2Q8GA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with glucose-lowering drug azd7545
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
383
structure length
368
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNDDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
total genus 128
structure length 368
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8gA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8gA02
2ESAA 3FV5A 2BU7A 3HYYA 1PVGA 4HYMA 3RKZA 3B26A 3T1KA 5CF0A 1TILA 3ZXQA 3U2KA 4YKZA 1TC6A 2YJXA 4CE2A 3ZKBA 2QG0A 4GCZA 4JASA 4HXZA 1EI1A 1KIJA 2YEFA 1AH6A 2XK2A 4O04A 1L0OA 1US7A 3OPDA 2XHXA 4WUDA 4EGKA 4CWSA 5D7RA 4URLA 4E01A 4XE2A 2O1VA 2YKIA 4R3AA 2ZBKB 5BODA 1UYLA 4P8OA 4BXIA 2H8MA 4LP0A 2YKCA 4FPPA 1QY8A 4O0BA 4FMTA 4GT8A 4XDMA 4XIQA 1NHJA 1B63A 3B25A 4MB9A 3U2DA 2XDKA 1UYFA 4XKKA 2YI7A 3B28A 5CTYA 3LNUA 4BAEA 2AKPA 4YKQA 1BGQA 4ASAA 2BZ5A 3HEKA 1YT1A 5IDMA 4GGLA 4URNA 2XJXA 3Q5KA 4BIZA 2WI5A 3MNRP 1MU5A 1I58A 4CE1A 1I5AA 3TZ2A 2C2AA 1I5CA 3R4OA 4L94A 1UYKA 5D7CA 2XDXA 4XTJA 5M4PA 3FT5A 1H7SA 4KFGA 2XCMA 4WUBA 3RLPA 1S14A 2CH4A 4XKOA 2QFOA 2YE7A 1R62A 2Q8GA 1OSFA 3OWBA 4GQTA 4MP2A 1MX0A 2HG1A 1H7UA 3VADA 4QPKA 2BU5A 3T2SA 3T0ZA 4AWOA 2EXLA 1ZXNA 4EGHA 5FNDA 3VHDA 2YE4A 4DZYA 4KSHA 4CWOA 3G7BA 4R3MA 1YETA 1AM1A 2YEGA 1ZWHA 4EMVA 2WEQA 3TZ5A 4E00A 4W7TA 4O07A 4NH9A 4V26A 4WUCA 5M4EA 4HXWA 3LPSA 1Z5AA 1UYEA 1I5DA 1UYIA 3O0IA 4K4OA 4XCLA 4O05A 3D0BA 4YKUA 3G7EA 4LWHA 4UROA 3VHCA 3K97A 1UYCA 2YE2A 2YEJA 3QTFA 3A0XA 2YI6A 4QPJA 3RLRA 4XCJA 2ZDYA 1YC1A 3GIEA 5BOCA 5D7DA 2WI6A 4DUHA 5GGZA 2YGAA 1JM6A 2HCHA 4U93A 3Q5JA 2XJGA 3WQ9A 3TZ4A 2FWYA 3T0HA 4U7OA 3INWA 4LWIA 2YI0A 1Y8NA 1I59A 2BU8A 4HZ5A 3A0TA 5D6QA 1BXDA 1UYMA 2CCTA 4CWQA 1YSZA 2VCIA 2JKIA 4MBCA 4AWQA 1B3QA 1ID0A 4MPNA 4KTNA 2CCUA 3EKRA 4PL9A 4FCQA 3B24A 4HZ0A 1Y4UA 2O1WA 2QF6A 2YEAA 4YKRA 4L90A 1QZRA 2VW5A 3K99A 3HYZA 3C11A 2YJWA 2BYIA 4ASBA 3A0WA 3CWVA 1BYQA 2K5BA 3QDDA 4H85A 2YE3A 2WEPA 1QYEA 5F5RA 3Q5LA 5M4KA 4ASGA 1NHHA 3T10A 2CGFA 1YT2A 4MPCA 3TTZA 3ZXOA 3KE6A 4MP7A 2YEIA 2XDUA 3B27A 2PNRA 4H7QA 2VWCA 2Q2EB 2YEEA 2IOQA 3TZ0A 1KZNA 3EHGA 4CWFA 3HHUA 4BQGA 1ZXMA 3CGYA 3H80A 3PEHA 4JAVA 3PEJA 3A0ZA 2YGFA 2WERA 1AH8A 4HYPA 1B62A 4KP4A 2XX5A 5CTWA 4EFUA 4EGIA 3U67A 4PU9A 2XJJA 4I3HA 3HZ5A 4GFNA 4BQJA 4PRVA 1BKNA 1Z5CA 3BMYA 4EM7A 3A0RA 3GIFA 4ASFA 1A4HA 2ZKJA 3D2RA 5M4NA 1GJVA 5M4HA 4R1FA 4JQLA 4LPBA 4BIUA 2CG9A 1YC3A 4CE3A 4MPEA 2FWZA 4JAUA 1U0ZA 5IN9A 4LWGA 3O6OA 4PRXA 1UYGA 4XIRA 4EFTA 3CRKA 2XHRA 1THNA 1Y8OA 1Z5BA 2IWSA 2YE8A 2HKJA 1YT0A 3OW6A 1AJ6A 3R4PA 5FWKA 2YEHA 3INXA 3CRLA 3EKOA 3G75A 3HZ1A 2BU2A 2IORA 1NHIA 2WI7A 1UYHA 5M4MA 2H55A 3K98A 4YKYA 2BYHA 2ZDXA 2JJCA 4AWPA 1AMWA 5L3JA 3DGEA 4YKXA 2BT0A 3EHFA 3ZM7A 2Q8HA 4XD8A 4HY6A 2IOPA 1ZW9A 4EEHA 4NH7A 1UY7A 2YGEA 2IWXA 3CGZA 4GEEA 2BTZA 5CPHA 2XX4A 4X9LA 5FNCA 2BU6A 2YEDA 1UY6A 4L91A 1YERA 4V25A 5J6AA 4AS9A 2YECA 4E02A 1YC4A 1UY8A 2QG2A 3IEDA 4NH8A 4B6CA 4O09A 1Y4SA 2XX2A 5IDJA 2O1UA 4HY1A 2WI1A 2YK2A 2CCSA 3GIGB 3JZ3A 3NMQA 3WHAA 4L8ZA 3FT8A 2IWUA 1I5BA 4FCRA 4CWRA 2Q8IA 3O2FA 2XDSA 1Y8PA 4ZVIA 4YKWA 2VCJA 1TC0A 4FCPA 3EHJA 5FNFA 4LWFA 2YKEA 4MOTA 4XITA 3D36A 3R92A 4CWPA 2YKBA 1TH8A 3K60A 1YS3A 2WI3A 4LWEA 1YSRA 3TUHA 3EHHA 5CTXA 1TBWA 2FXSA 1S16A 2YK9A 3R4NA 3R91A 1GKXA 1U2OA 3RLQA 2YE5A 5C93A 2BSMA 3OWDA 4ZKIA 2YE6A 4XC0A 2XDLA 4B7PA 1EA6A 4XKAA 4H81A 5CTUA 3OMUA 1UYDA 4Q20A 4CWTA 2GFDA 2YKJA 4CWNA 2GQPA 3VHAA 4KSGA 3A0YA 3C0EA 5F3KA 2BREA 5J71A 1TIDA 3H4LA 2Q8FA 3R4MA 4YKTA 1YESA 2XABA 1Z59A 4I5SA 4U7NA 3SL2A 3BM9A 1GKZA 2WI4A 5D6PA 2BRCA 1UY9A 4L93A 4URMA 2UWDA 2XHTA 4XIPA 2FYPA 2XD6A 2YI5A 2YEBA 2YE9A 3GIGA 4KQVA 2E0AA 4P7AA 3ZKDA 2WI2A
chains in the Genus database with same CATH superfamily
3S5TA 2ESAA 3FV5A 2BU7A 3HYYA 1PVGA 4HYMA 4NXLA 3B26A 3RKZA 3T1KA 5CF0A 1TILA 3ZXQA 3U2KA 3VKHA 2Z1QA 4YKZA 1TC6A 5B5WA 2YJXA 2OJQA 4CE2A 2JBTA 3ZKBA 2QG0A 4GCZA 4JASA 4HXZA 1EI1A 1KIJA 2YEFA 1AH6A 2XK2A 4O04A 1L0OA 1US7A 3OPDA 1XG2B 2XHXA 4WUDA 4EGKA 4CWSA 3UU9A 5D7RA 4URLA 3FCJA 4N5FA 4E01A 4XE2A 2O1VA 5B5VA 3AFFA 2YKIA 4R3AA 4KCFA 4HKSA 2ZBKB 5BODA 1UYLA 5B6BA 1T9GA 4P79A 4P8OA 3II9A 4BXIA 2H8MA 4LP0A 3L1TA 1LVCA 2YKCA 2YYJA 4FPPA 1XFZA 1QY8A 4O0BA 4ZYJA 4FMTA 4GT8A 4XDMA 4XIQA 1NHJA 1B63A 3B25A 4FF4A 4MB9A 3U2DA 2R05A 2XDKA 1UYFA 4AKGA 4XKKA 2HJNA 2YI7A 3B28A 5CTYA 3LNUA 4BAEA 2AKPA 1XFVA 1BGQA 3BNGA 4YKQA 4ASAA 1R2JA 2UXWA 2BZ5A 1SIQA 1YT1A 3HEKA 5IDMA 4GGLA 3Q22A 4URNA 4Q5BA 2XJXA 3Q5KA 4BIZA 2WI5A 2E80A 3Q24A 3MNRP 1MU5A 2CJ8A 1I58A 4CE1A 2VF1A 1I5AA 2AO2A 3TZ2A 2C2AA 1I5CA 3R4OA 2C12A 1UYKA 4L94A 5D7CA 1EGDA 2XDXA 4XTJA 5M4PA 1UDYA 2YYLA 4IV6A 3FT5A 1H7SA 1RJ1A 1BUCA 3OWAA 2XCMA 4KFGA 4WUBA 3FO3A 2R0NA 3RLPA 1S14A 2CH4A 4XKOA 2QFOA 2YE7A 1R62A 2Q8GA 2WBIA 2CJ4A 3TORA 1OSFA 3OWBA 4GQTA 1XFWA 4MP2A 1MX0A 5JENA 2HG1A 1H7UA 3VADA 4QPKA 1S26A 2BU5A 3BNJA 5BRMA 3T2SA 1U8VA 3D9DA 3T0ZA 4AWOA 2EXLA 1ZXNA 4EGHA 5FNDA 4Q4UA 3VHDA 3D6BA 3HWCA 4ZXVA 2YE4A 4DZYA 4KSHA 2GBBA 4CWOA 3G7BA 3X29A 4R3MA 1YETA 1AM1A 2YEGA 1ZWHA 2DVLA 4P13A 4EMVA 2WEQA 3TZ5A 1EGCA 4E00A 4W7TA 4O07A 5K3IA 4NH9A 4V26A 1K93A 3OWMA 4WUCA 5M4EA 2RFQA 4HXWA 3LPSA 1Z5AA 1UYEA 1XFXA 1I5DA 3D9EA 2RF7A 1UYIA 3O0IA 4K4OA 4XCLA 4O05A 3D0BA 3AFEA 4U83A 4YKUA 5GJWE 3BNFA 2LFWA 4FZ4A 3G7EA 4LWHA 3NF4A 3RKHA 2EBHX 4UROA 3K97A 3VHCA 1UYCA 3MXLA 2YE2A 2YEJA 3QTFA 3A0XA 2YI6A 4QPJA 2CJ5A 3RLRA 3UBRA 3EONA 2ZDYA 1YC1A 4XCJA 3GIEA 5BOCA 5D7DA 2WI6A 4DUHA 4JIZA 4L3YA 3C46A 3SXQA 5GGZA 2YGAA 1JM6A 3MKHA 2HCHA 4U93A 3Q5JA 2XJGA 3WQ9A 3TZ4A 2FWYA 3T0HA 3MPJA 4U7OA 3INWA 4G97A 2C1GA 2YI0A 4LWIA 1Y8NA 1I59A 2BU8A 4HZ5A 3A0TA 5D6QA 1BXDA 4Q5CA 1UYMA 2CCTA 2EBAA 4CWQA 3Q23A 1YSZA 2AZEA 2VCIA 2JKIA 4MBCA 1EGEA 4AWQA 1B3QA 4LQSB 1XFYA 2DDHA 2JBSA 2XS1A 3C2PA 4Q0TA 3Q0AA 1W07A 3F29A 1ID0A 4MPNA 4KTNA 3SF6A 2CCUA 3EKRA 4PL9A 2CX9A 4JIOA 1X90A 2F6LA 2RDZA 4QICA 3B24A 4FCQA 4HZ0A 1Y4UA 2O1WA 2QF6A 2YEAA 2VR0A 4YKRA 4L90A 1QZRA 2FTKA 4KTOA 2VW5A 5K3GA 3K99A 3HYZA 3C11A 4XVXA 2YJWA 2BYIA 4ASBA 3A0WA 3CWVA 1BYQA 2K5BA 3CYGA 3QDDA 4H85A 2YE3A 2WEPA 4JEKA 1QYEA 4LQQB 3LMMA 5F5RA 3Q5LA 5M4KA 4ASGA 2PO4A 1NHHA 4L3XA 1PK0A 2CGFA 3T10A 1YT2A 2CJ6A 4IRNA 4MPCA 3TTZA 3ZXOA 3KE6A 3D1IA 1RP3A 4MP7A 2XDUA 2YEIA 3B27A 3MPIA 4O5MA 4Q17A 2PNRA 4H7QA 2VWCA 1WS9A 2FONA 2Q2EB 3KMLA 2YEEA 2IOQA 3SCEA 3TZ0A 1KZNA 3GNCA 3EHGA 2CJ7A 4CWFA 3HHUA 4BQGA 1ZXMA 3CGYA 3H80A 3PEHA 4JAVA 3TTBA 3A0ZA 3PEJA 4WJYA 2YGFA 2E81A 2YYMA 3D9GA 2R03A 1Y0VA 4HKRA 2WERA 1AH8A 4HYPA 5GJVE 1B62A 2XX5A 4KP4A 5CTWA 4EFUA 4EGIA 3U67A 4PU9A 4W9UA 2XJJA 1SK6A 4I3HA 3HZ5A 4GFNA 4BQJA 4PRVA 1BKNA 1Z5CA 3BMYA 2IX5A 4EM7A 3A0RA 3GIFA 1QDBA 4Q1OA 4ASFA 1A4HA 1FS7A 3GQTA 2ZKJA 1XFUA 3MMOA 3D2RA 4RM7A 5M4NA 3X0YA 1GJVA 1X8ZA 5M4HA 2EBFX 4R1FA 2FP1A 4JQLA 4LPBA 4BIUA 4AKIA 2CG9A 4L38A 1YC3A 4CE3A 4MPEA 2FWZA 2QR4A 2JBRA 3VKGA 4JAUA 1U0ZA 5IN9A 4LWGA 3O6OA 4PRXA 1UYGA 4XIRA 2OT4A 4EFTA 3CRKA 2XHRA 1RJ4A 2XS8A 1THNA 1Y8OA 1Z5BA 2IWSA 4AI6A 2YE8A 2HKJA 1YT0A 3OW6A 4E72A 1AJ6A 3R4PA 5FWKA 3SWOA 2HHIA 2OEVA 2YEHA 3INXA 3CRLA 3EKOA 2OEXA 4FF3A 3G75A 3HZ1A 2BU2A 2IORA 2FP2A 1NHIA 4L3ZA 2WI7A 1UYHA 5M4MA 2H55A 3M9VA 3K98A 4YKYA 2BYHA 2ZDXA 2JJCA 4AWPA 1AMWA 5L3JA 3DGEA 3R7KA 2BT0A 3EHFA 4YKXA 2Q8HA 2C0UA 3ZM7A 4XD8A 4HY6A 3GM6A 1ZW9A 4L1FA 2IOPA 4EEHA 4NH7A 1UY7A 2YGEA 2IWXA 3CGZA 4GEEA 2BTZA 5CPHA 2XX4A 4X9LA 5FNCA 2BU6A 2YEDA 3MDEA 1UY6A 4L91A 1YERA 2D29A 4V25A 3C3LA 5J6AA 4AS9A 2YECA 4X28C 4E02A 1YC4A 1UY8A 1SIRA 3LG1A 2EC5A 1R3BA 2QG2A 3IEDA 4NH8A 4B6CA 4O09A 1Y4SA 2XX2A 5IDJA 2O1UA 4HY1A 2WI1A 2REHA 2YK2A 1GU6A 2CCSA 3CE2A 3GIGB 3JZ3A 3NMQA 2YGWA 3WHAA 4L8ZA 3LGQA 3FT8A 4HR3A 2IWUA 2ZO5A 1I5BA 2ZAFA 4FCRA 1FS9A 4CWRA 3PFDA 2Q8IA 3X0XA 3O2FA 2XDSA 1Y8PA 1OAHA 4F0XA 4ZVIA 4YKWA 2VCJA 2JIFA 1TC0A 4FCPA 2OR0A 3EHJA 3BNHA 4LWFA 5FNFA 2YKEA 2XQRB 4MOTA 4XITA 3D36A 4X28A 3R92A 4G5EA 4CWPA 2YKBA 1TH8A 3K60A 1YS3A 2WI3A 4LWEA 3P4TA 1YSRA 2C1IA 3TUHA 3EHHA 5CTXA 3S7WA 1TBWA 3EOMA 2FXSA 1S16A 2YK9A 2PG0A 3R4NA 3R91A 1GKXA 2J7AA 1U2OA 3RLQA 2YE5A 5C93A 1X91A 3D9FA 2BSMA 1RX0A 3OWDA 4ZKIA 2YE6A 4XC0A 1IXMA 4OO2A 2XDLA 2R0MA 4B7PA 2YYGA 1EA6A 1F51A 4FF1A 1JQIA 4XKAA 1IVHA 2YYKA 4H81A 3B96A 4FF2A 2R02A 3OMUA 5CTUA 1UYDA 4Q20A 4CWTA 2GFDA 2YKJA 4M9AA 4CWNA 1FS8A 2GQPA 3VHAA 4KSGA 3A0YA 3C0EA 5F3KA 2BREA 5J71A 4DOYA 5BRKA 1TIDA 3H4LA 2Q8FA 2YYIA 3R4MA 4YKTA 3MDDA 2VIGA 1YESA 1K8TA 1Z59A 2XABA 4I5SA 4U7NA 3SL2A 4KSAA 5K3HA 3BM9A 1GKZA 1K90A 2A1TA 1PI1A 4J1VA 5K3JA 2BRCA 2WI4A 5D6PA 1UY9A 4L93A 4URMA 2IX6A 4AKHA 2UWDA 1SC5A 2XHTA 4XIPA 2FYPA 2XD6A 2YI5A 2YEBA 4KS9A 2YE9A 3OIBA 3GIGA 4KQVA 2E0AA 1IS2A 1UKWA 4P7AA 3ZKDA 3N0RA 4KSFA 2WI2A
chains in the Genus database with same CATH topology
2ESAA 3FV5A 2BU7A 3HYYA 1PVGA 4HYMA 3RKZA 3B26A 3T1KA 5CF0A 1TILA 3ZXQA 3U2KA 4YKZA 1TC6A 2YJXA 4CE2A 3ZKBA 2QG0A 4GCZA 4JASA 4HXZA 1EI1A 1KIJA 2YEFA 1AH6A 2XK2A 4O04A 1L0OA 1US7A 3OPDA 2XHXA 4WUDA 4EGKA 4CWSA 5D7RA 4URLA 4E01A 4XE2A 2O1VA 2YKIA 4R3AA 2ZBKB 5BODA 1UYLA 4P8OA 4BXIA 2H8MA 4LP0A 2YKCA 4FPPA 1QY8A 4O0BA 4FMTA 4GT8A 4XDMA 4XIQA 1NHJA 1B63A 3B25A 4MB9A 3U2DA 2XDKA 1UYFA 4XKKA 2YI7A 3B28A 5CTYA 3LNUA 4BAEA 2AKPA 4YKQA 1BGQA 4ASAA 2BZ5A 3HEKA 1YT1A 5IDMA 4GGLA 4URNA 2XJXA 3Q5KA 4BIZA 2WI5A 3MNRP 1MU5A 1I58A 4CE1A 1I5AA 3TZ2A 2C2AA 1I5CA 3R4OA 4L94A 1UYKA 5D7CA 2XDXA 4XTJA 5M4PA 3FT5A 1H7SA 4KFGA 2XCMA 4WUBA 3RLPA 1S14A 2CH4A 4XKOA 2QFOA 2YE7A 1R62A 2Q8GA 1OSFA 3OWBA 4GQTA 4MP2A 1MX0A 2HG1A 1H7UA 3VADA 4QPKA 2BU5A 3T2SA 3T0ZA 4AWOA 2EXLA 1ZXNA 4EGHA 5FNDA 3VHDA 2YE4A 4DZYA 4KSHA 4CWOA 3G7BA 4R3MA 1YETA 1AM1A 2YEGA 1ZWHA 4EMVA 2WEQA 3TZ5A 4E00A 4W7TA 4O07A 4NH9A 4V26A 4WUCA 5M4EA 4HXWA 3LPSA 1Z5AA 1UYEA 1I5DA 1UYIA 3O0IA 4K4OA 4XCLA 4O05A 3D0BA 4YKUA 3G7EA 4LWHA 4UROA 3VHCA 3K97A 1UYCA 2YE2A 2YEJA 3QTFA 3A0XA 2YI6A 4QPJA 3RLRA 4XCJA 2ZDYA 1YC1A 3GIEA 5BOCA 5D7DA 2WI6A 4DUHA 5GGZA 2YGAA 1JM6A 2HCHA 4U93A 3Q5JA 2XJGA 3WQ9A 3TZ4A 2FWYA 3T0HA 4U7OA 3INWA 4LWIA 2YI0A 1Y8NA 1I59A 2BU8A 4HZ5A 3A0TA 5D6QA 1BXDA 1UYMA 2CCTA 4CWQA 1YSZA 2VCIA 2JKIA 4MBCA 4AWQA 1B3QA 1ID0A 4MPNA 4KTNA 2CCUA 3EKRA 4PL9A 4FCQA 3B24A 4HZ0A 1Y4UA 2O1WA 2QF6A 2YEAA 4YKRA 4L90A 1QZRA 2VW5A 3K99A 3HYZA 3C11A 2YJWA 2BYIA 4ASBA 3A0WA 3CWVA 1BYQA 2K5BA 3QDDA 4H85A 2YE3A 2WEPA 1QYEA 5F5RA 3Q5LA 5M4KA 4ASGA 1NHHA 3T10A 2CGFA 1YT2A 4MPCA 3TTZA 3ZXOA 3KE6A 4MP7A 2YEIA 2XDUA 3B27A 2PNRA 4H7QA 2VWCA 2Q2EB 2YEEA 2IOQA 3TZ0A 1KZNA 3EHGA 4CWFA 3HHUA 4BQGA 1ZXMA 3CGYA 3H80A 3PEHA 4JAVA 3PEJA 3A0ZA 2YGFA 2WERA 1AH8A 4HYPA 1B62A 4KP4A 2XX5A 5CTWA 4EFUA 4EGIA 3U67A 4PU9A 2XJJA 4I3HA 3HZ5A 4GFNA 4BQJA 4PRVA 1BKNA 1Z5CA 3BMYA 4EM7A 3A0RA 3GIFA 4ASFA 1A4HA 2ZKJA 3D2RA 5M4NA 1GJVA 5M4HA 4R1FA 4JQLA 4LPBA 4BIUA 2CG9A 1YC3A 4CE3A 4MPEA 2FWZA 4JAUA 1U0ZA 5IN9A 4LWGA 3O6OA 4PRXA 1UYGA 4XIRA 4EFTA 3CRKA 2XHRA 1THNA 1Y8OA 1Z5BA 2IWSA 2YE8A 2HKJA 1YT0A 3OW6A 1AJ6A 3R4PA 5FWKA 2YEHA 3INXA 3CRLA 3EKOA 3G75A 3HZ1A 2BU2A 2IORA 1NHIA 2WI7A 1UYHA 5M4MA 2H55A 3K98A 4YKYA 2BYHA 2ZDXA 2JJCA 4AWPA 1AMWA 5L3JA 3DGEA 4YKXA 2BT0A 3EHFA 3ZM7A 2Q8HA 4XD8A 4HY6A 2IOPA 1ZW9A 4EEHA 4NH7A 1UY7A 2YGEA 2IWXA 3CGZA 4GEEA 2BTZA 5CPHA 2XX4A 4X9LA 5FNCA 2BU6A 2YEDA 1UY6A 4L91A 1YERA 4V25A 5J6AA 4AS9A 2YECA 4E02A 1YC4A 1UY8A 2QG2A 3IEDA 4NH8A 4B6CA 4O09A 1Y4SA 2XX2A 5IDJA 2O1UA 4HY1A 2WI1A 2YK2A 2CCSA 3GIGB 3JZ3A 3NMQA 3WHAA 4L8ZA 3FT8A 2IWUA 1I5BA 4FCRA 4CWRA 2Q8IA 3O2FA 2XDSA 1Y8PA 4ZVIA 4YKWA 2VCJA 1TC0A 4FCPA 3EHJA 5FNFA 4LWFA 2YKEA 4MOTA 4XITA 3D36A 3R92A 4CWPA 2YKBA 1TH8A 3K60A 1YS3A 2WI3A 4LWEA 1YSRA 3TUHA 3EHHA 5CTXA 1TBWA 2FXSA 1S16A 2YK9A 3R4NA 3R91A 1GKXA 1U2OA 3RLQA 2YE5A 5C93A 2BSMA 3OWDA 4ZKIA 2YE6A 4XC0A 2XDLA 4B7PA 1EA6A 4XKAA 4H81A 5CTUA 3OMUA 1UYDA 4Q20A 4CWTA 2GFDA 2YKJA 4CWNA 2GQPA 3VHAA 4KSGA 3A0YA 3C0EA 5F3KA 2BREA 5J71A 1TIDA 3H4LA 2Q8FA 3R4MA 4YKTA 1YESA 2XABA 1Z59A 4I5SA 4U7NA 3SL2A 3BM9A 1GKZA 2WI4A 5D6PA 2BRCA 1UY9A 4L93A 4URMA 2UWDA 2XHTA 4XIPA 2FYPA 2XD6A 2YI5A 2YEBA 2YE9A 3GIGA 4KQVA 2E0AA 4P7AA 3ZKDA 2WI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESA A;  3FV5 A;  2BU7 A;  3HYY A;  1PVG A;  4HYM A;  3RKZ A;  3B26 A;  3T1K A;  5CF0 A;  1TIL A;  3ZXQ A;  3U2K A;  4YKZ A;  1TC6 A;  2YJX A;  4CE2 A;  3ZKB A;  2QG0 A;  4GCZ A;  4JAS A;  4HXZ A;  1EI1 A;  1KIJ A;  2YEF A;  1AH6 A;  2XK2 A;  4O04 A;  1L0O A;  1US7 A;  3OPD A;  2XHX A;  4WUD A;  4EGK A;  4CWS A;  5D7R A;  4URL A;  4E01 A;  4XE2 A;  2O1V A;  2YKI A;  4R3A A;  2ZBK B;  5BOD A;  1UYL A;  4P8O A;  4BXI A;  2H8M A;  4LP0 A;  2YKC A;  4FPP A;  1QY8 A;  4O0B A;  4FMT A;  4GT8 A;  4XDM A;  4XIQ A;  1NHJ A;  1B63 A;  3B25 A;  4MB9 A;  3U2D A;  2XDK A;  1UYF A;  4XKK A;  2YI7 A;  3B28 A;  5CTY A;  3LNU A;  4BAE A;  2AKP A;  4YKQ A;  1BGQ A;  4ASA A;  2BZ5 A;  3HEK A;  1YT1 A;  5IDM A;  4GGL A;  4URN A;  2XJX A;  3Q5K A;  4BIZ A;  2WI5 A;  3MNR P;  1MU5 A;  1I58 A;  4CE1 A;  1I5A A;  3TZ2 A;  2C2A A;  1I5C A;  3R4O A;  4L94 A;  1UYK A;  5D7C A;  2XDX A;  4XTJ A;  5M4P A;  3FT5 A;  1H7S A;  4KFG A;  2XCM A;  4WUB A;  3RLP A;  1S14 A;  2CH4 A;  4XKO A;  2QFO A;  2YE7 A;  1R62 A;  2Q8G A;  1OSF A;  3OWB A;  4GQT A;  4MP2 A;  1MX0 A;  2HG1 A;  1H7U A;  3VAD A;  4QPK A;  2BU5 A;  3T2S A;  3T0Z A;  4AWO A;  2EXL A;  1ZXN A;  4EGH A;  5FND A;  3VHD A;  2YE4 A;  4DZY A;  4KSH A;  4CWO A;  3G7B A;  4R3M A;  1YET A;  1AM1 A;  2YEG A;  1ZWH A;  4EMV A;  2WEQ A;  3TZ5 A;  4E00 A;  4W7T A;  4O07 A;  4NH9 A;  4V26 A;  4WUC A;  5M4E A;  4HXW A;  3LPS A;  1Z5A A;  1UYE A;  1I5D A;  1UYI A;  3O0I A;  4K4O A;  4XCL A;  4O05 A;  3D0B A;  4YKU A;  3G7E A;  4LWH A;  4URO A;  3VHC A;  3K97 A;  1UYC A;  2YE2 A;  2YEJ A;  3QTF A;  3A0X A;  2YI6 A;  4QPJ A;  3RLR A;  4XCJ A;  2ZDY A;  1YC1 A;  3GIE A;  5BOC A;  5D7D A;  2WI6 A;  4DUH A;  5GGZ A;  2YGA A;  1JM6 A;  2HCH A;  4U93 A;  3Q5J A;  2XJG A;  3WQ9 A;  3TZ4 A;  2FWY A;  3T0H A;  4U7O A;  3INW A;  4LWI A;  2YI0 A;  1Y8N A;  1I59 A;  2BU8 A;  4HZ5 A;  3A0T A;  5D6Q A;  1BXD A;  1UYM A;  2CCT A;  4CWQ A;  1YSZ A;  2VCI A;  2JKI A;  4MBC A;  4AWQ A;  1B3Q A;  1ID0 A;  4MPN A;  4KTN A;  2CCU A;  3EKR A;  4PL9 A;  4FCQ A;  3B24 A;  4HZ0 A;  1Y4U A;  2O1W A;  2QF6 A;  2YEA A;  4YKR A;  4L90 A;  1QZR A;  2VW5 A;  3K99 A;  3HYZ A;  3C11 A;  2YJW A;  2BYI A;  4ASB A;  3A0W A;  3CWV A;  1BYQ A;  2K5B A;  3QDD A;  4H85 A;  2YE3 A;  2WEP A;  1QYE A;  5F5R A;  3Q5L A;  5M4K A;  4ASG A;  1NHH A;  3T10 A;  2CGF A;  1YT2 A;  4MPC A;  3TTZ A;  3ZXO A;  3KE6 A;  4MP7 A;  2YEI A;  2XDU A;  3B27 A;  2PNR A;  4H7Q A;  2VWC A;  2Q2E B;  2YEE A;  2IOQ A;  3TZ0 A;  1KZN A;  3EHG A;  4CWF A;  3HHU A;  4BQG A;  1ZXM A;  3CGY A;  3H80 A;  3PEH A;  4JAV A;  3PEJ A;  3A0Z A;  2YGF A;  2WER A;  1AH8 A;  4HYP A;  1B62 A;  4KP4 A;  2XX5 A;  5CTW A;  4EFU A;  4EGI A;  3U67 A;  4PU9 A;  2XJJ A;  4I3H A;  3HZ5 A;  4GFN A;  4BQJ A;  4PRV A;  1BKN A;  1Z5C A;  3BMY A;  4EM7 A;  3A0R A;  3GIF A;  4ASF A;  1A4H A;  2ZKJ A;  3D2R A;  5M4N A;  1GJV A;  5M4H A;  4R1F A;  4JQL A;  4LPB A;  4BIU A;  2CG9 A;  1YC3 A;  4CE3 A;  4MPE A;  2FWZ A;  4JAU A;  1U0Z A;  5IN9 A;  4LWG A;  3O6O A;  4PRX A;  1UYG A;  4XIR A;  4EFT A;  3CRK A;  2XHR A;  1THN A;  1Y8O A;  1Z5B A;  2IWS A;  2YE8 A;  2HKJ A;  1YT0 A;  3OW6 A;  1AJ6 A;  3R4P A;  5FWK A;  2YEH A;  3INX A;  3CRL A;  3EKO A;  3G75 A;  3HZ1 A;  2BU2 A;  2IOR A;  1NHI A;  2WI7 A;  1UYH A;  5M4M A;  2H55 A;  3K98 A;  4YKY A;  2BYH A;  2ZDX A;  2JJC A;  4AWP A;  1AMW A;  5L3J A;  3DGE A;  4YKX A;  2BT0 A;  3EHF A;  3ZM7 A;  2Q8H A;  4XD8 A;  4HY6 A;  2IOP A;  1ZW9 A;  4EEH A;  4NH7 A;  1UY7 A;  2YGE A;  2IWX A;  3CGZ A;  4GEE A;  2BTZ A;  5CPH A;  2XX4 A;  4X9L A;  5FNC A;  2BU6 A;  2YED A;  1UY6 A;  4L91 A;  1YER A;  4V25 A;  5J6A A;  4AS9 A;  2YEC A;  4E02 A;  1YC4 A;  1UY8 A;  2QG2 A;  3IED A;  4NH8 A;  4B6C A;  4O09 A;  1Y4S A;  2XX2 A;  5IDJ A;  2O1U A;  4HY1 A;  2WI1 A;  2YK2 A;  2CCS A;  3GIG B;  3JZ3 A;  3NMQ A;  3WHA A;  4L8Z A;  3FT8 A;  2IWU A;  1I5B A;  4FCR A;  4CWR A;  2Q8I A;  3O2F A;  2XDS A;  1Y8P A;  4ZVI A;  4YKW A;  2VCJ A;  1TC0 A;  4FCP A;  3EHJ A;  5FNF A;  4LWF A;  2YKE A;  4MOT A;  4XIT A;  3D36 A;  3R92 A;  4CWP A;  2YKB A;  1TH8 A;  3K60 A;  1YS3 A;  2WI3 A;  4LWE A;  1YSR A;  3TUH A;  3EHH A;  5CTX A;  1TBW A;  2FXS A;  1S16 A;  2YK9 A;  3R4N A;  3R91 A;  1GKX A;  1U2O A;  3RLQ A;  2YE5 A;  5C93 A;  2BSM A;  3OWD A;  4ZKI A;  2YE6 A;  4XC0 A;  2XDL A;  4B7P A;  1EA6 A;  4XKA A;  4H81 A;  5CTU A;  3OMU A;  1UYD A;  4Q20 A;  4CWT A;  2GFD A;  2YKJ A;  4CWN A;  2GQP A;  3VHA A;  4KSG A;  3A0Y A;  3C0E A;  5F3K A;  2BRE A;  5J71 A;  1TID A;  3H4L A;  2Q8F A;  3R4M A;  4YKT A;  1YES A;  2XAB A;  1Z59 A;  4I5S A;  4U7N A;  3SL2 A;  3BM9 A;  1GKZ A;  2WI4 A;  5D6P A;  2BRC A;  1UY9 A;  4L93 A;  4URM A;  2UWD A;  2XHT A;  4XIP A;  2FYP A;  2XD6 A;  2YI5 A;  2YEB A;  2YE9 A;  3GIG A;  4KQV A;  2E0A A;  4P7A A;  3ZKD A;  2WI2 A; 
#chains in the Genus database with same CATH topology
 3S5T A;  2ESA A;  3FV5 A;  2BU7 A;  3HYY A;  1PVG A;  4HYM A;  4NXL A;  3B26 A;  3RKZ A;  3T1K A;  5CF0 A;  1TIL A;  3ZXQ A;  3U2K A;  3VKH A;  2Z1Q A;  4YKZ A;  1TC6 A;  5B5W A;  2YJX A;  2OJQ A;  4CE2 A;  2JBT A;  3ZKB A;  2QG0 A;  4GCZ A;  4JAS A;  4HXZ A;  1EI1 A;  1KIJ A;  2YEF A;  1AH6 A;  2XK2 A;  4O04 A;  1L0O A;  1US7 A;  3OPD A;  1XG2 B;  2XHX A;  4WUD A;  4EGK A;  4CWS A;  3UU9 A;  5D7R A;  4URL A;  3FCJ A;  4N5F A;  4E01 A;  4XE2 A;  2O1V A;  5B5V A;  3AFF A;  2YKI A;  4R3A A;  4KCF A;  4HKS A;  2ZBK B;  5BOD A;  1UYL A;  5B6B A;  1T9G A;  4P79 A;  4P8O A;  3II9 A;  4BXI A;  2H8M A;  4LP0 A;  3L1T A;  1LVC A;  2YKC A;  2YYJ A;  4FPP A;  1XFZ A;  1QY8 A;  4O0B A;  4ZYJ A;  4FMT A;  4GT8 A;  4XDM A;  4XIQ A;  1NHJ A;  1B63 A;  3B25 A;  4FF4 A;  4MB9 A;  3U2D A;  2R05 A;  2XDK A;  1UYF A;  4AKG A;  4XKK A;  2HJN A;  2YI7 A;  3B28 A;  5CTY A;  3LNU A;  4BAE A;  2AKP A;  1XFV A;  1BGQ A;  3BNG A;  4YKQ A;  4ASA A;  1R2J A;  2UXW A;  2BZ5 A;  1SIQ A;  1YT1 A;  3HEK A;  5IDM A;  4GGL A;  3Q22 A;  4URN A;  4Q5B A;  2XJX A;  3Q5K A;  4BIZ A;  2WI5 A;  2E80 A;  3Q24 A;  3MNR P;  1MU5 A;  2CJ8 A;  1I58 A;  4CE1 A;  2VF1 A;  1I5A A;  2AO2 A;  3TZ2 A;  2C2A A;  1I5C A;  3R4O A;  2C12 A;  1UYK A;  4L94 A;  5D7C A;  1EGD A;  2XDX A;  4XTJ A;  5M4P A;  1UDY A;  2YYL A;  4IV6 A;  3FT5 A;  1H7S A;  1RJ1 A;  1BUC A;  3OWA A;  2XCM A;  4KFG A;  4WUB A;  3FO3 A;  2R0N A;  3RLP A;  1S14 A;  2CH4 A;  4XKO A;  2QFO A;  2YE7 A;  1R62 A;  2Q8G A;  2WBI A;  2CJ4 A;  3TOR A;  1OSF A;  3OWB A;  4GQT A;  1XFW A;  4MP2 A;  1MX0 A;  5JEN A;  2HG1 A;  1H7U A;  3VAD A;  4QPK A;  1S26 A;  2BU5 A;  3BNJ A;  5BRM A;  3T2S A;  1U8V A;  3D9D A;  3T0Z A;  4AWO A;  2EXL A;  1ZXN A;  4EGH A;  5FND A;  4Q4U A;  3VHD A;  3D6B A;  3HWC A;  4ZXV A;  2YE4 A;  4DZY A;  4KSH A;  2GBB A;  4CWO A;  3G7B A;  3X29 A;  4R3M A;  1YET A;  1AM1 A;  2YEG A;  1ZWH A;  2DVL A;  4P13 A;  4EMV A;  2WEQ A;  3TZ5 A;  1EGC A;  4E00 A;  4W7T A;  4O07 A;  5K3I A;  4NH9 A;  4V26 A;  1K93 A;  3OWM A;  4WUC A;  5M4E A;  2RFQ A;  4HXW A;  3LPS A;  1Z5A A;  1UYE A;  1XFX A;  1I5D A;  3D9E A;  2RF7 A;  1UYI A;  3O0I A;  4K4O A;  4XCL A;  4O05 A;  3D0B A;  3AFE A;  4U83 A;  4YKU A;  5GJW E;  3BNF A;  2LFW A;  4FZ4 A;  3G7E A;  4LWH A;  3NF4 A;  3RKH A;  2EBH X;  4URO A;  3K97 A;  3VHC A;  1UYC A;  3MXL A;  2YE2 A;  2YEJ A;  3QTF A;  3A0X A;  2YI6 A;  4QPJ A;  2CJ5 A;  3RLR A;  3UBR A;  3EON A;  2ZDY A;  1YC1 A;  4XCJ A;  3GIE A;  5BOC A;  5D7D A;  2WI6 A;  4DUH A;  4JIZ A;  4L3Y A;  3C46 A;  3SXQ A;  5GGZ A;  2YGA A;  1JM6 A;  3MKH A;  2HCH A;  4U93 A;  3Q5J A;  2XJG A;  3WQ9 A;  3TZ4 A;  2FWY A;  3T0H A;  3MPJ A;  4U7O A;  3INW A;  4G97 A;  2C1G A;  2YI0 A;  4LWI A;  1Y8N A;  1I59 A;  2BU8 A;  4HZ5 A;  3A0T A;  5D6Q A;  1BXD A;  4Q5C A;  1UYM A;  2CCT A;  2EBA A;  4CWQ A;  3Q23 A;  1YSZ A;  2AZE A;  2VCI A;  2JKI A;  4MBC A;  1EGE A;  4AWQ A;  1B3Q A;  4LQS B;  1XFY A;  2DDH A;  2JBS A;  2XS1 A;  3C2P A;  4Q0T A;  3Q0A A;  1W07 A;  3F29 A;  1ID0 A;  4MPN A;  4KTN A;  3SF6 A;  2CCU A;  3EKR A;  4PL9 A;  2CX9 A;  4JIO A;  1X90 A;  2F6L A;  2RDZ A;  4QIC A;  3B24 A;  4FCQ A;  4HZ0 A;  1Y4U A;  2O1W A;  2QF6 A;  2YEA A;  2VR0 A;  4YKR A;  4L90 A;  1QZR A;  2FTK A;  4KTO A;  2VW5 A;  5K3G A;  3K99 A;  3HYZ A;  3C11 A;  4XVX A;  2YJW A;  2BYI A;  4ASB A;  3A0W A;  3CWV A;  1BYQ A;  2K5B A;  3CYG A;  3QDD A;  4H85 A;  2YE3 A;  2WEP A;  4JEK A;  1QYE A;  4LQQ B;  3LMM A;  5F5R A;  3Q5L A;  5M4K A;  4ASG A;  2PO4 A;  1NHH A;  4L3X A;  1PK0 A;  2CGF A;  3T10 A;  1YT2 A;  2CJ6 A;  4IRN A;  4MPC A;  3TTZ A;  3ZXO A;  3KE6 A;  3D1I A;  1RP3 A;  4MP7 A;  2XDU A;  2YEI A;  3B27 A;  3MPI A;  4O5M A;  4Q17 A;  2PNR A;  4H7Q A;  2VWC A;  1WS9 A;  2FON A;  2Q2E B;  3KML A;  2YEE A;  2IOQ A;  3SCE A;  3TZ0 A;  1KZN A;  3GNC A;  3EHG A;  2CJ7 A;  4CWF A;  3HHU A;  4BQG A;  1ZXM A;  3CGY A;  3H80 A;  3PEH A;  4JAV A;  3TTB A;  3A0Z A;  3PEJ A;  4WJY A;  2YGF A;  2E81 A;  2YYM A;  3D9G A;  2R03 A;  1Y0V A;  4HKR A;  2WER A;  1AH8 A;  4HYP A;  5GJV E;  1B62 A;  2XX5 A;  4KP4 A;  5CTW A;  4EFU A;  4EGI A;  3U67 A;  4PU9 A;  4W9U A;  2XJJ A;  1SK6 A;  4I3H A;  3HZ5 A;  4GFN A;  4BQJ A;  4PRV A;  1BKN A;  1Z5C A;  3BMY A;  2IX5 A;  4EM7 A;  3A0R A;  3GIF A;  1QDB A;  4Q1O A;  4ASF A;  1A4H A;  1FS7 A;  3GQT A;  2ZKJ A;  1XFU A;  3MMO A;  3D2R A;  4RM7 A;  5M4N A;  3X0Y A;  1GJV A;  1X8Z A;  5M4H A;  2EBF X;  4R1F A;  2FP1 A;  4JQL A;  4LPB A;  4BIU A;  4AKI A;  2CG9 A;  4L38 A;  1YC3 A;  4CE3 A;  4MPE A;  2FWZ A;  2QR4 A;  2JBR A;  3VKG A;  4JAU A;  1U0Z A;  5IN9 A;  4LWG A;  3O6O A;  4PRX A;  1UYG A;  4XIR A;  2OT4 A;  4EFT A;  3CRK A;  2XHR A;  1RJ4 A;  2XS8 A;  1THN A;  1Y8O A;  1Z5B A;  2IWS A;  4AI6 A;  2YE8 A;  2HKJ A;  1YT0 A;  3OW6 A;  4E72 A;  1AJ6 A;  3R4P A;  5FWK A;  3SWO A;  2HHI A;  2OEV A;  2YEH A;  3INX A;  3CRL A;  3EKO A;  2OEX A;  4FF3 A;  3G75 A;  3HZ1 A;  2BU2 A;  2IOR A;  2FP2 A;  1NHI A;  4L3Z A;  2WI7 A;  1UYH A;  5M4M A;  2H55 A;  3M9V A;  3K98 A;  4YKY A;  2BYH A;  2ZDX A;  2JJC A;  4AWP A;  1AMW A;  5L3J A;  3DGE A;  3R7K A;  2BT0 A;  3EHF A;  4YKX A;  2Q8H A;  2C0U A;  3ZM7 A;  4XD8 A;  4HY6 A;  3GM6 A;  1ZW9 A;  4L1F A;  2IOP A;  4EEH A;  4NH7 A;  1UY7 A;  2YGE A;  2IWX A;  3CGZ A;  4GEE A;  2BTZ A;  5CPH A;  2XX4 A;  4X9L A;  5FNC A;  2BU6 A;  2YED A;  3MDE A;  1UY6 A;  4L91 A;  1YER A;  2D29 A;  4V25 A;  3C3L A;  5J6A A;  4AS9 A;  2YEC A;  4X28 C;  4E02 A;  1YC4 A;  1UY8 A;  1SIR A;  3LG1 A;  2EC5 A;  1R3B A;  2QG2 A;  3IED A;  4NH8 A;  4B6C A;  4O09 A;  1Y4S A;  2XX2 A;  5IDJ A;  2O1U A;  4HY1 A;  2WI1 A;  2REH A;  2YK2 A;  1GU6 A;  2CCS A;  3CE2 A;  3GIG B;  3JZ3 A;  3NMQ A;  2YGW A;  3WHA A;  4L8Z A;  3LGQ A;  3FT8 A;  4HR3 A;  2IWU A;  2ZO5 A;  1I5B A;  2ZAF A;  4FCR A;  1FS9 A;  4CWR A;  3PFD A;  2Q8I A;  3X0X A;  3O2F A;  2XDS A;  1Y8P A;  1OAH A;  4F0X A;  4ZVI A;  4YKW A;  2VCJ A;  2JIF A;  1TC0 A;  4FCP A;  2OR0 A;  3EHJ A;  3BNH A;  4LWF A;  5FNF A;  2YKE A;  2XQR B;  4MOT A;  4XIT A;  3D36 A;  4X28 A;  3R92 A;  4G5E A;  4CWP A;  2YKB A;  1TH8 A;  3K60 A;  1YS3 A;  2WI3 A;  4LWE A;  3P4T A;  1YSR A;  2C1I A;  3TUH A;  3EHH A;  5CTX A;  3S7W A;  1TBW A;  3EOM A;  2FXS A;  1S16 A;  2YK9 A;  2PG0 A;  3R4N A;  3R91 A;  1GKX A;  2J7A A;  1U2O A;  3RLQ A;  2YE5 A;  5C93 A;  1X91 A;  3D9F A;  2BSM A;  1RX0 A;  3OWD A;  4ZKI A;  2YE6 A;  4XC0 A;  1IXM A;  4OO2 A;  2XDL A;  2R0M A;  4B7P A;  2YYG A;  1EA6 A;  1F51 A;  4FF1 A;  1JQI A;  4XKA A;  1IVH A;  2YYK A;  4H81 A;  3B96 A;  4FF2 A;  2R02 A;  3OMU A;  5CTU A;  1UYD A;  4Q20 A;  4CWT A;  2GFD A;  2YKJ A;  4M9A A;  4CWN A;  1FS8 A;  2GQP A;  3VHA A;  4KSG A;  3A0Y A;  3C0E A;  5F3K A;  2BRE A;  5J71 A;  4DOY A;  5BRK A;  1TID A;  3H4L A;  2Q8F A;  2YYI A;  3R4M A;  4YKT A;  3MDD A;  2VIG A;  1YES A;  1K8T A;  1Z59 A;  2XAB A;  4I5S A;  4U7N A;  3SL2 A;  4KSA A;  5K3H A;  3BM9 A;  1GKZ A;  1K90 A;  2A1T A;  1PI1 A;  4J1V A;  5K3J A;  2BRC A;  2WI4 A;  5D6P A;  1UY9 A;  4L93 A;  4URM A;  2IX6 A;  4AKH A;  2UWD A;  1SC5 A;  2XHT A;  4XIP A;  2FYP A;  2XD6 A;  2YI5 A;  2YEB A;  4KS9 A;  2YE9 A;  3OIB A;  3GIG A;  4KQV A;  2E0A A;  1IS2 A;  1UKW A;  4P7A A;  3ZKD A;  3N0R A;  4KSF A;  2WI2 A; 
#chains in the Genus database with same CATH homology
 2ESA A;  3FV5 A;  2BU7 A;  3HYY A;  1PVG A;  4HYM A;  3RKZ A;  3B26 A;  3T1K A;  5CF0 A;  1TIL A;  3ZXQ A;  3U2K A;  4YKZ A;  1TC6 A;  2YJX A;  4CE2 A;  3ZKB A;  2QG0 A;  4GCZ A;  4JAS A;  4HXZ A;  1EI1 A;  1KIJ A;  2YEF A;  1AH6 A;  2XK2 A;  4O04 A;  1L0O A;  1US7 A;  3OPD A;  2XHX A;  4WUD A;  4EGK A;  4CWS A;  5D7R A;  4URL A;  4E01 A;  4XE2 A;  2O1V A;  2YKI A;  4R3A A;  2ZBK B;  5BOD A;  1UYL A;  4P8O A;  4BXI A;  2H8M A;  4LP0 A;  2YKC A;  4FPP A;  1QY8 A;  4O0B A;  4FMT A;  4GT8 A;  4XDM A;  4XIQ A;  1NHJ A;  1B63 A;  3B25 A;  4MB9 A;  3U2D A;  2XDK A;  1UYF A;  4XKK A;  2YI7 A;  3B28 A;  5CTY A;  3LNU A;  4BAE A;  2AKP A;  4YKQ A;  1BGQ A;  4ASA A;  2BZ5 A;  3HEK A;  1YT1 A;  5IDM A;  4GGL A;  4URN A;  2XJX A;  3Q5K A;  4BIZ A;  2WI5 A;  3MNR P;  1MU5 A;  1I58 A;  4CE1 A;  1I5A A;  3TZ2 A;  2C2A A;  1I5C A;  3R4O A;  4L94 A;  1UYK A;  5D7C A;  2XDX A;  4XTJ A;  5M4P A;  3FT5 A;  1H7S A;  4KFG A;  2XCM A;  4WUB A;  3RLP A;  1S14 A;  2CH4 A;  4XKO A;  2QFO A;  2YE7 A;  1R62 A;  2Q8G A;  1OSF A;  3OWB A;  4GQT A;  4MP2 A;  1MX0 A;  2HG1 A;  1H7U A;  3VAD A;  4QPK A;  2BU5 A;  3T2S A;  3T0Z A;  4AWO A;  2EXL A;  1ZXN A;  4EGH A;  5FND A;  3VHD A;  2YE4 A;  4DZY A;  4KSH A;  4CWO A;  3G7B A;  4R3M A;  1YET A;  1AM1 A;  2YEG A;  1ZWH A;  4EMV A;  2WEQ A;  3TZ5 A;  4E00 A;  4W7T A;  4O07 A;  4NH9 A;  4V26 A;  4WUC A;  5M4E A;  4HXW A;  3LPS A;  1Z5A A;  1UYE A;  1I5D A;  1UYI A;  3O0I A;  4K4O A;  4XCL A;  4O05 A;  3D0B A;  4YKU A;  3G7E A;  4LWH A;  4URO A;  3VHC A;  3K97 A;  1UYC A;  2YE2 A;  2YEJ A;  3QTF A;  3A0X A;  2YI6 A;  4QPJ A;  3RLR A;  4XCJ A;  2ZDY A;  1YC1 A;  3GIE A;  5BOC A;  5D7D A;  2WI6 A;  4DUH A;  5GGZ A;  2YGA A;  1JM6 A;  2HCH A;  4U93 A;  3Q5J A;  2XJG A;  3WQ9 A;  3TZ4 A;  2FWY A;  3T0H A;  4U7O A;  3INW A;  4LWI A;  2YI0 A;  1Y8N A;  1I59 A;  2BU8 A;  4HZ5 A;  3A0T A;  5D6Q A;  1BXD A;  1UYM A;  2CCT A;  4CWQ A;  1YSZ A;  2VCI A;  2JKI A;  4MBC A;  4AWQ A;  1B3Q A;  1ID0 A;  4MPN A;  4KTN A;  2CCU A;  3EKR A;  4PL9 A;  4FCQ A;  3B24 A;  4HZ0 A;  1Y4U A;  2O1W A;  2QF6 A;  2YEA A;  4YKR A;  4L90 A;  1QZR A;  2VW5 A;  3K99 A;  3HYZ A;  3C11 A;  2YJW A;  2BYI A;  4ASB A;  3A0W A;  3CWV A;  1BYQ A;  2K5B A;  3QDD A;  4H85 A;  2YE3 A;  2WEP A;  1QYE A;  5F5R A;  3Q5L A;  5M4K A;  4ASG A;  1NHH A;  3T10 A;  2CGF A;  1YT2 A;  4MPC A;  3TTZ A;  3ZXO A;  3KE6 A;  4MP7 A;  2YEI A;  2XDU A;  3B27 A;  2PNR A;  4H7Q A;  2VWC A;  2Q2E B;  2YEE A;  2IOQ A;  3TZ0 A;  1KZN A;  3EHG A;  4CWF A;  3HHU A;  4BQG A;  1ZXM A;  3CGY A;  3H80 A;  3PEH A;  4JAV A;  3PEJ A;  3A0Z A;  2YGF A;  2WER A;  1AH8 A;  4HYP A;  1B62 A;  4KP4 A;  2XX5 A;  5CTW A;  4EFU A;  4EGI A;  3U67 A;  4PU9 A;  2XJJ A;  4I3H A;  3HZ5 A;  4GFN A;  4BQJ A;  4PRV A;  1BKN A;  1Z5C A;  3BMY A;  4EM7 A;  3A0R A;  3GIF A;  4ASF A;  1A4H A;  2ZKJ A;  3D2R A;  5M4N A;  1GJV A;  5M4H A;  4R1F A;  4JQL A;  4LPB A;  4BIU A;  2CG9 A;  1YC3 A;  4CE3 A;  4MPE A;  2FWZ A;  4JAU A;  1U0Z A;  5IN9 A;  4LWG A;  3O6O A;  4PRX A;  1UYG A;  4XIR A;  4EFT A;  3CRK A;  2XHR A;  1THN A;  1Y8O A;  1Z5B A;  2IWS A;  2YE8 A;  2HKJ A;  1YT0 A;  3OW6 A;  1AJ6 A;  3R4P A;  5FWK A;  2YEH A;  3INX A;  3CRL A;  3EKO A;  3G75 A;  3HZ1 A;  2BU2 A;  2IOR A;  1NHI A;  2WI7 A;  1UYH A;  5M4M A;  2H55 A;  3K98 A;  4YKY A;  2BYH A;  2ZDX A;  2JJC A;  4AWP A;  1AMW A;  5L3J A;  3DGE A;  4YKX A;  2BT0 A;  3EHF A;  3ZM7 A;  2Q8H A;  4XD8 A;  4HY6 A;  2IOP A;  1ZW9 A;  4EEH A;  4NH7 A;  1UY7 A;  2YGE A;  2IWX A;  3CGZ A;  4GEE A;  2BTZ A;  5CPH A;  2XX4 A;  4X9L A;  5FNC A;  2BU6 A;  2YED A;  1UY6 A;  4L91 A;  1YER A;  4V25 A;  5J6A A;  4AS9 A;  2YEC A;  4E02 A;  1YC4 A;  1UY8 A;  2QG2 A;  3IED A;  4NH8 A;  4B6C A;  4O09 A;  1Y4S A;  2XX2 A;  5IDJ A;  2O1U A;  4HY1 A;  2WI1 A;  2YK2 A;  2CCS A;  3GIG B;  3JZ3 A;  3NMQ A;  3WHA A;  4L8Z A;  3FT8 A;  2IWU A;  1I5B A;  4FCR A;  4CWR A;  2Q8I A;  3O2F A;  2XDS A;  1Y8P A;  4ZVI A;  4YKW A;  2VCJ A;  1TC0 A;  4FCP A;  3EHJ A;  5FNF A;  4LWF A;  2YKE A;  4MOT A;  4XIT A;  3D36 A;  3R92 A;  4CWP A;  2YKB A;  1TH8 A;  3K60 A;  1YS3 A;  2WI3 A;  4LWE A;  1YSR A;  3TUH A;  3EHH A;  5CTX A;  1TBW A;  2FXS A;  1S16 A;  2YK9 A;  3R4N A;  3R91 A;  1GKX A;  1U2O A;  3RLQ A;  2YE5 A;  5C93 A;  2BSM A;  3OWD A;  4ZKI A;  2YE6 A;  4XC0 A;  2XDL A;  4B7P A;  1EA6 A;  4XKA A;  4H81 A;  5CTU A;  3OMU A;  1UYD A;  4Q20 A;  4CWT A;  2GFD A;  2YKJ A;  4CWN A;  2GQP A;  3VHA A;  4KSG A;  3A0Y A;  3C0E A;  5F3K A;  2BRE A;  5J71 A;  1TID A;  3H4L A;  2Q8F A;  3R4M A;  4YKT A;  1YES A;  2XAB A;  1Z59 A;  4I5S A;  4U7N A;  3SL2 A;  3BM9 A;  1GKZ A;  2WI4 A;  5D6P A;  2BRC A;  1UY9 A;  4L93 A;  4URM A;  2UWD A;  2XHT A;  4XIP A;  2FYP A;  2XD6 A;  2YI5 A;  2YEB A;  2YE9 A;  3GIG A;  4KQV A;  2E0A A;  4P7A A;  3ZKD A;  2WI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...