2Q8GA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with glucose-lowering drug azd7545
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
383
structure length
368
Chain Sequence
b'GVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNDDWCVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 368
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8gA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8gA02
4XITA 2BU8A 4XE2A 5BODA 1I5DA 2XJXA 1Z5BA 1R62A 3MNRP 4XIRA 2XHXA 1B62A 4GGLA 4JQLA 4YKQA 2C2AA 1US7A 4PU9A 3EKOA 2XHTA 3ZM7A 3Q5JA 1S14A 2BYHA 4O09A 4YKTA 2WI4A 1I5CA 2IOQA 3K99A 2YE2A 3EHJA 4AWQA 4GFNA 1MX0A 3BM9A 4AWPA 3TZ4A 3HYZA 4WUDA 5L3JA 4FCQA 2O1WA 3T2SA 3CRLA 1TC0A 4MP7A 1ZWHA 2CGFA 2YK9A 5D6PA 4HXWA 2E0AA 5CTYA 3FT5A 3CWVA 3EHFA 4YKWA 2YKCA 3TZ2A 4MP2A 2YE4A 4XD8A 3T1KA 4NH8A 4O07A 3VADA 4Q20A 4EEHA 2BZ5A 1Y8NA 4P8OA 4JAVA 1YC4A 3HZ5A 2Q8GA 2Q2EB 2YE8A 2YGEA 3C11A 4XCJA 2YE5A 4HXZA 4EM7A 1UY9A 1YC3A 1H7UA 1EI1A 5CTWA 2YEJA 4URMA 2YEDA 1B63A 5CPHA 4DZYA 1Y4UA 2YI5A 5M4PA 3HEKA 3HZ1A 1YC1A 4GQTA 1Y4SA 3VHCA 3D36A 4KFGA 3JZ3A 4MPEA 3U67A 1Y8PA 4XIQA 1I5AA 4KSGA 4MPCA 3K60A 2XJGA 2H55A 1EA6A 4HY6A 2YEEA 4B7PA 2YEHA 4KSHA 3NMQA 4ASAA 2ZKJA 2BRCA 4FMTA 2BU7A 4QPJA 4LWIA 4EGHA 4URNA 5F5RA 3R92A 2XX4A 4E00A 4HY1A 4CE1A 1KIJA 1S16A 4NH9A 1UYCA 2ZBKB 5IN9A 4R3AA 4LWEA 2JJCA 1YESA 1PVGA 3CGZA 3OMUA 4BQGA 2FYPA 4R1FA 1BYQA 1TBWA 1U0ZA 1YSZA 4W7TA 4O05A 1GKXA 4YKRA 4XCLA 4BIUA 4B6CA 2WI2A 2XJJA 3GIFA 1UYFA 2WI6A 3QTFA 4L8ZA 3O0IA 3O2FA 2CCUA 1Z5AA 2K5BA 3PEHA 3OPDA 2WEQA 3T0ZA 2BTZA 5D7DA 3GIGB 3OWDA 1Z59A 4YKZA 5D7RA 3GIGA 4I3HA 1THNA 5J71A 1B3QA 3CGYA 4LWGA 1H7SA 2YGAA 2YK2A 1TIDA 3T10A 1ZXNA 4QPKA 2CG9A 4ZKIA 2XDLA 4HYMA 4BIZA 5FNCA 2HKJA 1ZW9A 1UYIA 2YE3A 4PL9A 4CWOA 2YE9A 1MU5A 4KQVA 5F3KA 3FV5A 2YKJA 2QG2A 3LPSA 5M4EA 3EHGA 4XDMA 3VHDA 4HZ5A 3B27A 3OW6A 4ZVIA 4X9LA 3A0XA 4CWPA 1QYEA 3TZ0A 4URLA 2YKBA 4V25A 2IWUA 3SL2A 3K97A 3QDDA 1I58A 1YSRA 2WI5A 2YEBA 3ZXQA 5FNFA 2WERA 4MBCA 3H80A 3RKZA 5M4MA 1GKZA 4U7OA 2Q8IA 1YT2A 4CWFA 5GGZA 2BU2A 3U2DA 3RLQA 2XHRA 2YE7A 3FT8A 4DUHA 2XDXA 3TZ5A 3A0RA 4K4OA 2Q8HA 3PEJA 1AM1A 1YETA 2YI0A 1BKNA 2WI7A 1NHHA 5J6AA 2WEPA 2QFOA 3C0EA 3IEDA 4FCRA 4L93A 4EFUA 2YEFA 2XDUA 4E01A 3INWA 4KTNA 3G7EA 2O1UA 5M4KA 2YI6A 5M4NA 4XKOA 2YJXA 1I5BA 2YE6A 4KP4A 2VCIA 4PRVA 3D0BA 2H8MA 1TILA 3A0WA 5M4HA 4AWOA 1Z5CA 4O0BA 2YEGA 4EGKA 2VCJA 2BU5A 3A0YA 4GEEA 2CH4A 2CCTA 1YT0A 3LNUA 4H81A 4CE3A 1Y8OA 2BU6A 3B25A 3BMYA 4BQJA 2HCHA 4BXIA 1KZNA 4GCZA 3OWBA 1I59A 4UROA 1OSFA 2IWSA 3B26A 3ZKDA 2PNRA 4LPBA 4YKXA 2IORA 4LP0A 4ASGA 4CE2A 2O1VA 1JM6A 1NHJA 3R91A 2XK2A 2ZDYA 4I5SA 2AKPA 3DGEA 2XD6A 1BXDA 1UY6A 4PRXA 2XDKA 4O04A 2Q8FA 4H7QA 2XX5A 1UYEA 3HHUA 4XTJA 2VW5A 4E02A 2WI1A 5IDJA 3EHHA 4CWNA 3WQ9A 5BOCA 3G75A 4XIPA 2GQPA 2ZDXA 4L91A 3A0TA 1AMWA 2YKEA 5CTXA 2FWYA 4ASBA 4LWHA 3Q5KA 4CWTA 2JKIA 2XDSA 2XCMA 2YI7A 3T0HA 1L0OA 2BREA 3GIEA 4H85A 2EXLA 4GT8A 4CWRA 2YJWA 1TH8A 1UYLA 1BGQA 3B24A 4U93A 2QG0A 3CRKA 2HG1A 1A4HA 2YKIA 2YEAA 5D6QA 4HYPA 1UYGA 3U2KA 2FXSA 3WHAA 1AH8A 5FWKA 1YERA 4YKYA 4JAUA 5FNDA 3R4MA 4XC0A 4EGIA 2IWXA 3RLPA 2ESAA 3INXA 4L90A 2YEIA 3A0ZA 3R4OA 1UYMA 2GFDA 4JASA 3RLRA 2QF6A 1UYDA 2XX2A 3ZXOA 2XABA 2YGFA 1QZRA 4FCPA 4XKKA 4EFTA 4EMVA 4CWSA 2CCSA 2IOPA 1U2OA 3HYYA 4HZ0A 5CF0A 4U7NA 3R4PA 4LWFA 1UY7A 5C93A 4R3MA 4V26A 1QY8A 1NHIA 4CWQA 4P7AA 1ZXMA 3KE6A 3K98A 1TC6A 2UWDA 3TTZA 4FPPA 1GJVA 4YKUA 1AH6A 3B28A 1YT1A 2BSMA 3VHAA 5CTUA 3D2RA 5IDMA 3EKRA 4MOTA 1YS3A 4L94A 1ID0A 2YECA 4NH7A 2FWZA 4MB9A 4BAEA 3TUHA 3H4LA 3O6OA 2VWCA 2BYIA 4XKAA 3G7BA 1UY8A 4ASFA 1UYKA 2WI3A 1UYHA 2BT0A 5D7CA 4WUBA 4AS9A 4MPNA 1AJ6A 3ZKBA 3Q5LA 3R4NA 4WUCA
chains in the Genus database with same CATH superfamily
4IRNA 2CJ6A 4XITA 3UU9A 4FF4A 2BU8A 3S5TA 1EGCA 4XE2A 4KSAA 5BODA 1I5DA 2XJXA 4FF2A 4Q17A 1Z5BA 1R62A 4Q1OA 3MNRP 4XIRA 2XHXA 1SIRA 1B62A 4GGLA 4JQLA 4YKQA 2C2AA 2ZO5A 1US7A 4L1FA 4PU9A 5K3GA 3F29A 2F6LA 2YYKA 3EKOA 2XHTA 3ZM7A 2VIGA 3Q5JA 1S14A 2BYHA 4L38A 4O09A 4YKTA 2GBBA 2WI4A 1I5CA 2IOQA 3K99A 2YE2A 3EHJA 4AWQA 4ZXVA 1EGEA 1MX0A 3GQTA 3BM9A 4GFNA 1R3BA 4AWPA 3TZ4A 4HR3A 3HYZA 4WUDA 5L3JA 3EOMA 3Q24A 2IX6A 3BNHA 4FCQA 2O1WA 3T2SA 4IV6A 3CRLA 1TC0A 4MP7A 1ZWHA 2CGFA 2XQRB 2YK9A 5D6PA 3FO3A 3BNGA 4HXWA 2E0AA 5CTYA 1X90A 3D9DA 3FT5A 3CWVA 3S7WA 3EHFA 4YKWA 2YKCA 3TZ2A 2C1IA 4MP2A 2AO2A 4L3XA 2YE4A 1RJ4A 4XD8A 3T1KA 4NH8A 5B5WA 1T9GA 3D9FA 4O07A 2FP2A 3VADA 1RJ1A 4Q20A 2C1GA 4EEHA 2BZ5A 2EBHX 1Y8NA 1GU6A 4P8OA 5BRKA 4JAVA 1YC4A 4W9UA 1SK6A 3HZ5A 2OEVA 2Q8GA 2Q2EB 2YE8A 4X28A 4ZYJA 2YGEA 3C11A 4XCJA 2RDZA 1RP3A 3GNCA 2YE5A 4HXZA 4EM7A 3UBRA 1UY9A 3SF6A 1YC3A 1H7UA 1EI1A 5CTWA 2YEJA 4URMA 2YEDA 1B63A 5CPHA 4DZYA 3CYGA 1Y4UA 4P79A 3NF4A 3MDDA 2YI5A 5M4PA 3HEKA 4KCFA 5BRMA 3HZ1A 1YC1A 4GQTA 1Y4SA 3VHCA 3D36A 4KFGA 3JZ3A 4MPEA 3U67A 1Y8PA 4XIQA 2OEXA 1I5AA 5K3HA 4KSGA 2HJNA 4MPCA 3K60A 4P13A 3MMOA 3X29A 2XJGA 2H55A 1EA6A 4HY6A 2YEEA 4B7PA 1F51A 2YEHA 4KSHA 3NMQA 4ASAA 2ZKJA 3VKGA 3EONA 2BRCA 2PG0A 4FMTA 2BU7A 4QPJA 4LWIA 3SCEA 4EGHA 4URNA 5F5RA 3R92A 2XX4A 4E00A 4HY1A 1IVHA 4CE1A 1KIJA 1S16A 2DDHA 4NH9A 1UYCA 2ZBKB 5IN9A 4R3AA 1XFWA 4F0XA 4LWEA 2JJCA 1YESA 4Q5CA 1PVGA 3CGZA 3OMUA 1PI1A 3D6BA 4BQGA 2FYPA 4AKGA 4R1FA 1BYQA 1TBWA 1U0ZA 1YSZA 4W7TA 2XS1A 1U8VA 4O05A 1GKXA 4YKRA 1XFXA 4XCLA 4BIUA 4B6CA 2WI2A 4AKHA 2XJJA 3GIFA 1UYFA 2WI6A 3QTFA 4L8ZA 2CJ5A 3O0IA 3O2FA 2CCUA 1K8TA 1Z5AA 2K5BA 3PEHA 3OPDA 4FF3A 3MPIA 2WEQA 3T0ZA 1SIQA 2BTZA 4Q0TA 1OAHA 5D7DA 3GIGB 3OWDA 1Z59A 4YKZA 5D7RA 3GIGA 2YYMA 1THNA 4I3HA 4WJYA 5J71A 1B3QA 3CGYA 1H7SA 2YGAA 4LWGA 1BUCA 2YK2A 2JBTA 1TIDA 3T10A 1ZXNA 3VKHA 4QPKA 3II9A 4RM7A 2CG9A 3LGQA 1UDYA 2OT4A 4ZKIA 1S26A 4Q4UA 2OR0A 2XDLA 4HYMA 4BIZA 5FNCA 2HKJA 1ZW9A 2D29A 1UYIA 2YE3A 4N5FA 4PL9A 4CWOA 2YE9A 1MU5A 4KQVA 5F3KA 5GJVE 3FV5A 1XFYA 2YKJA 1X91A 2QG2A 2E80A 3LPSA 5M4EA 2R0NA 3EHGA 4XDMA 3MDEA 3VHDA 4HZ5A 3B27A 3OW6A 4ZVIA 3TTBA 4X9LA 2J7AA 3A0XA 4CWPA 1QYEA 3TZ0A 4URLA 2YKBA 4V25A 1FS7A 2IWUA 2QR4A 3SL2A 3K97A 4DOYA 3P4TA 3QDDA 1I58A 1YSRA 1K93A 2WI5A 2YEBA 3ZXQA 2JIFA 5FNFA 1SC5A 2YYGA 2WERA 4MBCA 5K3IA 3H80A 3RKZA 5M4MA 1GKZA 3LMMA 2HHIA 4U7OA 3GM6A 2RF7A 2Q8IA 1YT2A 4CWFA 5GGZA 2BU2A 3U2DA 2YYLA 3RLQA 2XHRA 2YE7A 3FT8A 4DUHA 2XDXA 3TZ5A 3A0RA 4K4OA 2Q8HA 3PEJA 1AM1A 4JEKA 2OJQA 1YETA 2YI0A 2C12A 2YYIA 1BKNA 2WI7A 2LFWA 1NHHA 5J6AA 2E81A 2WEPA 2QFOA 3C0EA 3IEDA 4FCRA 4L93A 2XS8A 4EFUA 1IS2A 2YEFA 2XDUA 4E01A 3INWA 4KTNA 3G7EA 2O1UA 4LQQB 1Y0VA 5M4KA 2YI6A 1K90A 5M4NA 3MXLA 4O5MA 2YJXA 4XKOA 1I5BA 2YE6A 4KP4A 2VCIA 2A1TA 3KMLA 4PRVA 3OIBA 3SXQA 3D0BA 2H8MA 3OWMA 4KSFA 3R7KA 1TILA 1EGDA 3A0WA 5M4HA 4AWOA 1XFZA 3MPJA 1Z5CA 3Q0AA 2YEGA 4O0BA 4EGKA 2VCJA 2BU5A 4JIOA 3C2PA 3A0YA 4GEEA 2CH4A 3X0YA 2CCTA 4NXLA 1YT0A 3LNUA 4H81A 2AZEA 4CE3A 3Q22A 1PK0A 1Y8OA 2BU6A 3B25A 3BMYA 4BQJA 2HCHA 4BXIA 1KZNA 4GCZA 3OWBA 2CJ7A 1I59A 4L3YA 4UROA 1OSFA 2IWSA 3B26A 3ZKDA 1WS9A 2PNRA 4LPBA 4YKXA 2IORA 2VR0A 1LVCA 1UKWA 4LP0A 4ASGA 4CE2A 2O1VA 3L1TA 4E72A 1JM6A 1NHJA 3R91A 2XK2A 2ZDYA 4I5SA 2AKPA 3DGEA 2VF1A 2XD6A 1BXDA 3OWAA 3D9GA 1UY6A 4PRXA 2YYJA 2XDKA 4O04A 2Q8FA 4H7QA 2XX5A 1UYEA 1XG2B 1W07A 1XFVA 3HHUA 4XTJA 2VW5A 5JENA 4X28C 4E02A 2WI1A 3D9EA 2FONA 5IDJA 3EHHA 2JBRA 4CWNA 3WQ9A 5BOCA 3G75A 4L3ZA 4FF1A 4XIPA 3SWOA 2GQPA 2ZDXA 4L91A 3A0TA 1AMWA 2YKEA 2R02A 2EBFX 5CTXA 2FWYA 4ASBA 4LWHA 2UXWA 3Q5KA 1FS9A 4CWTA 4XVXA 2JKIA 2XDSA 2XCMA 2YI7A 3T0HA 1L0OA 2BREA 3GIEA 4G97A 3D1IA 4H85A 4LQSB 2EXLA 4GT8A 3FCJA 2IX5A 2JBSA 4CWRA 2YJWA 2Z1QA 2FTKA 1TH8A 1UYLA 1BGQA 3B24A 4U93A 4J1VA 4Q5BA 2QG0A 4M9AA 2CJ4A 3CRKA 2HG1A 1A4HA 2YKIA 2YEAA 3N0RA 5D6QA 1FS8A 1UYGA 4HYPA 3U2KA 5B5VA 3TORA 3AFEA 2FXSA 2C0UA 3WHAA 4HKSA 1AH8A 5FWKA 2ZAFA 1YERA 3CE2A 1JQIA 4YKYA 4U83A 4JAUA 4G5EA 5FNDA 1IXMA 3MKHA 3R4MA 2R03A 5GJWE 4XC0A 4EGIA 2WBIA 2IWXA 3RLPA 2ESAA 3INXA 2EBAA 4L90A 3Q23A 2YEIA 3A0ZA 3R4OA 1R2JA 1UYMA 2GFDA 4JASA 3RLRA 2QF6A 1UYDA 2XX2A 3ZXOA 1XFUA 5K3JA 2XABA 4OO2A 2R0MA 3BNJA 2YGFA 1QZRA 4FCPA 2REHA 4XKKA 4EFTA 4EMVA 4CWSA 4AKIA 2CCSA 2IOPA 1U2OA 3HYYA 4HZ0A 3HWCA 4KTOA 5CF0A 4U7NA 3R4PA 4LWFA 1UY7A 5C93A 4R3MA 4V26A 3PFDA 1QY8A 1NHIA 3LG1A 4CWQA 4P7AA 1ZXMA 3KE6A 4FZ4A 2YGWA 3AFFA 1X8ZA 3K98A 1TC6A 4KS9A 2CX9A 2UWDA 3TTZA 3M9VA 4FPPA 3BNFA 1QDBA 1GJVA 4YKUA 1AH6A 3B28A 1YT1A 2BSMA 3VHAA 4HKRA 3D2RA 5CTUA 5IDMA 4QICA 4AI6A 3EKRA 4MOTA 2DVLA 1YS3A 3X0XA 1ID0A 2YECA 3C3LA 2FWZA 4L94A 4MB9A 4NH7A 4BAEA 3TUHA 1RX0A 2CJ8A 5B6BA 3H4LA 3O6OA 2RFQA 2VWCA 2BYIA 2EC5A 4XKAA 3G7BA 1UY8A 3RKHA 4ASFA 1UYKA 2WI3A 1UYHA 3B96A 2BT0A 5D7CA 4JIZA 3C46A 4WUBA 4AS9A 4MPNA 2PO4A 1AJ6A 3Q5LA 3ZKBA 3R4NA 2FP1A 4WUCA 2R05A
chains in the Genus database with same CATH topology
4XITA 2BU8A 4XE2A 5BODA 1I5DA 2XJXA 1Z5BA 1R62A 3MNRP 4XIRA 2XHXA 1B62A 4GGLA 4JQLA 4YKQA 2C2AA 1US7A 4PU9A 3EKOA 2XHTA 3ZM7A 3Q5JA 1S14A 2BYHA 4O09A 4YKTA 2WI4A 1I5CA 2IOQA 3K99A 2YE2A 3EHJA 4AWQA 4GFNA 1MX0A 3BM9A 4AWPA 3TZ4A 3HYZA 4WUDA 5L3JA 4FCQA 2O1WA 3T2SA 3CRLA 1TC0A 4MP7A 1ZWHA 2CGFA 2YK9A 5D6PA 4HXWA 2E0AA 5CTYA 3FT5A 3CWVA 3EHFA 4YKWA 2YKCA 3TZ2A 4MP2A 2YE4A 4XD8A 3T1KA 4NH8A 4O07A 3VADA 4Q20A 4EEHA 2BZ5A 1Y8NA 4P8OA 4JAVA 1YC4A 3HZ5A 2Q8GA 2Q2EB 2YE8A 2YGEA 3C11A 4XCJA 2YE5A 4HXZA 4EM7A 1UY9A 1YC3A 1H7UA 1EI1A 5CTWA 2YEJA 4URMA 2YEDA 1B63A 5CPHA 4DZYA 1Y4UA 2YI5A 5M4PA 3HEKA 3HZ1A 1YC1A 4GQTA 1Y4SA 3VHCA 3D36A 4KFGA 3JZ3A 4MPEA 3U67A 1Y8PA 4XIQA 1I5AA 4KSGA 4MPCA 3K60A 2XJGA 2H55A 1EA6A 4HY6A 2YEEA 4B7PA 2YEHA 4KSHA 3NMQA 4ASAA 2ZKJA 2BRCA 4FMTA 2BU7A 4QPJA 4LWIA 4EGHA 4URNA 5F5RA 3R92A 2XX4A 4E00A 4HY1A 4CE1A 1KIJA 1S16A 4NH9A 1UYCA 2ZBKB 5IN9A 4R3AA 4LWEA 2JJCA 1YESA 1PVGA 3CGZA 3OMUA 4BQGA 2FYPA 4R1FA 1BYQA 1TBWA 1U0ZA 1YSZA 4W7TA 4O05A 1GKXA 4YKRA 4XCLA 4BIUA 4B6CA 2WI2A 2XJJA 3GIFA 1UYFA 2WI6A 3QTFA 4L8ZA 3O0IA 3O2FA 2CCUA 1Z5AA 2K5BA 3PEHA 3OPDA 2WEQA 3T0ZA 2BTZA 5D7DA 3GIGB 3OWDA 1Z59A 4YKZA 5D7RA 3GIGA 4I3HA 1THNA 5J71A 1B3QA 3CGYA 4LWGA 1H7SA 2YGAA 2YK2A 1TIDA 3T10A 1ZXNA 4QPKA 2CG9A 4ZKIA 2XDLA 4HYMA 4BIZA 5FNCA 2HKJA 1ZW9A 1UYIA 2YE3A 4PL9A 4CWOA 2YE9A 1MU5A 4KQVA 5F3KA 3FV5A 2YKJA 2QG2A 3LPSA 5M4EA 3EHGA 4XDMA 3VHDA 4HZ5A 3B27A 3OW6A 4ZVIA 4X9LA 3A0XA 4CWPA 1QYEA 3TZ0A 4URLA 2YKBA 4V25A 2IWUA 3SL2A 3K97A 3QDDA 1I58A 1YSRA 2WI5A 2YEBA 3ZXQA 5FNFA 2WERA 4MBCA 3H80A 3RKZA 5M4MA 1GKZA 4U7OA 2Q8IA 1YT2A 4CWFA 5GGZA 2BU2A 3U2DA 3RLQA 2XHRA 2YE7A 3FT8A 4DUHA 2XDXA 3TZ5A 3A0RA 4K4OA 2Q8HA 3PEJA 1AM1A 1YETA 2YI0A 1BKNA 2WI7A 1NHHA 5J6AA 2WEPA 2QFOA 3C0EA 3IEDA 4FCRA 4L93A 4EFUA 2YEFA 2XDUA 4E01A 3INWA 4KTNA 3G7EA 2O1UA 5M4KA 2YI6A 5M4NA 4XKOA 2YJXA 1I5BA 2YE6A 4KP4A 2VCIA 4PRVA 3D0BA 2H8MA 1TILA 3A0WA 5M4HA 4AWOA 1Z5CA 4O0BA 2YEGA 4EGKA 2VCJA 2BU5A 3A0YA 4GEEA 2CH4A 2CCTA 1YT0A 3LNUA 4H81A 4CE3A 1Y8OA 2BU6A 3B25A 3BMYA 4BQJA 2HCHA 4BXIA 1KZNA 4GCZA 3OWBA 1I59A 4UROA 1OSFA 2IWSA 3B26A 3ZKDA 2PNRA 4LPBA 4YKXA 2IORA 4LP0A 4ASGA 4CE2A 2O1VA 1JM6A 1NHJA 3R91A 2XK2A 2ZDYA 4I5SA 2AKPA 3DGEA 2XD6A 1BXDA 1UY6A 4PRXA 2XDKA 4O04A 2Q8FA 4H7QA 2XX5A 1UYEA 3HHUA 4XTJA 2VW5A 4E02A 2WI1A 5IDJA 3EHHA 4CWNA 3WQ9A 5BOCA 3G75A 4XIPA 2GQPA 2ZDXA 4L91A 3A0TA 1AMWA 2YKEA 5CTXA 2FWYA 4ASBA 4LWHA 3Q5KA 4CWTA 2JKIA 2XDSA 2XCMA 2YI7A 3T0HA 1L0OA 2BREA 3GIEA 4H85A 2EXLA 4GT8A 4CWRA 2YJWA 1TH8A 1UYLA 1BGQA 3B24A 4U93A 2QG0A 3CRKA 2HG1A 1A4HA 2YKIA 2YEAA 5D6QA 4HYPA 1UYGA 3U2KA 2FXSA 3WHAA 1AH8A 5FWKA 1YERA 4YKYA 4JAUA 5FNDA 3R4MA 4XC0A 4EGIA 2IWXA 3RLPA 2ESAA 3INXA 4L90A 2YEIA 3A0ZA 3R4OA 1UYMA 2GFDA 4JASA 3RLRA 2QF6A 1UYDA 2XX2A 3ZXOA 2XABA 2YGFA 1QZRA 4FCPA 4XKKA 4EFTA 4EMVA 4CWSA 2CCSA 2IOPA 1U2OA 3HYYA 4HZ0A 5CF0A 4U7NA 3R4PA 4LWFA 1UY7A 5C93A 4R3MA 4V26A 1QY8A 1NHIA 4CWQA 4P7AA 1ZXMA 3KE6A 3K98A 1TC6A 2UWDA 3TTZA 4FPPA 1GJVA 4YKUA 1AH6A 3B28A 1YT1A 2BSMA 3VHAA 5CTUA 3D2RA 5IDMA 3EKRA 4MOTA 1YS3A 4L94A 1ID0A 2YECA 4NH7A 2FWZA 4MB9A 4BAEA 3TUHA 3H4LA 3O6OA 2VWCA 2BYIA 4XKAA 3G7BA 1UY8A 4ASFA 1UYKA 2WI3A 1UYHA 2BT0A 5D7CA 4WUBA 4AS9A 4MPNA 1AJ6A 3ZKBA 3Q5LA 3R4NA 4WUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIT A;  2BU8 A;  4XE2 A;  5BOD A;  1I5D A;  2XJX A;  1Z5B A;  1R62 A;  3MNR P;  4XIR A;  2XHX A;  1B62 A;  4GGL A;  4JQL A;  4YKQ A;  2C2A A;  1US7 A;  4PU9 A;  3EKO A;  2XHT A;  3ZM7 A;  3Q5J A;  1S14 A;  2BYH A;  4O09 A;  4YKT A;  2WI4 A;  1I5C A;  2IOQ A;  3K99 A;  2YE2 A;  3EHJ A;  4AWQ A;  4GFN A;  1MX0 A;  3BM9 A;  4AWP A;  3TZ4 A;  3HYZ A;  4WUD A;  5L3J A;  4FCQ A;  2O1W A;  3T2S A;  3CRL A;  1TC0 A;  4MP7 A;  1ZWH A;  2CGF A;  2YK9 A;  5D6P A;  4HXW A;  2E0A A;  5CTY A;  3FT5 A;  3CWV A;  3EHF A;  4YKW A;  2YKC A;  3TZ2 A;  4MP2 A;  2YE4 A;  4XD8 A;  3T1K A;  4NH8 A;  4O07 A;  3VAD A;  4Q20 A;  4EEH A;  2BZ5 A;  1Y8N A;  4P8O A;  4JAV A;  1YC4 A;  3HZ5 A;  2Q8G A;  2Q2E B;  2YE8 A;  2YGE A;  3C11 A;  4XCJ A;  2YE5 A;  4HXZ A;  4EM7 A;  1UY9 A;  1YC3 A;  1H7U A;  1EI1 A;  5CTW A;  2YEJ A;  4URM A;  2YED A;  1B63 A;  5CPH A;  4DZY A;  1Y4U A;  2YI5 A;  5M4P A;  3HEK A;  3HZ1 A;  1YC1 A;  4GQT A;  1Y4S A;  3VHC A;  3D36 A;  4KFG A;  3JZ3 A;  4MPE A;  3U67 A;  1Y8P A;  4XIQ A;  1I5A A;  4KSG A;  4MPC A;  3K60 A;  2XJG A;  2H55 A;  1EA6 A;  4HY6 A;  2YEE A;  4B7P A;  2YEH A;  4KSH A;  3NMQ A;  4ASA A;  2ZKJ A;  2BRC A;  4FMT A;  2BU7 A;  4QPJ A;  4LWI A;  4EGH A;  4URN A;  5F5R A;  3R92 A;  2XX4 A;  4E00 A;  4HY1 A;  4CE1 A;  1KIJ A;  1S16 A;  4NH9 A;  1UYC A;  2ZBK B;  5IN9 A;  4R3A A;  4LWE A;  2JJC A;  1YES A;  1PVG A;  3CGZ A;  3OMU A;  4BQG A;  2FYP A;  4R1F A;  1BYQ A;  1TBW A;  1U0Z A;  1YSZ A;  4W7T A;  4O05 A;  1GKX A;  4YKR A;  4XCL A;  4BIU A;  4B6C A;  2WI2 A;  2XJJ A;  3GIF A;  1UYF A;  2WI6 A;  3QTF A;  4L8Z A;  3O0I A;  3O2F A;  2CCU A;  1Z5A A;  2K5B A;  3PEH A;  3OPD A;  2WEQ A;  3T0Z A;  2BTZ A;  5D7D A;  3GIG B;  3OWD A;  1Z59 A;  4YKZ A;  5D7R A;  3GIG A;  4I3H A;  1THN A;  5J71 A;  1B3Q A;  3CGY A;  4LWG A;  1H7S A;  2YGA A;  2YK2 A;  1TID A;  3T10 A;  1ZXN A;  4QPK A;  2CG9 A;  4ZKI A;  2XDL A;  4HYM A;  4BIZ A;  5FNC A;  2HKJ A;  1ZW9 A;  1UYI A;  2YE3 A;  4PL9 A;  4CWO A;  2YE9 A;  1MU5 A;  4KQV A;  5F3K A;  3FV5 A;  2YKJ A;  2QG2 A;  3LPS A;  5M4E A;  3EHG A;  4XDM A;  3VHD A;  4HZ5 A;  3B27 A;  3OW6 A;  4ZVI A;  4X9L A;  3A0X A;  4CWP A;  1QYE A;  3TZ0 A;  4URL A;  2YKB A;  4V25 A;  2IWU A;  3SL2 A;  3K97 A;  3QDD A;  1I58 A;  1YSR A;  2WI5 A;  2YEB A;  3ZXQ A;  5FNF A;  2WER A;  4MBC A;  3H80 A;  3RKZ A;  5M4M A;  1GKZ A;  4U7O A;  2Q8I A;  1YT2 A;  4CWF A;  5GGZ A;  2BU2 A;  3U2D A;  3RLQ A;  2XHR A;  2YE7 A;  3FT8 A;  4DUH A;  2XDX A;  3TZ5 A;  3A0R A;  4K4O A;  2Q8H A;  3PEJ A;  1AM1 A;  1YET A;  2YI0 A;  1BKN A;  2WI7 A;  1NHH A;  5J6A A;  2WEP A;  2QFO A;  3C0E A;  3IED A;  4FCR A;  4L93 A;  4EFU A;  2YEF A;  2XDU A;  4E01 A;  3INW A;  4KTN A;  3G7E A;  2O1U A;  5M4K A;  2YI6 A;  5M4N A;  4XKO A;  2YJX A;  1I5B A;  2YE6 A;  4KP4 A;  2VCI A;  4PRV A;  3D0B A;  2H8M A;  1TIL A;  3A0W A;  5M4H A;  4AWO A;  1Z5C A;  4O0B A;  2YEG A;  4EGK A;  2VCJ A;  2BU5 A;  3A0Y A;  4GEE A;  2CH4 A;  2CCT A;  1YT0 A;  3LNU A;  4H81 A;  4CE3 A;  1Y8O A;  2BU6 A;  3B25 A;  3BMY A;  4BQJ A;  2HCH A;  4BXI A;  1KZN A;  4GCZ A;  3OWB A;  1I59 A;  4URO A;  1OSF A;  2IWS A;  3B26 A;  3ZKD A;  2PNR A;  4LPB A;  4YKX A;  2IOR A;  4LP0 A;  4ASG A;  4CE2 A;  2O1V A;  1JM6 A;  1NHJ A;  3R91 A;  2XK2 A;  2ZDY A;  4I5S A;  2AKP A;  3DGE A;  2XD6 A;  1BXD A;  1UY6 A;  4PRX A;  2XDK A;  4O04 A;  2Q8F A;  4H7Q A;  2XX5 A;  1UYE A;  3HHU A;  4XTJ A;  2VW5 A;  4E02 A;  2WI1 A;  5IDJ A;  3EHH A;  4CWN A;  3WQ9 A;  5BOC A;  3G75 A;  4XIP A;  2GQP A;  2ZDX A;  4L91 A;  3A0T A;  1AMW A;  2YKE A;  5CTX A;  2FWY A;  4ASB A;  4LWH A;  3Q5K A;  4CWT A;  2JKI A;  2XDS A;  2XCM A;  2YI7 A;  3T0H A;  1L0O A;  2BRE A;  3GIE A;  4H85 A;  2EXL A;  4GT8 A;  4CWR A;  2YJW A;  1TH8 A;  1UYL A;  1BGQ A;  3B24 A;  4U93 A;  2QG0 A;  3CRK A;  2HG1 A;  1A4H A;  2YKI A;  2YEA A;  5D6Q A;  4HYP A;  1UYG A;  3U2K A;  2FXS A;  3WHA A;  1AH8 A;  5FWK A;  1YER A;  4YKY A;  4JAU A;  5FND A;  3R4M A;  4XC0 A;  4EGI A;  2IWX A;  3RLP A;  2ESA A;  3INX A;  4L90 A;  2YEI A;  3A0Z A;  3R4O A;  1UYM A;  2GFD A;  4JAS A;  3RLR A;  2QF6 A;  1UYD A;  2XX2 A;  3ZXO A;  2XAB A;  2YGF A;  1QZR A;  4FCP A;  4XKK A;  4EFT A;  4EMV A;  4CWS A;  2CCS A;  2IOP A;  1U2O A;  3HYY A;  4HZ0 A;  5CF0 A;  4U7N A;  3R4P A;  4LWF A;  1UY7 A;  5C93 A;  4R3M A;  4V26 A;  1QY8 A;  1NHI A;  4CWQ A;  4P7A A;  1ZXM A;  3KE6 A;  3K98 A;  1TC6 A;  2UWD A;  3TTZ A;  4FPP A;  1GJV A;  4YKU A;  1AH6 A;  3B28 A;  1YT1 A;  2BSM A;  3VHA A;  5CTU A;  3D2R A;  5IDM A;  3EKR A;  4MOT A;  1YS3 A;  4L94 A;  1ID0 A;  2YEC A;  4NH7 A;  2FWZ A;  4MB9 A;  4BAE A;  3TUH A;  3H4L A;  3O6O A;  2VWC A;  2BYI A;  4XKA A;  3G7B A;  1UY8 A;  4ASF A;  1UYK A;  2WI3 A;  1UYH A;  2BT0 A;  5D7C A;  4WUB A;  4AS9 A;  4MPN A;  1AJ6 A;  3ZKB A;  3Q5L A;  3R4N A;  4WUC A; 
#chains in the Genus database with same CATH topology
 4IRN A;  2CJ6 A;  4XIT A;  3UU9 A;  4FF4 A;  2BU8 A;  3S5T A;  1EGC A;  4XE2 A;  4KSA A;  5BOD A;  1I5D A;  2XJX A;  4FF2 A;  4Q17 A;  1Z5B A;  1R62 A;  4Q1O A;  3MNR P;  4XIR A;  2XHX A;  1SIR A;  1B62 A;  4GGL A;  4JQL A;  4YKQ A;  2C2A A;  2ZO5 A;  1US7 A;  4L1F A;  4PU9 A;  5K3G A;  3F29 A;  2F6L A;  2YYK A;  3EKO A;  2XHT A;  3ZM7 A;  2VIG A;  3Q5J A;  1S14 A;  2BYH A;  4L38 A;  4O09 A;  4YKT A;  2GBB A;  2WI4 A;  1I5C A;  2IOQ A;  3K99 A;  2YE2 A;  3EHJ A;  4AWQ A;  4ZXV A;  1EGE A;  1MX0 A;  3GQT A;  3BM9 A;  4GFN A;  1R3B A;  4AWP A;  3TZ4 A;  4HR3 A;  3HYZ A;  4WUD A;  5L3J A;  3EOM A;  3Q24 A;  2IX6 A;  3BNH A;  4FCQ A;  2O1W A;  3T2S A;  4IV6 A;  3CRL A;  1TC0 A;  4MP7 A;  1ZWH A;  2CGF A;  2XQR B;  2YK9 A;  5D6P A;  3FO3 A;  3BNG A;  4HXW A;  2E0A A;  5CTY A;  1X90 A;  3D9D A;  3FT5 A;  3CWV A;  3S7W A;  3EHF A;  4YKW A;  2YKC A;  3TZ2 A;  2C1I A;  4MP2 A;  2AO2 A;  4L3X A;  2YE4 A;  1RJ4 A;  4XD8 A;  3T1K A;  4NH8 A;  5B5W A;  1T9G A;  3D9F A;  4O07 A;  2FP2 A;  3VAD A;  1RJ1 A;  4Q20 A;  2C1G A;  4EEH A;  2BZ5 A;  2EBH X;  1Y8N A;  1GU6 A;  4P8O A;  5BRK A;  4JAV A;  1YC4 A;  4W9U A;  1SK6 A;  3HZ5 A;  2OEV A;  2Q8G A;  2Q2E B;  2YE8 A;  4X28 A;  4ZYJ A;  2YGE A;  3C11 A;  4XCJ A;  2RDZ A;  1RP3 A;  3GNC A;  2YE5 A;  4HXZ A;  4EM7 A;  3UBR A;  1UY9 A;  3SF6 A;  1YC3 A;  1H7U A;  1EI1 A;  5CTW A;  2YEJ A;  4URM A;  2YED A;  1B63 A;  5CPH A;  4DZY A;  3CYG A;  1Y4U A;  4P79 A;  3NF4 A;  3MDD A;  2YI5 A;  5M4P A;  3HEK A;  4KCF A;  5BRM A;  3HZ1 A;  1YC1 A;  4GQT A;  1Y4S A;  3VHC A;  3D36 A;  4KFG A;  3JZ3 A;  4MPE A;  3U67 A;  1Y8P A;  4XIQ A;  2OEX A;  1I5A A;  5K3H A;  4KSG A;  2HJN A;  4MPC A;  3K60 A;  4P13 A;  3MMO A;  3X29 A;  2XJG A;  2H55 A;  1EA6 A;  4HY6 A;  2YEE A;  4B7P A;  1F51 A;  2YEH A;  4KSH A;  3NMQ A;  4ASA A;  2ZKJ A;  3VKG A;  3EON A;  2BRC A;  2PG0 A;  4FMT A;  2BU7 A;  4QPJ A;  4LWI A;  3SCE A;  4EGH A;  4URN A;  5F5R A;  3R92 A;  2XX4 A;  4E00 A;  4HY1 A;  1IVH A;  4CE1 A;  1KIJ A;  1S16 A;  2DDH A;  4NH9 A;  1UYC A;  2ZBK B;  5IN9 A;  4R3A A;  1XFW A;  4F0X A;  4LWE A;  2JJC A;  1YES A;  4Q5C A;  1PVG A;  3CGZ A;  3OMU A;  1PI1 A;  3D6B A;  4BQG A;  2FYP A;  4AKG A;  4R1F A;  1BYQ A;  1TBW A;  1U0Z A;  1YSZ A;  4W7T A;  2XS1 A;  1U8V A;  4O05 A;  1GKX A;  4YKR A;  1XFX A;  4XCL A;  4BIU A;  4B6C A;  2WI2 A;  4AKH A;  2XJJ A;  3GIF A;  1UYF A;  2WI6 A;  3QTF A;  4L8Z A;  2CJ5 A;  3O0I A;  3O2F A;  2CCU A;  1K8T A;  1Z5A A;  2K5B A;  3PEH A;  3OPD A;  4FF3 A;  3MPI A;  2WEQ A;  3T0Z A;  1SIQ A;  2BTZ A;  4Q0T A;  1OAH A;  5D7D A;  3GIG B;  3OWD A;  1Z59 A;  4YKZ A;  5D7R A;  3GIG A;  2YYM A;  1THN A;  4I3H A;  4WJY A;  5J71 A;  1B3Q A;  3CGY A;  1H7S A;  2YGA A;  4LWG A;  1BUC A;  2YK2 A;  2JBT A;  1TID A;  3T10 A;  1ZXN A;  3VKH A;  4QPK A;  3II9 A;  4RM7 A;  2CG9 A;  3LGQ A;  1UDY A;  2OT4 A;  4ZKI A;  1S26 A;  4Q4U A;  2OR0 A;  2XDL A;  4HYM A;  4BIZ A;  5FNC A;  2HKJ A;  1ZW9 A;  2D29 A;  1UYI A;  2YE3 A;  4N5F A;  4PL9 A;  4CWO A;  2YE9 A;  1MU5 A;  4KQV A;  5F3K A;  5GJV E;  3FV5 A;  1XFY A;  2YKJ A;  1X91 A;  2QG2 A;  2E80 A;  3LPS A;  5M4E A;  2R0N A;  3EHG A;  4XDM A;  3MDE A;  3VHD A;  4HZ5 A;  3B27 A;  3OW6 A;  4ZVI A;  3TTB A;  4X9L A;  2J7A A;  3A0X A;  4CWP A;  1QYE A;  3TZ0 A;  4URL A;  2YKB A;  4V25 A;  1FS7 A;  2IWU A;  2QR4 A;  3SL2 A;  3K97 A;  4DOY A;  3P4T A;  3QDD A;  1I58 A;  1YSR A;  1K93 A;  2WI5 A;  2YEB A;  3ZXQ A;  2JIF A;  5FNF A;  1SC5 A;  2YYG A;  2WER A;  4MBC A;  5K3I A;  3H80 A;  3RKZ A;  5M4M A;  1GKZ A;  3LMM A;  2HHI A;  4U7O A;  3GM6 A;  2RF7 A;  2Q8I A;  1YT2 A;  4CWF A;  5GGZ A;  2BU2 A;  3U2D A;  2YYL A;  3RLQ A;  2XHR A;  2YE7 A;  3FT8 A;  4DUH A;  2XDX A;  3TZ5 A;  3A0R A;  4K4O A;  2Q8H A;  3PEJ A;  1AM1 A;  4JEK A;  2OJQ A;  1YET A;  2YI0 A;  2C12 A;  2YYI A;  1BKN A;  2WI7 A;  2LFW A;  1NHH A;  5J6A A;  2E81 A;  2WEP A;  2QFO A;  3C0E A;  3IED A;  4FCR A;  4L93 A;  2XS8 A;  4EFU A;  1IS2 A;  2YEF A;  2XDU A;  4E01 A;  3INW A;  4KTN A;  3G7E A;  2O1U A;  4LQQ B;  1Y0V A;  5M4K A;  2YI6 A;  1K90 A;  5M4N A;  3MXL A;  4O5M A;  2YJX A;  4XKO A;  1I5B A;  2YE6 A;  4KP4 A;  2VCI A;  2A1T A;  3KML A;  4PRV A;  3OIB A;  3SXQ A;  3D0B A;  2H8M A;  3OWM A;  4KSF A;  3R7K A;  1TIL A;  1EGD A;  3A0W A;  5M4H A;  4AWO A;  1XFZ A;  3MPJ A;  1Z5C A;  3Q0A A;  2YEG A;  4O0B A;  4EGK A;  2VCJ A;  2BU5 A;  4JIO A;  3C2P A;  3A0Y A;  4GEE A;  2CH4 A;  3X0Y A;  2CCT A;  4NXL A;  1YT0 A;  3LNU A;  4H81 A;  2AZE A;  4CE3 A;  3Q22 A;  1PK0 A;  1Y8O A;  2BU6 A;  3B25 A;  3BMY A;  4BQJ A;  2HCH A;  4BXI A;  1KZN A;  4GCZ A;  3OWB A;  2CJ7 A;  1I59 A;  4L3Y A;  4URO A;  1OSF A;  2IWS A;  3B26 A;  3ZKD A;  1WS9 A;  2PNR A;  4LPB A;  4YKX A;  2IOR A;  2VR0 A;  1LVC A;  1UKW A;  4LP0 A;  4ASG A;  4CE2 A;  2O1V A;  3L1T A;  4E72 A;  1JM6 A;  1NHJ A;  3R91 A;  2XK2 A;  2ZDY A;  4I5S A;  2AKP A;  3DGE A;  2VF1 A;  2XD6 A;  1BXD A;  3OWA A;  3D9G A;  1UY6 A;  4PRX A;  2YYJ A;  2XDK A;  4O04 A;  2Q8F A;  4H7Q A;  2XX5 A;  1UYE A;  1XG2 B;  1W07 A;  1XFV A;  3HHU A;  4XTJ A;  2VW5 A;  5JEN A;  4X28 C;  4E02 A;  2WI1 A;  3D9E A;  2FON A;  5IDJ A;  3EHH A;  2JBR A;  4CWN A;  3WQ9 A;  5BOC A;  3G75 A;  4L3Z A;  4FF1 A;  4XIP A;  3SWO A;  2GQP A;  2ZDX A;  4L91 A;  3A0T A;  1AMW A;  2YKE A;  2R02 A;  2EBF X;  5CTX A;  2FWY A;  4ASB A;  4LWH A;  2UXW A;  3Q5K A;  1FS9 A;  4CWT A;  4XVX A;  2JKI A;  2XDS A;  2XCM A;  2YI7 A;  3T0H A;  1L0O A;  2BRE A;  3GIE A;  4G97 A;  3D1I A;  4H85 A;  4LQS B;  2EXL A;  4GT8 A;  3FCJ A;  2IX5 A;  2JBS A;  4CWR A;  2YJW A;  2Z1Q A;  2FTK A;  1TH8 A;  1UYL A;  1BGQ A;  3B24 A;  4U93 A;  4J1V A;  4Q5B A;  2QG0 A;  4M9A A;  2CJ4 A;  3CRK A;  2HG1 A;  1A4H A;  2YKI A;  2YEA A;  3N0R A;  5D6Q A;  1FS8 A;  1UYG A;  4HYP A;  3U2K A;  5B5V A;  3TOR A;  3AFE A;  2FXS A;  2C0U A;  3WHA A;  4HKS A;  1AH8 A;  5FWK A;  2ZAF A;  1YER A;  3CE2 A;  1JQI A;  4YKY A;  4U83 A;  4JAU A;  4G5E A;  5FND A;  1IXM A;  3MKH A;  3R4M A;  2R03 A;  5GJW E;  4XC0 A;  4EGI A;  2WBI A;  2IWX A;  3RLP A;  2ESA A;  3INX A;  2EBA A;  4L90 A;  3Q23 A;  2YEI A;  3A0Z A;  3R4O A;  1R2J A;  1UYM A;  2GFD A;  4JAS A;  3RLR A;  2QF6 A;  1UYD A;  2XX2 A;  3ZXO A;  1XFU A;  5K3J A;  2XAB A;  4OO2 A;  2R0M A;  3BNJ A;  2YGF A;  1QZR A;  4FCP A;  2REH A;  4XKK A;  4EFT A;  4EMV A;  4CWS A;  4AKI A;  2CCS A;  2IOP A;  1U2O A;  3HYY A;  4HZ0 A;  3HWC A;  4KTO A;  5CF0 A;  4U7N A;  3R4P A;  4LWF A;  1UY7 A;  5C93 A;  4R3M A;  4V26 A;  3PFD A;  1QY8 A;  1NHI A;  3LG1 A;  4CWQ A;  4P7A A;  1ZXM A;  3KE6 A;  4FZ4 A;  2YGW A;  3AFF A;  1X8Z A;  3K98 A;  1TC6 A;  4KS9 A;  2CX9 A;  2UWD A;  3TTZ A;  3M9V A;  4FPP A;  3BNF A;  1QDB A;  1GJV A;  4YKU A;  1AH6 A;  3B28 A;  1YT1 A;  2BSM A;  3VHA A;  4HKR A;  3D2R A;  5CTU A;  5IDM A;  4QIC A;  4AI6 A;  3EKR A;  4MOT A;  2DVL A;  1YS3 A;  3X0X A;  1ID0 A;  2YEC A;  3C3L A;  2FWZ A;  4L94 A;  4MB9 A;  4NH7 A;  4BAE A;  3TUH A;  1RX0 A;  2CJ8 A;  5B6B A;  3H4L A;  3O6O A;  2RFQ A;  2VWC A;  2BYI A;  2EC5 A;  4XKA A;  3G7B A;  1UY8 A;  3RKH A;  4ASF A;  1UYK A;  2WI3 A;  1UYH A;  3B96 A;  2BT0 A;  5D7C A;  4JIZ A;  3C46 A;  4WUB A;  4AS9 A;  4MPN A;  2PO4 A;  1AJ6 A;  3Q5L A;  3ZKB A;  3R4N A;  2FP1 A;  4WUC A;  2R05 A; 
#chains in the Genus database with same CATH homology
 4XIT A;  2BU8 A;  4XE2 A;  5BOD A;  1I5D A;  2XJX A;  1Z5B A;  1R62 A;  3MNR P;  4XIR A;  2XHX A;  1B62 A;  4GGL A;  4JQL A;  4YKQ A;  2C2A A;  1US7 A;  4PU9 A;  3EKO A;  2XHT A;  3ZM7 A;  3Q5J A;  1S14 A;  2BYH A;  4O09 A;  4YKT A;  2WI4 A;  1I5C A;  2IOQ A;  3K99 A;  2YE2 A;  3EHJ A;  4AWQ A;  4GFN A;  1MX0 A;  3BM9 A;  4AWP A;  3TZ4 A;  3HYZ A;  4WUD A;  5L3J A;  4FCQ A;  2O1W A;  3T2S A;  3CRL A;  1TC0 A;  4MP7 A;  1ZWH A;  2CGF A;  2YK9 A;  5D6P A;  4HXW A;  2E0A A;  5CTY A;  3FT5 A;  3CWV A;  3EHF A;  4YKW A;  2YKC A;  3TZ2 A;  4MP2 A;  2YE4 A;  4XD8 A;  3T1K A;  4NH8 A;  4O07 A;  3VAD A;  4Q20 A;  4EEH A;  2BZ5 A;  1Y8N A;  4P8O A;  4JAV A;  1YC4 A;  3HZ5 A;  2Q8G A;  2Q2E B;  2YE8 A;  2YGE A;  3C11 A;  4XCJ A;  2YE5 A;  4HXZ A;  4EM7 A;  1UY9 A;  1YC3 A;  1H7U A;  1EI1 A;  5CTW A;  2YEJ A;  4URM A;  2YED A;  1B63 A;  5CPH A;  4DZY A;  1Y4U A;  2YI5 A;  5M4P A;  3HEK A;  3HZ1 A;  1YC1 A;  4GQT A;  1Y4S A;  3VHC A;  3D36 A;  4KFG A;  3JZ3 A;  4MPE A;  3U67 A;  1Y8P A;  4XIQ A;  1I5A A;  4KSG A;  4MPC A;  3K60 A;  2XJG A;  2H55 A;  1EA6 A;  4HY6 A;  2YEE A;  4B7P A;  2YEH A;  4KSH A;  3NMQ A;  4ASA A;  2ZKJ A;  2BRC A;  4FMT A;  2BU7 A;  4QPJ A;  4LWI A;  4EGH A;  4URN A;  5F5R A;  3R92 A;  2XX4 A;  4E00 A;  4HY1 A;  4CE1 A;  1KIJ A;  1S16 A;  4NH9 A;  1UYC A;  2ZBK B;  5IN9 A;  4R3A A;  4LWE A;  2JJC A;  1YES A;  1PVG A;  3CGZ A;  3OMU A;  4BQG A;  2FYP A;  4R1F A;  1BYQ A;  1TBW A;  1U0Z A;  1YSZ A;  4W7T A;  4O05 A;  1GKX A;  4YKR A;  4XCL A;  4BIU A;  4B6C A;  2WI2 A;  2XJJ A;  3GIF A;  1UYF A;  2WI6 A;  3QTF A;  4L8Z A;  3O0I A;  3O2F A;  2CCU A;  1Z5A A;  2K5B A;  3PEH A;  3OPD A;  2WEQ A;  3T0Z A;  2BTZ A;  5D7D A;  3GIG B;  3OWD A;  1Z59 A;  4YKZ A;  5D7R A;  3GIG A;  4I3H A;  1THN A;  5J71 A;  1B3Q A;  3CGY A;  4LWG A;  1H7S A;  2YGA A;  2YK2 A;  1TID A;  3T10 A;  1ZXN A;  4QPK A;  2CG9 A;  4ZKI A;  2XDL A;  4HYM A;  4BIZ A;  5FNC A;  2HKJ A;  1ZW9 A;  1UYI A;  2YE3 A;  4PL9 A;  4CWO A;  2YE9 A;  1MU5 A;  4KQV A;  5F3K A;  3FV5 A;  2YKJ A;  2QG2 A;  3LPS A;  5M4E A;  3EHG A;  4XDM A;  3VHD A;  4HZ5 A;  3B27 A;  3OW6 A;  4ZVI A;  4X9L A;  3A0X A;  4CWP A;  1QYE A;  3TZ0 A;  4URL A;  2YKB A;  4V25 A;  2IWU A;  3SL2 A;  3K97 A;  3QDD A;  1I58 A;  1YSR A;  2WI5 A;  2YEB A;  3ZXQ A;  5FNF A;  2WER A;  4MBC A;  3H80 A;  3RKZ A;  5M4M A;  1GKZ A;  4U7O A;  2Q8I A;  1YT2 A;  4CWF A;  5GGZ A;  2BU2 A;  3U2D A;  3RLQ A;  2XHR A;  2YE7 A;  3FT8 A;  4DUH A;  2XDX A;  3TZ5 A;  3A0R A;  4K4O A;  2Q8H A;  3PEJ A;  1AM1 A;  1YET A;  2YI0 A;  1BKN A;  2WI7 A;  1NHH A;  5J6A A;  2WEP A;  2QFO A;  3C0E A;  3IED A;  4FCR A;  4L93 A;  4EFU A;  2YEF A;  2XDU A;  4E01 A;  3INW A;  4KTN A;  3G7E A;  2O1U A;  5M4K A;  2YI6 A;  5M4N A;  4XKO A;  2YJX A;  1I5B A;  2YE6 A;  4KP4 A;  2VCI A;  4PRV A;  3D0B A;  2H8M A;  1TIL A;  3A0W A;  5M4H A;  4AWO A;  1Z5C A;  4O0B A;  2YEG A;  4EGK A;  2VCJ A;  2BU5 A;  3A0Y A;  4GEE A;  2CH4 A;  2CCT A;  1YT0 A;  3LNU A;  4H81 A;  4CE3 A;  1Y8O A;  2BU6 A;  3B25 A;  3BMY A;  4BQJ A;  2HCH A;  4BXI A;  1KZN A;  4GCZ A;  3OWB A;  1I59 A;  4URO A;  1OSF A;  2IWS A;  3B26 A;  3ZKD A;  2PNR A;  4LPB A;  4YKX A;  2IOR A;  4LP0 A;  4ASG A;  4CE2 A;  2O1V A;  1JM6 A;  1NHJ A;  3R91 A;  2XK2 A;  2ZDY A;  4I5S A;  2AKP A;  3DGE A;  2XD6 A;  1BXD A;  1UY6 A;  4PRX A;  2XDK A;  4O04 A;  2Q8F A;  4H7Q A;  2XX5 A;  1UYE A;  3HHU A;  4XTJ A;  2VW5 A;  4E02 A;  2WI1 A;  5IDJ A;  3EHH A;  4CWN A;  3WQ9 A;  5BOC A;  3G75 A;  4XIP A;  2GQP A;  2ZDX A;  4L91 A;  3A0T A;  1AMW A;  2YKE A;  5CTX A;  2FWY A;  4ASB A;  4LWH A;  3Q5K A;  4CWT A;  2JKI A;  2XDS A;  2XCM A;  2YI7 A;  3T0H A;  1L0O A;  2BRE A;  3GIE A;  4H85 A;  2EXL A;  4GT8 A;  4CWR A;  2YJW A;  1TH8 A;  1UYL A;  1BGQ A;  3B24 A;  4U93 A;  2QG0 A;  3CRK A;  2HG1 A;  1A4H A;  2YKI A;  2YEA A;  5D6Q A;  4HYP A;  1UYG A;  3U2K A;  2FXS A;  3WHA A;  1AH8 A;  5FWK A;  1YER A;  4YKY A;  4JAU A;  5FND A;  3R4M A;  4XC0 A;  4EGI A;  2IWX A;  3RLP A;  2ESA A;  3INX A;  4L90 A;  2YEI A;  3A0Z A;  3R4O A;  1UYM A;  2GFD A;  4JAS A;  3RLR A;  2QF6 A;  1UYD A;  2XX2 A;  3ZXO A;  2XAB A;  2YGF A;  1QZR A;  4FCP A;  4XKK A;  4EFT A;  4EMV A;  4CWS A;  2CCS A;  2IOP A;  1U2O A;  3HYY A;  4HZ0 A;  5CF0 A;  4U7N A;  3R4P A;  4LWF A;  1UY7 A;  5C93 A;  4R3M A;  4V26 A;  1QY8 A;  1NHI A;  4CWQ A;  4P7A A;  1ZXM A;  3KE6 A;  3K98 A;  1TC6 A;  2UWD A;  3TTZ A;  4FPP A;  1GJV A;  4YKU A;  1AH6 A;  3B28 A;  1YT1 A;  2BSM A;  3VHA A;  5CTU A;  3D2R A;  5IDM A;  3EKR A;  4MOT A;  1YS3 A;  4L94 A;  1ID0 A;  2YEC A;  4NH7 A;  2FWZ A;  4MB9 A;  4BAE A;  3TUH A;  3H4L A;  3O6O A;  2VWC A;  2BYI A;  4XKA A;  3G7B A;  1UY8 A;  4ASF A;  1UYK A;  2WI3 A;  1UYH A;  2BT0 A;  5D7C A;  4WUB A;  4AS9 A;  4MPN A;  1AJ6 A;  3ZKB A;  3Q5L A;  3R4N A;  4WUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...