2Q8BA

Structure of the malaria antigen ama1 in complex with a growth-inhibitory antibody
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
292
Chain Sequence
b'YMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1
publication title Structure of the Malaria Antigen AMA1 in Complex with a Growth-Inhibitory Antibody
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 84
structure length 292
sequence length 334
ec nomenclature
pdb deposition date 2007-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2q8bA01
1NK1A 2QJ2A 2YIPA 1Z40A 3HMSA 4R19A 2J8JA 5EOKA 1W81A 1YXEA 3ZLEA 2J8LA 2Q8BA 4UAOA 1HKYA 2K13X 4R1CA 1GMOA 4IUAA 5I25A 2F83A 2YIOA 4APLA 1W8KA 5CS5A 2X2ZA 5CT1A 2HGFA 4Z0EA 1I8NA 5CS3A 3ZWZA 2LL4M 1BHTA 5CT3A 2YILA 2Z8VA 5CS1A 4DURA 2QJ4A 4R1BA 3SP8A 3HMTA 4A5TS 5COEA 5CSQA 3SRJA 4R1AA 3SRIA 5CP9A 3HN4A 4Z0DA 2Y8RA 2Z8WA 3HMRA 2LL3A 4UV6A 5CS9A 4Z09A 1GP9A 4APMA 4Z0FA 2Q8AA 1GMNA 5CT2A 5EODA 3MKPA
chains in the Genus database with same CATH superfamily
1NK1A 2QJ2A 2YIPA 1Z40A 3HMSA 4R19A 2J8JA 5EOKA 1W81A 1YXEA 3ZLEA 2J8LA 2Q8BA 4UAOA 1HKYA 2K13X 4R1CA 1GMOA 4IUAA 5I25A 2F83A 2KL5A 2YIOA 4APLA 1W8KA 5CS5A 2X2ZA 5CT1A 2HGFA 4Z0EA 4YIZA 1I8NA 5CS3A 3ZWZA 2LL4M 1BHTA 5CT3A 2YILA 2Z8VA 5CS1A 4DURA 2QJ4A 4R1BA 3SP8A 3HMTA 4A5TS 5COEA 5CSQA 4YIVA 3SRJA 4R1AA 3SRIA 5CP9A 3HN4A 4Z0DA 2Y8RA 2Z8WA 3HMRA 2LL3A 4UV6A 5CS9A 4Z09A 1GP9A 4APMA 4Z0FA 2Q8AA 1GMNA 5CT2A 5EODA 3MKPA
chains in the Genus database with same CATH topology
1NK1A 2QJ2A 2YIPA 1Z40A 3HMSA 4R19A 2J8JA 5EOKA 1W81A 1YXEA 3ZLEA 2J8LA 2Q8BA 4UAOA 1HKYA 2K13X 4R1CA 1GMOA 4IUAA 5I25A 2F83A 2KL5A 2YIOA 4APLA 1W8KA 5CS5A 2X2ZA 5CT1A 2HGFA 4Z0EA 4YIZA 1I8NA 5CS3A 3ZWZA 2LL4M 1BHTA 5CT3A 2YILA 2Z8VA 5CS1A 4DURA 2QJ4A 4R1BA 3SP8A 3HMTA 4A5TS 5COEA 5CSQA 4YIVA 3SRJA 4R1AA 3SRIA 5CP9A 3HN4A 4Z0DA 2Y8RA 2Z8WA 3HMRA 2LL3A 4UV6A 5CS9A 4Z09A 1GP9A 4APMA 4Z0FA 2Q8AA 1GMNA 5CT2A 5EODA 3MKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK1 A;  2QJ2 A;  2YIP A;  1Z40 A;  3HMS A;  4R19 A;  2J8J A;  5EOK A;  1W81 A;  1YXE A;  3ZLE A;  2J8L A;  2Q8B A;  4UAO A;  1HKY A;  2K13 X;  4R1C A;  1GMO A;  4IUA A;  5I25 A;  2F83 A;  2YIO A;  4APL A;  1W8K A;  5CS5 A;  2X2Z A;  5CT1 A;  2HGF A;  4Z0E A;  1I8N A;  5CS3 A;  3ZWZ A;  2LL4 M;  1BHT A;  5CT3 A;  2YIL A;  2Z8V A;  5CS1 A;  4DUR A;  2QJ4 A;  4R1B A;  3SP8 A;  3HMT A;  4A5T S;  5COE A;  5CSQ A;  3SRJ A;  4R1A A;  3SRI A;  5CP9 A;  3HN4 A;  4Z0D A;  2Y8R A;  2Z8W A;  3HMR A;  2LL3 A;  4UV6 A;  5CS9 A;  4Z09 A;  1GP9 A;  4APM A;  4Z0F A;  2Q8A A;  1GMN A;  5CT2 A;  5EOD A;  3MKP A; 
#chains in the Genus database with same CATH topology
 1NK1 A;  2QJ2 A;  2YIP A;  1Z40 A;  3HMS A;  4R19 A;  2J8J A;  5EOK A;  1W81 A;  1YXE A;  3ZLE A;  2J8L A;  2Q8B A;  4UAO A;  1HKY A;  2K13 X;  4R1C A;  1GMO A;  4IUA A;  5I25 A;  2F83 A;  2KL5 A;  2YIO A;  4APL A;  1W8K A;  5CS5 A;  2X2Z A;  5CT1 A;  2HGF A;  4Z0E A;  4YIZ A;  1I8N A;  5CS3 A;  3ZWZ A;  2LL4 M;  1BHT A;  5CT3 A;  2YIL A;  2Z8V A;  5CS1 A;  4DUR A;  2QJ4 A;  4R1B A;  3SP8 A;  3HMT A;  4A5T S;  5COE A;  5CSQ A;  4YIV A;  3SRJ A;  4R1A A;  3SRI A;  5CP9 A;  3HN4 A;  4Z0D A;  2Y8R A;  2Z8W A;  3HMR A;  2LL3 A;  4UV6 A;  5CS9 A;  4Z09 A;  1GP9 A;  4APM A;  4Z0F A;  2Q8A A;  1GMN A;  5CT2 A;  5EOD A;  3MKP A; 
#chains in the Genus database with same CATH homology
 1NK1 A;  2QJ2 A;  2YIP A;  1Z40 A;  3HMS A;  4R19 A;  2J8J A;  5EOK A;  1W81 A;  1YXE A;  3ZLE A;  2J8L A;  2Q8B A;  4UAO A;  1HKY A;  2K13 X;  4R1C A;  1GMO A;  4IUA A;  5I25 A;  2F83 A;  2KL5 A;  2YIO A;  4APL A;  1W8K A;  5CS5 A;  2X2Z A;  5CT1 A;  2HGF A;  4Z0E A;  4YIZ A;  1I8N A;  5CS3 A;  3ZWZ A;  2LL4 M;  1BHT A;  5CT3 A;  2YIL A;  2Z8V A;  5CS1 A;  4DUR A;  2QJ4 A;  4R1B A;  3SP8 A;  3HMT A;  4A5T S;  5COE A;  5CSQ A;  4YIV A;  3SRJ A;  4R1A A;  3SRI A;  5CP9 A;  3HN4 A;  4Z0D A;  2Y8R A;  2Z8W A;  3HMR A;  2LL3 A;  4UV6 A;  5CS9 A;  4Z09 A;  1GP9 A;  4APM A;  4Z0F A;  2Q8A A;  1GMN A;  5CT2 A;  5EOD A;  3MKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...