2Q8HA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with dichloroacetate (dca)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
383
structure length
365
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSCEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNADDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
total genus 122
structure length 365
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8hA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8hA02
2YE4A 4X9LA 4CWQA 4EGIA 4U7NA 3A0YA 4B6CA 3EHJA 4BAEA 4E02A 4UROA 4HXWA 4KSHA 4YKTA 4WUCA 2YGEA 3K97A 3TZ4A 1EA6A 4EFTA 3R4MA 4YKQA 4AWQA 4KQVA 1GKZA 3K60A 3T2SA 5D7DA 1YT0A 2CGFA 3GIFA 4JAUA 4EM7A 3PEHA 2VW5A 5F3KA 2WI4A 4L90A 5M4PA 3B26A 3FT8A 2BU5A 2XDKA 1ID0A 2ZDXA 2QFOA 3RLQA 3B27A 4L94A 4CWOA 4GT8A 4LWGA 4R1FA 2WI3A 2YKJA 3O0IA 4XC0A 2CCUA 2E0AA 4HY1A 1KIJA 1UYDA 2BREA 3R4OA 1PVGA 3HYYA 2YKIA 1R62A 2YEJA 2YEGA 3OWBA 3R4NA 2ZBKB 4YKXA 4WUBA 2H55A 1JM6A 3TZ5A 1AH6A 4O05A 3TTZA 1I5AA 1AH8A 3C11A 1Y4SA 1THNA 2Q8GA 1UY9A 4URMA 2EXLA 4ASGA 3EKRA 5BODA 3TUHA 5BOCA 2FWYA 2XABA 4GQTA 2WI5A 4W7TA 3GIGB 4NH8A 1S16A 2YI7A 4LWIA 2YGFA 4EGKA 1TH8A 3EHGA 2YE6A 3RLPA 4EMVA 1UYLA 4U93A 1NHIA 3A0XA 5FNCA 2Q2EB 1UY8A 2YEBA 3HZ1A 4CWFA 2XX2A 4XKOA 4MP7A 1Z5CA 2WI2A 1UYHA 1YC1A 2PNRA 2IOQA 2BSMA 1QZRA 4H85A 4CWRA 1I58A 3U2KA 4H81A 4XTJA 1Y8PA 2HG1A 2VCIA 4O04A 1Z5AA 2Q8FA 1ZXNA 2VCJA 2JKIA 2YGAA 2YEIA 4CWNA 4MBCA 3ZKDA 2Q8HA 3VHCA 5F5RA 4JAVA 2QF6A 5IDJA 1UYIA 4BXIA 1U2OA 4HXZA 3IEDA 4BIUA 4CE2A 1YERA 1AJ6A 1B62A 2BU7A 4LP0A 1AM1A 4XDMA 1Z59A 2ZKJA 1EI1A 5M4KA 1NHJA 3B24A 2GFDA 3QTFA 4HY6A 2XDXA 1Y4UA 1I5BA 2H8MA 2YJWA 4XITA 4EFUA 4AWPA 3RLRA 3C0EA 2WERA 5M4MA 4LWHA 1UYKA 4HYMA 4XIQA 2WEPA 3CWVA 4GCZA 4JQLA 4XE2A 1UYFA 4AWOA 1YT1A 3LPSA 4XCJA 3CGZA 2BRCA 3U67A 4XKAA 4PRVA 5D6PA 1US7A 4FCPA 2BYIA 4R3AA 5D6QA 1BYQA 2UWDA 2XJXA 2AKPA 3TZ0A 1UY6A 4XD8A 1TIDA 4U7OA 1UYGA 3D0BA 4KSGA 4R3MA 3D36A 2YKCA 2VWCA 3PEJA 3CRKA 3H80A 2XK2A 2BU8A 3HHUA 5D7CA 4AS9A 4LWEA 4MPEA 4I5SA 1I59A 4ZVIA 5C93A 3OW6A 4MP2A 4MB9A 4HZ0A 4PU9A 2IWUA 2YE2A 4MOTA 1YT2A 2YI6A 4FMTA 3O2FA 2HCHA 1OSFA 2BYHA 3H4LA 5CPHA 3LNUA 1MX0A 2ESAA 2Q8IA 3HYZA 2YKBA 1AMWA 2BTZA 4E00A 4YKYA 2YE9A 5J6AA 2ZDYA 3R91A 3T0HA 1YETA 2XX5A 4KTNA 1Z5BA 4BQJA 4MPCA 3RKZA 2YE3A 2O1WA 2XJGA 3GIEA 4PL9A 3EKOA 3T0ZA 2XHTA 1TILA 4LPBA 1Y8OA 2JJCA 4QPKA 2YEFA 3CGYA 3T10A 1UYMA 4URNA 1YC4A 3Q5JA 1BKNA 2QG2A 4FCRA 4KP4A 4KFGA 4WUDA 2WI7A 5FNFA 1GJVA 4ASFA 3ZXOA 3TZ2A 1TC6A 5CTXA 5CTUA 2WI1A 2XDUA 3Q5KA 4LWFA 5L3JA 4O07A 1I5CA 4Q20A 4CE3A 3A0TA 5GGZA 4HZ5A 1I5DA 3R4PA 4BQGA 4DUHA 2CH4A 4QPJA 4H7QA 2XDSA 1UYEA 4GFNA 2K5BA 2IWSA 2CCSA 3A0ZA 3T1KA 1UYCA 2XHXA 5D7RA 4V26A 3MNRP 2CG9A 3U2DA 4ZKIA 1ZWHA 2YE8A 2YE5A 2XJJA 4NH7A 2YJXA 1S14A 1B63A 3A0WA 1B3QA 3OMUA 3R92A 3HEKA 4P8OA 3ZM7A 3BM9A 5IDMA 4MPNA 1UY7A 2BT0A 4XIRA 2WI6A 2BU2A 4P7AA 2C2AA 4E01A 2YK9A 1BGQA 4L8ZA 3KE6A 1BXDA 4ASBA 4XCLA 2YEEA 4YKRA 1Y8NA 3O6OA 4CE1A 2FYPA 4CWSA 3K98A 1ZW9A 2XDLA 1H7SA 3ZXQA 2YE7A 2O1UA 1U0ZA 1YSZA 4L93A 3ZKBA 3WQ9A 4CWPA 4FCQA 1YSRA 1KZNA 4BIZA 4FPPA 4GEEA 3FV5A 3QDDA 4L91A 4I3HA 5M4HA 4O09A 3BMYA 4V25A 3EHFA 2YEAA 4NH9A 4YKUA 5CF0A 2YK2A 1YC3A 5CTWA 3NMQA 5IN9A 4DZYA 4XIPA 2XD6A 2YI5A 3HZ5A 4JASA 2XHRA 5FWKA 5CTYA 2YI0A 2FXSA 4PRXA 1ZXMA 1QY8A 5M4EA 2FWZA 2IORA 1TBWA 4CWTA 2O1VA 3CRLA 2BZ5A 3VHAA 2YEDA 3Q5LA 5FNDA 1QYEA 1YS3A 3D2RA 4YKZA 3SL2A 5J71A 5M4NA 2YEHA 3FT5A 3JZ3A 3EHHA 3G75A 3OWDA 3DGEA 3G7BA 3WHAA 3OPDA 2XX4A 4YKWA 1NHHA 3VHDA 1YESA 4K4OA 2IOPA 3K99A 4ASAA 4B7PA 4EGHA 2CCTA 4URLA 3INXA 3VADA 1A4HA 2WEQA 3GIGA 1MU5A 2IWXA 2XCMA 4GGLA 3G7EA 4O0BA 4XKKA 1GKXA 2GQPA 2YECA 1H7UA 3B25A 2QG0A 1L0OA 3INWA 2BU6A 2HKJA 1TC0A 2YKEA 3B28A 3A0RA 4EEHA 4HYPA
chains in the Genus database with same CATH superfamily
1PK0A 1K8TA 2YE4A 4X9LA 3CE2A 4CWQA 4EGIA 2YGWA 4U7NA 3A0YA 4B6CA 3EHJA 4BAEA 4E02A 3MDEA 4UROA 3MXLA 4HXWA 4KSHA 4YKTA 3SXQA 4WUCA 4Q5BA 4X28A 2YGEA 3K97A 3MKHA 3TZ4A 1EA6A 2JIFA 3GM6A 4EFTA 3R4MA 1FS8A 3FCJA 4Q0TA 4YKQA 4AWQA 2CJ4A 1W07A 4KQVA 1GKZA 2YYMA 2JBRA 3K60A 4HR3A 3T2SA 5D7DA 1WS9A 1YT0A 3TORA 2CGFA 3GIFA 4JAUA 4EM7A 3PEHA 2VW5A 5F3KA 2WI4A 1T9GA 4L90A 2CJ7A 4LQQB 1XG2B 5M4PA 3B26A 3FT8A 2BU5A 4IRNA 2XDKA 2A1TA 1U8VA 4WJYA 1ID0A 2R0MA 2ZDXA 2QFOA 3RLQA 3B27A 4L94A 4CWOA 4GT8A 4LWGA 4R1FA 2WI3A 2YKJA 3O0IA 4XC0A 2DVLA 2CCUA 2E0AA 3PFDA 4HY1A 1KIJA 3C46A 1UYDA 4G97A 2BREA 2LFWA 3R4OA 3BNFA 1PVGA 3HYYA 2YKIA 1SK6A 1EGEA 1R62A 2RF7A 2YEJA 2YEGA 4P79A 3OWBA 3R4NA 5B6BA 2ZBKB 4YKXA 4WUBA 3SWOA 2H55A 1JM6A 4HKSA 3TZ5A 3Q24A 1AH6A 4O05A 3TTZA 1I5AA 1X8ZA 1AH8A 3C11A 1RJ1A 1Y4SA 1THNA 2CJ5A 4ZXVA 2Q8GA 1UY9A 3OWMA 4KCFA 3D6BA 2EXLA 3EKRA 4URMA 4ASGA 4FF2A 2OEVA 5BODA 3TUHA 5BOCA 4JIZA 2FWYA 2XABA 4GQTA 2YYLA 2WI5A 4W9UA 3D1IA 4W7TA 4L3YA 3GIGB 4NH8A 3HWCA 1XFVA 1S16A 2YI7A 4LWIA 3MPJA 2YGFA 4EGKA 2PG0A 1TH8A 3EHGA 2ZO5A 2YE6A 3RLPA 4EMVA 4Q4UA 1UYLA 4U93A 1NHIA 1SIRA 3A0XA 5FNCA 2YYGA 2Q2EB 1UY8A 2YEBA 3S5TA 3HZ1A 4CWFA 2XX2A 4XKOA 4MP7A 1Z5CA 2WI2A 1UYHA 1YC1A 2PNRA 4FF1A 4JEKA 2BSMA 2IOQA 1QZRA 3Q22A 4H85A 4CWRA 5K3HA 1I58A 3Q23A 1RP3A 4H81A 3C3LA 1EGDA 4XTJA 3U2KA 1Y8PA 2HG1A 2VCIA 4O04A 1Z5AA 2Q8FA 1ZXNA 3LG1A 2VCJA 2JKIA 3BNJA 2YGAA 2YEIA 4CWNA 4MBCA 3ZKDA 4U83A 2Q8HA 3VHCA 5F5RA 4JAVA 2HJNA 2QF6A 5IDJA 3EOMA 1UYIA 5JENA 4Q17A 4BXIA 1U2OA 1XFUA 4HKRA 4HXZA 3IEDA 4BIUA 2VF1A 1YERA 4CE2A 1AJ6A 1B62A 2BU7A 4KS9A 4LP0A 1AM1A 4XDMA 3LGQA 3OWAA 2RDZA 1Z59A 2ZKJA 1EI1A 2VIGA 5M4KA 1NHJA 3B24A 2GFDA 4AKIA 3QTFA 4HY6A 2XDXA 1Y4UA 4RM7A 1I5BA 2H8MA 2YJWA 4XITA 4EFUA 4AWPA 3RLRA 3C0EA 1IXMA 2WERA 5M4MA 4LWHA 5K3GA 2EBHX 2D29A 2GBBA 2J7AA 5B5VA 1UYKA 1X91A 4HYMA 4XIQA 1BUCA 2WEPA 3CWVA 4GCZA 4JQLA 4XE2A 1UYFA 4AWOA 1YT1A 3LPSA 4XCJA 3CGZA 2BRCA 3VKGA 2IX5A 3U67A 1R2JA 4XKAA 3L1TA 4PRVA 5D6PA 4G5EA 1US7A 2BYIA 4FCPA 4R3AA 5D6QA 1BYQA 2UWDA 2XJXA 2AKPA 2YYKA 3MDDA 3TZ0A 4M9AA 1UY6A 1TIDA 4XD8A 4U7OA 5GJVE 1UYGA 3D0BA 4KSGA 4R3MA 3D36A 2QR4A 2YKCA 4DOYA 2VWCA 3PEJA 3CRKA 3H80A 2XS8A 2XK2A 2BU8A 2FP2A 2FONA 5K3JA 3HHUA 5D7CA 4AS9A 4LWEA 4MPEA 4I5SA 1I59A 4KTOA 4ZVIA 5C93A 1UKWA 3D9DA 3OW6A 4MP2A 4MB9A 4HZ0A 4PU9A 3OIBA 2IWUA 2YE2A 4MOTA 2DDHA 1YT2A 2YI6A 4JIOA 4X28C 4FMTA 3O2FA 2HCHA 1OSFA 2BYHA 3H4LA 3LMMA 5CPHA 2R03A 2XQRB 2YYIA 3LNUA 1MX0A 2ESAA 2Q8IA 4QICA 3HYZA 2YKBA 2E80A 4IV6A 1AMWA 2BTZA 1XFZA 4E00A 4YKYA 2YE9A 1FS7A 2R02A 2REHA 5J6AA 2ZDYA 3R91A 3T0HA 1YETA 2XX5A 4KTNA 1Z5BA 4BQJA 2E81A 4MPCA 3RKZA 2YE3A 2O1WA 2XJGA 3GIEA 4PL9A 3EKOA 4FZ4A 1IVHA 3T0ZA 2C0UA 3Q0AA 2XHTA 1Y0VA 2OEXA 4L1FA 3D9GA 1TILA 4N5FA 1Y8OA 2JJCA 4LPBA 2YEFA 3CGYA 4QPKA 1UYMA 3T10A 4URNA 1YC4A 3Q5JA 1BKNA 2FTKA 2QG2A 4FCRA 2OT4A 4KP4A 4KFGA 5BRKA 3GNCA 4WUDA 2WI7A 5FNFA 3F29A 2AO2A 2AZEA 1GJVA 3BNHA 4ASFA 3NF4A 3ZXOA 3TZ2A 1TC6A 4AKGA 5CTXA 5CTUA 3AFFA 2WI1A 2XDUA 3Q5KA 4LWFA 5L3JA 4O07A 1I5CA 4Q20A 3D9FA 4CE3A 3A0TA 5GGZA 4HZ5A 1I5DA 3R4PA 4BQGA 4DUHA 2CH4A 4QPJA 3MPIA 3X29A 4H7QA 2XDSA 1UYEA 4GFNA 2K5BA 2Z1QA 2IWSA 2CCSA 3A0ZA 3T1KA 1UYCA 2XHXA 5D7RA 4V26A 3MNRP 2CG9A 2YYJA 3U2DA 4ZKIA 1ZWHA 2YE8A 2YE5A 3M9VA 2XJJA 4NH7A 4FF3A 4E72A 2YJXA 1S14A 3VKHA 1B63A 3A0WA 1B3QA 3OMUA 3R92A 3HEKA 4P8OA 2XS1A 1K93A 3ZM7A 3BM9A 1QDBA 5IDMA 2F6LA 3FO3A 5BRMA 2C1IA 4MPNA 1UY7A 2BT0A 1JQIA 4AI6A 3CYGA 4XIRA 2WI6A 2BU2A 4KSAA 3GQTA 4P7AA 2C2AA 4E01A 2YK9A 1RJ4A 1BGQA 5K3IA 4L8ZA 1R3BA 2EBFX 2UXWA 2IX6A 2OR0A 3KE6A 1BXDA 4ASBA 4XCLA 2YEEA 3UU9A 3N0RA 2FP1A 1K90A 4YKRA 1Y8NA 3O6OA 4Q1OA 2EC5A 4CE1A 2FYPA 4CWSA 3K98A 1ZW9A 2XDLA 1H7SA 3ZXQA 2YE7A 2O1UA 1U0ZA 1YSZA 4L93A 3ZKBA 4Q5CA 3WQ9A 4CWPA 1YSRA 4FCQA 1XFWA 5GJWE 1IS2A 2CX9A 3C2PA 1KZNA 3TTBA 4BIZA 1UDYA 3SCEA 4FPPA 4GEEA 3FV5A 3QDDA 4L91A 4I3HA 5M4HA 4O09A 3BMYA 4L38A 4LQSB 3MMOA 4L3ZA 4O5MA 4KSFA 4V25A 3EHFA 2YEAA 4NH9A 4L3XA 4NXLA 1GU6A 4XVXA 3X0XA 2HHIA 2YK2A 1YC3A 4YKUA 5CF0A 5B5WA 1S26A 2R0NA 2WBIA 5CTWA 3NMQA 5IN9A 4DZYA 4XIPA 1SC5A 2R05A 2XD6A 2YI5A 3HZ5A 4JASA 2XHRA 5FWKA 5CTYA 2YI0A 2FXSA 4PRXA 3R7KA 2VR0A 1ZXMA 1EGCA 2C12A 1QY8A 5M4EA 2CJ6A 2FWZA 1TBWA 2IORA 4CWTA 4P13A 3B96A 2O1VA 3CRLA 2BZ5A 3BNGA 1PI1A 2RFQA 2YEDA 3VHAA 2C1GA 3Q5LA 5FNDA 4J1VA 1QYEA 1YS3A 3D2RA 1XFYA 3D9EA 4OO2A 4YKZA 3SL2A 5J71A 5M4NA 2YEHA 3FT5A 3JZ3A 3EHHA 1OAHA 2OJQA 3G75A 4AKHA 3OWDA 2EBAA 3DGEA 3G7BA 4ZYJA 3WHAA 3OPDA 2XX4A 4YKWA 1NHHA 3VHDA 1YESA 2PO4A 4K4OA 2IOPA 3K99A 4ASAA 4B7PA 4EGHA 2CCTA 4URLA 3INXA 3VADA 1A4HA 3RKHA 2WEQA 3GIGA 3UBRA 1MU5A 2ZAFA 2JBTA 1FS9A 3EONA 4F0XA 3SF6A 2IWXA 2XCMA 3KMLA 4GGLA 3G7EA 4O0BA 3AFEA 4XKKA 3X0YA 1RX0A 1GKXA 1LVCA 2GQPA 2YECA 1SIQA 1H7UA 3B25A 1XFXA 1X90A 2QG0A 1L0OA 3S7WA 3INWA 2CJ8A 2JBSA 2BU6A 4FF4A 3P4TA 2HKJA 1TC0A 2YKEA 3II9A 3B28A 3A0RA 4EEHA 4HYPA 1F51A
chains in the Genus database with same CATH topology
2YE4A 4X9LA 4CWQA 4EGIA 4U7NA 3A0YA 4B6CA 3EHJA 4BAEA 4E02A 4UROA 4HXWA 4KSHA 4YKTA 4WUCA 2YGEA 3K97A 3TZ4A 1EA6A 4EFTA 3R4MA 4YKQA 4AWQA 4KQVA 1GKZA 3K60A 3T2SA 5D7DA 1YT0A 2CGFA 3GIFA 4JAUA 4EM7A 3PEHA 2VW5A 5F3KA 2WI4A 4L90A 5M4PA 3B26A 3FT8A 2BU5A 2XDKA 1ID0A 2ZDXA 2QFOA 3RLQA 3B27A 4L94A 4CWOA 4GT8A 4LWGA 4R1FA 2WI3A 2YKJA 3O0IA 4XC0A 2CCUA 2E0AA 4HY1A 1KIJA 1UYDA 2BREA 3R4OA 1PVGA 3HYYA 2YKIA 1R62A 2YEJA 2YEGA 3OWBA 3R4NA 2ZBKB 4YKXA 4WUBA 2H55A 1JM6A 3TZ5A 1AH6A 4O05A 3TTZA 1I5AA 1AH8A 3C11A 1Y4SA 1THNA 2Q8GA 1UY9A 4URMA 2EXLA 4ASGA 3EKRA 5BODA 3TUHA 5BOCA 2FWYA 2XABA 4GQTA 2WI5A 4W7TA 3GIGB 4NH8A 1S16A 2YI7A 4LWIA 2YGFA 4EGKA 1TH8A 3EHGA 2YE6A 3RLPA 4EMVA 1UYLA 4U93A 1NHIA 3A0XA 5FNCA 2Q2EB 1UY8A 2YEBA 3HZ1A 4CWFA 2XX2A 4XKOA 4MP7A 1Z5CA 2WI2A 1UYHA 1YC1A 2PNRA 2IOQA 2BSMA 1QZRA 4H85A 4CWRA 1I58A 3U2KA 4H81A 4XTJA 1Y8PA 2HG1A 2VCIA 4O04A 1Z5AA 2Q8FA 1ZXNA 2VCJA 2JKIA 2YGAA 2YEIA 4CWNA 4MBCA 3ZKDA 2Q8HA 3VHCA 5F5RA 4JAVA 2QF6A 5IDJA 1UYIA 4BXIA 1U2OA 4HXZA 3IEDA 4BIUA 4CE2A 1YERA 1AJ6A 1B62A 2BU7A 4LP0A 1AM1A 4XDMA 1Z59A 2ZKJA 1EI1A 5M4KA 1NHJA 3B24A 2GFDA 3QTFA 4HY6A 2XDXA 1Y4UA 1I5BA 2H8MA 2YJWA 4XITA 4EFUA 4AWPA 3RLRA 3C0EA 2WERA 5M4MA 4LWHA 1UYKA 4HYMA 4XIQA 2WEPA 3CWVA 4GCZA 4JQLA 4XE2A 1UYFA 4AWOA 1YT1A 3LPSA 4XCJA 3CGZA 2BRCA 3U67A 4XKAA 4PRVA 5D6PA 1US7A 4FCPA 2BYIA 4R3AA 5D6QA 1BYQA 2UWDA 2XJXA 2AKPA 3TZ0A 1UY6A 4XD8A 1TIDA 4U7OA 1UYGA 3D0BA 4KSGA 4R3MA 3D36A 2YKCA 2VWCA 3PEJA 3CRKA 3H80A 2XK2A 2BU8A 3HHUA 5D7CA 4AS9A 4LWEA 4MPEA 4I5SA 1I59A 4ZVIA 5C93A 3OW6A 4MP2A 4MB9A 4HZ0A 4PU9A 2IWUA 2YE2A 4MOTA 1YT2A 2YI6A 4FMTA 3O2FA 2HCHA 1OSFA 2BYHA 3H4LA 5CPHA 3LNUA 1MX0A 2ESAA 2Q8IA 3HYZA 2YKBA 1AMWA 2BTZA 4E00A 4YKYA 2YE9A 5J6AA 2ZDYA 3R91A 3T0HA 1YETA 2XX5A 4KTNA 1Z5BA 4BQJA 4MPCA 3RKZA 2YE3A 2O1WA 2XJGA 3GIEA 4PL9A 3EKOA 3T0ZA 2XHTA 1TILA 4LPBA 1Y8OA 2JJCA 4QPKA 2YEFA 3CGYA 3T10A 1UYMA 4URNA 1YC4A 3Q5JA 1BKNA 2QG2A 4FCRA 4KP4A 4KFGA 4WUDA 2WI7A 5FNFA 1GJVA 4ASFA 3ZXOA 3TZ2A 1TC6A 5CTXA 5CTUA 2WI1A 2XDUA 3Q5KA 4LWFA 5L3JA 4O07A 1I5CA 4Q20A 4CE3A 3A0TA 5GGZA 4HZ5A 1I5DA 3R4PA 4BQGA 4DUHA 2CH4A 4QPJA 4H7QA 2XDSA 1UYEA 4GFNA 2K5BA 2IWSA 2CCSA 3A0ZA 3T1KA 1UYCA 2XHXA 5D7RA 4V26A 3MNRP 2CG9A 3U2DA 4ZKIA 1ZWHA 2YE8A 2YE5A 2XJJA 4NH7A 2YJXA 1S14A 1B63A 3A0WA 1B3QA 3OMUA 3R92A 3HEKA 4P8OA 3ZM7A 3BM9A 5IDMA 4MPNA 1UY7A 2BT0A 4XIRA 2WI6A 2BU2A 4P7AA 2C2AA 4E01A 2YK9A 1BGQA 4L8ZA 3KE6A 1BXDA 4ASBA 4XCLA 2YEEA 4YKRA 1Y8NA 3O6OA 4CE1A 2FYPA 4CWSA 3K98A 1ZW9A 2XDLA 1H7SA 3ZXQA 2YE7A 2O1UA 1U0ZA 1YSZA 4L93A 3ZKBA 3WQ9A 4CWPA 4FCQA 1YSRA 1KZNA 4BIZA 4FPPA 4GEEA 3FV5A 3QDDA 4L91A 4I3HA 5M4HA 4O09A 3BMYA 4V25A 3EHFA 2YEAA 4NH9A 4YKUA 5CF0A 2YK2A 1YC3A 5CTWA 3NMQA 5IN9A 4DZYA 4XIPA 2XD6A 2YI5A 3HZ5A 4JASA 2XHRA 5FWKA 5CTYA 2YI0A 2FXSA 4PRXA 1ZXMA 1QY8A 5M4EA 2FWZA 2IORA 1TBWA 4CWTA 2O1VA 3CRLA 2BZ5A 3VHAA 2YEDA 3Q5LA 5FNDA 1QYEA 1YS3A 3D2RA 4YKZA 3SL2A 5J71A 5M4NA 2YEHA 3FT5A 3JZ3A 3EHHA 3G75A 3OWDA 3DGEA 3G7BA 3WHAA 3OPDA 2XX4A 4YKWA 1NHHA 3VHDA 1YESA 4K4OA 2IOPA 3K99A 4ASAA 4B7PA 4EGHA 2CCTA 4URLA 3INXA 3VADA 1A4HA 2WEQA 3GIGA 1MU5A 2IWXA 2XCMA 4GGLA 3G7EA 4O0BA 4XKKA 1GKXA 2GQPA 2YECA 1H7UA 3B25A 2QG0A 1L0OA 3INWA 2BU6A 2HKJA 1TC0A 2YKEA 3B28A 3A0RA 4EEHA 4HYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YE4 A;  4X9L A;  4CWQ A;  4EGI A;  4U7N A;  3A0Y A;  4B6C A;  3EHJ A;  4BAE A;  4E02 A;  4URO A;  4HXW A;  4KSH A;  4YKT A;  4WUC A;  2YGE A;  3K97 A;  3TZ4 A;  1EA6 A;  4EFT A;  3R4M A;  4YKQ A;  4AWQ A;  4KQV A;  1GKZ A;  3K60 A;  3T2S A;  5D7D A;  1YT0 A;  2CGF A;  3GIF A;  4JAU A;  4EM7 A;  3PEH A;  2VW5 A;  5F3K A;  2WI4 A;  4L90 A;  5M4P A;  3B26 A;  3FT8 A;  2BU5 A;  2XDK A;  1ID0 A;  2ZDX A;  2QFO A;  3RLQ A;  3B27 A;  4L94 A;  4CWO A;  4GT8 A;  4LWG A;  4R1F A;  2WI3 A;  2YKJ A;  3O0I A;  4XC0 A;  2CCU A;  2E0A A;  4HY1 A;  1KIJ A;  1UYD A;  2BRE A;  3R4O A;  1PVG A;  3HYY A;  2YKI A;  1R62 A;  2YEJ A;  2YEG A;  3OWB A;  3R4N A;  2ZBK B;  4YKX A;  4WUB A;  2H55 A;  1JM6 A;  3TZ5 A;  1AH6 A;  4O05 A;  3TTZ A;  1I5A A;  1AH8 A;  3C11 A;  1Y4S A;  1THN A;  2Q8G A;  1UY9 A;  4URM A;  2EXL A;  4ASG A;  3EKR A;  5BOD A;  3TUH A;  5BOC A;  2FWY A;  2XAB A;  4GQT A;  2WI5 A;  4W7T A;  3GIG B;  4NH8 A;  1S16 A;  2YI7 A;  4LWI A;  2YGF A;  4EGK A;  1TH8 A;  3EHG A;  2YE6 A;  3RLP A;  4EMV A;  1UYL A;  4U93 A;  1NHI A;  3A0X A;  5FNC A;  2Q2E B;  1UY8 A;  2YEB A;  3HZ1 A;  4CWF A;  2XX2 A;  4XKO A;  4MP7 A;  1Z5C A;  2WI2 A;  1UYH A;  1YC1 A;  2PNR A;  2IOQ A;  2BSM A;  1QZR A;  4H85 A;  4CWR A;  1I58 A;  3U2K A;  4H81 A;  4XTJ A;  1Y8P A;  2HG1 A;  2VCI A;  4O04 A;  1Z5A A;  2Q8F A;  1ZXN A;  2VCJ A;  2JKI A;  2YGA A;  2YEI A;  4CWN A;  4MBC A;  3ZKD A;  2Q8H A;  3VHC A;  5F5R A;  4JAV A;  2QF6 A;  5IDJ A;  1UYI A;  4BXI A;  1U2O A;  4HXZ A;  3IED A;  4BIU A;  4CE2 A;  1YER A;  1AJ6 A;  1B62 A;  2BU7 A;  4LP0 A;  1AM1 A;  4XDM A;  1Z59 A;  2ZKJ A;  1EI1 A;  5M4K A;  1NHJ A;  3B24 A;  2GFD A;  3QTF A;  4HY6 A;  2XDX A;  1Y4U A;  1I5B A;  2H8M A;  2YJW A;  4XIT A;  4EFU A;  4AWP A;  3RLR A;  3C0E A;  2WER A;  5M4M A;  4LWH A;  1UYK A;  4HYM A;  4XIQ A;  2WEP A;  3CWV A;  4GCZ A;  4JQL A;  4XE2 A;  1UYF A;  4AWO A;  1YT1 A;  3LPS A;  4XCJ A;  3CGZ A;  2BRC A;  3U67 A;  4XKA A;  4PRV A;  5D6P A;  1US7 A;  4FCP A;  2BYI A;  4R3A A;  5D6Q A;  1BYQ A;  2UWD A;  2XJX A;  2AKP A;  3TZ0 A;  1UY6 A;  4XD8 A;  1TID A;  4U7O A;  1UYG A;  3D0B A;  4KSG A;  4R3M A;  3D36 A;  2YKC A;  2VWC A;  3PEJ A;  3CRK A;  3H80 A;  2XK2 A;  2BU8 A;  3HHU A;  5D7C A;  4AS9 A;  4LWE A;  4MPE A;  4I5S A;  1I59 A;  4ZVI A;  5C93 A;  3OW6 A;  4MP2 A;  4MB9 A;  4HZ0 A;  4PU9 A;  2IWU A;  2YE2 A;  4MOT A;  1YT2 A;  2YI6 A;  4FMT A;  3O2F A;  2HCH A;  1OSF A;  2BYH A;  3H4L A;  5CPH A;  3LNU A;  1MX0 A;  2ESA A;  2Q8I A;  3HYZ A;  2YKB A;  1AMW A;  2BTZ A;  4E00 A;  4YKY A;  2YE9 A;  5J6A A;  2ZDY A;  3R91 A;  3T0H A;  1YET A;  2XX5 A;  4KTN A;  1Z5B A;  4BQJ A;  4MPC A;  3RKZ A;  2YE3 A;  2O1W A;  2XJG A;  3GIE A;  4PL9 A;  3EKO A;  3T0Z A;  2XHT A;  1TIL A;  4LPB A;  1Y8O A;  2JJC A;  4QPK A;  2YEF A;  3CGY A;  3T10 A;  1UYM A;  4URN A;  1YC4 A;  3Q5J A;  1BKN A;  2QG2 A;  4FCR A;  4KP4 A;  4KFG A;  4WUD A;  2WI7 A;  5FNF A;  1GJV A;  4ASF A;  3ZXO A;  3TZ2 A;  1TC6 A;  5CTX A;  5CTU A;  2WI1 A;  2XDU A;  3Q5K A;  4LWF A;  5L3J A;  4O07 A;  1I5C A;  4Q20 A;  4CE3 A;  3A0T A;  5GGZ A;  4HZ5 A;  1I5D A;  3R4P A;  4BQG A;  4DUH A;  2CH4 A;  4QPJ A;  4H7Q A;  2XDS A;  1UYE A;  4GFN A;  2K5B A;  2IWS A;  2CCS A;  3A0Z A;  3T1K A;  1UYC A;  2XHX A;  5D7R A;  4V26 A;  3MNR P;  2CG9 A;  3U2D A;  4ZKI A;  1ZWH A;  2YE8 A;  2YE5 A;  2XJJ A;  4NH7 A;  2YJX A;  1S14 A;  1B63 A;  3A0W A;  1B3Q A;  3OMU A;  3R92 A;  3HEK A;  4P8O A;  3ZM7 A;  3BM9 A;  5IDM A;  4MPN A;  1UY7 A;  2BT0 A;  4XIR A;  2WI6 A;  2BU2 A;  4P7A A;  2C2A A;  4E01 A;  2YK9 A;  1BGQ A;  4L8Z A;  3KE6 A;  1BXD A;  4ASB A;  4XCL A;  2YEE A;  4YKR A;  1Y8N A;  3O6O A;  4CE1 A;  2FYP A;  4CWS A;  3K98 A;  1ZW9 A;  2XDL A;  1H7S A;  3ZXQ A;  2YE7 A;  2O1U A;  1U0Z A;  1YSZ A;  4L93 A;  3ZKB A;  3WQ9 A;  4CWP A;  4FCQ A;  1YSR A;  1KZN A;  4BIZ A;  4FPP A;  4GEE A;  3FV5 A;  3QDD A;  4L91 A;  4I3H A;  5M4H A;  4O09 A;  3BMY A;  4V25 A;  3EHF A;  2YEA A;  4NH9 A;  4YKU A;  5CF0 A;  2YK2 A;  1YC3 A;  5CTW A;  3NMQ A;  5IN9 A;  4DZY A;  4XIP A;  2XD6 A;  2YI5 A;  3HZ5 A;  4JAS A;  2XHR A;  5FWK A;  5CTY A;  2YI0 A;  2FXS A;  4PRX A;  1ZXM A;  1QY8 A;  5M4E A;  2FWZ A;  2IOR A;  1TBW A;  4CWT A;  2O1V A;  3CRL A;  2BZ5 A;  3VHA A;  2YED A;  3Q5L A;  5FND A;  1QYE A;  1YS3 A;  3D2R A;  4YKZ A;  3SL2 A;  5J71 A;  5M4N A;  2YEH A;  3FT5 A;  3JZ3 A;  3EHH A;  3G75 A;  3OWD A;  3DGE A;  3G7B A;  3WHA A;  3OPD A;  2XX4 A;  4YKW A;  1NHH A;  3VHD A;  1YES A;  4K4O A;  2IOP A;  3K99 A;  4ASA A;  4B7P A;  4EGH A;  2CCT A;  4URL A;  3INX A;  3VAD A;  1A4H A;  2WEQ A;  3GIG A;  1MU5 A;  2IWX A;  2XCM A;  4GGL A;  3G7E A;  4O0B A;  4XKK A;  1GKX A;  2GQP A;  2YEC A;  1H7U A;  3B25 A;  2QG0 A;  1L0O A;  3INW A;  2BU6 A;  2HKJ A;  1TC0 A;  2YKE A;  3B28 A;  3A0R A;  4EEH A;  4HYP A; 
#chains in the Genus database with same CATH topology
 1PK0 A;  1K8T A;  2YE4 A;  4X9L A;  3CE2 A;  4CWQ A;  4EGI A;  2YGW A;  4U7N A;  3A0Y A;  4B6C A;  3EHJ A;  4BAE A;  4E02 A;  3MDE A;  4URO A;  3MXL A;  4HXW A;  4KSH A;  4YKT A;  3SXQ A;  4WUC A;  4Q5B A;  4X28 A;  2YGE A;  3K97 A;  3MKH A;  3TZ4 A;  1EA6 A;  2JIF A;  3GM6 A;  4EFT A;  3R4M A;  1FS8 A;  3FCJ A;  4Q0T A;  4YKQ A;  4AWQ A;  2CJ4 A;  1W07 A;  4KQV A;  1GKZ A;  2YYM A;  2JBR A;  3K60 A;  4HR3 A;  3T2S A;  5D7D A;  1WS9 A;  1YT0 A;  3TOR A;  2CGF A;  3GIF A;  4JAU A;  4EM7 A;  3PEH A;  2VW5 A;  5F3K A;  2WI4 A;  1T9G A;  4L90 A;  2CJ7 A;  4LQQ B;  1XG2 B;  5M4P A;  3B26 A;  3FT8 A;  2BU5 A;  4IRN A;  2XDK A;  2A1T A;  1U8V A;  4WJY A;  1ID0 A;  2R0M A;  2ZDX A;  2QFO A;  3RLQ A;  3B27 A;  4L94 A;  4CWO A;  4GT8 A;  4LWG A;  4R1F A;  2WI3 A;  2YKJ A;  3O0I A;  4XC0 A;  2DVL A;  2CCU A;  2E0A A;  3PFD A;  4HY1 A;  1KIJ A;  3C46 A;  1UYD A;  4G97 A;  2BRE A;  2LFW A;  3R4O A;  3BNF A;  1PVG A;  3HYY A;  2YKI A;  1SK6 A;  1EGE A;  1R62 A;  2RF7 A;  2YEJ A;  2YEG A;  4P79 A;  3OWB A;  3R4N A;  5B6B A;  2ZBK B;  4YKX A;  4WUB A;  3SWO A;  2H55 A;  1JM6 A;  4HKS A;  3TZ5 A;  3Q24 A;  1AH6 A;  4O05 A;  3TTZ A;  1I5A A;  1X8Z A;  1AH8 A;  3C11 A;  1RJ1 A;  1Y4S A;  1THN A;  2CJ5 A;  4ZXV A;  2Q8G A;  1UY9 A;  3OWM A;  4KCF A;  3D6B A;  2EXL A;  3EKR A;  4URM A;  4ASG A;  4FF2 A;  2OEV A;  5BOD A;  3TUH A;  5BOC A;  4JIZ A;  2FWY A;  2XAB A;  4GQT A;  2YYL A;  2WI5 A;  4W9U A;  3D1I A;  4W7T A;  4L3Y A;  3GIG B;  4NH8 A;  3HWC A;  1XFV A;  1S16 A;  2YI7 A;  4LWI A;  3MPJ A;  2YGF A;  4EGK A;  2PG0 A;  1TH8 A;  3EHG A;  2ZO5 A;  2YE6 A;  3RLP A;  4EMV A;  4Q4U A;  1UYL A;  4U93 A;  1NHI A;  1SIR A;  3A0X A;  5FNC A;  2YYG A;  2Q2E B;  1UY8 A;  2YEB A;  3S5T A;  3HZ1 A;  4CWF A;  2XX2 A;  4XKO A;  4MP7 A;  1Z5C A;  2WI2 A;  1UYH A;  1YC1 A;  2PNR A;  4FF1 A;  4JEK A;  2BSM A;  2IOQ A;  1QZR A;  3Q22 A;  4H85 A;  4CWR A;  5K3H A;  1I58 A;  3Q23 A;  1RP3 A;  4H81 A;  3C3L A;  1EGD A;  4XTJ A;  3U2K A;  1Y8P A;  2HG1 A;  2VCI A;  4O04 A;  1Z5A A;  2Q8F A;  1ZXN A;  3LG1 A;  2VCJ A;  2JKI A;  3BNJ A;  2YGA A;  2YEI A;  4CWN A;  4MBC A;  3ZKD A;  4U83 A;  2Q8H A;  3VHC A;  5F5R A;  4JAV A;  2HJN A;  2QF6 A;  5IDJ A;  3EOM A;  1UYI A;  5JEN A;  4Q17 A;  4BXI A;  1U2O A;  1XFU A;  4HKR A;  4HXZ A;  3IED A;  4BIU A;  2VF1 A;  1YER A;  4CE2 A;  1AJ6 A;  1B62 A;  2BU7 A;  4KS9 A;  4LP0 A;  1AM1 A;  4XDM A;  3LGQ A;  3OWA A;  2RDZ A;  1Z59 A;  2ZKJ A;  1EI1 A;  2VIG A;  5M4K A;  1NHJ A;  3B24 A;  2GFD A;  4AKI A;  3QTF A;  4HY6 A;  2XDX A;  1Y4U A;  4RM7 A;  1I5B A;  2H8M A;  2YJW A;  4XIT A;  4EFU A;  4AWP A;  3RLR A;  3C0E A;  1IXM A;  2WER A;  5M4M A;  4LWH A;  5K3G A;  2EBH X;  2D29 A;  2GBB A;  2J7A A;  5B5V A;  1UYK A;  1X91 A;  4HYM A;  4XIQ A;  1BUC A;  2WEP A;  3CWV A;  4GCZ A;  4JQL A;  4XE2 A;  1UYF A;  4AWO A;  1YT1 A;  3LPS A;  4XCJ A;  3CGZ A;  2BRC A;  3VKG A;  2IX5 A;  3U67 A;  1R2J A;  4XKA A;  3L1T A;  4PRV A;  5D6P A;  4G5E A;  1US7 A;  2BYI A;  4FCP A;  4R3A A;  5D6Q A;  1BYQ A;  2UWD A;  2XJX A;  2AKP A;  2YYK A;  3MDD A;  3TZ0 A;  4M9A A;  1UY6 A;  1TID A;  4XD8 A;  4U7O A;  5GJV E;  1UYG A;  3D0B A;  4KSG A;  4R3M A;  3D36 A;  2QR4 A;  2YKC A;  4DOY A;  2VWC A;  3PEJ A;  3CRK A;  3H80 A;  2XS8 A;  2XK2 A;  2BU8 A;  2FP2 A;  2FON A;  5K3J A;  3HHU A;  5D7C A;  4AS9 A;  4LWE A;  4MPE A;  4I5S A;  1I59 A;  4KTO A;  4ZVI A;  5C93 A;  1UKW A;  3D9D A;  3OW6 A;  4MP2 A;  4MB9 A;  4HZ0 A;  4PU9 A;  3OIB A;  2IWU A;  2YE2 A;  4MOT A;  2DDH A;  1YT2 A;  2YI6 A;  4JIO A;  4X28 C;  4FMT A;  3O2F A;  2HCH A;  1OSF A;  2BYH A;  3H4L A;  3LMM A;  5CPH A;  2R03 A;  2XQR B;  2YYI A;  3LNU A;  1MX0 A;  2ESA A;  2Q8I A;  4QIC A;  3HYZ A;  2YKB A;  2E80 A;  4IV6 A;  1AMW A;  2BTZ A;  1XFZ A;  4E00 A;  4YKY A;  2YE9 A;  1FS7 A;  2R02 A;  2REH A;  5J6A A;  2ZDY A;  3R91 A;  3T0H A;  1YET A;  2XX5 A;  4KTN A;  1Z5B A;  4BQJ A;  2E81 A;  4MPC A;  3RKZ A;  2YE3 A;  2O1W A;  2XJG A;  3GIE A;  4PL9 A;  3EKO A;  4FZ4 A;  1IVH A;  3T0Z A;  2C0U A;  3Q0A A;  2XHT A;  1Y0V A;  2OEX A;  4L1F A;  3D9G A;  1TIL A;  4N5F A;  1Y8O A;  2JJC A;  4LPB A;  2YEF A;  3CGY A;  4QPK A;  1UYM A;  3T10 A;  4URN A;  1YC4 A;  3Q5J A;  1BKN A;  2FTK A;  2QG2 A;  4FCR A;  2OT4 A;  4KP4 A;  4KFG A;  5BRK A;  3GNC A;  4WUD A;  2WI7 A;  5FNF A;  3F29 A;  2AO2 A;  2AZE A;  1GJV A;  3BNH A;  4ASF A;  3NF4 A;  3ZXO A;  3TZ2 A;  1TC6 A;  4AKG A;  5CTX A;  5CTU A;  3AFF A;  2WI1 A;  2XDU A;  3Q5K A;  4LWF A;  5L3J A;  4O07 A;  1I5C A;  4Q20 A;  3D9F A;  4CE3 A;  3A0T A;  5GGZ A;  4HZ5 A;  1I5D A;  3R4P A;  4BQG A;  4DUH A;  2CH4 A;  4QPJ A;  3MPI A;  3X29 A;  4H7Q A;  2XDS A;  1UYE A;  4GFN A;  2K5B A;  2Z1Q A;  2IWS A;  2CCS A;  3A0Z A;  3T1K A;  1UYC A;  2XHX A;  5D7R A;  4V26 A;  3MNR P;  2CG9 A;  2YYJ A;  3U2D A;  4ZKI A;  1ZWH A;  2YE8 A;  2YE5 A;  3M9V A;  2XJJ A;  4NH7 A;  4FF3 A;  4E72 A;  2YJX A;  1S14 A;  3VKH A;  1B63 A;  3A0W A;  1B3Q A;  3OMU A;  3R92 A;  3HEK A;  4P8O A;  2XS1 A;  1K93 A;  3ZM7 A;  3BM9 A;  1QDB A;  5IDM A;  2F6L A;  3FO3 A;  5BRM A;  2C1I A;  4MPN A;  1UY7 A;  2BT0 A;  1JQI A;  4AI6 A;  3CYG A;  4XIR A;  2WI6 A;  2BU2 A;  4KSA A;  3GQT A;  4P7A A;  2C2A A;  4E01 A;  2YK9 A;  1RJ4 A;  1BGQ A;  5K3I A;  4L8Z A;  1R3B A;  2EBF X;  2UXW A;  2IX6 A;  2OR0 A;  3KE6 A;  1BXD A;  4ASB A;  4XCL A;  2YEE A;  3UU9 A;  3N0R A;  2FP1 A;  1K90 A;  4YKR A;  1Y8N A;  3O6O A;  4Q1O A;  2EC5 A;  4CE1 A;  2FYP A;  4CWS A;  3K98 A;  1ZW9 A;  2XDL A;  1H7S A;  3ZXQ A;  2YE7 A;  2O1U A;  1U0Z A;  1YSZ A;  4L93 A;  3ZKB A;  4Q5C A;  3WQ9 A;  4CWP A;  1YSR A;  4FCQ A;  1XFW A;  5GJW E;  1IS2 A;  2CX9 A;  3C2P A;  1KZN A;  3TTB A;  4BIZ A;  1UDY A;  3SCE A;  4FPP A;  4GEE A;  3FV5 A;  3QDD A;  4L91 A;  4I3H A;  5M4H A;  4O09 A;  3BMY A;  4L38 A;  4LQS B;  3MMO A;  4L3Z A;  4O5M A;  4KSF A;  4V25 A;  3EHF A;  2YEA A;  4NH9 A;  4L3X A;  4NXL A;  1GU6 A;  4XVX A;  3X0X A;  2HHI A;  2YK2 A;  1YC3 A;  4YKU A;  5CF0 A;  5B5W A;  1S26 A;  2R0N A;  2WBI A;  5CTW A;  3NMQ A;  5IN9 A;  4DZY A;  4XIP A;  1SC5 A;  2R05 A;  2XD6 A;  2YI5 A;  3HZ5 A;  4JAS A;  2XHR A;  5FWK A;  5CTY A;  2YI0 A;  2FXS A;  4PRX A;  3R7K A;  2VR0 A;  1ZXM A;  1EGC A;  2C12 A;  1QY8 A;  5M4E A;  2CJ6 A;  2FWZ A;  1TBW A;  2IOR A;  4CWT A;  4P13 A;  3B96 A;  2O1V A;  3CRL A;  2BZ5 A;  3BNG A;  1PI1 A;  2RFQ A;  2YED A;  3VHA A;  2C1G A;  3Q5L A;  5FND A;  4J1V A;  1QYE A;  1YS3 A;  3D2R A;  1XFY A;  3D9E A;  4OO2 A;  4YKZ A;  3SL2 A;  5J71 A;  5M4N A;  2YEH A;  3FT5 A;  3JZ3 A;  3EHH A;  1OAH A;  2OJQ A;  3G75 A;  4AKH A;  3OWD A;  2EBA A;  3DGE A;  3G7B A;  4ZYJ A;  3WHA A;  3OPD A;  2XX4 A;  4YKW A;  1NHH A;  3VHD A;  1YES A;  2PO4 A;  4K4O A;  2IOP A;  3K99 A;  4ASA A;  4B7P A;  4EGH A;  2CCT A;  4URL A;  3INX A;  3VAD A;  1A4H A;  3RKH A;  2WEQ A;  3GIG A;  3UBR A;  1MU5 A;  2ZAF A;  2JBT A;  1FS9 A;  3EON A;  4F0X A;  3SF6 A;  2IWX A;  2XCM A;  3KML A;  4GGL A;  3G7E A;  4O0B A;  3AFE A;  4XKK A;  3X0Y A;  1RX0 A;  1GKX A;  1LVC A;  2GQP A;  2YEC A;  1SIQ A;  1H7U A;  3B25 A;  1XFX A;  1X90 A;  2QG0 A;  1L0O A;  3S7W A;  3INW A;  2CJ8 A;  2JBS A;  2BU6 A;  4FF4 A;  3P4T A;  2HKJ A;  1TC0 A;  2YKE A;  3II9 A;  3B28 A;  3A0R A;  4EEH A;  4HYP A;  1F51 A; 
#chains in the Genus database with same CATH homology
 2YE4 A;  4X9L A;  4CWQ A;  4EGI A;  4U7N A;  3A0Y A;  4B6C A;  3EHJ A;  4BAE A;  4E02 A;  4URO A;  4HXW A;  4KSH A;  4YKT A;  4WUC A;  2YGE A;  3K97 A;  3TZ4 A;  1EA6 A;  4EFT A;  3R4M A;  4YKQ A;  4AWQ A;  4KQV A;  1GKZ A;  3K60 A;  3T2S A;  5D7D A;  1YT0 A;  2CGF A;  3GIF A;  4JAU A;  4EM7 A;  3PEH A;  2VW5 A;  5F3K A;  2WI4 A;  4L90 A;  5M4P A;  3B26 A;  3FT8 A;  2BU5 A;  2XDK A;  1ID0 A;  2ZDX A;  2QFO A;  3RLQ A;  3B27 A;  4L94 A;  4CWO A;  4GT8 A;  4LWG A;  4R1F A;  2WI3 A;  2YKJ A;  3O0I A;  4XC0 A;  2CCU A;  2E0A A;  4HY1 A;  1KIJ A;  1UYD A;  2BRE A;  3R4O A;  1PVG A;  3HYY A;  2YKI A;  1R62 A;  2YEJ A;  2YEG A;  3OWB A;  3R4N A;  2ZBK B;  4YKX A;  4WUB A;  2H55 A;  1JM6 A;  3TZ5 A;  1AH6 A;  4O05 A;  3TTZ A;  1I5A A;  1AH8 A;  3C11 A;  1Y4S A;  1THN A;  2Q8G A;  1UY9 A;  4URM A;  2EXL A;  4ASG A;  3EKR A;  5BOD A;  3TUH A;  5BOC A;  2FWY A;  2XAB A;  4GQT A;  2WI5 A;  4W7T A;  3GIG B;  4NH8 A;  1S16 A;  2YI7 A;  4LWI A;  2YGF A;  4EGK A;  1TH8 A;  3EHG A;  2YE6 A;  3RLP A;  4EMV A;  1UYL A;  4U93 A;  1NHI A;  3A0X A;  5FNC A;  2Q2E B;  1UY8 A;  2YEB A;  3HZ1 A;  4CWF A;  2XX2 A;  4XKO A;  4MP7 A;  1Z5C A;  2WI2 A;  1UYH A;  1YC1 A;  2PNR A;  2IOQ A;  2BSM A;  1QZR A;  4H85 A;  4CWR A;  1I58 A;  3U2K A;  4H81 A;  4XTJ A;  1Y8P A;  2HG1 A;  2VCI A;  4O04 A;  1Z5A A;  2Q8F A;  1ZXN A;  2VCJ A;  2JKI A;  2YGA A;  2YEI A;  4CWN A;  4MBC A;  3ZKD A;  2Q8H A;  3VHC A;  5F5R A;  4JAV A;  2QF6 A;  5IDJ A;  1UYI A;  4BXI A;  1U2O A;  4HXZ A;  3IED A;  4BIU A;  4CE2 A;  1YER A;  1AJ6 A;  1B62 A;  2BU7 A;  4LP0 A;  1AM1 A;  4XDM A;  1Z59 A;  2ZKJ A;  1EI1 A;  5M4K A;  1NHJ A;  3B24 A;  2GFD A;  3QTF A;  4HY6 A;  2XDX A;  1Y4U A;  1I5B A;  2H8M A;  2YJW A;  4XIT A;  4EFU A;  4AWP A;  3RLR A;  3C0E A;  2WER A;  5M4M A;  4LWH A;  1UYK A;  4HYM A;  4XIQ A;  2WEP A;  3CWV A;  4GCZ A;  4JQL A;  4XE2 A;  1UYF A;  4AWO A;  1YT1 A;  3LPS A;  4XCJ A;  3CGZ A;  2BRC A;  3U67 A;  4XKA A;  4PRV A;  5D6P A;  1US7 A;  4FCP A;  2BYI A;  4R3A A;  5D6Q A;  1BYQ A;  2UWD A;  2XJX A;  2AKP A;  3TZ0 A;  1UY6 A;  4XD8 A;  1TID A;  4U7O A;  1UYG A;  3D0B A;  4KSG A;  4R3M A;  3D36 A;  2YKC A;  2VWC A;  3PEJ A;  3CRK A;  3H80 A;  2XK2 A;  2BU8 A;  3HHU A;  5D7C A;  4AS9 A;  4LWE A;  4MPE A;  4I5S A;  1I59 A;  4ZVI A;  5C93 A;  3OW6 A;  4MP2 A;  4MB9 A;  4HZ0 A;  4PU9 A;  2IWU A;  2YE2 A;  4MOT A;  1YT2 A;  2YI6 A;  4FMT A;  3O2F A;  2HCH A;  1OSF A;  2BYH A;  3H4L A;  5CPH A;  3LNU A;  1MX0 A;  2ESA A;  2Q8I A;  3HYZ A;  2YKB A;  1AMW A;  2BTZ A;  4E00 A;  4YKY A;  2YE9 A;  5J6A A;  2ZDY A;  3R91 A;  3T0H A;  1YET A;  2XX5 A;  4KTN A;  1Z5B A;  4BQJ A;  4MPC A;  3RKZ A;  2YE3 A;  2O1W A;  2XJG A;  3GIE A;  4PL9 A;  3EKO A;  3T0Z A;  2XHT A;  1TIL A;  4LPB A;  1Y8O A;  2JJC A;  4QPK A;  2YEF A;  3CGY A;  3T10 A;  1UYM A;  4URN A;  1YC4 A;  3Q5J A;  1BKN A;  2QG2 A;  4FCR A;  4KP4 A;  4KFG A;  4WUD A;  2WI7 A;  5FNF A;  1GJV A;  4ASF A;  3ZXO A;  3TZ2 A;  1TC6 A;  5CTX A;  5CTU A;  2WI1 A;  2XDU A;  3Q5K A;  4LWF A;  5L3J A;  4O07 A;  1I5C A;  4Q20 A;  4CE3 A;  3A0T A;  5GGZ A;  4HZ5 A;  1I5D A;  3R4P A;  4BQG A;  4DUH A;  2CH4 A;  4QPJ A;  4H7Q A;  2XDS A;  1UYE A;  4GFN A;  2K5B A;  2IWS A;  2CCS A;  3A0Z A;  3T1K A;  1UYC A;  2XHX A;  5D7R A;  4V26 A;  3MNR P;  2CG9 A;  3U2D A;  4ZKI A;  1ZWH A;  2YE8 A;  2YE5 A;  2XJJ A;  4NH7 A;  2YJX A;  1S14 A;  1B63 A;  3A0W A;  1B3Q A;  3OMU A;  3R92 A;  3HEK A;  4P8O A;  3ZM7 A;  3BM9 A;  5IDM A;  4MPN A;  1UY7 A;  2BT0 A;  4XIR A;  2WI6 A;  2BU2 A;  4P7A A;  2C2A A;  4E01 A;  2YK9 A;  1BGQ A;  4L8Z A;  3KE6 A;  1BXD A;  4ASB A;  4XCL A;  2YEE A;  4YKR A;  1Y8N A;  3O6O A;  4CE1 A;  2FYP A;  4CWS A;  3K98 A;  1ZW9 A;  2XDL A;  1H7S A;  3ZXQ A;  2YE7 A;  2O1U A;  1U0Z A;  1YSZ A;  4L93 A;  3ZKB A;  3WQ9 A;  4CWP A;  4FCQ A;  1YSR A;  1KZN A;  4BIZ A;  4FPP A;  4GEE A;  3FV5 A;  3QDD A;  4L91 A;  4I3H A;  5M4H A;  4O09 A;  3BMY A;  4V25 A;  3EHF A;  2YEA A;  4NH9 A;  4YKU A;  5CF0 A;  2YK2 A;  1YC3 A;  5CTW A;  3NMQ A;  5IN9 A;  4DZY A;  4XIP A;  2XD6 A;  2YI5 A;  3HZ5 A;  4JAS A;  2XHR A;  5FWK A;  5CTY A;  2YI0 A;  2FXS A;  4PRX A;  1ZXM A;  1QY8 A;  5M4E A;  2FWZ A;  2IOR A;  1TBW A;  4CWT A;  2O1V A;  3CRL A;  2BZ5 A;  3VHA A;  2YED A;  3Q5L A;  5FND A;  1QYE A;  1YS3 A;  3D2R A;  4YKZ A;  3SL2 A;  5J71 A;  5M4N A;  2YEH A;  3FT5 A;  3JZ3 A;  3EHH A;  3G75 A;  3OWD A;  3DGE A;  3G7B A;  3WHA A;  3OPD A;  2XX4 A;  4YKW A;  1NHH A;  3VHD A;  1YES A;  4K4O A;  2IOP A;  3K99 A;  4ASA A;  4B7P A;  4EGH A;  2CCT A;  4URL A;  3INX A;  3VAD A;  1A4H A;  2WEQ A;  3GIG A;  1MU5 A;  2IWX A;  2XCM A;  4GGL A;  3G7E A;  4O0B A;  4XKK A;  1GKX A;  2GQP A;  2YEC A;  1H7U A;  3B25 A;  2QG0 A;  1L0O A;  3INW A;  2BU6 A;  2HKJ A;  1TC0 A;  2YKE A;  3B28 A;  3A0R A;  4EEH A;  4HYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...