2Q8GA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with glucose-lowering drug azd7545
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
383
structure length
368
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNDDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 368
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8gA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8gA02
4PU9A 4XC0A 2E0AA 4HXZA 1KIJA 4U7NA 4BXIA 2XJGA 1YSZA 2CCTA 4WUDA 3VHAA 2XABA 5BOCA 1BXDA 2GQPA 4XIQA 4HY6A 3GIFA 4EFTA 4HYPA 4JAUA 5D7DA 1Y8PA 3O2FA 1MU5A 4KTNA 1TILA 5IN9A 1YC3A 1TIDA 1YETA 2YE6A 2YEIA 4H85A 4V25A 3HZ1A 4HXWA 4U7OA 1I5AA 2XDXA 3VADA 5M4EA 4MPNA 2XK2A 3D0BA 4CWOA 1JM6A 2IWSA 3HYZA 2XHRA 3OWDA 1AMWA 1TBWA 5J6AA 3EHFA 3A0RA 2Q8GA 4FCRA 2XDSA 1H7SA 3K99A 4O09A 4AWQA 2IWXA 1Z5AA 1AM1A 3GIGB 4R1FA 3OMUA 4ZVIA 2ZBKB 1I5CA 1Z5CA 2VW5A 2CGFA 3CWVA 2YE5A 2IOQA 3B26A 1QY8A 1QYEA 2HCHA 4MP7A 2XDUA 1Y4SA 1YESA 3QTFA 2ZDYA 5CTXA 4EM7A 3B27A 2CCUA 3Q5LA 5IDJA 3O6OA 4EFUA 2YE4A 3TTZA 1B3QA 3EHJA 4EGHA 1TC0A 4ZKIA 2Q8FA 4DZYA 4KSHA 1UYFA 3HHUA 4CWTA 1PVGA 5C93A 2BTZA 1GJVA 4E01A 4ASGA 2YI5A 4CWNA 3RLPA 1YERA 3A0WA 3Q5KA 4P7AA 4KSGA 1UY6A 2YKEA 3HZ5A 3EHHA 3BM9A 3TZ0A 3T2SA 4O04A 1EI1A 4E02A 3GIEA 3TUHA 2YEEA 1THNA 4YKZA 2YI0A 4YKQA 2XCMA 2BU2A 4NH8A 4QPJA 3RLQA 1Y8NA 5CPHA 2YI7A 1ZWHA 2JJCA 4GEEA 2H8MA 1U2OA 3C0EA 3G75A 5BODA 2XHTA 4PL9A 2YKCA 4E00A 1YT0A 2YEFA 2WEPA 4HYMA 4FCPA 2XX4A 2XX2A 4BQJA 5D7CA 5FWKA 4HZ5A 2AKPA 4GCZA 4URMA 4I5SA 3OPDA 4L91A 4MBCA 2YEBA 4LWHA 2UWDA 2Q8IA 3CGYA 2WEQA 3D36A 1B62A 4KP4A 1NHHA 3ZXQA 3LPSA 3GIGA 3PEJA 4L90A 2HKJA 2BZ5A 2BRCA 2QF6A 1S14A 1I59A 2O1VA 1GKXA 5CTWA 2O1UA 3FV5A 3R4MA 2YKBA 1Y4UA 4JAVA 4LPBA 4URLA 3ZKBA 5D7RA 2YGAA 1Y8OA 4CWQA 1I5BA 3U67A 1UYEA 1Z59A 5F3KA 2XX5A 1YT2A 3A0ZA 2XDKA 1BKNA 2XD6A 1YT1A 2YEJA 2YE7A 4V26A 4XE2A 1AH6A 2Q8HA 4CE3A 4CE2A 4ASFA 4EGKA 1H7UA 3NMQA 4NH7A 4JQLA 3CGZA 3A0YA 5L3JA 4WUCA 3EKRA 4BIUA 1UY8A 4LWGA 2HG1A 4JASA 5IDMA 4YKUA 1UYCA 4BAEA 2YE8A 3RKZA 3TZ5A 4XIPA 3R4NA 1ZXMA 4URNA 4FCQA 2VCIA 4PRXA 4BQGA 4O05A 5J71A 2YJXA 2YKJA 4CWPA 5D6QA 4XCJA 2GFDA 1UYMA 4AWOA 3QDDA 4YKRA 2YEAA 3IEDA 4O0BA 2WI6A 5FNCA 3CRLA 1EA6A 2WI2A 2IORA 2BT0A 4KFGA 3D2RA 1AJ6A 1ID0A 1S16A 5M4KA 1NHJA 4XKOA 2WI5A 4MB9A 2BU7A 4X9LA 4XTJA 4HY1A 3B25A 1KZNA 1TC6A 2EXLA 3A0XA 2BYIA 3WQ9A 3Q5JA 4GFNA 1R62A 4MPEA 2O1WA 4LWEA 2BYHA 2BREA 2ZDXA 4DUHA 4CE1A 2FXSA 3OWBA 4L94A 4B7PA 4CWFA 2ESAA 4XKAA 3ZXOA 2YGFA 4ASBA 3B24A 2WI1A 4YKYA 1BYQA 4XD8A 1UYHA 1B63A 4XIRA 3INXA 4LWFA 3CRKA 2QG0A 4O07A 4CWSA 5M4PA 1ZXNA 5GGZA 3OW6A 4H7QA 5M4NA 4MOTA 3G7EA 1UY9A 2WI4A 3EKOA 4R3AA 5CTUA 1UYLA 3SL2A 3TZ4A 3R4OA 2YE3A 2C2AA 3B28A 3G7BA 5F5RA 4ASAA 3INWA 4YKWA 2JKIA 3RLRA 3VHDA 2BU6A 3H4LA 3K60A 4MPCA 1UYDA 2VWCA 4L8ZA 4U93A 4XDMA 1MX0A 2YE2A 3C11A 4LP0A 3ZM7A 4XKKA 1I58A 2XJJA 2WI3A 4EEHA 4HZ0A 3KE6A 2CG9A 1U0ZA 2YKIA 3VHCA 5FNFA 2YEDA 4FMTA 3T0HA 1BGQA 4XITA 5M4MA 1Z5BA 3HYYA 4K4OA 4NH9A 1I5DA 2QFOA 2FWYA 2BU5A 2K5BA 1YC1A 3R91A 1NHIA 4Q20A 4R3MA 2YJWA 4FPPA 2VCJA 1QZRA 2IOPA 3T1KA 1UYGA 4AS9A 3FT5A 1UYKA 5CTYA 4BIZA 3BMYA 3O0IA 4UROA 3U2KA 1TH8A 2YECA 3DGEA 5D6PA 4B6CA 4EGIA 3EHGA 4WUBA 4L93A 2ZKJA 4MP2A 5FNDA 2XDLA 3U2DA 2Q2EB 3WHAA 3MNRP 3HEKA 2WERA 3K98A 3LNUA 4W7TA 4QPKA 2XJXA 1US7A 4GGLA 3ZKDA 4H81A 2YEHA 4YKXA 1YS3A 1UYIA 4I3HA 2CCSA 3R4PA 4PRVA 2YI6A 4P8OA 1UY7A 3A0TA 5CF0A 3TZ2A 2H55A 2WI7A 4AWPA 4GQTA 2YE9A 1L0OA 1YC4A 3K97A 1YSRA 3R92A 2FYPA 2XHXA 2PNRA 2BSMA 4YKTA 3H80A 2QG2A 1AH8A 3FT8A 5M4HA 2FWZA 1OSFA 4EMVA 3JZ3A 4LWIA 1ZW9A 2YEGA 2CH4A 1A4HA 4XCLA 4KQVA 3T0ZA 1GKZA 4CWRA 2BU8A 4GT8A 2YK2A 3PEHA 3T10A 2YGEA 2YK9A 2IWUA
chains in the Genus database with same CATH superfamily
2F6LA 1U8VA 4PU9A 4XC0A 1T9GA 2E0AA 3FCJA 4HXZA 1KIJA 4U7NA 4BXIA 2XJGA 1YSZA 3MPJA 2CCTA 4WUDA 4L1FA 3SF6A 2XABA 3MDDA 3VHAA 5BOCA 1BXDA 2GQPA 3Q23A 4XIQA 3S5TA 4HY6A 3GIFA 4EFTA 4LQSB 4HYPA 4JAUA 5D7DA 1Y8PA 3D1IA 3O2FA 1MU5A 4KTNA 4IRNA 1TILA 5IN9A 1W07A 2ZAFA 1YC3A 1TIDA 3LMMA 1YETA 2YE6A 2YEIA 3FO3A 1S26A 2YYMA 4L3ZA 4H85A 4V25A 3L1TA 3HZ1A 4HXWA 2VF1A 1I5AA 4U7OA 3PFDA 4HKSA 2XDXA 3VADA 5M4EA 4MPNA 1F51A 2XK2A 3D0BA 4CWOA 3VKGA 1JM6A 2IWSA 3HYZA 2XS8A 2XHRA 1GU6A 3OWDA 1AMWA 1TBWA 2GBBA 2OT4A 5J6AA 4IV6A 3EHFA 3M9VA 2RDZA 3A0RA 2OEXA 4U83A 2EC5A 1RP3A 2Q8GA 4Q1OA 4FCRA 1SK6A 2WBIA 2XDSA 2CJ6A 3NF4A 3P4TA 3X0XA 1H7SA 3K99A 4O09A 4AWQA 4Q5BA 2IWXA 1Z5AA 1AM1A 3UU9A 3GIGB 4R1FA 3OMUA 4ZVIA 1FS8A 2ZBKB 3B96A 1I5CA 1Z5CA 2VW5A 2CGFA 3CWVA 2D29A 2YE5A 2IOQA 4Q4UA 1QY8A 3B26A 1QYEA 3CE2A 2HCHA 4MP7A 2XDUA 5B5WA 1Y4SA 1YESA 3EOMA 4DOYA 2ZDYA 3QTFA 5CTXA 4EM7A 3B27A 2CCUA 3Q5LA 2E80A 5GJVE 5IDJA 2CX9A 4AKHA 1XFVA 2YYIA 1R2JA 3O6OA 4EFUA 4WJYA 3LG1A 2YE4A 3TTZA 1B3QA 1K93A 3EHJA 2LFWA 1TC0A 4EGHA 4ZKIA 2Q8FA 4DZYA 4KSHA 1UYFA 3HHUA 2DDHA 4CWTA 1PVGA 3D6BA 5C93A 2BTZA 1GJVA 4E01A 4ASGA 1PK0A 2C12A 2YI5A 4CWNA 2QR4A 1RJ1A 3OWMA 2R0MA 2OR0A 3RLPA 1YERA 3F29A 3A0WA 3Q5KA 4L38A 4P7AA 4KSGA 1SC5A 1UY6A 2YKEA 3HZ5A 3EHHA 3BM9A 3TZ0A 2YYKA 3HWCA 3T2SA 4O04A 1EI1A 4E02A 3GIEA 3TUHA 2YEEA 1THNA 4YKZA 2YI0A 4JIOA 4YKQA 2XCMA 3CYGA 2BU2A 4NH8A 4QPJA 2VIGA 3RLQA 1Y8NA 5CPHA 1JQIA 2YI7A 1EGCA 4E72A 1ZWHA 2JJCA 4GEEA 2H8MA 3SCEA 5BRKA 1U2OA 3C0EA 3G75A 1RX0A 5BODA 3Q22A 2XHTA 4PL9A 2YKCA 4E00A 1YT0A 2YEFA 2WEPA 4HYMA 4FCPA 2XX4A 2XX2A 4BQJA 4KCFA 5D7CA 4N5FA 2E81A 5FWKA 3R7KA 4HZ5A 1BUCA 1EGDA 2AKPA 4GCZA 4URMA 4I5SA 3OPDA 3MKHA 4L91A 3S7WA 4MBCA 2YEBA 1XFXA 4LWHA 2UWDA 1IXMA 1IVHA 2JBSA 2Q8IA 3CGYA 2WEQA 3D36A 2RFQA 1B62A 1NHHA 4KP4A 3ZXQA 2OJQA 3LPSA 2VR0A 3GIGA 3PEJA 4L90A 3C2PA 2HKJA 2BZ5A 2BRCA 3BNHA 2QF6A 1S14A 3OIBA 1I59A 2O1VA 1GKXA 5CTWA 2O1UA 3FV5A 3R4MA 2YKBA 1Y4UA 2JIFA 4JAVA 4LPBA 3ZKBA 4URLA 5D7RA 2XQRB 3BNGA 1Y8OA 5B5VA 2YGAA 2IX6A 2R03A 4CWQA 1I5BA 2C0UA 3U67A 1UYEA 2R02A 1Z59A 2EBFX 3TTBA 5F3KA 2XX5A 2JBTA 1YT2A 3D9GA 2XDKA 1BKNA 3A0ZA 2XD6A 4NXLA 1YT1A 2XS1A 3II9A 2YEJA 2YE7A 1RJ4A 4V26A 4XE2A 2REHA 1AH6A 2Q8HA 4CE3A 4CE2A 4ASFA 4EGKA 1H7UA 3NMQA 4NH7A 4JQLA 3CGZA 3A0YA 5L3JA 3N0RA 4WUCA 3EKRA 1SIQA 1UY8A 4BIUA 4LWGA 2HG1A 4JASA 5IDMA 2ZO5A 4YKUA 4KTOA 1UDYA 1UYCA 3SWOA 4BAEA 2YE8A 3RKZA 3TZ5A 3AFEA 3LGQA 2C1GA 4XIPA 3R4NA 5K3GA 1ZXMA 2YYLA 4URNA 2CJ4A 4AI6A 4JIZA 4FCQA 2VCIA 4PRXA 4BQGA 4O05A 5J71A 2YJXA 2YKJA 4CWPA 1Y0VA 5D6QA 4XCJA 2GFDA 1UYMA 3GQTA 1X90A 4AWOA 3KMLA 3QDDA 4YKRA 4OO2A 2YEAA 3IEDA 4F0XA 2RF7A 4O0BA 2WI6A 5FNCA 4HKRA 4G5EA 3GM6A 3CRLA 1EA6A 2WI2A 2C1IA 4XVXA 2IORA 2FTKA 2BT0A 4KFGA 5K3HA 1XG2B 3D2RA 2FONA 1AJ6A 1ID0A 3OWAA 1S16A 5M4KA 2CJ8A 2DVLA 1NHJA 4XKOA 2WI5A 4MB9A 2BU7A 4X9LA 4XTJA 4W9UA 4HY1A 4ZXVA 3B25A 3BNJA 1KZNA 1TC6A 4HR3A 2EXLA 3A0XA 3D9DA 2BYIA 2YYJA 3WQ9A 4KSAA 4KSFA 3Q5JA 4GFNA 1R62A 4MPEA 2O1WA 4LWEA 2BYHA 2HHIA 2BREA 3EONA 2ZDXA 4DUHA 3MPIA 4CE1A 2FXSA 3OWBA 4L94A 4B7PA 4CWFA 1K90A 2JBRA 4Q0TA 2ESAA 4XKAA 3ZXOA 3SXQA 1X91A 4P79A 2YGFA 4ASBA 1R3BA 2FP2A 2WI1A 3B24A 4YKYA 1BYQA 4XD8A 1UYHA 3TORA 1B63A 4XIRA 5K3IA 3INXA 4LWFA 4Q5CA 3CRKA 5B6BA 2QG0A 4O07A 4CWSA 5M4PA 1ZXNA 5GGZA 4X28A 3OW6A 4H7QA 3X29A 5M4NA 1OAHA 4MOTA 3G7EA 1UY9A 2WI4A 3EKOA 4R3AA 5CTUA 1UYLA 3SL2A 3TZ4A 3R4OA 2YE3A 2C2AA 3B28A 3G7BA 5F5RA 4ASAA 3INWA 4YKWA 2AO2A 3MMOA 2JKIA 3RLRA 3VHDA 2BU6A 3H4LA 2AZEA 1FS9A 3K60A 1LVCA 1XFUA 2OEVA 4MPCA 1UYDA 4P13A 2VWCA 4AKIA 4L8ZA 4U93A 4XDMA 1FS7A 1MX0A 2YE2A 1UKWA 4J1VA 3C11A 4LP0A 3D9EA 3ZM7A 4XKKA 1XFYA 1I58A 4KS9A 2XJJA 4FF3A 2WI3A 4EEHA 4HZ0A 3KE6A 2CG9A 1U0ZA 2YKIA 3VHCA 5FNFA 2CJ7A 3GNCA 2YEDA 4FMTA 3T0HA 1BGQA 4XITA 5M4MA 1Z5BA 3HYYA 4K4OA 4NH9A 1SIRA 1I5DA 2QFOA 2FWYA 2BU5A 2PO4A 3D9FA 3C46A 3UBRA 4FF1A 2K5BA 1YC1A 3R91A 1NHIA 4Q20A 4X28C 1QDBA 4R3MA 2YJWA 4FPPA 4RM7A 2VCJA 1QZRA 2IOPA 3T1KA 4FF2A 2YYGA 1IS2A 1UYGA 5BRMA 2FP1A 4AS9A 2IX5A 3FT5A 5JENA 1UYKA 5CTYA 4BIZA 3BMYA 3O0IA 4UROA 3U2KA 1TH8A 2YECA 3DGEA 5D6PA 4B6CA 4EGIA 3EHGA 4WUBA 4L93A 2ZKJA 4MP2A 5FNDA 3RKHA 2XDLA 3U2DA 2Q2EB 3WHAA 1XFZA 2EBHX 3MNRP 3HEKA 3VKHA 2WERA 3K98A 3LNUA 4W7TA 4O5MA 4QPKA 4L3YA 2XJXA 1PI1A 1US7A 1WS9A 4GGLA 3ZKDA 4H81A 2YEHA 4YKXA 1YS3A 1UYIA 4I3HA 2CCSA 3R4PA 3Q24A 4PRVA 4FF4A 2YI6A 4P8OA 1UY7A 3A0TA 5CF0A 3TZ2A 3MDEA 4QICA 2H55A 2WI7A 1X8ZA 4AWPA 5GJWE 4GQTA 2YE9A 4LQQB 2PG0A 1L0OA 2EBAA 1YC4A 2R05A 4FZ4A 1YSRA 3K97A 4M9AA 4AKGA 3R92A 2FYPA 2R0NA 2Z1QA 2XHXA 2PNRA 3AFFA 2BSMA 3C3LA 4YKTA 3H80A 4ZYJA 1XFWA 2QG2A 1AH8A 2J7AA 3FT8A 1K8TA 5M4HA 2CJ5A 4L3XA 2FWZA 1OSFA 4EMVA 4Q17A 3JZ3A 4LWIA 1ZW9A 2YEGA 2CH4A 2UXWA 1A4HA 4XCLA 4KQVA 3T0ZA 1GKZA 1EGEA 2HJNA 2A1TA 4CWRA 2BU8A 4GT8A 2YK2A 3PEHA 2YGWA 3X0YA 5K3JA 3T10A 3BNFA 3Q0AA 3MXLA 4JEKA 2YGEA 4G97A 2YK9A 2IWUA
chains in the Genus database with same CATH topology
4PU9A 4XC0A 2E0AA 4HXZA 1KIJA 4U7NA 4BXIA 2XJGA 1YSZA 2CCTA 4WUDA 3VHAA 2XABA 5BOCA 1BXDA 2GQPA 4XIQA 4HY6A 3GIFA 4EFTA 4HYPA 4JAUA 5D7DA 1Y8PA 3O2FA 1MU5A 4KTNA 1TILA 5IN9A 1YC3A 1TIDA 1YETA 2YE6A 2YEIA 4H85A 4V25A 3HZ1A 4HXWA 4U7OA 1I5AA 2XDXA 3VADA 5M4EA 4MPNA 2XK2A 3D0BA 4CWOA 1JM6A 2IWSA 3HYZA 2XHRA 3OWDA 1AMWA 1TBWA 5J6AA 3EHFA 3A0RA 2Q8GA 4FCRA 2XDSA 1H7SA 3K99A 4O09A 4AWQA 2IWXA 1Z5AA 1AM1A 3GIGB 4R1FA 3OMUA 4ZVIA 2ZBKB 1I5CA 1Z5CA 2VW5A 2CGFA 3CWVA 2YE5A 2IOQA 3B26A 1QY8A 1QYEA 2HCHA 4MP7A 2XDUA 1Y4SA 1YESA 3QTFA 2ZDYA 5CTXA 4EM7A 3B27A 2CCUA 3Q5LA 5IDJA 3O6OA 4EFUA 2YE4A 3TTZA 1B3QA 3EHJA 4EGHA 1TC0A 4ZKIA 2Q8FA 4DZYA 4KSHA 1UYFA 3HHUA 4CWTA 1PVGA 5C93A 2BTZA 1GJVA 4E01A 4ASGA 2YI5A 4CWNA 3RLPA 1YERA 3A0WA 3Q5KA 4P7AA 4KSGA 1UY6A 2YKEA 3HZ5A 3EHHA 3BM9A 3TZ0A 3T2SA 4O04A 1EI1A 4E02A 3GIEA 3TUHA 2YEEA 1THNA 4YKZA 2YI0A 4YKQA 2XCMA 2BU2A 4NH8A 4QPJA 3RLQA 1Y8NA 5CPHA 2YI7A 1ZWHA 2JJCA 4GEEA 2H8MA 1U2OA 3C0EA 3G75A 5BODA 2XHTA 4PL9A 2YKCA 4E00A 1YT0A 2YEFA 2WEPA 4HYMA 4FCPA 2XX4A 2XX2A 4BQJA 5D7CA 5FWKA 4HZ5A 2AKPA 4GCZA 4URMA 4I5SA 3OPDA 4L91A 4MBCA 2YEBA 4LWHA 2UWDA 2Q8IA 3CGYA 2WEQA 3D36A 1B62A 4KP4A 1NHHA 3ZXQA 3LPSA 3GIGA 3PEJA 4L90A 2HKJA 2BZ5A 2BRCA 2QF6A 1S14A 1I59A 2O1VA 1GKXA 5CTWA 2O1UA 3FV5A 3R4MA 2YKBA 1Y4UA 4JAVA 4LPBA 4URLA 3ZKBA 5D7RA 2YGAA 1Y8OA 4CWQA 1I5BA 3U67A 1UYEA 1Z59A 5F3KA 2XX5A 1YT2A 3A0ZA 2XDKA 1BKNA 2XD6A 1YT1A 2YEJA 2YE7A 4V26A 4XE2A 1AH6A 2Q8HA 4CE3A 4CE2A 4ASFA 4EGKA 1H7UA 3NMQA 4NH7A 4JQLA 3CGZA 3A0YA 5L3JA 4WUCA 3EKRA 4BIUA 1UY8A 4LWGA 2HG1A 4JASA 5IDMA 4YKUA 1UYCA 4BAEA 2YE8A 3RKZA 3TZ5A 4XIPA 3R4NA 1ZXMA 4URNA 4FCQA 2VCIA 4PRXA 4BQGA 4O05A 5J71A 2YJXA 2YKJA 4CWPA 5D6QA 4XCJA 2GFDA 1UYMA 4AWOA 3QDDA 4YKRA 2YEAA 3IEDA 4O0BA 2WI6A 5FNCA 3CRLA 1EA6A 2WI2A 2IORA 2BT0A 4KFGA 3D2RA 1AJ6A 1ID0A 1S16A 5M4KA 1NHJA 4XKOA 2WI5A 4MB9A 2BU7A 4X9LA 4XTJA 4HY1A 3B25A 1KZNA 1TC6A 2EXLA 3A0XA 2BYIA 3WQ9A 3Q5JA 4GFNA 1R62A 4MPEA 2O1WA 4LWEA 2BYHA 2BREA 2ZDXA 4DUHA 4CE1A 2FXSA 3OWBA 4L94A 4B7PA 4CWFA 2ESAA 4XKAA 3ZXOA 2YGFA 4ASBA 3B24A 2WI1A 4YKYA 1BYQA 4XD8A 1UYHA 1B63A 4XIRA 3INXA 4LWFA 3CRKA 2QG0A 4O07A 4CWSA 5M4PA 1ZXNA 5GGZA 3OW6A 4H7QA 5M4NA 4MOTA 3G7EA 1UY9A 2WI4A 3EKOA 4R3AA 5CTUA 1UYLA 3SL2A 3TZ4A 3R4OA 2YE3A 2C2AA 3B28A 3G7BA 5F5RA 4ASAA 3INWA 4YKWA 2JKIA 3RLRA 3VHDA 2BU6A 3H4LA 3K60A 4MPCA 1UYDA 2VWCA 4L8ZA 4U93A 4XDMA 1MX0A 2YE2A 3C11A 4LP0A 3ZM7A 4XKKA 1I58A 2XJJA 2WI3A 4EEHA 4HZ0A 3KE6A 2CG9A 1U0ZA 2YKIA 3VHCA 5FNFA 2YEDA 4FMTA 3T0HA 1BGQA 4XITA 5M4MA 1Z5BA 3HYYA 4K4OA 4NH9A 1I5DA 2QFOA 2FWYA 2BU5A 2K5BA 1YC1A 3R91A 1NHIA 4Q20A 4R3MA 2YJWA 4FPPA 2VCJA 1QZRA 2IOPA 3T1KA 1UYGA 4AS9A 3FT5A 1UYKA 5CTYA 4BIZA 3BMYA 3O0IA 4UROA 3U2KA 1TH8A 2YECA 3DGEA 5D6PA 4B6CA 4EGIA 3EHGA 4WUBA 4L93A 2ZKJA 4MP2A 5FNDA 2XDLA 3U2DA 2Q2EB 3WHAA 3MNRP 3HEKA 2WERA 3K98A 3LNUA 4W7TA 4QPKA 2XJXA 1US7A 4GGLA 3ZKDA 4H81A 2YEHA 4YKXA 1YS3A 1UYIA 4I3HA 2CCSA 3R4PA 4PRVA 2YI6A 4P8OA 1UY7A 3A0TA 5CF0A 3TZ2A 2H55A 2WI7A 4AWPA 4GQTA 2YE9A 1L0OA 1YC4A 3K97A 1YSRA 3R92A 2FYPA 2XHXA 2PNRA 2BSMA 4YKTA 3H80A 2QG2A 1AH8A 3FT8A 5M4HA 2FWZA 1OSFA 4EMVA 3JZ3A 4LWIA 1ZW9A 2YEGA 2CH4A 1A4HA 4XCLA 4KQVA 3T0ZA 1GKZA 4CWRA 2BU8A 4GT8A 2YK2A 3PEHA 3T10A 2YGEA 2YK9A 2IWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU9 A;  4XC0 A;  2E0A A;  4HXZ A;  1KIJ A;  4U7N A;  4BXI A;  2XJG A;  1YSZ A;  2CCT A;  4WUD A;  3VHA A;  2XAB A;  5BOC A;  1BXD A;  2GQP A;  4XIQ A;  4HY6 A;  3GIF A;  4EFT A;  4HYP A;  4JAU A;  5D7D A;  1Y8P A;  3O2F A;  1MU5 A;  4KTN A;  1TIL A;  5IN9 A;  1YC3 A;  1TID A;  1YET A;  2YE6 A;  2YEI A;  4H85 A;  4V25 A;  3HZ1 A;  4HXW A;  4U7O A;  1I5A A;  2XDX A;  3VAD A;  5M4E A;  4MPN A;  2XK2 A;  3D0B A;  4CWO A;  1JM6 A;  2IWS A;  3HYZ A;  2XHR A;  3OWD A;  1AMW A;  1TBW A;  5J6A A;  3EHF A;  3A0R A;  2Q8G A;  4FCR A;  2XDS A;  1H7S A;  3K99 A;  4O09 A;  4AWQ A;  2IWX A;  1Z5A A;  1AM1 A;  3GIG B;  4R1F A;  3OMU A;  4ZVI A;  2ZBK B;  1I5C A;  1Z5C A;  2VW5 A;  2CGF A;  3CWV A;  2YE5 A;  2IOQ A;  3B26 A;  1QY8 A;  1QYE A;  2HCH A;  4MP7 A;  2XDU A;  1Y4S A;  1YES A;  3QTF A;  2ZDY A;  5CTX A;  4EM7 A;  3B27 A;  2CCU A;  3Q5L A;  5IDJ A;  3O6O A;  4EFU A;  2YE4 A;  3TTZ A;  1B3Q A;  3EHJ A;  4EGH A;  1TC0 A;  4ZKI A;  2Q8F A;  4DZY A;  4KSH A;  1UYF A;  3HHU A;  4CWT A;  1PVG A;  5C93 A;  2BTZ A;  1GJV A;  4E01 A;  4ASG A;  2YI5 A;  4CWN A;  3RLP A;  1YER A;  3A0W A;  3Q5K A;  4P7A A;  4KSG A;  1UY6 A;  2YKE A;  3HZ5 A;  3EHH A;  3BM9 A;  3TZ0 A;  3T2S A;  4O04 A;  1EI1 A;  4E02 A;  3GIE A;  3TUH A;  2YEE A;  1THN A;  4YKZ A;  2YI0 A;  4YKQ A;  2XCM A;  2BU2 A;  4NH8 A;  4QPJ A;  3RLQ A;  1Y8N A;  5CPH A;  2YI7 A;  1ZWH A;  2JJC A;  4GEE A;  2H8M A;  1U2O A;  3C0E A;  3G75 A;  5BOD A;  2XHT A;  4PL9 A;  2YKC A;  4E00 A;  1YT0 A;  2YEF A;  2WEP A;  4HYM A;  4FCP A;  2XX4 A;  2XX2 A;  4BQJ A;  5D7C A;  5FWK A;  4HZ5 A;  2AKP A;  4GCZ A;  4URM A;  4I5S A;  3OPD A;  4L91 A;  4MBC A;  2YEB A;  4LWH A;  2UWD A;  2Q8I A;  3CGY A;  2WEQ A;  3D36 A;  1B62 A;  4KP4 A;  1NHH A;  3ZXQ A;  3LPS A;  3GIG A;  3PEJ A;  4L90 A;  2HKJ A;  2BZ5 A;  2BRC A;  2QF6 A;  1S14 A;  1I59 A;  2O1V A;  1GKX A;  5CTW A;  2O1U A;  3FV5 A;  3R4M A;  2YKB A;  1Y4U A;  4JAV A;  4LPB A;  4URL A;  3ZKB A;  5D7R A;  2YGA A;  1Y8O A;  4CWQ A;  1I5B A;  3U67 A;  1UYE A;  1Z59 A;  5F3K A;  2XX5 A;  1YT2 A;  3A0Z A;  2XDK A;  1BKN A;  2XD6 A;  1YT1 A;  2YEJ A;  2YE7 A;  4V26 A;  4XE2 A;  1AH6 A;  2Q8H A;  4CE3 A;  4CE2 A;  4ASF A;  4EGK A;  1H7U A;  3NMQ A;  4NH7 A;  4JQL A;  3CGZ A;  3A0Y A;  5L3J A;  4WUC A;  3EKR A;  4BIU A;  1UY8 A;  4LWG A;  2HG1 A;  4JAS A;  5IDM A;  4YKU A;  1UYC A;  4BAE A;  2YE8 A;  3RKZ A;  3TZ5 A;  4XIP A;  3R4N A;  1ZXM A;  4URN A;  4FCQ A;  2VCI A;  4PRX A;  4BQG A;  4O05 A;  5J71 A;  2YJX A;  2YKJ A;  4CWP A;  5D6Q A;  4XCJ A;  2GFD A;  1UYM A;  4AWO A;  3QDD A;  4YKR A;  2YEA A;  3IED A;  4O0B A;  2WI6 A;  5FNC A;  3CRL A;  1EA6 A;  2WI2 A;  2IOR A;  2BT0 A;  4KFG A;  3D2R A;  1AJ6 A;  1ID0 A;  1S16 A;  5M4K A;  1NHJ A;  4XKO A;  2WI5 A;  4MB9 A;  2BU7 A;  4X9L A;  4XTJ A;  4HY1 A;  3B25 A;  1KZN A;  1TC6 A;  2EXL A;  3A0X A;  2BYI A;  3WQ9 A;  3Q5J A;  4GFN A;  1R62 A;  4MPE A;  2O1W A;  4LWE A;  2BYH A;  2BRE A;  2ZDX A;  4DUH A;  4CE1 A;  2FXS A;  3OWB A;  4L94 A;  4B7P A;  4CWF A;  2ESA A;  4XKA A;  3ZXO A;  2YGF A;  4ASB A;  3B24 A;  2WI1 A;  4YKY A;  1BYQ A;  4XD8 A;  1UYH A;  1B63 A;  4XIR A;  3INX A;  4LWF A;  3CRK A;  2QG0 A;  4O07 A;  4CWS A;  5M4P A;  1ZXN A;  5GGZ A;  3OW6 A;  4H7Q A;  5M4N A;  4MOT A;  3G7E A;  1UY9 A;  2WI4 A;  3EKO A;  4R3A A;  5CTU A;  1UYL A;  3SL2 A;  3TZ4 A;  3R4O A;  2YE3 A;  2C2A A;  3B28 A;  3G7B A;  5F5R A;  4ASA A;  3INW A;  4YKW A;  2JKI A;  3RLR A;  3VHD A;  2BU6 A;  3H4L A;  3K60 A;  4MPC A;  1UYD A;  2VWC A;  4L8Z A;  4U93 A;  4XDM A;  1MX0 A;  2YE2 A;  3C11 A;  4LP0 A;  3ZM7 A;  4XKK A;  1I58 A;  2XJJ A;  2WI3 A;  4EEH A;  4HZ0 A;  3KE6 A;  2CG9 A;  1U0Z A;  2YKI A;  3VHC A;  5FNF A;  2YED A;  4FMT A;  3T0H A;  1BGQ A;  4XIT A;  5M4M A;  1Z5B A;  3HYY A;  4K4O A;  4NH9 A;  1I5D A;  2QFO A;  2FWY A;  2BU5 A;  2K5B A;  1YC1 A;  3R91 A;  1NHI A;  4Q20 A;  4R3M A;  2YJW A;  4FPP A;  2VCJ A;  1QZR A;  2IOP A;  3T1K A;  1UYG A;  4AS9 A;  3FT5 A;  1UYK A;  5CTY A;  4BIZ A;  3BMY A;  3O0I A;  4URO A;  3U2K A;  1TH8 A;  2YEC A;  3DGE A;  5D6P A;  4B6C A;  4EGI A;  3EHG A;  4WUB A;  4L93 A;  2ZKJ A;  4MP2 A;  5FND A;  2XDL A;  3U2D A;  2Q2E B;  3WHA A;  3MNR P;  3HEK A;  2WER A;  3K98 A;  3LNU A;  4W7T A;  4QPK A;  2XJX A;  1US7 A;  4GGL A;  3ZKD A;  4H81 A;  2YEH A;  4YKX A;  1YS3 A;  1UYI A;  4I3H A;  2CCS A;  3R4P A;  4PRV A;  2YI6 A;  4P8O A;  1UY7 A;  3A0T A;  5CF0 A;  3TZ2 A;  2H55 A;  2WI7 A;  4AWP A;  4GQT A;  2YE9 A;  1L0O A;  1YC4 A;  3K97 A;  1YSR A;  3R92 A;  2FYP A;  2XHX A;  2PNR A;  2BSM A;  4YKT A;  3H80 A;  2QG2 A;  1AH8 A;  3FT8 A;  5M4H A;  2FWZ A;  1OSF A;  4EMV A;  3JZ3 A;  4LWI A;  1ZW9 A;  2YEG A;  2CH4 A;  1A4H A;  4XCL A;  4KQV A;  3T0Z A;  1GKZ A;  4CWR A;  2BU8 A;  4GT8 A;  2YK2 A;  3PEH A;  3T10 A;  2YGE A;  2YK9 A;  2IWU A; 
#chains in the Genus database with same CATH topology
 2F6L A;  1U8V A;  4PU9 A;  4XC0 A;  1T9G A;  2E0A A;  3FCJ A;  4HXZ A;  1KIJ A;  4U7N A;  4BXI A;  2XJG A;  1YSZ A;  3MPJ A;  2CCT A;  4WUD A;  4L1F A;  3SF6 A;  2XAB A;  3MDD A;  3VHA A;  5BOC A;  1BXD A;  2GQP A;  3Q23 A;  4XIQ A;  3S5T A;  4HY6 A;  3GIF A;  4EFT A;  4LQS B;  4HYP A;  4JAU A;  5D7D A;  1Y8P A;  3D1I A;  3O2F A;  1MU5 A;  4KTN A;  4IRN A;  1TIL A;  5IN9 A;  1W07 A;  2ZAF A;  1YC3 A;  1TID A;  3LMM A;  1YET A;  2YE6 A;  2YEI A;  3FO3 A;  1S26 A;  2YYM A;  4L3Z A;  4H85 A;  4V25 A;  3L1T A;  3HZ1 A;  4HXW A;  2VF1 A;  1I5A A;  4U7O A;  3PFD A;  4HKS A;  2XDX A;  3VAD A;  5M4E A;  4MPN A;  1F51 A;  2XK2 A;  3D0B A;  4CWO A;  3VKG A;  1JM6 A;  2IWS A;  3HYZ A;  2XS8 A;  2XHR A;  1GU6 A;  3OWD A;  1AMW A;  1TBW A;  2GBB A;  2OT4 A;  5J6A A;  4IV6 A;  3EHF A;  3M9V A;  2RDZ A;  3A0R A;  2OEX A;  4U83 A;  2EC5 A;  1RP3 A;  2Q8G A;  4Q1O A;  4FCR A;  1SK6 A;  2WBI A;  2XDS A;  2CJ6 A;  3NF4 A;  3P4T A;  3X0X A;  1H7S A;  3K99 A;  4O09 A;  4AWQ A;  4Q5B A;  2IWX A;  1Z5A A;  1AM1 A;  3UU9 A;  3GIG B;  4R1F A;  3OMU A;  4ZVI A;  1FS8 A;  2ZBK B;  3B96 A;  1I5C A;  1Z5C A;  2VW5 A;  2CGF A;  3CWV A;  2D29 A;  2YE5 A;  2IOQ A;  4Q4U A;  1QY8 A;  3B26 A;  1QYE A;  3CE2 A;  2HCH A;  4MP7 A;  2XDU A;  5B5W A;  1Y4S A;  1YES A;  3EOM A;  4DOY A;  2ZDY A;  3QTF A;  5CTX A;  4EM7 A;  3B27 A;  2CCU A;  3Q5L A;  2E80 A;  5GJV E;  5IDJ A;  2CX9 A;  4AKH A;  1XFV A;  2YYI A;  1R2J A;  3O6O A;  4EFU A;  4WJY A;  3LG1 A;  2YE4 A;  3TTZ A;  1B3Q A;  1K93 A;  3EHJ A;  2LFW A;  1TC0 A;  4EGH A;  4ZKI A;  2Q8F A;  4DZY A;  4KSH A;  1UYF A;  3HHU A;  2DDH A;  4CWT A;  1PVG A;  3D6B A;  5C93 A;  2BTZ A;  1GJV A;  4E01 A;  4ASG A;  1PK0 A;  2C12 A;  2YI5 A;  4CWN A;  2QR4 A;  1RJ1 A;  3OWM A;  2R0M A;  2OR0 A;  3RLP A;  1YER A;  3F29 A;  3A0W A;  3Q5K A;  4L38 A;  4P7A A;  4KSG A;  1SC5 A;  1UY6 A;  2YKE A;  3HZ5 A;  3EHH A;  3BM9 A;  3TZ0 A;  2YYK A;  3HWC A;  3T2S A;  4O04 A;  1EI1 A;  4E02 A;  3GIE A;  3TUH A;  2YEE A;  1THN A;  4YKZ A;  2YI0 A;  4JIO A;  4YKQ A;  2XCM A;  3CYG A;  2BU2 A;  4NH8 A;  4QPJ A;  2VIG A;  3RLQ A;  1Y8N A;  5CPH A;  1JQI A;  2YI7 A;  1EGC A;  4E72 A;  1ZWH A;  2JJC A;  4GEE A;  2H8M A;  3SCE A;  5BRK A;  1U2O A;  3C0E A;  3G75 A;  1RX0 A;  5BOD A;  3Q22 A;  2XHT A;  4PL9 A;  2YKC A;  4E00 A;  1YT0 A;  2YEF A;  2WEP A;  4HYM A;  4FCP A;  2XX4 A;  2XX2 A;  4BQJ A;  4KCF A;  5D7C A;  4N5F A;  2E81 A;  5FWK A;  3R7K A;  4HZ5 A;  1BUC A;  1EGD A;  2AKP A;  4GCZ A;  4URM A;  4I5S A;  3OPD A;  3MKH A;  4L91 A;  3S7W A;  4MBC A;  2YEB A;  1XFX A;  4LWH A;  2UWD A;  1IXM A;  1IVH A;  2JBS A;  2Q8I A;  3CGY A;  2WEQ A;  3D36 A;  2RFQ A;  1B62 A;  1NHH A;  4KP4 A;  3ZXQ A;  2OJQ A;  3LPS A;  2VR0 A;  3GIG A;  3PEJ A;  4L90 A;  3C2P A;  2HKJ A;  2BZ5 A;  2BRC A;  3BNH A;  2QF6 A;  1S14 A;  3OIB A;  1I59 A;  2O1V A;  1GKX A;  5CTW A;  2O1U A;  3FV5 A;  3R4M A;  2YKB A;  1Y4U A;  2JIF A;  4JAV A;  4LPB A;  3ZKB A;  4URL A;  5D7R A;  2XQR B;  3BNG A;  1Y8O A;  5B5V A;  2YGA A;  2IX6 A;  2R03 A;  4CWQ A;  1I5B A;  2C0U A;  3U67 A;  1UYE A;  2R02 A;  1Z59 A;  2EBF X;  3TTB A;  5F3K A;  2XX5 A;  2JBT A;  1YT2 A;  3D9G A;  2XDK A;  1BKN A;  3A0Z A;  2XD6 A;  4NXL A;  1YT1 A;  2XS1 A;  3II9 A;  2YEJ A;  2YE7 A;  1RJ4 A;  4V26 A;  4XE2 A;  2REH A;  1AH6 A;  2Q8H A;  4CE3 A;  4CE2 A;  4ASF A;  4EGK A;  1H7U A;  3NMQ A;  4NH7 A;  4JQL A;  3CGZ A;  3A0Y A;  5L3J A;  3N0R A;  4WUC A;  3EKR A;  1SIQ A;  1UY8 A;  4BIU A;  4LWG A;  2HG1 A;  4JAS A;  5IDM A;  2ZO5 A;  4YKU A;  4KTO A;  1UDY A;  1UYC A;  3SWO A;  4BAE A;  2YE8 A;  3RKZ A;  3TZ5 A;  3AFE A;  3LGQ A;  2C1G A;  4XIP A;  3R4N A;  5K3G A;  1ZXM A;  2YYL A;  4URN A;  2CJ4 A;  4AI6 A;  4JIZ A;  4FCQ A;  2VCI A;  4PRX A;  4BQG A;  4O05 A;  5J71 A;  2YJX A;  2YKJ A;  4CWP A;  1Y0V A;  5D6Q A;  4XCJ A;  2GFD A;  1UYM A;  3GQT A;  1X90 A;  4AWO A;  3KML A;  3QDD A;  4YKR A;  4OO2 A;  2YEA A;  3IED A;  4F0X A;  2RF7 A;  4O0B A;  2WI6 A;  5FNC A;  4HKR A;  4G5E A;  3GM6 A;  3CRL A;  1EA6 A;  2WI2 A;  2C1I A;  4XVX A;  2IOR A;  2FTK A;  2BT0 A;  4KFG A;  5K3H A;  1XG2 B;  3D2R A;  2FON A;  1AJ6 A;  1ID0 A;  3OWA A;  1S16 A;  5M4K A;  2CJ8 A;  2DVL A;  1NHJ A;  4XKO A;  2WI5 A;  4MB9 A;  2BU7 A;  4X9L A;  4XTJ A;  4W9U A;  4HY1 A;  4ZXV A;  3B25 A;  3BNJ A;  1KZN A;  1TC6 A;  4HR3 A;  2EXL A;  3A0X A;  3D9D A;  2BYI A;  2YYJ A;  3WQ9 A;  4KSA A;  4KSF A;  3Q5J A;  4GFN A;  1R62 A;  4MPE A;  2O1W A;  4LWE A;  2BYH A;  2HHI A;  2BRE A;  3EON A;  2ZDX A;  4DUH A;  3MPI A;  4CE1 A;  2FXS A;  3OWB A;  4L94 A;  4B7P A;  4CWF A;  1K90 A;  2JBR A;  4Q0T A;  2ESA A;  4XKA A;  3ZXO A;  3SXQ A;  1X91 A;  4P79 A;  2YGF A;  4ASB A;  1R3B A;  2FP2 A;  2WI1 A;  3B24 A;  4YKY A;  1BYQ A;  4XD8 A;  1UYH A;  3TOR A;  1B63 A;  4XIR A;  5K3I A;  3INX A;  4LWF A;  4Q5C A;  3CRK A;  5B6B A;  2QG0 A;  4O07 A;  4CWS A;  5M4P A;  1ZXN A;  5GGZ A;  4X28 A;  3OW6 A;  4H7Q A;  3X29 A;  5M4N A;  1OAH A;  4MOT A;  3G7E A;  1UY9 A;  2WI4 A;  3EKO A;  4R3A A;  5CTU A;  1UYL A;  3SL2 A;  3TZ4 A;  3R4O A;  2YE3 A;  2C2A A;  3B28 A;  3G7B A;  5F5R A;  4ASA A;  3INW A;  4YKW A;  2AO2 A;  3MMO A;  2JKI A;  3RLR A;  3VHD A;  2BU6 A;  3H4L A;  2AZE A;  1FS9 A;  3K60 A;  1LVC A;  1XFU A;  2OEV A;  4MPC A;  1UYD A;  4P13 A;  2VWC A;  4AKI A;  4L8Z A;  4U93 A;  4XDM A;  1FS7 A;  1MX0 A;  2YE2 A;  1UKW A;  4J1V A;  3C11 A;  4LP0 A;  3D9E A;  3ZM7 A;  4XKK A;  1XFY A;  1I58 A;  4KS9 A;  2XJJ A;  4FF3 A;  2WI3 A;  4EEH A;  4HZ0 A;  3KE6 A;  2CG9 A;  1U0Z A;  2YKI A;  3VHC A;  5FNF A;  2CJ7 A;  3GNC A;  2YED A;  4FMT A;  3T0H A;  1BGQ A;  4XIT A;  5M4M A;  1Z5B A;  3HYY A;  4K4O A;  4NH9 A;  1SIR A;  1I5D A;  2QFO A;  2FWY A;  2BU5 A;  2PO4 A;  3D9F A;  3C46 A;  3UBR A;  4FF1 A;  2K5B A;  1YC1 A;  3R91 A;  1NHI A;  4Q20 A;  4X28 C;  1QDB A;  4R3M A;  2YJW A;  4FPP A;  4RM7 A;  2VCJ A;  1QZR A;  2IOP A;  3T1K A;  4FF2 A;  2YYG A;  1IS2 A;  1UYG A;  5BRM A;  2FP1 A;  4AS9 A;  2IX5 A;  3FT5 A;  5JEN A;  1UYK A;  5CTY A;  4BIZ A;  3BMY A;  3O0I A;  4URO A;  3U2K A;  1TH8 A;  2YEC A;  3DGE A;  5D6P A;  4B6C A;  4EGI A;  3EHG A;  4WUB A;  4L93 A;  2ZKJ A;  4MP2 A;  5FND A;  3RKH A;  2XDL A;  3U2D A;  2Q2E B;  3WHA A;  1XFZ A;  2EBH X;  3MNR P;  3HEK A;  3VKH A;  2WER A;  3K98 A;  3LNU A;  4W7T A;  4O5M A;  4QPK A;  4L3Y A;  2XJX A;  1PI1 A;  1US7 A;  1WS9 A;  4GGL A;  3ZKD A;  4H81 A;  2YEH A;  4YKX A;  1YS3 A;  1UYI A;  4I3H A;  2CCS A;  3R4P A;  3Q24 A;  4PRV A;  4FF4 A;  2YI6 A;  4P8O A;  1UY7 A;  3A0T A;  5CF0 A;  3TZ2 A;  3MDE A;  4QIC A;  2H55 A;  2WI7 A;  1X8Z A;  4AWP A;  5GJW E;  4GQT A;  2YE9 A;  4LQQ B;  2PG0 A;  1L0O A;  2EBA A;  1YC4 A;  2R05 A;  4FZ4 A;  1YSR A;  3K97 A;  4M9A A;  4AKG A;  3R92 A;  2FYP A;  2R0N A;  2Z1Q A;  2XHX A;  2PNR A;  3AFF A;  2BSM A;  3C3L A;  4YKT A;  3H80 A;  4ZYJ A;  1XFW A;  2QG2 A;  1AH8 A;  2J7A A;  3FT8 A;  1K8T A;  5M4H A;  2CJ5 A;  4L3X A;  2FWZ A;  1OSF A;  4EMV A;  4Q17 A;  3JZ3 A;  4LWI A;  1ZW9 A;  2YEG A;  2CH4 A;  2UXW A;  1A4H A;  4XCL A;  4KQV A;  3T0Z A;  1GKZ A;  1EGE A;  2HJN A;  2A1T A;  4CWR A;  2BU8 A;  4GT8 A;  2YK2 A;  3PEH A;  2YGW A;  3X0Y A;  5K3J A;  3T10 A;  3BNF A;  3Q0A A;  3MXL A;  4JEK A;  2YGE A;  4G97 A;  2YK9 A;  2IWU A; 
#chains in the Genus database with same CATH homology
 4PU9 A;  4XC0 A;  2E0A A;  4HXZ A;  1KIJ A;  4U7N A;  4BXI A;  2XJG A;  1YSZ A;  2CCT A;  4WUD A;  3VHA A;  2XAB A;  5BOC A;  1BXD A;  2GQP A;  4XIQ A;  4HY6 A;  3GIF A;  4EFT A;  4HYP A;  4JAU A;  5D7D A;  1Y8P A;  3O2F A;  1MU5 A;  4KTN A;  1TIL A;  5IN9 A;  1YC3 A;  1TID A;  1YET A;  2YE6 A;  2YEI A;  4H85 A;  4V25 A;  3HZ1 A;  4HXW A;  4U7O A;  1I5A A;  2XDX A;  3VAD A;  5M4E A;  4MPN A;  2XK2 A;  3D0B A;  4CWO A;  1JM6 A;  2IWS A;  3HYZ A;  2XHR A;  3OWD A;  1AMW A;  1TBW A;  5J6A A;  3EHF A;  3A0R A;  2Q8G A;  4FCR A;  2XDS A;  1H7S A;  3K99 A;  4O09 A;  4AWQ A;  2IWX A;  1Z5A A;  1AM1 A;  3GIG B;  4R1F A;  3OMU A;  4ZVI A;  2ZBK B;  1I5C A;  1Z5C A;  2VW5 A;  2CGF A;  3CWV A;  2YE5 A;  2IOQ A;  3B26 A;  1QY8 A;  1QYE A;  2HCH A;  4MP7 A;  2XDU A;  1Y4S A;  1YES A;  3QTF A;  2ZDY A;  5CTX A;  4EM7 A;  3B27 A;  2CCU A;  3Q5L A;  5IDJ A;  3O6O A;  4EFU A;  2YE4 A;  3TTZ A;  1B3Q A;  3EHJ A;  4EGH A;  1TC0 A;  4ZKI A;  2Q8F A;  4DZY A;  4KSH A;  1UYF A;  3HHU A;  4CWT A;  1PVG A;  5C93 A;  2BTZ A;  1GJV A;  4E01 A;  4ASG A;  2YI5 A;  4CWN A;  3RLP A;  1YER A;  3A0W A;  3Q5K A;  4P7A A;  4KSG A;  1UY6 A;  2YKE A;  3HZ5 A;  3EHH A;  3BM9 A;  3TZ0 A;  3T2S A;  4O04 A;  1EI1 A;  4E02 A;  3GIE A;  3TUH A;  2YEE A;  1THN A;  4YKZ A;  2YI0 A;  4YKQ A;  2XCM A;  2BU2 A;  4NH8 A;  4QPJ A;  3RLQ A;  1Y8N A;  5CPH A;  2YI7 A;  1ZWH A;  2JJC A;  4GEE A;  2H8M A;  1U2O A;  3C0E A;  3G75 A;  5BOD A;  2XHT A;  4PL9 A;  2YKC A;  4E00 A;  1YT0 A;  2YEF A;  2WEP A;  4HYM A;  4FCP A;  2XX4 A;  2XX2 A;  4BQJ A;  5D7C A;  5FWK A;  4HZ5 A;  2AKP A;  4GCZ A;  4URM A;  4I5S A;  3OPD A;  4L91 A;  4MBC A;  2YEB A;  4LWH A;  2UWD A;  2Q8I A;  3CGY A;  2WEQ A;  3D36 A;  1B62 A;  4KP4 A;  1NHH A;  3ZXQ A;  3LPS A;  3GIG A;  3PEJ A;  4L90 A;  2HKJ A;  2BZ5 A;  2BRC A;  2QF6 A;  1S14 A;  1I59 A;  2O1V A;  1GKX A;  5CTW A;  2O1U A;  3FV5 A;  3R4M A;  2YKB A;  1Y4U A;  4JAV A;  4LPB A;  4URL A;  3ZKB A;  5D7R A;  2YGA A;  1Y8O A;  4CWQ A;  1I5B A;  3U67 A;  1UYE A;  1Z59 A;  5F3K A;  2XX5 A;  1YT2 A;  3A0Z A;  2XDK A;  1BKN A;  2XD6 A;  1YT1 A;  2YEJ A;  2YE7 A;  4V26 A;  4XE2 A;  1AH6 A;  2Q8H A;  4CE3 A;  4CE2 A;  4ASF A;  4EGK A;  1H7U A;  3NMQ A;  4NH7 A;  4JQL A;  3CGZ A;  3A0Y A;  5L3J A;  4WUC A;  3EKR A;  4BIU A;  1UY8 A;  4LWG A;  2HG1 A;  4JAS A;  5IDM A;  4YKU A;  1UYC A;  4BAE A;  2YE8 A;  3RKZ A;  3TZ5 A;  4XIP A;  3R4N A;  1ZXM A;  4URN A;  4FCQ A;  2VCI A;  4PRX A;  4BQG A;  4O05 A;  5J71 A;  2YJX A;  2YKJ A;  4CWP A;  5D6Q A;  4XCJ A;  2GFD A;  1UYM A;  4AWO A;  3QDD A;  4YKR A;  2YEA A;  3IED A;  4O0B A;  2WI6 A;  5FNC A;  3CRL A;  1EA6 A;  2WI2 A;  2IOR A;  2BT0 A;  4KFG A;  3D2R A;  1AJ6 A;  1ID0 A;  1S16 A;  5M4K A;  1NHJ A;  4XKO A;  2WI5 A;  4MB9 A;  2BU7 A;  4X9L A;  4XTJ A;  4HY1 A;  3B25 A;  1KZN A;  1TC6 A;  2EXL A;  3A0X A;  2BYI A;  3WQ9 A;  3Q5J A;  4GFN A;  1R62 A;  4MPE A;  2O1W A;  4LWE A;  2BYH A;  2BRE A;  2ZDX A;  4DUH A;  4CE1 A;  2FXS A;  3OWB A;  4L94 A;  4B7P A;  4CWF A;  2ESA A;  4XKA A;  3ZXO A;  2YGF A;  4ASB A;  3B24 A;  2WI1 A;  4YKY A;  1BYQ A;  4XD8 A;  1UYH A;  1B63 A;  4XIR A;  3INX A;  4LWF A;  3CRK A;  2QG0 A;  4O07 A;  4CWS A;  5M4P A;  1ZXN A;  5GGZ A;  3OW6 A;  4H7Q A;  5M4N A;  4MOT A;  3G7E A;  1UY9 A;  2WI4 A;  3EKO A;  4R3A A;  5CTU A;  1UYL A;  3SL2 A;  3TZ4 A;  3R4O A;  2YE3 A;  2C2A A;  3B28 A;  3G7B A;  5F5R A;  4ASA A;  3INW A;  4YKW A;  2JKI A;  3RLR A;  3VHD A;  2BU6 A;  3H4L A;  3K60 A;  4MPC A;  1UYD A;  2VWC A;  4L8Z A;  4U93 A;  4XDM A;  1MX0 A;  2YE2 A;  3C11 A;  4LP0 A;  3ZM7 A;  4XKK A;  1I58 A;  2XJJ A;  2WI3 A;  4EEH A;  4HZ0 A;  3KE6 A;  2CG9 A;  1U0Z A;  2YKI A;  3VHC A;  5FNF A;  2YED A;  4FMT A;  3T0H A;  1BGQ A;  4XIT A;  5M4M A;  1Z5B A;  3HYY A;  4K4O A;  4NH9 A;  1I5D A;  2QFO A;  2FWY A;  2BU5 A;  2K5B A;  1YC1 A;  3R91 A;  1NHI A;  4Q20 A;  4R3M A;  2YJW A;  4FPP A;  2VCJ A;  1QZR A;  2IOP A;  3T1K A;  1UYG A;  4AS9 A;  3FT5 A;  1UYK A;  5CTY A;  4BIZ A;  3BMY A;  3O0I A;  4URO A;  3U2K A;  1TH8 A;  2YEC A;  3DGE A;  5D6P A;  4B6C A;  4EGI A;  3EHG A;  4WUB A;  4L93 A;  2ZKJ A;  4MP2 A;  5FND A;  2XDL A;  3U2D A;  2Q2E B;  3WHA A;  3MNR P;  3HEK A;  2WER A;  3K98 A;  3LNU A;  4W7T A;  4QPK A;  2XJX A;  1US7 A;  4GGL A;  3ZKD A;  4H81 A;  2YEH A;  4YKX A;  1YS3 A;  1UYI A;  4I3H A;  2CCS A;  3R4P A;  4PRV A;  2YI6 A;  4P8O A;  1UY7 A;  3A0T A;  5CF0 A;  3TZ2 A;  2H55 A;  2WI7 A;  4AWP A;  4GQT A;  2YE9 A;  1L0O A;  1YC4 A;  3K97 A;  1YSR A;  3R92 A;  2FYP A;  2XHX A;  2PNR A;  2BSM A;  4YKT A;  3H80 A;  2QG2 A;  1AH8 A;  3FT8 A;  5M4H A;  2FWZ A;  1OSF A;  4EMV A;  3JZ3 A;  4LWI A;  1ZW9 A;  2YEG A;  2CH4 A;  1A4H A;  4XCL A;  4KQV A;  3T0Z A;  1GKZ A;  4CWR A;  2BU8 A;  4GT8 A;  2YK2 A;  3PEH A;  3T10 A;  2YGE A;  2YK9 A;  2IWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...