  1ASA A;  2EGY A;  1ASM A;  4XJM A;  5FT8 A;  4DGT A;  4ZAH A;  5BJ4 A;  4WBT A;  5E3K A;  3HVY A;  3RBF A;  2ORD A;  4OC9 A;  3A2B A;  2WK8 A;  4MQP A;  5M4D A;  2ZY2 A;  2GSA A;  4XAU A;  5DJ9 A;  4M2K A;  3BWN A;  4MY5 A;  4ADE A;  5EAV A;  1AKB A;  4PFF A;  5EUE A;  2CJG A;  4M2J A;  3QM2 A;  4FFC A;  4E77 A;  1GEY A;  1OHV A;  3B1D A;  3PPL A;  4UHM A;  3W1J A;  1WKG A;  3E77 A;  4ITG A;  4P7Y A;  4LC3 A;  3G8M A;  1KKJ A;  2C7T A;  5BJ3 A;  1OHY A;  4ZSW A;  5FT6 A;  2W7L A;  1SF2 A;  2VMZ A;  3MC6 C;  3TCM A;  2D5Y A;  1WYT A;  3GET A;  1LC8 A;  2VMT A;  4GDY A;  2Z9V A;  1N31 A;  3A9X A;  2AY4 A;  3BCA A;  1TOG A;  4OMA A;  3WCN A;  5G4J A;  2HUF A;  4A72 A;  2W8J A;  4F5H A;  4ADB A;  3NYU A;  3AEN A;  1KMK A;  1DGD A;  3NTJ A;  4GE9 A;  2AAT A;  3FSL A;  2VIA A;  3DXV A;  1I48 A;  2BIE A;  4ITX A;  3EIA A;  4RIZ A;  4AO4 A;  2D64 A;  4F5M A;  1DJE A;  2W7E A;  4MKK A;  4JEV A;  4W5K A;  3B1C A;  2JJG A;  1YJY A;  2X5F A;  4W1W A;  3NX3 A;  3PD6 B;  1ASF A;  2D66 A;  3ZZK A;  1BT4 A;  4AO9 A;  2HUU A;  4A6T A;  3CQ4 A;  2E7J A;  2QB3 A;  3BB8 A;  3OP7 A;  4Q76 A;  2HUI A;  1AY8 A;  3B46 A;  1IJI A;  3G0T A;  4J8L A;  3GR9 A;  3WGB A;  4OBU A;  3E9K A;  2GQN A;  3HBX A;  3USF A;  4F5L A;  4M2M A;  5M46 A;  5K8B A;  3AOW A;  1MAQ A;  4BQ0 A;  2OGE A;  2OKJ A;  1JS6 A;  4K2I A;  2AY1 A;  3NU8 A;  1D7S A;  3ZZJ A;  2OGA A;  3ELE A;  1M32 A;  2ZSL A;  3N4X A;  4MQQ A;  2HZP A;  3PDB A;  4MGR A;  2FQ6 A;  2Z9U A;  1LC7 A;  4EMY A;  1WKH A;  2D7Y A;  1ASB A;  4GSA A;  1BS0 A;  1OXP A;  1ZC9 A;  3AEJ C;  5E5I A;  3G7Q A;  4UOY A;  4Y0D A;  4ATP A;  5FT4 A;  5G2P A;  2ZY5 A;  1GEX A;  1U08 A;  3TAT A;  4IXS A;  1AMS A;  2VMV A;  4QGR A;  2HOZ A;  2DOU A;  3PD6 A;  2W7H A;  1TPL A;  2EZ2 A;  1D7U A;  3ATH A;  1G4V A;  1BJO B;  1OXO A;  2WK9 A;  4OTL A;  1V2E A;  2R0T A;  2Z9W A;  2BIA A;  2VI9 A;  2VMQ A;  8AAT A;  2AY9 A;  1ARS A;  2BIG A;  2YKX A;  1ASE A;  3AEP A;  2BWO A;  3L8A A;  1SZS A;  2JG2 A;  4N0B A;  5M49 A;  3NU7 A;  3GBX A;  1QIS A;  3ZRR A;  2W7F A;  1M0O A;  3H7F A;  1S07 A;  3WKS A;  3H9X A;  1QIR A;  4O6Z A;  3VOM A;  2V1P A;  4Q6R A;  1VEF A;  2PB0 A;  3JTX A;  5DJ1 A;  1QJ5 A;  3EIB A;  2W8V A;  3BS8 A;  3CBF A;  1Z3Z A;  1W3U A;  1O69 A;  3NUB A;  3QBO A;  4ZDP A;  2G6W A;  2JIS A;  1AIC A;  3PGY A;  3ZRP A;  4GE7 A;  3UWC A;  1GCK A;  2W7D A;  3BN1 A;  1W7L A;  2NMP A;  4OBV A;  4F5G A;  4ZWM A;  1AAW A;  1O61 A;  2D65 A;  2C44 A;  2EO5 A;  2GB3 A;  3GWP A;  3N0L A;  4RJ0 A;  5TF5 A;  2FKI A;  3MAD A;  9AAT A;  1ELQ A;  4WP0 A;  1SZK A;  3FDB A;  4A6R A;  3N4S A;  2Z67 A;  1C7G A;  3NRA A;  4WXB A;  3FQ7 A;  2CFB A;  3RUY A;  3I16 A;  4XQ2 A;  1CZE A;  3AEM C;  4WYG A;  1KKP A;  2D61 A;  1GBN A;  1S06 A;  1W7N A;  1Z7D A;  4MSO A;  4UQV A;  3VAX A;  3WGC A;  1MDZ A;  1IBJ A;  5AX8 A;  1X29 A;  1GC0 A;  2PO3 A;  4B98 A;  1TOE A;  2Z9X A;  5G2Q A;  1AY5 A;  2Z20 A;  1GC4 A;  3PA9 A;  4W8I A;  3GZC A;  3JWB A;  1IAY A;  2BYL A;  1Y4I A;  4OT8 A;  1IUG A;  4WYC A;  1BW0 A;  3ASA A;  1P3W A;  4Q75 A;  2W7I A;  2KFP A;  3EZS A;  3R9A A;  1T3I A;  2BI3 A;  1D7R A;  2BYJ A;  2YKY A;  2O7C A;  3P1T A;  3DU4 A;  4TMR A;  1CQ6 A;  2VMO A;  1OHW A;  4N0W A;  1MAP A;  1DTY A;  1LW5 A;  1DKA A;  1RVU A;  2JGT A;  2OKK A;  2VGT A;  4F4E A;  3HDO A;  2BKW A;  2HOY A;  4B9B A;  4LNL A;  4EU1 A;  1AMR A;  1KL1 A;  3RCH B;  5M4B A;  2V0Y A;  3RBL A;  5J8Q A;  2YHK A;  3DRD A;  4HVK A;  3ECD A;  3WLX A;  1B5P A;  2CH2 A;  4IXZ A;  4IYO A;  3WKR A;  2ZUK A;  4XEW A;  3T32 A;  3VK4 A;  3PDB B;  4WXF A;  1I43 A;  3A9Y A;  4XJO A;  2W8W A;  2QA3 A;  2VYC A;  1V72 A;  2X5D A;  4OCA A;  5JAY A;  2AY5 A;  2VGU A;  4RKC A;  1X2A A;  3IHJ A;  1TOJ A;  4NOG A;  3EI6 A;  1ASL A;  1J32 A;  5LHA A;  2E7I A;  2EH6 A;  3UAK A;  5F9S A;  2VMX A;  1UU0 A;  1DJU A;  2ZY4 A;  1C7O A;  1O4S A;  4HF8 A;  5EQC A;  4JEW A;  1CL1 A;  3EI9 A;  4Q31 A;  3E6G A;  5G4I A;  1C9C A;  3FFH A;  4MKJ A;  1ASN A;  3CQ6 A;  1JS3 A;  1EQB A;  1N2T A;  3JW9 A;  4OYT A;  3BV0 A;  1AAM A;  4GRX A;  2O0R A;  1BKG A;  1B4X A;  3FD0 A;  2DR1 A;  4DQ6 A;  2EPJ A;  2JJH A;  2AEV A;  2AEU A;  4WB0 B;  3NYS A;  1UU1 A;  3RCH A;  1CS1 A;  3N5M A;  3QGU A;  4WYE A;  1W7M A;  3FQA A;  2TPL A;  4E1O A;  1H1C A;  1MLZ A;  1C7N A;  3PAA A;  2Z61 A;  4ZSY A;  4EFF A;  1M7Y A;  2VMR A;  3JWA A;  2VMP A;  2VLH A;  4AZK A;  1GDE A;  1SZU A;  5DX5 A;  1ARG A;  2BI2 A;  4Y0I A;  1E5F A;  1OAT A;  2VGZ A;  2HP1 A;  3DYD A;  2D7Z A;  4R2N A;  2YCT A;  1WST A;  2HOR A;  4DBC A;  3FQ8 A;  3TFU A;  1AIA A;  3COG A;  3CQ5 A;  2VGS A;  1TOI A;  2E54 A;  3FDD A;  1AMA A;  2RFV A;  1B9I A;  3VP6 A;  1RV4 A;  2DGM A;  3Q8N A;  3BCB A;  4KXK A;  2YRI A;  3DR4 A;  4BMK A;  4JE5 D;  2C0R A;  3GSB A;  4MQR A;  4ZDL A;  3OKS A;  4ISY A;  3EI8 A;  1LK9 A;  1ART A;  1ORD A;  3LVL B;  3PJ0 A;  3FZ6 A;  2JJF A;  3DZZ A;  4LNJ A;  4PVF A;  3HT4 A;  3LY1 A;  4CBS A;  2GMS A;  2FNI A;  1DJ9 A;  2X8U A;  4WB0 A;  1FG3 A;  1ASG A;  7AAT A;  3N4R A;  1ASC A;  1D2F A;  3LG0 A;  2R5E A;  2AY3 A;  1PFF A;  3II0 A;  2BWP A;  2OQX A;  4R8D A;  1YIY A;  1YOO A;  3DOD A;  4J5U A;  1SVV A;  1PG8 A;  2CJD A;  2DKB A;  3TFT A;  1MGV A;  2EYQ A;  3KE3 A;  2AY8 A;  5EUN A;  2YCN A;  4LW2 A;  4A00 A;  2ZP7 A;  3NNK A;  4WD2 A;  3RI6 A;  5D5S A;  1SPA A;  3DC1 A;  2XBN A;  4IYO B;  4JF1 A;  1AMQ A;  4ADC A;  3K7Y A;  1AKA A;  2CIN A;  2W7J A;  4CXQ A;  3A8U X;  3GZD C;  3MAU A;  4CBR A;  1YJS A;  2CH1 A;  1X0M A;  1G7W A;  1YJZ A;  3EI7 A;  3HLM A;  1S08 A;  4JEY A;  4F5F A;  4UHO A;  4GEB A;  4IW7 A;  3UE8 A;  2Q7W A;  3AEL A;  1CJ0 A;  4F5K A;  1H0C A;  4K2M A;  4ADD A;  3D6K A;  3FFR A;  3FCR A;  3HMU A;  1ECX A;  1VJO A;  2CTZ A;  3FVU A;  4XJL A;  3MKJ A;  1IX6 A;  2YRR A;  4JE5 A;  4UHN A;  3I5T A;  3HQT A;  1CQ7 A;  4BA4 A;  2A1V A;  1M4N A;  4RLG A;  2VIB A;  3BWN C;  1RVY A;  2ZY3 A;  4R5Z A;  4IX8 A;  4LW4 A;  1EG5 A;  1S09 A;  5I92 A;  2HP2 A;  1BJW A;  1M6S A;  2BI1 A;  5C6U A;  2W8T A;  3ZRQ A;  4WLH A;  3PDX A;  1MLY A;  2JJE A;  2CAN A;  3QN6 A;  1IVR A;  2ZC0 A;  4KAM A;  3DR7 A;  1VP4 A;  1O62 A;  3ISL A;  2WB6 A;  1IX8 A;  1IX7 A;  1KL2 A;  1I41 A;  4WXG A;  2D63 A;  4K05 A;  3E2Z A;  5KTB A;  2YCP A;  2O1B A;  2FYF A;  3LWS A;  5IWQ A;  3WY7 A;  1QGN A;  3JU7 A;  4XJP A;  1XEY A;  1XI9 A;  1AY4 A;  3N75 A;  2QLR A;  2Z1Z A;  1WYU A;  1MDO A;  2CB1 A;  1PMM A;  1C0N A;  1ARI A;  1QZ9 A;  3FRK A;  4AH3 A;  2VMS A;  1DGE A;  1YNU A;  1B9H A;  2CY8 A;  1AHE A;  3NYT A;  3PIU A;  4LNM A;  3LVM A;  2GMU A;  4ZLV A;  1AHY A;  4A0H A;  1FC4 A;  4CVQ A;  2VMW A;  2G7J A;  3H14 A;  3LVK A;  3MC6 A;  1M0Q A;  2OAT A;  2ZYJ A;  4KYO A;  3RQ1 A;  4CXR A;  1V2F A;  2C81 A;  5HXX A;  2BHX A;  4ATQ A;  3QHX A;  4RM1 A;  2DGL A;  2R5C B;  5EIG A;  1G4X A;  5LH9 A;  2DGK A;  3VK3 A;  4JEZ A;  1MDX A;  2HOX A;  4EB7 A;  4EB5 A;  1TAT A;  3JZL A;  5G0A A;  3K40 A;  1AJS A;  4H51 A;  1AHX A;  4AOA A;  3NUI A;  4BA5 A;  1BJN A;  2VMU A;  4E3Q A;  2AY6 A;  4WYA A;  2VI8 A;  4ZDO A;  3BCX A;  4TN4 A;  2ZSM A;  1WYV A;  3ACZ A;  3R4T A;  1LS3 A;  4JEX A;  2VGW A;  1W23 A;  1D7V A;  2YKV A;  2EZ1 A;  4K2B A;  1ARH A;  3WX9 A;  1S0A A;  3EI5 A;  5G09 A;  3AAT A;  4AZJ A;  2FN6 A;  2X3L A;  4JF0 A;  1FG7 A;  5EUD A;  1QIT A;  1C4K A;  2W7M A;  4A0R A;  1LKC A;  3IF2 A;  4TV7 A;  1B5O A;  3AEO A;  2ZJG A;  4RJY A;  1UU2 A;  3EUC A;  1GC3 A;  2WKA A;  3KKI A;  1GEW A;  1LW4 A;  3KGX A;  2FM1 A;  3FZ8 A;  3KGW A;  3MAF B;  5FT5 A;  4RIT A;  5HDM A;  3WCO A;  3LV2 A;  2BI5 A;  2BI9 A;  3E2F A;  3F6T A;  5E4Z A;  1BQA A;  5EAA A;  2QB2 A;  1AKC A;  2R5C A;  4F5I A;  1UKJ A;  3AOV A;  5EFS A;  2W8U A;  1B8G A;  3BC8 A;  4H63 Q;  1JF9 A;  1GC2 A;  3AEJ A;  1BQD A;  1YIZ A;  1AHF A;  2QSR A;  2QBT A;  3CAI A;  3MEB A;  3LVJ A;  3GJU A;  4WYD A;  1TAS A;  1M0N A;  4RKD A;  1PMO A;  2BWN A;  3FTB A;  1DFO A;  1GD9 A;  3ELP A;  3QI6 A;  3MBB A;  4W91 A;  4ZAS A;  4A0F A;  3TQX A;  2F8J A;  2XH1 A;  4FL0 A;  4I8A A;  4BHD A;  4R5F A;  3B8X A;  4A6U A;  1LC5 A;  4RAE A;  1YAA A;  3B1E A;  1X28 A;  1CQ8 A;  2Z1Y A;  1V2D A;  2YKU A;  1AX4 A;  1E5E A;  1EJI A;  4E3R A;  1CL2 A;  1IAX A;  2VMN A;  1CZC A;  2E7U A;  2DKJ A;  3E2Z B;  4U1T A;  3F9T A;  2AY2 A;  1TAR A;  3FVX A;  3MAF A;  4W1X A;  3HL2 A;  4PFN A;  1ZOD A;  3WZF A;  3F0H A;  4PIW A;  5D95 A;  1WYU B;  3QPG A;  1TOK A;  1SFF A;  1M0P A;  2YOB A; 
#chains in the Genus database with same CATH homology
 4WLJ A;  1KMJ A;  1ZOB A;  3A9Z A;  1JG8 A;  2VMY A;  3FKD A;  4IXO A;  4XK1 A;  2W7K A;  4IY7 A;  4F5J A;  4GE4 A;  4ZM3 A;  3EZ1 A;  1AIB A;  4L0O A;  1AHG A;  3DXW A;  3E2Y A;  3I4J A;  4P3M A;  4ZWV A;  4Y0H A;  2VLF A;  3BWO A;  2AY7 A;  1WYT B;  3ASB A;  4W1V A;  1ELU A;  2QMA A;  2WK7 A;  3AEM A;  5EIG B;  3FVS A;  1AJR A;  3NDN A;  1BJO A;  1RV3 A;  3AEN B;  3GZD A;  4WYF A;  5F8V A;  3W1I A;  5HHY A;  3L44 A;  2CST A;  2CJH A;  2VGV A;  4U2H A;  1ASD A;  2FNU A;  2W7G A;  5DB5 A;  3W1H A;  1AJS B;  3M5U A;  4ZM4 A;  1BJ4 A;  3AV7 A;  3N7N A;  1J04 A;  2R2N A;  3VK2 A;  2PB2 A;  4A0G A;  1QJ3 A;  1WYV B;  3K28 A;  3FZ7 A;  1G7X A;  1N8P A;  3P6K A;  1I29 A;  1ASA A;  2EGY A;  1ASM A;  4XJM A;  5FT8 A;  4DGT A;  4ZAH A;  5BJ4 A;  4WBT A;  5E3K A;  3HVY A;  3RBF A;  2ORD A;  4OC9 A;  3A2B A;  2WK8 A;  4MQP A;  5M4D A;  2ZY2 A;  2GSA A;  4XAU A;  5DJ9 A;  4M2K A;  3BWN A;  4MY5 A;  4ADE A;  5EAV A;  1AKB A;  4PFF A;  5EUE A;  2CJG A;  4M2J A;  3QM2 A;  4FFC A;  4E77 A;  1GEY A;  1OHV A;  3B1D A;  3PPL A;  4UHM A;  3W1J A;  1WKG A;  3E77 A;  4ITG A;  4P7Y A;  4LC3 A;  3G8M A;  1KKJ A;  2C7T A;  5BJ3 A;  1OHY A;  4ZSW A;  5FT6 A;  2W7L A;  1SF2 A;  2VMZ A;  3MC6 C;  3TCM A;  2D5Y A;  1WYT A;  3GET A;  1LC8 A;  2VMT A;  4GDY A;  2Z9V A;  1N31 A;  3A9X A;  2AY4 A;  3BCA A;  1TOG A;  4OMA A;  3WCN A;  5G4J A;  2HUF A;  4A72 A;  2W8J A;  4F5H A;  4ADB A;  3NYU A;  3AEN A;  1KMK A;  1DGD A;  3NTJ A;  4GE9 A;  2AAT A;  3FSL A;  2VIA A;  3DXV A;  1I48 A;  2BIE A;  4ITX A;  3EIA A;  4RIZ A;  4AO4 A;  2D64 A;  4F5M A;  1DJE A;  2W7E A;  4MKK A;  4JEV A;  4W5K A;  3B1C A;  2JJG A;  1YJY A;  2X5F A;  4W1W A;  3NX3 A;  3PD6 B;  1ASF A;  2D66 A;  3ZZK A;  1BT4 A;  4AO9 A;  2HUU A;  4A6T A;  3CQ4 A;  2E7J A;  2QB3 A;  3BB8 A;  3OP7 A;  4Q76 A;  2HUI A;  1AY8 A;  3B46 A;  1IJI A;  3G0T A;  4J8L A;  3GR9 A;  3WGB A;  4OBU A;  3E9K A;  2GQN A;  3HBX A;  3USF A;  4F5L A;  4M2M A;  5M46 A;  5K8B A;  3AOW A;  1MAQ A;  4BQ0 A;  2OGE A;  2OKJ A;  1JS6 A;  4K2I A;  2AY1 A;  3NU8 A;  1D7S A;  3ZZJ A;  2OGA A;  3ELE A;  1M32 A;  2ZSL A;  3N4X A;  4MQQ A;  2HZP A;  3PDB A;  4MGR A;  2FQ6 A;  2Z9U A;  1LC7 A;  4EMY A;  1WKH A;  2D7Y A;  1ASB A;  4GSA A;  1BS0 A;  1OXP A;  1ZC9 A;  3AEJ C;  5E5I A;  3G7Q A;  4UOY A;  4Y0D A;  4ATP A;  5FT4 A;  5G2P A;  2ZY5 A;  1GEX A;  1U08 A;  3TAT A;  4IXS A;  1AMS A;  2VMV A;  4QGR A;  2HOZ A;  2DOU A;  3PD6 A;  2W7H A;  1TPL A;  2EZ2 A;  1D7U A;  3ATH A;  1G4V A;  1BJO B;  1OXO A;  2WK9 A;  4OTL A;  1V2E A;  2R0T A;  2Z9W A;  2BIA A;  2VI9 A;  2VMQ A;  8AAT A;  2AY9 A;  1ARS A;  2BIG A;  2YKX A;  1ASE A;  3AEP A;  2BWO A;  3L8A A;  1SZS A;  2JG2 A;  4N0B A;  5M49 A;  3NU7 A;  3GBX A;  1QIS A;  3ZRR A;  2W7F A;  1M0O A;  3H7F A;  1S07 A;  3WKS A;  3H9X A;  1QIR A;  4O6Z A;  3VOM A;  2V1P A;  4Q6R A;  1VEF A;  2PB0 A;  3JTX A;  5DJ1 A;  1QJ5 A;  3EIB A;  2W8V A;  3BS8 A;  3CBF A;  1Z3Z A;  1W3U A;  1O69 A;  3NUB A;  3QBO A;  4ZDP A;  2G6W A;  2JIS A;  1AIC A;  3PGY A;  3ZRP A;  4GE7 A;  3UWC A;  1GCK A;  2W7D A;  3BN1 A;  1W7L A;  2NMP A;  4OBV A;  4F5G A;  4ZWM A;  1AAW A;  1O61 A;  2D65 A;  2C44 A;  2EO5 A;  2GB3 A;  3GWP A;  3N0L A;  4RJ0 A;  5TF5 A;  2FKI A;  3MAD A;  9AAT A;  1ELQ A;  4WP0 A;  1SZK A;  3FDB A;  4A6R A;  3N4S A;  2Z67 A;  1C7G A;  3NRA A;  4WXB A;  3FQ7 A;  2CFB A;  3RUY A;  3I16 A;  4XQ2 A;  1CZE A;  3AEM C;  4WYG A;  1KKP A;  2D61 A;  1GBN A;  1S06 A;  1W7N A;  1Z7D A;  4MSO A;  4UQV A;  3VAX A;  3WGC A;  1MDZ A;  1IBJ A;  5AX8 A;  1X29 A;  1GC0 A;  2PO3 A;  4B98 A;  1TOE A;  2Z9X A;  5G2Q A;  1AY5 A;  2Z20 A;  1GC4 A;  3PA9 A;  4W8I A;  3GZC A;  3JWB A;  1IAY A;  2BYL A;  1Y4I A;  4OT8 A;  1IUG A;  4WYC A;  1BW0 A;  3ASA A;  1P3W A;  4Q75 A;  2W7I A;  2KFP A;  3EZS A;  3R9A A;  1T3I A;  2BI3 A;  1D7R A;  2BYJ A;  2YKY A;  2O7C A;  3P1T A;  3DU4 A;  4TMR A;  1CQ6 A;  2VMO A;  1OHW A;  4N0W A;  1MAP A;  1DTY A;  1LW5 A;  1DKA A;  1RVU A;  2JGT A;  2OKK A;  2VGT A;  4F4E A;  3HDO A;  2BKW A;  2HOY A;  4B9B A;  4LNL A;  4EU1 A;  1AMR A;  1KL1 A;  3RCH B;  5M4B A;  2V0Y A;  3RBL A;  5J8Q A;  2YHK A;  3DRD A;  4HVK A;  3ECD A;  3WLX A;  1B5P A;  2CH2 A;  4IXZ A;  4IYO A;  3WKR A;  2ZUK A;  4XEW A;  3T32 A;  3VK4 A;  3PDB B;  4WXF A;  1I43 A;  3A9Y A;  4XJO A;  2W8W A;  2QA3 A;  2VYC A;  1V72 A;  2X5D A;  4OCA A;  5JAY A;  2AY5 A;  2VGU A;  4RKC A;  1X2A A;  3IHJ A;  1TOJ A;  4NOG A;  3EI6 A;  1ASL A;  1J32 A;  5LHA A;  2E7I A;  2EH6 A;  3UAK A;  5F9S A;  2VMX A;  1UU0 A;  1DJU A;  2ZY4 A;  1C7O A;  1O4S A;  4HF8 A;  5EQC A;  4JEW A;  1CL1 A;  3EI9 A;  4Q31 A;  3E6G A;  5G4I A;  1C9C A;  3FFH A;  4MKJ A;  1ASN A;  3CQ6 A;  1JS3 A;  1EQB A;  1N2T A;  3JW9 A;  4OYT A;  3BV0 A;  1AAM A;  4GRX A;  2O0R A;  1BKG A;  1B4X A;  3FD0 A;  2DR1 A;  4DQ6 A;  2EPJ A;  2JJH A;  2AEV A;  2AEU A;  4WB0 B;  3NYS A;  1UU1 A;  3RCH A;  1CS1 A;  3N5M A;  3QGU A;  4WYE A;  1W7M A;  3FQA A;  2TPL A;  4E1O A;  1H1C A;  1MLZ A;  1C7N A;  3PAA A;  2Z61 A;  4ZSY A;  4EFF A;  1M7Y A;  2VMR A;  3JWA A;  2VMP A;  2VLH A;  4AZK A;  1GDE A;  1SZU A;  5DX5 A;  1ARG A;  2BI2 A;  4Y0I A;  1E5F A;  1OAT A;  2VGZ A;  2HP1 A;  3DYD A;  2D7Z A;  4R2N A;  2YCT A;  1WST A;  2HOR A;  4DBC A;  3FQ8 A;  3TFU A;  1AIA A;  3COG A;  3CQ5 A;  2VGS A;  1TOI A;  2E54 A;  3FDD A;  1AMA A;  2RFV A;  1B9I A;  3VP6 A;  1RV4 A;  2DGM A;  3Q8N A;  3BCB A;  4KXK A;  2YRI A;  3DR4 A;  4BMK A;  4JE5 D;  2C0R A;  3GSB A;  4MQR A;  4ZDL A;  3OKS A;  4ISY A;  3EI8 A;  1LK9 A;  1ART A;  1ORD A;  3LVL B;  3PJ0 A;  3FZ6 A;  2JJF A;  3DZZ A;  4LNJ A;  4PVF A;  3HT4 A;  3LY1 A;  4CBS A;  2GMS A;  2FNI A;  1DJ9 A;  2X8U A;  4WB0 A;  1FG3 A;  1ASG A;  7AAT A;  3N4R A;  1ASC A;  1D2F A;  3LG0 A;  2R5E A;  2AY3 A;  1PFF A;  3II0 A;  2BWP A;  2OQX A;  4R8D A;  1YIY A;  1YOO A;  3DOD A;  4J5U A;  1SVV A;  1PG8 A;  2CJD A;  2DKB A;  3TFT A;  1MGV A;  2EYQ A;  3KE3 A;  2AY8 A;  5EUN A;  2YCN A;  4LW2 A;  4A00 A;  2ZP7 A;  3NNK A;  4WD2 A;  3RI6 A;  5D5S A;  1SPA A;  3DC1 A;  2XBN A;  4IYO B;  4JF1 A;  1AMQ A;  4ADC A;  3K7Y A;  1AKA A;  2CIN A;  2W7J A;  4CXQ A;  3A8U X;  3GZD C;  3MAU A;  4CBR A;  1YJS A;  2CH1 A;  1X0M A;  1G7W A;  1YJZ A;  3EI7 A;  3HLM A;  1S08 A;  4JEY A;  4F5F A;  4UHO A;  4GEB A;  4IW7 A;  3UE8 A;  2Q7W A;  3AEL A;  1CJ0 A;  4F5K A;  1H0C A;  4K2M A;  4ADD A;  3D6K A;  3FFR A;  3FCR A;  3HMU A;  1ECX A;  1VJO A;  2CTZ A;  3FVU A;  4XJL A;  3MKJ A;  1IX6 A;  2YRR A;  4JE5 A;  4UHN A;  3I5T A;  3HQT A;  1CQ7 A;  4BA4 A;  2A1V A;  1M4N A;  4RLG A;  2VIB A;  3BWN C;  1RVY A;  2ZY3 A;  4R5Z A;  4IX8 A;  4LW4 A;  1EG5 A;  1S09 A;  5I92 A;  2HP2 A;  1BJW A;  1M6S A;  2BI1 A;  5C6U A;  2W8T A;  3ZRQ A;  4WLH A;  3PDX A;  1MLY A;  2JJE A;  2CAN A;  3QN6 A;  1IVR A;  2ZC0 A;  4KAM A;  3DR7 A;  1VP4 A;  1O62 A;  3ISL A;  2WB6 A;  1IX8 A;  1IX7 A;  1KL2 A;  1I41 A;  4WXG A;  2D63 A;  4K05 A;  3E2Z A;  5KTB A;  2YCP A;  2O1B A;  2FYF A;  3LWS A;  5IWQ A;  3WY7 A;  1QGN A;  3JU7 A;  4XJP A;  1XEY A;  1XI9 A;  1AY4 A;  3N75 A;  2QLR A;  2Z1Z A;  1WYU A;  1MDO A;  2CB1 A;  1PMM A;  1C0N A;  1ARI A;  1QZ9 A;  3FRK A;  4AH3 A;  2VMS A;  1DGE A;  1YNU A;  1B9H A;  2CY8 A;  1AHE A;  3NYT A;  3PIU A;  4LNM A;  3LVM A;  2GMU A;  4ZLV A;  1AHY A;  4A0H A;  1FC4 A;  4CVQ A;  2VMW A;  2G7J A;  3H14 A;  3LVK A;  3MC6 A;  1M0Q A;  2OAT A;  2ZYJ A;  4KYO A;  3RQ1 A;  4CXR A;  1V2F A;  2C81 A;  5HXX A;  2BHX A;  4ATQ A;  3QHX A;  4RM1 A;  2DGL A;  2R5C B;  5EIG A;  1G4X A;  5LH9 A;  2DGK A;  3VK3 A;  4JEZ A;  1MDX A;  2HOX A;  4EB7 A;  4EB5 A;  1TAT A;  3JZL A;  5G0A A;  3K40 A;  1AJS A;  4H51 A;  1AHX A;  4AOA A;  3NUI A;  4BA5 A;  1BJN A;  2VMU A;  4E3Q A;  2AY6 A;  4WYA A;  2VI8 A;  4ZDO A;  3BCX A;  4TN4 A;  2ZSM A;  1WYV A;  3ACZ A;  3R4T A;  1LS3 A;  4JEX A;  2VGW A;  1W23 A;  1D7V A;  2YKV A;  2EZ1 A;  4K2B A;  1ARH A;  3WX9 A;  1S0A A;  3EI5 A;  5G09 A;  3AAT A;  4AZJ A;  2FN6 A;  2X3L A;  4JF0 A;  1FG7 A;  5EUD A;  1QIT A;  1C4K A;  2W7M A;  4A0R A;  1LKC A;  3IF2 A;  4TV7 A;  1B5O A;  3AEO A;  2ZJG A;  4RJY A;  1UU2 A;  3EUC A;  1GC3 A;  2WKA A;  3KKI A;  1GEW A;  1LW4 A;  3KGX A;  2FM1 A;  3FZ8 A;  3KGW A;  3MAF B;  5FT5 A;  4RIT A;  5HDM A;  3WCO A;  3LV2 A;  2BI5 A;  2BI9 A;  3E2F A;  3F6T A;  5E4Z A;  1BQA A;  5EAA A;  2QB2 A;  1AKC A;  2R5C A;  4F5I A;  1UKJ A;  3AOV A;  5EFS A;  2W8U A;  1B8G A;  3BC8 A;  4H63 Q;  1JF9 A;  1GC2 A;  3AEJ A;  1BQD A;  1YIZ A;  1AHF A;  2QSR A;  2QBT A;  3CAI A;  3MEB A;  3LVJ A;  3GJU A;  4WYD A;  1TAS A;  1M0N A;  4RKD A;  1PMO A;  2BWN A;  3FTB A;  1DFO A;  1GD9 A;  3ELP A;  3QI6 A;  3MBB A;  4W91 A;  4ZAS A;  4A0F A;  3TQX A;  2F8J A;  2XH1 A;  4FL0 A;  4I8A A;  4BHD A;  4R5F A;  3B8X A;  4A6U A;  1LC5 A;  4RAE A;  1YAA A;  3B1E A;  1X28 A;  1CQ8 A;  2Z1Y A;  1V2D A;  2YKU A;  1AX4 A;  1E5E A;  1EJI A;  4E3R A;  1CL2 A;  1IAX A;  2VMN A;  1CZC A;  2E7U A;  2DKJ A;  3E2Z B;  4U1T A;  3F9T A;  2AY2 A;  1TAR A;  3FVX A;  3MAF A;  4W1X A;  3HL2 A;  4PFN A;  1ZOD A;  3WZF A;  3F0H A;  4PIW A;  5D95 A;  1WYU B;  3QPG A;  1TOK A;  1SFF A;  1M0P A;  2YOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...