2Q8GA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with glucose-lowering drug azd7545
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
383
structure length
368
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNDDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
total genus 128
structure length 368
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8gA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8gA02
3K98A 2WERA 1OSFA 3RLRA 2YK2A 4UROA 4ASBA 2BSMA 2YEFA 2CH4A 2HG1A 3O2FA 4GEEA 4LWEA 4CWNA 1MX0A 4E02A 2Q8GA 2XJXA 4EEHA 4CE3A 1B63A 2Q8IA 3ZXQA 4AWOA 1S16A 4XE2A 3O0IA 1ZXNA 2XDXA 2YKCA 5CTUA 4ZKIA 4XDMA 3U2KA 4YKXA 2YEDA 3HHUA 4MOTA 4XCJA 2YKBA 2H55A 4U93A 2YE3A 5CTWA 4XD8A 2HCHA 1TC6A 4XIQA 3K99A 2JKIA 1TH8A 3GIEA 1B62A 1YESA 1ZXMA 3HZ5A 3H4LA 5D6QA 3FV5A 3G75A 2YEEA 5FNDA 3IEDA 5M4EA 2YKIA 4I5SA 2BREA 3B26A 1JM6A 1UYGA 1BYQA 2PNRA 2IWUA 5M4PA 2WI3A 2XDKA 1S14A 1U2OA 1UY6A 1Y8PA 4LWIA 4URLA 1I5AA 5CTXA 2VWCA 1ID0A 4EM7A 2BU8A 1KZNA 1QZRA 4EGKA 3QDDA 2VCJA 4AS9A 4E00A 2IOPA 4NH8A 1UYCA 4XIPA 2QF6A 3KE6A 4E01A 3A0WA 2YEIA 4HYPA 4WUBA 3DGEA 1YS3A 2YI6A 4GGLA 4W7TA 2FWYA 4H85A 2XABA 2WI4A 4X9LA 4ASAA 4LWFA 4O05A 2YEAA 3LNUA 4XTJA 5CF0A 5L3JA 1H7SA 2GFDA 5IDJA 2BYIA 4WUDA 1AM1A 4BXIA 3OWBA 3EHJA 3JZ3A 2Q2EB 2YE9A 3BMYA 2O1UA 3OMUA 4MB9A 3VHDA 3INWA 4EGHA 3CGYA 3TZ2A 4ASFA 2YE8A 3OW6A 1YC1A 2ZDXA 3RKZA 4CE2A 2YEBA 1Y8NA 3ZM7A 2BT0A 4BAEA 3LPSA 3RLQA 5J71A 3TZ4A 1Z5CA 3GIGA 4XCLA 3K97A 4FMTA 2YJXA 1I5DA 4R3AA 3BM9A 1I5BA 3R4NA 4CWTA 3VHCA 2WI1A 3Q5LA 4L93A 2YGFA 2CG9A 1UYFA 3VHAA 3FT5A 2Q8FA 4BIZA 4HZ5A 4URNA 4EFUA 1UY8A 1UYHA 3T2SA 3A0ZA 2XCMA 4LWHA 4P7AA 3B28A 3C11A 4YKTA 5BODA 3SL2A 4KQVA 3B27A 4XKAA 2YEJA 3A0TA 3B25A 3CWVA 2XHTA 1BGQA 1UY9A 2YE2A 4H7QA 4CWQA 1R62A 5F5RA 3INXA 1QYEA 4NH7A 2ZBKB 2AKPA 1TIDA 2WI7A 3T10A 1I59A 2WI6A 4BQJA 2E0AA 4GCZA 2ESAA 1BXDA 4Q20A 4AWPA 4JAUA 2CCTA 5D6PA 5D7RA 1TBWA 4CWFA 2CGFA 4DUHA 4O07A 3C0EA 4HYMA 4GFNA 4L94A 2WI2A 3O6OA 2ZDYA 3Q5KA 1Y4SA 2XJJA 4P8OA 2YKJA 2YJWA 3HYZA 2YGAA 4YKQA 1A4HA 4KTNA 3G7EA 3H80A 4YKYA 4EFTA 3A0XA 2XX2A 3RLPA 3CGZA 2JJCA 2BU2A 4V25A 1YC3A 1YC4A 1H7UA 5M4MA 2QFOA 4JASA 3EKOA 1B3QA 3D0BA 5J6AA 2YGEA 2YI0A 3A0YA 5CTYA 1UYMA 4AWQA 5FNFA 4EMVA 4U7OA 4LP0A 3PEJA 4XITA 4CWRA 1GKZA 1THNA 1GKXA 2XD6A 1UYIA 4MBCA 1PVGA 3A0RA 1GJVA 3U2DA 5D7DA 3ZKBA 4K4OA 2FWZA 4YKUA 3NMQA 5C93A 3U67A 4O0BA 3T1KA 4KP4A 4R3MA 2K5BA 2QG2A 2BU7A 3G7BA 3GIGB 4XKKA 5F3KA 4CWOA 4B7PA 4MPCA 4QPJA 4B6CA 5CPHA 5GGZA 2EXLA 2BU5A 1AJ6A 3OWDA 4YKRA 4FCQA 4HY6A 3HEKA 1QY8A 4HXZA 3R4PA 2BYHA 2O1VA 3VADA 3HZ1A 1Z59A 1UYKA 3TZ5A 2CCUA 1US7A 3CRLA 2YK9A 1YSZA 4XIRA 1NHIA 2YE4A 1TILA 5D7CA 4HXWA 1AMWA 4LWGA 3T0ZA 1L0OA 4JAVA 2XDUA 1YT0A 3FT8A 3OPDA 2YKEA 4XKOA 4HY1A 3EHHA 1I5CA 1U0ZA 1ZWHA 4LPBA 2UWDA 4CWPA 1TC0A 2YECA 2Q8HA 2YI5A 1YT2A 1UYDA 4FCPA 1AH8A 1NHHA 3CRKA 4H81A 5M4KA 2IWSA 2VW5A 3D2RA 2H8MA 5M4NA 2YE5A 2GQPA 2XHXA 1NHJA 1UYLA 2WEPA 3TTZA 3T0HA 2ZKJA 3PEHA 2XJGA 4GT8A 4EGIA 4MPNA 4MPEA 3R4OA 4GQTA 3EKRA 4O09A 4JQLA 4ASGA 5IDMA 2VCIA 4L8ZA 1UY7A 3R92A 2BRCA 2YE7A 4CE1A 3HYYA 2WI5A 2BZ5A 2BTZA 2YE6A 4QPKA 3GIFA 2XDLA 2WEQA 1Y8OA 1MU5A 1UYEA 5IN9A 3B24A 3TZ0A 4KSHA 4PRXA 3Q5JA 3EHFA 4PL9A 2C2AA 1Z5AA 3K60A 4URMA 4FCRA 1EI1A 4PRVA 3MNRP 2YEGA 4PU9A 5FWKA 4I3HA 1Y4UA 1KIJA 2FXSA 5FNCA 4KFGA 2IORA 3D36A 3R4MA 2QG0A 4U7NA 3ZXOA 4L90A 4BIUA 2BU6A 1YT1A 4ZVIA 3EHGA 2CCSA 1YERA 2XX4A 2IWXA 4FPPA 4HZ0A 4O04A 2YEHA 5BOCA 1BKNA 2FYPA 2XDSA 1Z5BA 4MP7A 4XC0A 3WQ9A 2XX5A 4DZYA 2HKJA 2YI7A 3ZKDA 4L91A 1ZW9A 3R91A 5M4HA 4NH9A 2XK2A 3TUHA 4MP2A 1YSRA 4V26A 2XHRA 4KSGA 2IOQA 4YKZA 4WUCA 4CWSA 4R1FA 1YETA 1I58A 4BQGA 3WHAA 3QTFA 1AH6A 2O1WA 4YKWA 1EA6A
chains in the Genus database with same CATH superfamily
1RX0A 3K98A 5K3JA 3UU9A 1OSFA 2WERA 4L3YA 4IV6A 3RLRA 2FP2A 4ZXVA 3KMLA 2YK2A 4UROA 4ASBA 3CE2A 2BSMA 1SK6A 2YEFA 2CH4A 5GJWE 2HG1A 1QDBA 3O2FA 4GEEA 3OWMA 4LWEA 4CWNA 1MX0A 2FP1A 4E02A 3SXQA 2Q8GA 2XJXA 4EEHA 3L1TA 1B63A 4CE3A 2Q8IA 3D1IA 3ZXQA 4AWOA 1S16A 4XE2A 3O0IA 1ZXNA 2XDXA 2YKCA 5CTUA 4ZKIA 2VIGA 4XDMA 3U2KA 4YKXA 3TTBA 2YEDA 3HHUA 1PI1A 4MOTA 4XCJA 2YKBA 2H55A 4U93A 2VF1A 2YE3A 3D9EA 5CTWA 4XD8A 2HCHA 1IS2A 1TC6A 4XIQA 3K99A 2JKIA 1TH8A 1XFXA 4AKGA 2FTKA 4AI6A 4ZYJA 3GIEA 5K3GA 3VKGA 1B62A 4X28A 1YESA 4L1FA 1ZXMA 2R02A 3HZ5A 3H4LA 5D6QA 3FV5A 3G75A 2YEEA 5FNDA 3IEDA 2HHIA 5M4EA 1XFVA 2YKIA 3X29A 4I5SA 2BREA 2RF7A 3X0XA 3B26A 1JM6A 3C3LA 1UYGA 1BYQA 2PNRA 3MKHA 1EGDA 2IWUA 5M4PA 2ZAFA 2WI3A 2XDKA 1S14A 1U2OA 1UY6A 1Y8PA 4LWIA 2R03A 4URLA 1I5AA 5CTXA 3GNCA 2VWCA 1ID0A 4KTOA 4EM7A 2BU8A 1KZNA 1QZRA 4EGKA 3QDDA 2VCJA 4AS9A 4E00A 2IOPA 1PK0A 4NH8A 1UYCA 4XIPA 3Q0AA 2QF6A 3KE6A 1XFWA 4E01A 3A0WA 2AZEA 2YEIA 3B96A 4HYPA 4WUBA 3DGEA 1YS3A 4FF1A 1K93A 2WBIA 3S5TA 1IXMA 2YI6A 4GGLA 4W7TA 2FWYA 4JIOA 4H85A 2OJQA 2XABA 2WI4A 1F51A 4X9LA 4ASAA 4LWFA 4O05A 2YEAA 3LNUA 4XTJA 5CF0A 5L3JA 1H7SA 2GFDA 5IDJA 2HJNA 4KSAA 2JBRA 2BYIA 4WUDA 2PO4A 1AM1A 4P79A 4BXIA 3OWBA 3EHJA 3MDEA 3JZ3A 1SIQA 2R05A 4U83A 2Q2EB 2YE9A 3BMYA 2O1UA 3OMUA 4MB9A 3VHDA 1X90A 3MXLA 3INWA 4EGHA 3CGYA 3TZ2A 4ASFA 2YE8A 3OW6A 1YC1A 1RJ4A 3UBRA 3GM6A 2ZDXA 3RKZA 4CE2A 2YEBA 3N0RA 1Y8NA 3ZM7A 2BT0A 4BAEA 3LPSA 3RLQA 5J71A 4L3ZA 3TZ4A 1Z5CA 2VR0A 4OO2A 3GIGA 4HKRA 2JIFA 4XCLA 3K97A 4FMTA 2YJXA 4N5FA 1I5DA 4R3AA 3BM9A 1I5BA 3R4NA 2R0MA 1UKWA 4CWTA 3VHCA 2XQRB 2WI1A 3Q5LA 4L93A 2YGFA 2CG9A 1UYFA 3VHAA 3FT5A 2Q8FA 4BIZA 2RDZA 4Q17A 4HZ5A 4URNA 4EFUA 1UY8A 1UYHA 1K8TA 3LGQA 4LQSB 3T2SA 1X8ZA 4JIZA 3A0ZA 2XCMA 2FONA 4LWHA 4P7AA 4HKSA 3B28A 2YYJA 2Z1QA 4F0XA 3C11A 4KS9A 4YKTA 4Q1OA 2F6LA 2DDHA 5BODA 3SL2A 4KQVA 3B27A 4XKAA 2YEJA 1LVCA 3Q24A 3VKHA 3A0TA 3B25A 1UDYA 3CYGA 3CWVA 1R3BA 2XHTA 1BGQA 1UY9A 2XS8A 2YE2A 4H7QA 4CWQA 1R62A 5F5RA 3INXA 1QYEA 2GBBA 4NH7A 2UXWA 2ZBKB 2AKPA 1TIDA 2WI7A 3T10A 1I59A 2WI6A 4BQJA 2E0AA 3II9A 4GCZA 4E72A 3C2PA 2ESAA 4KSFA 1BXDA 4Q20A 4AWPA 4JAUA 1WS9A 2CCTA 5D6PA 1TBWA 5D7RA 4CWFA 2CGFA 4DUHA 4G5EA 4O07A 3C0EA 4HYMA 4GFNA 4L94A 2WI2A 2YYLA 3O6OA 2ZDYA 3Q5KA 1Y4SA 3BNHA 3D6BA 2XJJA 4P8OA 2YKJA 2YJWA 1SIRA 3HYZA 2YGAA 3M9VA 4AKHA 1RP3A 4YKQA 1A4HA 4KTNA 1S26A 3G7EA 2YYGA 3C46A 3H80A 1W07A 4YKYA 4EFTA 3MMOA 3A0XA 2XX2A 3RLPA 3CGZA 2LFWA 3BNFA 2JJCA 2BU2A 4V25A 2JBTA 3GQTA 1YC3A 1YC4A 2CJ7A 1Y0VA 3X0YA 2EBAA 2CJ4A 1H7UA 3BNJA 5M4MA 1XFYA 4NXLA 4L3XA 1BUCA 3F29A 2QFOA 4JASA 3SWOA 3EKOA 1B3QA 3D0BA 3AFEA 5J6AA 2YGEA 1GU6A 1JQIA 2YI0A 3A0YA 5CTYA 1UYMA 4AWQA 3MPJA 2XS1A 5FNFA 2E80A 2E81A 3FCJA 4EMVA 4U7OA 4LP0A 3PEJA 4XITA 4IRNA 3OWAA 4CWRA 1GKZA 1SC5A 3S7WA 1THNA 1GKXA 2XD6A 3D9GA 1UYIA 4MBCA 4W9UA 1PVGA 2OEXA 3A0RA 1GJVA 2IX5A 3U2DA 5GJVE 5D7DA 3ZKBA 4K4OA 2YYIA 2FWZA 3Q22A 4XVXA 4YKUA 3NMQA 5C93A 4WJYA 3U67A 1X91A 4O0BA 1XG2B 3T1KA 4KP4A 4R3MA 2K5BA 2QG2A 2BU7A 3P4TA 2YYKA 1OAHA 4G97A 2CX9A 4Q5CA 3G7BA 3GIGB 4XKKA 5F3KA 4CWOA 2OR0A 4B7PA 2J7AA 4MPCA 4QPJA 5CPHA 4B6CA 2IX6A 5GGZA 2EXLA 2BU5A 1AJ6A 3OWDA 4YKRA 4FCQA 3R7KA 4HY6A 3HEKA 2YYMA 1QY8A 4HXZA 3R4PA 2EBFX 2BYHA 1XFUA 4O5MA 2O1VA 3SCEA 3VADA 1EGEA 4J1VA 1FS9A 3PFDA 4LQQB 1Z59A 3HZ1A 1IVHA 1UYKA 1T9GA 3TZ5A 2CJ6A 2CCUA 3NF4A 1US7A 3CRLA 2YK9A 1YSZA 4XIRA 1NHIA 2YE4A 1TILA 2EBHX 5D7CA 2C1IA 4HXWA 1AMWA 4LWGA 1K90A 3T0ZA 1L0OA 4JAVA 2XDUA 4FF2A 3LG1A 4L38A 4FZ4A 1YT0A 3FT8A 3OPDA 3AFFA 4FF4A 2YKEA 4XKOA 4HY1A 3EHHA 1I5CA 1U0ZA 1ZWHA 4LPBA 5K3IA 1XFZA 2UWDA 1TC0A 4CWPA 2YECA 2Q8HA 2YI5A 2A1TA 1YT2A 1UYDA 3Q23A 4FCPA 2DVLA 1AH8A 1NHHA 3CRKA 4H81A 5M4KA 2IWSA 2VW5A 3D2RA 4RM7A 5M4NA 2H8MA 2GQPA 2YE5A 2XHXA 4Q5BA 1NHJA 1UYLA 2WEPA 3TTZA 3TORA 2ZKJA 1R2JA 3OIBA 2JBSA 3PEHA 3T0HA 5JENA 2XJGA 5BRMA 5B6BA 2EC5A 4GT8A 4EGIA 4MPNA 5K3HA 4MPEA 4DOYA 3R4OA 4GQTA 3EKRA 4Q4UA 4O09A 2AO2A 4JQLA 1FS8A 2QR4A 2D29A 4ASGA 5IDMA 2VCIA 4L8ZA 4X28C 1UY7A 3R92A 2BRCA 2YE7A 4CE1A 3HYYA 4Q0TA 2C0UA 2WI5A 2BZ5A 3D9FA 3D9DA 2BTZA 3MDDA 2YE6A 4QPKA 3GIFA 2XDLA 2WEQA 1Y8OA 1MU5A 1UYEA 5IN9A 3B24A 3TZ0A 4KSHA 4PRXA 3Q5JA 3EHFA 4PL9A 2C2AA 1Z5AA 3K60A 4URMA 2RFQA 3EONA 2REHA 1EI1A 4FCRA 3MNRP 4PRVA 2YEGA 2CJ8A 4PU9A 5FWKA 4I3HA 1Y4UA 1KIJA 3LMMA 2C12A 4KCFA 2FXSA 4FF3A 5FNCA 4KFGA 2IORA 4M9AA 3D36A 3R4MA 2ZO5A 2QG0A 4U7NA 4L90A 3ZXOA 2R0NA 4HR3A 4BIUA 5B5VA 2BU6A 2OEVA 1YT1A 4ZVIA 3EHGA 2CCSA 1YERA 3EOMA 2XX4A 3MPIA 2IWXA 4FPPA 4HZ0A 4O04A 1FS7A 2YEHA 3BNGA 5BOCA 1BKNA 2FYPA 2XDSA 1Z5BA 4MP7A 2C1GA 4XC0A 1EGCA 2YGWA 4JEKA 3WQ9A 1U8VA 2XX5A 4DZYA 2CJ5A 3FO3A 2HKJA 2YI7A 4QICA 3ZKDA 4L91A 4P13A 1ZW9A 3R91A 3RKHA 4NH9A 5M4HA 3HWCA 2XK2A 3TUHA 4MP2A 1YSRA 1RJ1A 4V26A 2XHRA 2PG0A 4KSGA 3SF6A 2IOQA 4YKZA 4WUCA 4CWSA 4R1FA 1YETA 1I58A 2OT4A 5B5WA 4BQGA 3WHAA 3QTFA 4AKIA 1AH6A 2O1WA 4YKWA 5BRKA 1EA6A
chains in the Genus database with same CATH topology
3K98A 2WERA 1OSFA 3RLRA 2YK2A 4UROA 4ASBA 2BSMA 2YEFA 2CH4A 2HG1A 3O2FA 4GEEA 4LWEA 4CWNA 1MX0A 4E02A 2Q8GA 2XJXA 4EEHA 4CE3A 1B63A 2Q8IA 3ZXQA 4AWOA 1S16A 4XE2A 3O0IA 1ZXNA 2XDXA 2YKCA 5CTUA 4ZKIA 4XDMA 3U2KA 4YKXA 2YEDA 3HHUA 4MOTA 4XCJA 2YKBA 2H55A 4U93A 2YE3A 5CTWA 4XD8A 2HCHA 1TC6A 4XIQA 3K99A 2JKIA 1TH8A 3GIEA 1B62A 1YESA 1ZXMA 3HZ5A 3H4LA 5D6QA 3FV5A 3G75A 2YEEA 5FNDA 3IEDA 5M4EA 2YKIA 4I5SA 2BREA 3B26A 1JM6A 1UYGA 1BYQA 2PNRA 2IWUA 5M4PA 2WI3A 2XDKA 1S14A 1U2OA 1UY6A 1Y8PA 4LWIA 4URLA 1I5AA 5CTXA 2VWCA 1ID0A 4EM7A 2BU8A 1KZNA 1QZRA 4EGKA 3QDDA 2VCJA 4AS9A 4E00A 2IOPA 4NH8A 1UYCA 4XIPA 2QF6A 3KE6A 4E01A 3A0WA 2YEIA 4HYPA 4WUBA 3DGEA 1YS3A 2YI6A 4GGLA 4W7TA 2FWYA 4H85A 2XABA 2WI4A 4X9LA 4ASAA 4LWFA 4O05A 2YEAA 3LNUA 4XTJA 5CF0A 5L3JA 1H7SA 2GFDA 5IDJA 2BYIA 4WUDA 1AM1A 4BXIA 3OWBA 3EHJA 3JZ3A 2Q2EB 2YE9A 3BMYA 2O1UA 3OMUA 4MB9A 3VHDA 3INWA 4EGHA 3CGYA 3TZ2A 4ASFA 2YE8A 3OW6A 1YC1A 2ZDXA 3RKZA 4CE2A 2YEBA 1Y8NA 3ZM7A 2BT0A 4BAEA 3LPSA 3RLQA 5J71A 3TZ4A 1Z5CA 3GIGA 4XCLA 3K97A 4FMTA 2YJXA 1I5DA 4R3AA 3BM9A 1I5BA 3R4NA 4CWTA 3VHCA 2WI1A 3Q5LA 4L93A 2YGFA 2CG9A 1UYFA 3VHAA 3FT5A 2Q8FA 4BIZA 4HZ5A 4URNA 4EFUA 1UY8A 1UYHA 3T2SA 3A0ZA 2XCMA 4LWHA 4P7AA 3B28A 3C11A 4YKTA 5BODA 3SL2A 4KQVA 3B27A 4XKAA 2YEJA 3A0TA 3B25A 3CWVA 2XHTA 1BGQA 1UY9A 2YE2A 4H7QA 4CWQA 1R62A 5F5RA 3INXA 1QYEA 4NH7A 2ZBKB 2AKPA 1TIDA 2WI7A 3T10A 1I59A 2WI6A 4BQJA 2E0AA 4GCZA 2ESAA 1BXDA 4Q20A 4AWPA 4JAUA 2CCTA 5D6PA 5D7RA 1TBWA 4CWFA 2CGFA 4DUHA 4O07A 3C0EA 4HYMA 4GFNA 4L94A 2WI2A 3O6OA 2ZDYA 3Q5KA 1Y4SA 2XJJA 4P8OA 2YKJA 2YJWA 3HYZA 2YGAA 4YKQA 1A4HA 4KTNA 3G7EA 3H80A 4YKYA 4EFTA 3A0XA 2XX2A 3RLPA 3CGZA 2JJCA 2BU2A 4V25A 1YC3A 1YC4A 1H7UA 5M4MA 2QFOA 4JASA 3EKOA 1B3QA 3D0BA 5J6AA 2YGEA 2YI0A 3A0YA 5CTYA 1UYMA 4AWQA 5FNFA 4EMVA 4U7OA 4LP0A 3PEJA 4XITA 4CWRA 1GKZA 1THNA 1GKXA 2XD6A 1UYIA 4MBCA 1PVGA 3A0RA 1GJVA 3U2DA 5D7DA 3ZKBA 4K4OA 2FWZA 4YKUA 3NMQA 5C93A 3U67A 4O0BA 3T1KA 4KP4A 4R3MA 2K5BA 2QG2A 2BU7A 3G7BA 3GIGB 4XKKA 5F3KA 4CWOA 4B7PA 4MPCA 4QPJA 4B6CA 5CPHA 5GGZA 2EXLA 2BU5A 1AJ6A 3OWDA 4YKRA 4FCQA 4HY6A 3HEKA 1QY8A 4HXZA 3R4PA 2BYHA 2O1VA 3VADA 3HZ1A 1Z59A 1UYKA 3TZ5A 2CCUA 1US7A 3CRLA 2YK9A 1YSZA 4XIRA 1NHIA 2YE4A 1TILA 5D7CA 4HXWA 1AMWA 4LWGA 3T0ZA 1L0OA 4JAVA 2XDUA 1YT0A 3FT8A 3OPDA 2YKEA 4XKOA 4HY1A 3EHHA 1I5CA 1U0ZA 1ZWHA 4LPBA 2UWDA 4CWPA 1TC0A 2YECA 2Q8HA 2YI5A 1YT2A 1UYDA 4FCPA 1AH8A 1NHHA 3CRKA 4H81A 5M4KA 2IWSA 2VW5A 3D2RA 2H8MA 5M4NA 2YE5A 2GQPA 2XHXA 1NHJA 1UYLA 2WEPA 3TTZA 3T0HA 2ZKJA 3PEHA 2XJGA 4GT8A 4EGIA 4MPNA 4MPEA 3R4OA 4GQTA 3EKRA 4O09A 4JQLA 4ASGA 5IDMA 2VCIA 4L8ZA 1UY7A 3R92A 2BRCA 2YE7A 4CE1A 3HYYA 2WI5A 2BZ5A 2BTZA 2YE6A 4QPKA 3GIFA 2XDLA 2WEQA 1Y8OA 1MU5A 1UYEA 5IN9A 3B24A 3TZ0A 4KSHA 4PRXA 3Q5JA 3EHFA 4PL9A 2C2AA 1Z5AA 3K60A 4URMA 4FCRA 1EI1A 4PRVA 3MNRP 2YEGA 4PU9A 5FWKA 4I3HA 1Y4UA 1KIJA 2FXSA 5FNCA 4KFGA 2IORA 3D36A 3R4MA 2QG0A 4U7NA 3ZXOA 4L90A 4BIUA 2BU6A 1YT1A 4ZVIA 3EHGA 2CCSA 1YERA 2XX4A 2IWXA 4FPPA 4HZ0A 4O04A 2YEHA 5BOCA 1BKNA 2FYPA 2XDSA 1Z5BA 4MP7A 4XC0A 3WQ9A 2XX5A 4DZYA 2HKJA 2YI7A 3ZKDA 4L91A 1ZW9A 3R91A 5M4HA 4NH9A 2XK2A 3TUHA 4MP2A 1YSRA 4V26A 2XHRA 4KSGA 2IOQA 4YKZA 4WUCA 4CWSA 4R1FA 1YETA 1I58A 4BQGA 3WHAA 3QTFA 1AH6A 2O1WA 4YKWA 1EA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K98 A;  2WER A;  1OSF A;  3RLR A;  2YK2 A;  4URO A;  4ASB A;  2BSM A;  2YEF A;  2CH4 A;  2HG1 A;  3O2F A;  4GEE A;  4LWE A;  4CWN A;  1MX0 A;  4E02 A;  2Q8G A;  2XJX A;  4EEH A;  4CE3 A;  1B63 A;  2Q8I A;  3ZXQ A;  4AWO A;  1S16 A;  4XE2 A;  3O0I A;  1ZXN A;  2XDX A;  2YKC A;  5CTU A;  4ZKI A;  4XDM A;  3U2K A;  4YKX A;  2YED A;  3HHU A;  4MOT A;  4XCJ A;  2YKB A;  2H55 A;  4U93 A;  2YE3 A;  5CTW A;  4XD8 A;  2HCH A;  1TC6 A;  4XIQ A;  3K99 A;  2JKI A;  1TH8 A;  3GIE A;  1B62 A;  1YES A;  1ZXM A;  3HZ5 A;  3H4L A;  5D6Q A;  3FV5 A;  3G75 A;  2YEE A;  5FND A;  3IED A;  5M4E A;  2YKI A;  4I5S A;  2BRE A;  3B26 A;  1JM6 A;  1UYG A;  1BYQ A;  2PNR A;  2IWU A;  5M4P A;  2WI3 A;  2XDK A;  1S14 A;  1U2O A;  1UY6 A;  1Y8P A;  4LWI A;  4URL A;  1I5A A;  5CTX A;  2VWC A;  1ID0 A;  4EM7 A;  2BU8 A;  1KZN A;  1QZR A;  4EGK A;  3QDD A;  2VCJ A;  4AS9 A;  4E00 A;  2IOP A;  4NH8 A;  1UYC A;  4XIP A;  2QF6 A;  3KE6 A;  4E01 A;  3A0W A;  2YEI A;  4HYP A;  4WUB A;  3DGE A;  1YS3 A;  2YI6 A;  4GGL A;  4W7T A;  2FWY A;  4H85 A;  2XAB A;  2WI4 A;  4X9L A;  4ASA A;  4LWF A;  4O05 A;  2YEA A;  3LNU A;  4XTJ A;  5CF0 A;  5L3J A;  1H7S A;  2GFD A;  5IDJ A;  2BYI A;  4WUD A;  1AM1 A;  4BXI A;  3OWB A;  3EHJ A;  3JZ3 A;  2Q2E B;  2YE9 A;  3BMY A;  2O1U A;  3OMU A;  4MB9 A;  3VHD A;  3INW A;  4EGH A;  3CGY A;  3TZ2 A;  4ASF A;  2YE8 A;  3OW6 A;  1YC1 A;  2ZDX A;  3RKZ A;  4CE2 A;  2YEB A;  1Y8N A;  3ZM7 A;  2BT0 A;  4BAE A;  3LPS A;  3RLQ A;  5J71 A;  3TZ4 A;  1Z5C A;  3GIG A;  4XCL A;  3K97 A;  4FMT A;  2YJX A;  1I5D A;  4R3A A;  3BM9 A;  1I5B A;  3R4N A;  4CWT A;  3VHC A;  2WI1 A;  3Q5L A;  4L93 A;  2YGF A;  2CG9 A;  1UYF A;  3VHA A;  3FT5 A;  2Q8F A;  4BIZ A;  4HZ5 A;  4URN A;  4EFU A;  1UY8 A;  1UYH A;  3T2S A;  3A0Z A;  2XCM A;  4LWH A;  4P7A A;  3B28 A;  3C11 A;  4YKT A;  5BOD A;  3SL2 A;  4KQV A;  3B27 A;  4XKA A;  2YEJ A;  3A0T A;  3B25 A;  3CWV A;  2XHT A;  1BGQ A;  1UY9 A;  2YE2 A;  4H7Q A;  4CWQ A;  1R62 A;  5F5R A;  3INX A;  1QYE A;  4NH7 A;  2ZBK B;  2AKP A;  1TID A;  2WI7 A;  3T10 A;  1I59 A;  2WI6 A;  4BQJ A;  2E0A A;  4GCZ A;  2ESA A;  1BXD A;  4Q20 A;  4AWP A;  4JAU A;  2CCT A;  5D6P A;  5D7R A;  1TBW A;  4CWF A;  2CGF A;  4DUH A;  4O07 A;  3C0E A;  4HYM A;  4GFN A;  4L94 A;  2WI2 A;  3O6O A;  2ZDY A;  3Q5K A;  1Y4S A;  2XJJ A;  4P8O A;  2YKJ A;  2YJW A;  3HYZ A;  2YGA A;  4YKQ A;  1A4H A;  4KTN A;  3G7E A;  3H80 A;  4YKY A;  4EFT A;  3A0X A;  2XX2 A;  3RLP A;  3CGZ A;  2JJC A;  2BU2 A;  4V25 A;  1YC3 A;  1YC4 A;  1H7U A;  5M4M A;  2QFO A;  4JAS A;  3EKO A;  1B3Q A;  3D0B A;  5J6A A;  2YGE A;  2YI0 A;  3A0Y A;  5CTY A;  1UYM A;  4AWQ A;  5FNF A;  4EMV A;  4U7O A;  4LP0 A;  3PEJ A;  4XIT A;  4CWR A;  1GKZ A;  1THN A;  1GKX A;  2XD6 A;  1UYI A;  4MBC A;  1PVG A;  3A0R A;  1GJV A;  3U2D A;  5D7D A;  3ZKB A;  4K4O A;  2FWZ A;  4YKU A;  3NMQ A;  5C93 A;  3U67 A;  4O0B A;  3T1K A;  4KP4 A;  4R3M A;  2K5B A;  2QG2 A;  2BU7 A;  3G7B A;  3GIG B;  4XKK A;  5F3K A;  4CWO A;  4B7P A;  4MPC A;  4QPJ A;  4B6C A;  5CPH A;  5GGZ A;  2EXL A;  2BU5 A;  1AJ6 A;  3OWD A;  4YKR A;  4FCQ A;  4HY6 A;  3HEK A;  1QY8 A;  4HXZ A;  3R4P A;  2BYH A;  2O1V A;  3VAD A;  3HZ1 A;  1Z59 A;  1UYK A;  3TZ5 A;  2CCU A;  1US7 A;  3CRL A;  2YK9 A;  1YSZ A;  4XIR A;  1NHI A;  2YE4 A;  1TIL A;  5D7C A;  4HXW A;  1AMW A;  4LWG A;  3T0Z A;  1L0O A;  4JAV A;  2XDU A;  1YT0 A;  3FT8 A;  3OPD A;  2YKE A;  4XKO A;  4HY1 A;  3EHH A;  1I5C A;  1U0Z A;  1ZWH A;  4LPB A;  2UWD A;  4CWP A;  1TC0 A;  2YEC A;  2Q8H A;  2YI5 A;  1YT2 A;  1UYD A;  4FCP A;  1AH8 A;  1NHH A;  3CRK A;  4H81 A;  5M4K A;  2IWS A;  2VW5 A;  3D2R A;  2H8M A;  5M4N A;  2YE5 A;  2GQP A;  2XHX A;  1NHJ A;  1UYL A;  2WEP A;  3TTZ A;  3T0H A;  2ZKJ A;  3PEH A;  2XJG A;  4GT8 A;  4EGI A;  4MPN A;  4MPE A;  3R4O A;  4GQT A;  3EKR A;  4O09 A;  4JQL A;  4ASG A;  5IDM A;  2VCI A;  4L8Z A;  1UY7 A;  3R92 A;  2BRC A;  2YE7 A;  4CE1 A;  3HYY A;  2WI5 A;  2BZ5 A;  2BTZ A;  2YE6 A;  4QPK A;  3GIF A;  2XDL A;  2WEQ A;  1Y8O A;  1MU5 A;  1UYE A;  5IN9 A;  3B24 A;  3TZ0 A;  4KSH A;  4PRX A;  3Q5J A;  3EHF A;  4PL9 A;  2C2A A;  1Z5A A;  3K60 A;  4URM A;  4FCR A;  1EI1 A;  4PRV A;  3MNR P;  2YEG A;  4PU9 A;  5FWK A;  4I3H A;  1Y4U A;  1KIJ A;  2FXS A;  5FNC A;  4KFG A;  2IOR A;  3D36 A;  3R4M A;  2QG0 A;  4U7N A;  3ZXO A;  4L90 A;  4BIU A;  2BU6 A;  1YT1 A;  4ZVI A;  3EHG A;  2CCS A;  1YER A;  2XX4 A;  2IWX A;  4FPP A;  4HZ0 A;  4O04 A;  2YEH A;  5BOC A;  1BKN A;  2FYP A;  2XDS A;  1Z5B A;  4MP7 A;  4XC0 A;  3WQ9 A;  2XX5 A;  4DZY A;  2HKJ A;  2YI7 A;  3ZKD A;  4L91 A;  1ZW9 A;  3R91 A;  5M4H A;  4NH9 A;  2XK2 A;  3TUH A;  4MP2 A;  1YSR A;  4V26 A;  2XHR A;  4KSG A;  2IOQ A;  4YKZ A;  4WUC A;  4CWS A;  4R1F A;  1YET A;  1I58 A;  4BQG A;  3WHA A;  3QTF A;  1AH6 A;  2O1W A;  4YKW A;  1EA6 A; 
#chains in the Genus database with same CATH topology
 1RX0 A;  3K98 A;  5K3J A;  3UU9 A;  1OSF A;  2WER A;  4L3Y A;  4IV6 A;  3RLR A;  2FP2 A;  4ZXV A;  3KML A;  2YK2 A;  4URO A;  4ASB A;  3CE2 A;  2BSM A;  1SK6 A;  2YEF A;  2CH4 A;  5GJW E;  2HG1 A;  1QDB A;  3O2F A;  4GEE A;  3OWM A;  4LWE A;  4CWN A;  1MX0 A;  2FP1 A;  4E02 A;  3SXQ A;  2Q8G A;  2XJX A;  4EEH A;  3L1T A;  1B63 A;  4CE3 A;  2Q8I A;  3D1I A;  3ZXQ A;  4AWO A;  1S16 A;  4XE2 A;  3O0I A;  1ZXN A;  2XDX A;  2YKC A;  5CTU A;  4ZKI A;  2VIG A;  4XDM A;  3U2K A;  4YKX A;  3TTB A;  2YED A;  3HHU A;  1PI1 A;  4MOT A;  4XCJ A;  2YKB A;  2H55 A;  4U93 A;  2VF1 A;  2YE3 A;  3D9E A;  5CTW A;  4XD8 A;  2HCH A;  1IS2 A;  1TC6 A;  4XIQ A;  3K99 A;  2JKI A;  1TH8 A;  1XFX A;  4AKG A;  2FTK A;  4AI6 A;  4ZYJ A;  3GIE A;  5K3G A;  3VKG A;  1B62 A;  4X28 A;  1YES A;  4L1F A;  1ZXM A;  2R02 A;  3HZ5 A;  3H4L A;  5D6Q A;  3FV5 A;  3G75 A;  2YEE A;  5FND A;  3IED A;  2HHI A;  5M4E A;  1XFV A;  2YKI A;  3X29 A;  4I5S A;  2BRE A;  2RF7 A;  3X0X A;  3B26 A;  1JM6 A;  3C3L A;  1UYG A;  1BYQ A;  2PNR A;  3MKH A;  1EGD A;  2IWU A;  5M4P A;  2ZAF A;  2WI3 A;  2XDK A;  1S14 A;  1U2O A;  1UY6 A;  1Y8P A;  4LWI A;  2R03 A;  4URL A;  1I5A A;  5CTX A;  3GNC A;  2VWC A;  1ID0 A;  4KTO A;  4EM7 A;  2BU8 A;  1KZN A;  1QZR A;  4EGK A;  3QDD A;  2VCJ A;  4AS9 A;  4E00 A;  2IOP A;  1PK0 A;  4NH8 A;  1UYC A;  4XIP A;  3Q0A A;  2QF6 A;  3KE6 A;  1XFW A;  4E01 A;  3A0W A;  2AZE A;  2YEI A;  3B96 A;  4HYP A;  4WUB A;  3DGE A;  1YS3 A;  4FF1 A;  1K93 A;  2WBI A;  3S5T A;  1IXM A;  2YI6 A;  4GGL A;  4W7T A;  2FWY A;  4JIO A;  4H85 A;  2OJQ A;  2XAB A;  2WI4 A;  1F51 A;  4X9L A;  4ASA A;  4LWF A;  4O05 A;  2YEA A;  3LNU A;  4XTJ A;  5CF0 A;  5L3J A;  1H7S A;  2GFD A;  5IDJ A;  2HJN A;  4KSA A;  2JBR A;  2BYI A;  4WUD A;  2PO4 A;  1AM1 A;  4P79 A;  4BXI A;  3OWB A;  3EHJ A;  3MDE A;  3JZ3 A;  1SIQ A;  2R05 A;  4U83 A;  2Q2E B;  2YE9 A;  3BMY A;  2O1U A;  3OMU A;  4MB9 A;  3VHD A;  1X90 A;  3MXL A;  3INW A;  4EGH A;  3CGY A;  3TZ2 A;  4ASF A;  2YE8 A;  3OW6 A;  1YC1 A;  1RJ4 A;  3UBR A;  3GM6 A;  2ZDX A;  3RKZ A;  4CE2 A;  2YEB A;  3N0R A;  1Y8N A;  3ZM7 A;  2BT0 A;  4BAE A;  3LPS A;  3RLQ A;  5J71 A;  4L3Z A;  3TZ4 A;  1Z5C A;  2VR0 A;  4OO2 A;  3GIG A;  4HKR A;  2JIF A;  4XCL A;  3K97 A;  4FMT A;  2YJX A;  4N5F A;  1I5D A;  4R3A A;  3BM9 A;  1I5B A;  3R4N A;  2R0M A;  1UKW A;  4CWT A;  3VHC A;  2XQR B;  2WI1 A;  3Q5L A;  4L93 A;  2YGF A;  2CG9 A;  1UYF A;  3VHA A;  3FT5 A;  2Q8F A;  4BIZ A;  2RDZ A;  4Q17 A;  4HZ5 A;  4URN A;  4EFU A;  1UY8 A;  1UYH A;  1K8T A;  3LGQ A;  4LQS B;  3T2S A;  1X8Z A;  4JIZ A;  3A0Z A;  2XCM A;  2FON A;  4LWH A;  4P7A A;  4HKS A;  3B28 A;  2YYJ A;  2Z1Q A;  4F0X A;  3C11 A;  4KS9 A;  4YKT A;  4Q1O A;  2F6L A;  2DDH A;  5BOD A;  3SL2 A;  4KQV A;  3B27 A;  4XKA A;  2YEJ A;  1LVC A;  3Q24 A;  3VKH A;  3A0T A;  3B25 A;  1UDY A;  3CYG A;  3CWV A;  1R3B A;  2XHT A;  1BGQ A;  1UY9 A;  2XS8 A;  2YE2 A;  4H7Q A;  4CWQ A;  1R62 A;  5F5R A;  3INX A;  1QYE A;  2GBB A;  4NH7 A;  2UXW A;  2ZBK B;  2AKP A;  1TID A;  2WI7 A;  3T10 A;  1I59 A;  2WI6 A;  4BQJ A;  2E0A A;  3II9 A;  4GCZ A;  4E72 A;  3C2P A;  2ESA A;  4KSF A;  1BXD A;  4Q20 A;  4AWP A;  4JAU A;  1WS9 A;  2CCT A;  5D6P A;  1TBW A;  5D7R A;  4CWF A;  2CGF A;  4DUH A;  4G5E A;  4O07 A;  3C0E A;  4HYM A;  4GFN A;  4L94 A;  2WI2 A;  2YYL A;  3O6O A;  2ZDY A;  3Q5K A;  1Y4S A;  3BNH A;  3D6B A;  2XJJ A;  4P8O A;  2YKJ A;  2YJW A;  1SIR A;  3HYZ A;  2YGA A;  3M9V A;  4AKH A;  1RP3 A;  4YKQ A;  1A4H A;  4KTN A;  1S26 A;  3G7E A;  2YYG A;  3C46 A;  3H80 A;  1W07 A;  4YKY A;  4EFT A;  3MMO A;  3A0X A;  2XX2 A;  3RLP A;  3CGZ A;  2LFW A;  3BNF A;  2JJC A;  2BU2 A;  4V25 A;  2JBT A;  3GQT A;  1YC3 A;  1YC4 A;  2CJ7 A;  1Y0V A;  3X0Y A;  2EBA A;  2CJ4 A;  1H7U A;  3BNJ A;  5M4M A;  1XFY A;  4NXL A;  4L3X A;  1BUC A;  3F29 A;  2QFO A;  4JAS A;  3SWO A;  3EKO A;  1B3Q A;  3D0B A;  3AFE A;  5J6A A;  2YGE A;  1GU6 A;  1JQI A;  2YI0 A;  3A0Y A;  5CTY A;  1UYM A;  4AWQ A;  3MPJ A;  2XS1 A;  5FNF A;  2E80 A;  2E81 A;  3FCJ A;  4EMV A;  4U7O A;  4LP0 A;  3PEJ A;  4XIT A;  4IRN A;  3OWA A;  4CWR A;  1GKZ A;  1SC5 A;  3S7W A;  1THN A;  1GKX A;  2XD6 A;  3D9G A;  1UYI A;  4MBC A;  4W9U A;  1PVG A;  2OEX A;  3A0R A;  1GJV A;  2IX5 A;  3U2D A;  5GJV E;  5D7D A;  3ZKB A;  4K4O A;  2YYI A;  2FWZ A;  3Q22 A;  4XVX A;  4YKU A;  3NMQ A;  5C93 A;  4WJY A;  3U67 A;  1X91 A;  4O0B A;  1XG2 B;  3T1K A;  4KP4 A;  4R3M A;  2K5B A;  2QG2 A;  2BU7 A;  3P4T A;  2YYK A;  1OAH A;  4G97 A;  2CX9 A;  4Q5C A;  3G7B A;  3GIG B;  4XKK A;  5F3K A;  4CWO A;  2OR0 A;  4B7P A;  2J7A A;  4MPC A;  4QPJ A;  5CPH A;  4B6C A;  2IX6 A;  5GGZ A;  2EXL A;  2BU5 A;  1AJ6 A;  3OWD A;  4YKR A;  4FCQ A;  3R7K A;  4HY6 A;  3HEK A;  2YYM A;  1QY8 A;  4HXZ A;  3R4P A;  2EBF X;  2BYH A;  1XFU A;  4O5M A;  2O1V A;  3SCE A;  3VAD A;  1EGE A;  4J1V A;  1FS9 A;  3PFD A;  4LQQ B;  1Z59 A;  3HZ1 A;  1IVH A;  1UYK A;  1T9G A;  3TZ5 A;  2CJ6 A;  2CCU A;  3NF4 A;  1US7 A;  3CRL A;  2YK9 A;  1YSZ A;  4XIR A;  1NHI A;  2YE4 A;  1TIL A;  2EBH X;  5D7C A;  2C1I A;  4HXW A;  1AMW A;  4LWG A;  1K90 A;  3T0Z A;  1L0O A;  4JAV A;  2XDU A;  4FF2 A;  3LG1 A;  4L38 A;  4FZ4 A;  1YT0 A;  3FT8 A;  3OPD A;  3AFF A;  4FF4 A;  2YKE A;  4XKO A;  4HY1 A;  3EHH A;  1I5C A;  1U0Z A;  1ZWH A;  4LPB A;  5K3I A;  1XFZ A;  2UWD A;  1TC0 A;  4CWP A;  2YEC A;  2Q8H A;  2YI5 A;  2A1T A;  1YT2 A;  1UYD A;  3Q23 A;  4FCP A;  2DVL A;  1AH8 A;  1NHH A;  3CRK A;  4H81 A;  5M4K A;  2IWS A;  2VW5 A;  3D2R A;  4RM7 A;  5M4N A;  2H8M A;  2GQP A;  2YE5 A;  2XHX A;  4Q5B A;  1NHJ A;  1UYL A;  2WEP A;  3TTZ A;  3TOR A;  2ZKJ A;  1R2J A;  3OIB A;  2JBS A;  3PEH A;  3T0H A;  5JEN A;  2XJG A;  5BRM A;  5B6B A;  2EC5 A;  4GT8 A;  4EGI A;  4MPN A;  5K3H A;  4MPE A;  4DOY A;  3R4O A;  4GQT A;  3EKR A;  4Q4U A;  4O09 A;  2AO2 A;  4JQL A;  1FS8 A;  2QR4 A;  2D29 A;  4ASG A;  5IDM A;  2VCI A;  4L8Z A;  4X28 C;  1UY7 A;  3R92 A;  2BRC A;  2YE7 A;  4CE1 A;  3HYY A;  4Q0T A;  2C0U A;  2WI5 A;  2BZ5 A;  3D9F A;  3D9D A;  2BTZ A;  3MDD A;  2YE6 A;  4QPK A;  3GIF A;  2XDL A;  2WEQ A;  1Y8O A;  1MU5 A;  1UYE A;  5IN9 A;  3B24 A;  3TZ0 A;  4KSH A;  4PRX A;  3Q5J A;  3EHF A;  4PL9 A;  2C2A A;  1Z5A A;  3K60 A;  4URM A;  2RFQ A;  3EON A;  2REH A;  1EI1 A;  4FCR A;  3MNR P;  4PRV A;  2YEG A;  2CJ8 A;  4PU9 A;  5FWK A;  4I3H A;  1Y4U A;  1KIJ A;  3LMM A;  2C12 A;  4KCF A;  2FXS A;  4FF3 A;  5FNC A;  4KFG A;  2IOR A;  4M9A A;  3D36 A;  3R4M A;  2ZO5 A;  2QG0 A;  4U7N A;  4L90 A;  3ZXO A;  2R0N A;  4HR3 A;  4BIU A;  5B5V A;  2BU6 A;  2OEV A;  1YT1 A;  4ZVI A;  3EHG A;  2CCS A;  1YER A;  3EOM A;  2XX4 A;  3MPI A;  2IWX A;  4FPP A;  4HZ0 A;  4O04 A;  1FS7 A;  2YEH A;  3BNG A;  5BOC A;  1BKN A;  2FYP A;  2XDS A;  1Z5B A;  4MP7 A;  2C1G A;  4XC0 A;  1EGC A;  2YGW A;  4JEK A;  3WQ9 A;  1U8V A;  2XX5 A;  4DZY A;  2CJ5 A;  3FO3 A;  2HKJ A;  2YI7 A;  4QIC A;  3ZKD A;  4L91 A;  4P13 A;  1ZW9 A;  3R91 A;  3RKH A;  4NH9 A;  5M4H A;  3HWC A;  2XK2 A;  3TUH A;  4MP2 A;  1YSR A;  1RJ1 A;  4V26 A;  2XHR A;  2PG0 A;  4KSG A;  3SF6 A;  2IOQ A;  4YKZ A;  4WUC A;  4CWS A;  4R1F A;  1YET A;  1I58 A;  2OT4 A;  5B5W A;  4BQG A;  3WHA A;  3QTF A;  4AKI A;  1AH6 A;  2O1W A;  4YKW A;  5BRK A;  1EA6 A; 
#chains in the Genus database with same CATH homology
 3K98 A;  2WER A;  1OSF A;  3RLR A;  2YK2 A;  4URO A;  4ASB A;  2BSM A;  2YEF A;  2CH4 A;  2HG1 A;  3O2F A;  4GEE A;  4LWE A;  4CWN A;  1MX0 A;  4E02 A;  2Q8G A;  2XJX A;  4EEH A;  4CE3 A;  1B63 A;  2Q8I A;  3ZXQ A;  4AWO A;  1S16 A;  4XE2 A;  3O0I A;  1ZXN A;  2XDX A;  2YKC A;  5CTU A;  4ZKI A;  4XDM A;  3U2K A;  4YKX A;  2YED A;  3HHU A;  4MOT A;  4XCJ A;  2YKB A;  2H55 A;  4U93 A;  2YE3 A;  5CTW A;  4XD8 A;  2HCH A;  1TC6 A;  4XIQ A;  3K99 A;  2JKI A;  1TH8 A;  3GIE A;  1B62 A;  1YES A;  1ZXM A;  3HZ5 A;  3H4L A;  5D6Q A;  3FV5 A;  3G75 A;  2YEE A;  5FND A;  3IED A;  5M4E A;  2YKI A;  4I5S A;  2BRE A;  3B26 A;  1JM6 A;  1UYG A;  1BYQ A;  2PNR A;  2IWU A;  5M4P A;  2WI3 A;  2XDK A;  1S14 A;  1U2O A;  1UY6 A;  1Y8P A;  4LWI A;  4URL A;  1I5A A;  5CTX A;  2VWC A;  1ID0 A;  4EM7 A;  2BU8 A;  1KZN A;  1QZR A;  4EGK A;  3QDD A;  2VCJ A;  4AS9 A;  4E00 A;  2IOP A;  4NH8 A;  1UYC A;  4XIP A;  2QF6 A;  3KE6 A;  4E01 A;  3A0W A;  2YEI A;  4HYP A;  4WUB A;  3DGE A;  1YS3 A;  2YI6 A;  4GGL A;  4W7T A;  2FWY A;  4H85 A;  2XAB A;  2WI4 A;  4X9L A;  4ASA A;  4LWF A;  4O05 A;  2YEA A;  3LNU A;  4XTJ A;  5CF0 A;  5L3J A;  1H7S A;  2GFD A;  5IDJ A;  2BYI A;  4WUD A;  1AM1 A;  4BXI A;  3OWB A;  3EHJ A;  3JZ3 A;  2Q2E B;  2YE9 A;  3BMY A;  2O1U A;  3OMU A;  4MB9 A;  3VHD A;  3INW A;  4EGH A;  3CGY A;  3TZ2 A;  4ASF A;  2YE8 A;  3OW6 A;  1YC1 A;  2ZDX A;  3RKZ A;  4CE2 A;  2YEB A;  1Y8N A;  3ZM7 A;  2BT0 A;  4BAE A;  3LPS A;  3RLQ A;  5J71 A;  3TZ4 A;  1Z5C A;  3GIG A;  4XCL A;  3K97 A;  4FMT A;  2YJX A;  1I5D A;  4R3A A;  3BM9 A;  1I5B A;  3R4N A;  4CWT A;  3VHC A;  2WI1 A;  3Q5L A;  4L93 A;  2YGF A;  2CG9 A;  1UYF A;  3VHA A;  3FT5 A;  2Q8F A;  4BIZ A;  4HZ5 A;  4URN A;  4EFU A;  1UY8 A;  1UYH A;  3T2S A;  3A0Z A;  2XCM A;  4LWH A;  4P7A A;  3B28 A;  3C11 A;  4YKT A;  5BOD A;  3SL2 A;  4KQV A;  3B27 A;  4XKA A;  2YEJ A;  3A0T A;  3B25 A;  3CWV A;  2XHT A;  1BGQ A;  1UY9 A;  2YE2 A;  4H7Q A;  4CWQ A;  1R62 A;  5F5R A;  3INX A;  1QYE A;  4NH7 A;  2ZBK B;  2AKP A;  1TID A;  2WI7 A;  3T10 A;  1I59 A;  2WI6 A;  4BQJ A;  2E0A A;  4GCZ A;  2ESA A;  1BXD A;  4Q20 A;  4AWP A;  4JAU A;  2CCT A;  5D6P A;  5D7R A;  1TBW A;  4CWF A;  2CGF A;  4DUH A;  4O07 A;  3C0E A;  4HYM A;  4GFN A;  4L94 A;  2WI2 A;  3O6O A;  2ZDY A;  3Q5K A;  1Y4S A;  2XJJ A;  4P8O A;  2YKJ A;  2YJW A;  3HYZ A;  2YGA A;  4YKQ A;  1A4H A;  4KTN A;  3G7E A;  3H80 A;  4YKY A;  4EFT A;  3A0X A;  2XX2 A;  3RLP A;  3CGZ A;  2JJC A;  2BU2 A;  4V25 A;  1YC3 A;  1YC4 A;  1H7U A;  5M4M A;  2QFO A;  4JAS A;  3EKO A;  1B3Q A;  3D0B A;  5J6A A;  2YGE A;  2YI0 A;  3A0Y A;  5CTY A;  1UYM A;  4AWQ A;  5FNF A;  4EMV A;  4U7O A;  4LP0 A;  3PEJ A;  4XIT A;  4CWR A;  1GKZ A;  1THN A;  1GKX A;  2XD6 A;  1UYI A;  4MBC A;  1PVG A;  3A0R A;  1GJV A;  3U2D A;  5D7D A;  3ZKB A;  4K4O A;  2FWZ A;  4YKU A;  3NMQ A;  5C93 A;  3U67 A;  4O0B A;  3T1K A;  4KP4 A;  4R3M A;  2K5B A;  2QG2 A;  2BU7 A;  3G7B A;  3GIG B;  4XKK A;  5F3K A;  4CWO A;  4B7P A;  4MPC A;  4QPJ A;  4B6C A;  5CPH A;  5GGZ A;  2EXL A;  2BU5 A;  1AJ6 A;  3OWD A;  4YKR A;  4FCQ A;  4HY6 A;  3HEK A;  1QY8 A;  4HXZ A;  3R4P A;  2BYH A;  2O1V A;  3VAD A;  3HZ1 A;  1Z59 A;  1UYK A;  3TZ5 A;  2CCU A;  1US7 A;  3CRL A;  2YK9 A;  1YSZ A;  4XIR A;  1NHI A;  2YE4 A;  1TIL A;  5D7C A;  4HXW A;  1AMW A;  4LWG A;  3T0Z A;  1L0O A;  4JAV A;  2XDU A;  1YT0 A;  3FT8 A;  3OPD A;  2YKE A;  4XKO A;  4HY1 A;  3EHH A;  1I5C A;  1U0Z A;  1ZWH A;  4LPB A;  2UWD A;  4CWP A;  1TC0 A;  2YEC A;  2Q8H A;  2YI5 A;  1YT2 A;  1UYD A;  4FCP A;  1AH8 A;  1NHH A;  3CRK A;  4H81 A;  5M4K A;  2IWS A;  2VW5 A;  3D2R A;  2H8M A;  5M4N A;  2YE5 A;  2GQP A;  2XHX A;  1NHJ A;  1UYL A;  2WEP A;  3TTZ A;  3T0H A;  2ZKJ A;  3PEH A;  2XJG A;  4GT8 A;  4EGI A;  4MPN A;  4MPE A;  3R4O A;  4GQT A;  3EKR A;  4O09 A;  4JQL A;  4ASG A;  5IDM A;  2VCI A;  4L8Z A;  1UY7 A;  3R92 A;  2BRC A;  2YE7 A;  4CE1 A;  3HYY A;  2WI5 A;  2BZ5 A;  2BTZ A;  2YE6 A;  4QPK A;  3GIF A;  2XDL A;  2WEQ A;  1Y8O A;  1MU5 A;  1UYE A;  5IN9 A;  3B24 A;  3TZ0 A;  4KSH A;  4PRX A;  3Q5J A;  3EHF A;  4PL9 A;  2C2A A;  1Z5A A;  3K60 A;  4URM A;  4FCR A;  1EI1 A;  4PRV A;  3MNR P;  2YEG A;  4PU9 A;  5FWK A;  4I3H A;  1Y4U A;  1KIJ A;  2FXS A;  5FNC A;  4KFG A;  2IOR A;  3D36 A;  3R4M A;  2QG0 A;  4U7N A;  3ZXO A;  4L90 A;  4BIU A;  2BU6 A;  1YT1 A;  4ZVI A;  3EHG A;  2CCS A;  1YER A;  2XX4 A;  2IWX A;  4FPP A;  4HZ0 A;  4O04 A;  2YEH A;  5BOC A;  1BKN A;  2FYP A;  2XDS A;  1Z5B A;  4MP7 A;  4XC0 A;  3WQ9 A;  2XX5 A;  4DZY A;  2HKJ A;  2YI7 A;  3ZKD A;  4L91 A;  1ZW9 A;  3R91 A;  5M4H A;  4NH9 A;  2XK2 A;  3TUH A;  4MP2 A;  1YSR A;  4V26 A;  2XHR A;  4KSG A;  2IOQ A;  4YKZ A;  4WUC A;  4CWS A;  4R1F A;  1YET A;  1I58 A;  4BQG A;  3WHA A;  3QTF A;  1AH6 A;  2O1W A;  4YKW A;  1EA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...