2Q8BA

Structure of the malaria antigen ama1 in complex with a growth-inhibitory antibody
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
334
structure length
292
Chain Sequence
YMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apical membrane antigen 1
publication title Structure of the Malaria Antigen AMA1 in Complex with a Growth-Inhibitory Antibody
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 84
structure length 292
sequence length 334
ec nomenclature
pdb deposition date 2007-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2q8bA01
1GMOA 4DURA 4A5TS 3HMTA 5CS3A 4UAOA 5CS5A 3SRIA 2LL4M 3HN4A 3SRJA 4Z09A 5EOKA 4UV6A 2QJ4A 5CS1A 5I25A 3HMSA 4R19A 2J8JA 2Y8RA 2YIOA 2QJ2A 1I8NA 2Z8WA 2Z8VA 5COEA 4APMA 1GMNA 1W81A 4Z0FA 3HMRA 4R1BA 3ZLEA 5EODA 2HGFA 1NK1A 3ZWZA 3MKPA 5CT3A 2K13X 2X2ZA 4R1CA 2Q8BA 2F83A 2J8LA 2LL3A 2YILA 5CT1A 4IUAA 4R1AA 3SP8A 1HKYA 1GP9A 1YXEA 5CT2A 1W8KA 5CP9A 5CS9A 5CSQA 4APLA 1Z40A 2YIPA 4Z0DA 4Z0EA 2Q8AA 1BHTA
chains in the Genus database with same CATH superfamily
1GMOA 4DURA 4A5TS 3HMTA 5CS3A 4UAOA 5CS5A 3SRIA 2LL4M 3HN4A 3SRJA 4YIZA 4Z09A 5EOKA 4UV6A 2QJ4A 5CS1A 5I25A 3HMSA 4R19A 2J8JA 2Y8RA 2YIOA 2QJ2A 1I8NA 2Z8WA 2Z8VA 5COEA 4APMA 1GMNA 2KL5A 1W81A 4Z0FA 3HMRA 4R1BA 3ZLEA 5EODA 2HGFA 4YIVA 1NK1A 3ZWZA 3MKPA 5CT3A 2K13X 2X2ZA 4R1CA 2Q8BA 2F83A 2J8LA 2LL3A 2YILA 5CT1A 4IUAA 4R1AA 3SP8A 1HKYA 1GP9A 1YXEA 5CT2A 1W8KA 5CP9A 5CS9A 5CSQA 4APLA 1Z40A 2YIPA 4Z0DA 4Z0EA 2Q8AA 1BHTA
chains in the Genus database with same CATH topology
1GMOA 4DURA 4A5TS 3HMTA 5CS3A 4UAOA 5CS5A 3SRIA 2LL4M 3HN4A 3SRJA 4YIZA 4Z09A 5EOKA 4UV6A 2QJ4A 5CS1A 5I25A 3HMSA 4R19A 2J8JA 2Y8RA 2YIOA 2QJ2A 1I8NA 2Z8WA 2Z8VA 5COEA 4APMA 1GMNA 2KL5A 1W81A 4Z0FA 3HMRA 4R1BA 3ZLEA 5EODA 2HGFA 4YIVA 1NK1A 3ZWZA 3MKPA 5CT3A 2K13X 2X2ZA 4R1CA 2Q8BA 2F83A 2J8LA 2LL3A 2YILA 5CT1A 4IUAA 4R1AA 3SP8A 1HKYA 1GP9A 1YXEA 5CT2A 1W8KA 5CP9A 5CS9A 5CSQA 4APLA 1Z40A 2YIPA 4Z0DA 4Z0EA 2Q8AA 1BHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMO A;  4DUR A;  4A5T S;  3HMT A;  5CS3 A;  4UAO A;  5CS5 A;  3SRI A;  2LL4 M;  3HN4 A;  3SRJ A;  4Z09 A;  5EOK A;  4UV6 A;  2QJ4 A;  5CS1 A;  5I25 A;  3HMS A;  4R19 A;  2J8J A;  2Y8R A;  2YIO A;  2QJ2 A;  1I8N A;  2Z8W A;  2Z8V A;  5COE A;  4APM A;  1GMN A;  1W81 A;  4Z0F A;  3HMR A;  4R1B A;  3ZLE A;  5EOD A;  2HGF A;  1NK1 A;  3ZWZ A;  3MKP A;  5CT3 A;  2K13 X;  2X2Z A;  4R1C A;  2Q8B A;  2F83 A;  2J8L A;  2LL3 A;  2YIL A;  5CT1 A;  4IUA A;  4R1A A;  3SP8 A;  1HKY A;  1GP9 A;  1YXE A;  5CT2 A;  1W8K A;  5CP9 A;  5CS9 A;  5CSQ A;  4APL A;  1Z40 A;  2YIP A;  4Z0D A;  4Z0E A;  2Q8A A;  1BHT A; 
#chains in the Genus database with same CATH topology
 1GMO A;  4DUR A;  4A5T S;  3HMT A;  5CS3 A;  4UAO A;  5CS5 A;  3SRI A;  2LL4 M;  3HN4 A;  3SRJ A;  4YIZ A;  4Z09 A;  5EOK A;  4UV6 A;  2QJ4 A;  5CS1 A;  5I25 A;  3HMS A;  4R19 A;  2J8J A;  2Y8R A;  2YIO A;  2QJ2 A;  1I8N A;  2Z8W A;  2Z8V A;  5COE A;  4APM A;  1GMN A;  2KL5 A;  1W81 A;  4Z0F A;  3HMR A;  4R1B A;  3ZLE A;  5EOD A;  2HGF A;  4YIV A;  1NK1 A;  3ZWZ A;  3MKP A;  5CT3 A;  2K13 X;  2X2Z A;  4R1C A;  2Q8B A;  2F83 A;  2J8L A;  2LL3 A;  2YIL A;  5CT1 A;  4IUA A;  4R1A A;  3SP8 A;  1HKY A;  1GP9 A;  1YXE A;  5CT2 A;  1W8K A;  5CP9 A;  5CS9 A;  5CSQ A;  4APL A;  1Z40 A;  2YIP A;  4Z0D A;  4Z0E A;  2Q8A A;  1BHT A; 
#chains in the Genus database with same CATH homology
 1GMO A;  4DUR A;  4A5T S;  3HMT A;  5CS3 A;  4UAO A;  5CS5 A;  3SRI A;  2LL4 M;  3HN4 A;  3SRJ A;  4YIZ A;  4Z09 A;  5EOK A;  4UV6 A;  2QJ4 A;  5CS1 A;  5I25 A;  3HMS A;  4R19 A;  2J8J A;  2Y8R A;  2YIO A;  2QJ2 A;  1I8N A;  2Z8W A;  2Z8V A;  5COE A;  4APM A;  1GMN A;  2KL5 A;  1W81 A;  4Z0F A;  3HMR A;  4R1B A;  3ZLE A;  5EOD A;  2HGF A;  4YIV A;  1NK1 A;  3ZWZ A;  3MKP A;  5CT3 A;  2K13 X;  2X2Z A;  4R1C A;  2Q8B A;  2F83 A;  2J8L A;  2LL3 A;  2YIL A;  5CT1 A;  4IUA A;  4R1A A;  3SP8 A;  1HKY A;  1GP9 A;  1YXE A;  5CT2 A;  1W8K A;  5CP9 A;  5CS9 A;  5CSQ A;  4APL A;  1Z40 A;  2YIP A;  4Z0D A;  4Z0E A;  2Q8A A;  1BHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...