2Q8HA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with dichloroacetate (dca)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
383
structure length
365
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSCEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNADDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 122
structure length 365
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8hA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8hA02
2UWDA 4CWFA 2WEPA 2YKCA 3NMQA 4HYPA 4YKYA 5CF0A 2WI6A 3RLRA 4XTJA 3CRLA 1YERA 2BU2A 4XIRA 4URMA 4EGHA 3JZ3A 3VHAA 3WHAA 2BYHA 2Q8FA 2XD6A 4BQJA 3TZ5A 2O1VA 1Y8OA 4XIQA 2HG1A 2BT0A 2YE5A 4CWQA 3B24A 4AWQA 4GEEA 2QG0A 1UYCA 2FWZA 3C11A 4LWFA 4HY1A 3GIEA 4H81A 1I5AA 2BU7A 4PL9A 3IEDA 1L0OA 4L91A 2WI3A 1YSZA 2YE2A 2IWSA 3EHJA 1UYFA 4EMVA 3INWA 1EI1A 4FPPA 4H85A 4P8OA 4MOTA 2YJXA 4MPNA 2H8MA 1YESA 2ZKJA 2IWXA 4L94A 2BU6A 1TC0A 2IORA 4BIUA 2XX2A 2YEBA 2O1WA 2K5BA 3CGZA 4MPCA 2YEEA 1Z59A 1QYEA 4XKKA 4EM7A 2QF6A 1S14A 3HYYA 2WI7A 1I58A 1GJVA 4UROA 1H7UA 2XDXA 2YECA 4BQGA 2WI5A 3K99A 3R92A 5F5RA 2CH4A 4O05A 4LPBA 3D36A 5C93A 3T0HA 4MPEA 2YJWA 4NH8A 2FXSA 3R4NA 3Q5JA 3O2FA 1B63A 3SL2A 1I5DA 1I5CA 3EHHA 4AS9A 3KE6A 1UYIA 3OWDA 2YI5A 3O6OA 1S16A 4EFUA 4DUHA 4XE2A 2CGFA 1YT1A 1ZXNA 4QPKA 2E0AA 3TTZA 3T0ZA 4LWEA 2YE4A 4R3MA 4YKUA 3HZ1A 4GQTA 2YI6A 4P7AA 1BYQA 3WQ9A 4JQLA 1NHHA 4R3AA 4EGIA 3D2RA 3D0BA 1BKNA 3U67A 4PRXA 2C2AA 1YSRA 5F3KA 1YC4A 2WI1A 3FV5A 2IOPA 4XCLA 5FWKA 3EHGA 3EKOA 4WUCA 2XJGA 4HZ0A 4GT8A 1TILA 1UY9A 1TH8A 2YGAA 1UYGA 4E02A 5IDJA 4NH7A 3QDDA 2IWUA 4HZ5A 2Q8IA 4B7PA 1NHJA 1YC3A 5M4MA 2ESAA 4U7OA 4WUBA 1JM6A 1KIJA 3G7BA 2EXLA 1H7SA 3U2DA 2PNRA 3OW6A 3RLPA 1BGQA 2CG9A 2XHXA 1R62A 5J71A 3U2KA 5IN9A 2YI7A 2YK2A 3B27A 3K97A 3H4LA 3T2SA 1MU5A 3CWVA 2QFOA 4EGKA 5D7RA 4Q20A 4X9LA 1THNA 4NH9A 5M4EA 2YKJA 5M4NA 2GFDA 1TIDA 1QZRA 1YT2A 4FMTA 4EFTA 2QG2A 3ZKBA 2BRCA 2YK9A 4CE1A 3T10A 4WUDA 3TUHA 1GKXA 1UYKA 4GGLA 3O0IA 2Q8GA 3EKRA 2IOQA 3A0TA 4LWGA 4E01A 2XCMA 5CTXA 4KSGA 4ZVIA 4I3HA 1Y8NA 5FNFA 4KSHA 5FNDA 4KQVA 5IDMA 4XKOA 3A0WA 5L3JA 2YEDA 1YETA 4L8ZA 2O1UA 2BSMA 4QPJA 2YEHA 3K60A 2BREA 3BMYA 4BIZA 1B62A 1MX0A 1AH6A 5M4KA 1I59A 4URNA 3R4OA 2YGFA 1UYDA 5D6QA 2YEFA 4O07A 1Y4UA 2JKIA 3LPSA 1ID0A 1TBWA 3B26A 1BXDA 3G75A 4B6CA 4ZKIA 3PEJA 3VHCA 3VHDA 2YE6A 4FCQA 5D6PA 3PEHA 2YEJA 4W7TA 4XDMA 5GGZA 4LWHA 3FT5A 1AH8A 4XCJA 4O04A 2XDSA 1YT0A 1UY6A 2YGEA 2GQPA 2YE3A 2YE9A 4XC0A 3A0XA 2VCIA 1UYMA 4JAVA 2Q2EB 2XK2A 2YKIA 3R4PA 4GCZA 4L93A 3R4MA 3BM9A 3Q5KA 4JAUA 1ZWHA 1Z5CA 5M4HA 3T1KA 3FT8A 4O0BA 3INXA 4CWTA 3C0EA 5CTUA 4ASGA 2XDUA 2BTZA 1NHIA 2YKBA 1AM1A 2AKPA 4ASBA 2JJCA 3ZXOA 5BOCA 1A4HA 3Q5LA 4HYMA 2BU8A 4FCPA 3CRKA 4YKRA 4O09A 4CE3A 3A0ZA 1UY7A 2XJXA 2BU5A 4BXIA 2ZBKB 2FYPA 3HZ5A 1US7A 4MB9A 4MP2A 4LP0A 3H80A 4R1FA 1UY8A 3B25A 1GKZA 3TZ4A 4U93A 3RLQA 2HCHA 4CWPA 3GIFA 3TZ0A 1YS3A 3OWBA 5J6AA 2XDKA 3GIGA 4AWOA 3GIGB 4I5SA 2YEIA 2YI0A 3K98A 4V26A 4KP4A 4AWPA 1AJ6A 3OMUA 2WEQA 1TC6A 1Z5BA 2XX5A 2YE7A 5D7CA 5BODA 4ASFA 4URLA 4XKAA 2XJJA 1ZW9A 4JASA 3EHFA 4L90A 2XX4A 1PVGA 2CCUA 5CPHA 1Y8PA 4BAEA 2YEGA 4CWOA 4V25A 3ZXQA 1AMWA 2CCSA 4E00A 2WERA 3CGYA 3HHUA 4XITA 1UYLA 4U7NA 4LWIA 5FNCA 2XABA 3QTFA 4YKTA 3MNRP 2XHTA 3OPDA 2VW5A 5D7DA 3TZ2A 2XDLA 2VWCA 3A0YA 3B28A 1UYHA 2BZ5A 2CCTA 4EEHA 2YEAA 4HXWA 1Z5AA 1QY8A 4KFGA 4XD8A 3ZKDA 4ASAA 1YC1A 4HY6A 4CWRA 4YKXA 2YKEA 1UYEA 4PU9A 1KZNA 1U0ZA 2FWYA 1OSFA 2VCJA 4YKQA 1ZXMA 4HXZA 4H7QA 2ZDXA 3DGEA 4DZYA 1B3QA 5M4PA 2HKJA 3A0RA 1EA6A 1I5BA 2XHRA 2WI2A 2Q8HA 2H55A 3G7EA 3ZM7A 3LNUA 3RKZA 4K4OA 3HEKA 2ZDYA 4CWSA 4CE2A 1U2OA 4XIPA 2BYIA 4KTNA 3VADA 3R91A 5CTWA 4FCRA 4YKWA 5CTYA 4PRVA 4MP7A 4GFNA 2YE8A 4MBCA 2WI4A 1Y4SA 4CWNA 3HYZA 4YKZA
chains in the Genus database with same CATH superfamily
2UWDA 1LVCA 1SIRA 4CWFA 3SXQA 2CX9A 3MDEA 2WEPA 2YKCA 3NMQA 4HYPA 4NXLA 4YKYA 1UDYA 5CF0A 5K3IA 4Q4UA 2AZEA 2WI6A 4HKSA 3X0YA 3RLRA 4XTJA 3CRLA 1YERA 2BU2A 4XIRA 3EOMA 4URMA 4EGHA 2EBHX 3NF4A 3JZ3A 3VHAA 2C1GA 3WHAA 2BYHA 2FONA 2Q8FA 2XD6A 4BQJA 3TZ5A 4KSFA 3Q23A 2O1VA 1Y8OA 1U8VA 4XIQA 2VF1A 2HG1A 2BT0A 2YE5A 4CWQA 3B24A 3GM6A 4AWQA 4GEEA 2QG0A 1UYCA 2FWZA 2JBTA 1K90A 3C11A 1K8TA 3BNGA 4XVXA 4LWFA 4HY1A 4RM7A 3TTBA 3GIEA 4H81A 5BRKA 1I5AA 4FF3A 2BU7A 4PL9A 3IEDA 1L0OA 4L91A 2WI3A 1YSZA 2YE2A 2IWSA 3EHJA 1UYFA 4EMVA 3INWA 1EI1A 4FPPA 4H85A 4P8OA 3P4TA 4MOTA 3MMOA 2REHA 2YJXA 1XFYA 4MPNA 1YESA 1T9GA 2H8MA 2ZKJA 4L38A 2IWXA 2YYJA 4L94A 2BU6A 1TC0A 2IORA 4BIUA 2UXWA 1PK0A 2XX2A 3FO3A 2YEBA 2O1WA 2K5BA 3CGZA 4MPCA 2YEEA 1Z59A 1EGDA 1BUCA 1QYEA 4XKKA 2CJ5A 3MPJA 4EM7A 2QF6A 1S14A 3HYYA 2WI7A 4E72A 3Q24A 1I58A 3M9VA 1XFZA 1GJVA 1Y0VA 1H7UA 4UROA 2XDXA 2YECA 4BQGA 2F6LA 2WI5A 3K99A 3SF6A 2R0MA 3R92A 5F5RA 2CH4A 4O05A 4LPBA 3OWAA 2JBSA 3D36A 2OR0A 3D9EA 5C93A 3T0HA 4MPEA 2YJWA 4NH8A 2FXSA 4L3ZA 3R4NA 3Q5JA 3O2FA 1B63A 1SK6A 3SL2A 3VKGA 2C1IA 3L1TA 4JIOA 1I5DA 1I5CA 3EHHA 4AS9A 3KE6A 1UYIA 4X28A 3OWDA 3F29A 3PFDA 3C46A 2YI5A 3O6OA 1S16A 4EFUA 4DUHA 4XE2A 2CGFA 1YT1A 1ZXNA 4QPKA 2E0AA 3TTZA 2DDHA 4LWEA 2YE4A 3T0ZA 2FP2A 4R3MA 4DOYA 2PG0A 4YKUA 3HZ1A 4GQTA 2YI6A 4P7AA 4FF4A 1BYQA 3VKHA 3WQ9A 3UU9A 4JQLA 1NHHA 4F0XA 4R3AA 1FS9A 2HJNA 2LFWA 4EGIA 3D2RA 3D0BA 1BKNA 2AO2A 3U67A 4PRXA 5JENA 2C2AA 1YSRA 5F3KA 1YC4A 2YYIA 2WI1A 3B96A 3FV5A 2IOPA 2R0NA 3HWCA 4XCLA 5FWKA 3EHGA 3EKOA 4WUCA 2XJGA 4HZ0A 4GT8A 3RKHA 3N0RA 1IXMA 1TILA 1UY9A 1TH8A 2YGAA 1UYGA 4E02A 5IDJA 4NH7A 2XS8A 3QDDA 4ZYJA 2IWUA 4HZ5A 2Q8IA 4B7PA 1NHJA 1YC3A 5M4MA 2R05A 3Q22A 1RJ4A 4P79A 5B6BA 2ESAA 4U7OA 4WUBA 1JM6A 3CE2A 1KIJA 3G7BA 2EXLA 4Q1OA 1H7SA 3U2DA 1S26A 2PNRA 2OEXA 2J7AA 1SC5A 3OW6A 3RLPA 4J1VA 3X29A 3SWOA 1BGQA 2CG9A 2XHXA 3S5TA 1R62A 3AFFA 5J71A 3U2KA 5IN9A 3CYGA 2YI7A 2YK2A 1RX0A 2R02A 5BRMA 3LMMA 3B27A 3K97A 3MXLA 3H4LA 3T2SA 1MU5A 3CWVA 2YYLA 2QFOA 4EGKA 5D7RA 2C0UA 4Q20A 4X9LA 1THNA 4NH9A 4LQSB 5B5VA 5M4EA 2IX5A 2YKJA 5M4NA 4KSAA 2YYGA 2GFDA 1TIDA 1QZRA 1YT2A 4FMTA 4EFTA 2QG2A 3ZKBA 2BRCA 4JEKA 3EONA 1XFWA 2YK9A 4HR3A 4CE1A 2QR4A 3T10A 4WUDA 3TUHA 1GKXA 4CWNA 4G97A 4KCFA 1UYKA 4GGLA 3O0IA 3BNHA 2Q8GA 3EKRA 2IOQA 1GU6A 3A0TA 2YYKA 4LWGA 4E01A 2XCMA 2RFQA 5CTXA 4Q5CA 1FS8A 4KSGA 4ZVIA 4I3HA 1Y8NA 3R7KA 1K93A 5FNFA 4KSHA 5K3JA 1R2JA 4KQVA 5FNDA 5IDMA 4XKOA 3D1IA 3A0WA 5L3JA 3LGQA 2A1TA 2YEDA 1YETA 3D9GA 4IV6A 4L8ZA 2O1UA 2RDZA 2BSMA 4QPJA 4FZ4A 2YEHA 2BREA 3OIBA 3BMYA 3K60A 2JBRA 4BIZA 1B62A 1MX0A 1EGCA 4N5FA 2E80A 1AH6A 5M4KA 1I59A 4URNA 3R4OA 2YGFA 4G5EA 1UYDA 1X8ZA 4Q17A 1EGEA 2JIFA 3SCEA 4JIZA 5D6QA 2YEFA 4O07A 3AFEA 1Y4UA 2JKIA 2VIGA 3LPSA 4L3YA 4Q5BA 1ID0A 1TBWA 3B26A 1BXDA 1JQIA 3G75A 4AKIA 4B6CA 4ZKIA 3PEJA 1IVHA 3VHCA 1IS2A 4LQQB 3VHDA 2EC5A 2EBAA 2YE6A 2FP1A 4FCQA 4KS9A 5D6PA 3PEHA 2YEJA 4W7TA 4M9AA 2PO4A 4XDMA 5GGZA 2E81A 4LWHA 3FT5A 1AH8A 4XCJA 3MKHA 4OO2A 4O04A 2XDSA 1YT0A 1UY6A 2YGEA 3MDDA 2GQPA 2YE3A 2YE9A 4XC0A 3A0XA 5K3GA 2VCIA 1UYMA 4JAVA 2Q2EB 2XK2A 2YKIA 3R4PA 4GCZA 4L93A 3C3LA 3GNCA 3R4MA 3BM9A 3Q5KA 4JAUA 4O5MA 1ZWHA 1Z5CA 5M4HA 3T1KA 2GBBA 1RP3A 3FT8A 4O0BA 3INXA 3MPIA 4CWTA 3D9DA 3C0EA 5CTUA 4ASGA 2XDUA 2BTZA 1NHIA 2YKBA 1AM1A 2AKPA 3FCJA 4ASBA 1QDBA 2JJCA 4FF2A 1XFVA 5BOCA 1A4HA 2XQRB 4IRNA 3Q5LA 4HYMA 3ZXOA 2BU8A 1OAHA 3CRKA 4FCPA 2RF7A 3TORA 4YKRA 4O09A 1F51A 4CE3A 3A0ZA 2OT4A 1UY7A 2XJXA 2BU5A 4BXIA 2ZBKB 1X91A 2FYPA 4HKRA 3LG1A 3S7WA 3HZ5A 1US7A 4MB9A 4MP2A 4LP0A 3H80A 3GQTA 4R1FA 1UY8A 3B25A 1GKZA 3TZ4A 2EBFX 2YYMA 4U93A 3UBRA 3RLQA 2HCHA 4U83A 4CWPA 3GIFA 3TZ0A 1YS3A 3OWBA 1X90A 5J6AA 2CJ6A 3C2PA 3BNFA 2XDKA 3GIGA 4QICA 3GIGB 4AWOA 4L3XA 4ZXVA 4I5SA 2ZAFA 2YEIA 2YI0A 3K98A 1XFXA 4V26A 4KP4A 4AWPA 1AJ6A 3OMUA 2WEQA 1TC6A 1XG2B 1Z5BA 2XX5A 3II9A 2YE7A 2DVLA 3D9FA 5D7CA 5BODA 4ASFA 4URLA 4XKAA 3Q0AA 2XJJA 4Q0TA 1ZW9A 4JASA 2OJQA 3EHFA 4X28C 4L90A 1PI1A 2XX4A 1PVGA 2CCUA 5CPHA 2Z1QA 1Y8PA 4BAEA 5GJWE 2YEGA 4CWOA 4V25A 3ZXQA 4AI6A 1AMWA 1R3BA 2CCSA 4E00A 2WERA 3CGYA 3HHUA 4XITA 2OEVA 1UYLA 4U7NA 2CJ7A 4LWIA 2R03A 5FNCA 2FTKA 4W9UA 2XABA 1RJ1A 2VR0A 4L1FA 3QTFA 4YKTA 3BNJA 3MNRP 5B5WA 3KMLA 2XHTA 2IX6A 2YGWA 3OPDA 3D6BA 2VW5A 4WJYA 5D7DA 3TZ2A 2XDLA 2VWCA 2WBIA 1SIQA 5K3HA 3A0YA 3B28A 1UYHA 2XS1A 2BZ5A 2CCTA 4EEHA 2D29A 2YEAA 1XFUA 1Z5AA 4HXWA 1WS9A 1QY8A 4KFGA 4XD8A 3ZKDA 4ASAA 1UKWA 1YC1A 4HY6A 4CWRA 4YKXA 2YKEA 1UYEA 4PU9A 1KZNA 1U0ZA 2C12A 5GJVE 1OSFA 2FWYA 2VCJA 4YKQA 1ZXMA 4HXZA 4AKHA 4H7QA 2ZDXA 4DZYA 4KTOA 1B3QA 5M4PA 2HKJA 3A0RA 3DGEA 1EA6A 1I5BA 2XHRA 2WI2A 2Q8HA 2H55A 3G7EA 3ZM7A 3LNUA 2CJ8A 3OWMA 3RKZA 2CJ4A 2ZO5A 4AKGA 2HHIA 1W07A 3HEKA 2ZDYA 4K4OA 4CWSA 4FF1A 1U2OA 4XIPA 4CE2A 2BYIA 4KTNA 3VADA 3R91A 1FS7A 5CTWA 4FCRA 4YKWA 5CTYA 4PRVA 4MP7A 4GFNA 2YE8A 4MBCA 2WI4A 1Y4SA 4P13A 3X0XA 3HYZA 4YKZA
chains in the Genus database with same CATH topology
2UWDA 4CWFA 2WEPA 2YKCA 3NMQA 4HYPA 4YKYA 5CF0A 2WI6A 3RLRA 4XTJA 3CRLA 1YERA 2BU2A 4XIRA 4URMA 4EGHA 3JZ3A 3VHAA 3WHAA 2BYHA 2Q8FA 2XD6A 4BQJA 3TZ5A 2O1VA 1Y8OA 4XIQA 2HG1A 2BT0A 2YE5A 4CWQA 3B24A 4AWQA 4GEEA 2QG0A 1UYCA 2FWZA 3C11A 4LWFA 4HY1A 3GIEA 4H81A 1I5AA 2BU7A 4PL9A 3IEDA 1L0OA 4L91A 2WI3A 1YSZA 2YE2A 2IWSA 3EHJA 1UYFA 4EMVA 3INWA 1EI1A 4FPPA 4H85A 4P8OA 4MOTA 2YJXA 4MPNA 2H8MA 1YESA 2ZKJA 2IWXA 4L94A 2BU6A 1TC0A 2IORA 4BIUA 2XX2A 2YEBA 2O1WA 2K5BA 3CGZA 4MPCA 2YEEA 1Z59A 1QYEA 4XKKA 4EM7A 2QF6A 1S14A 3HYYA 2WI7A 1I58A 1GJVA 4UROA 1H7UA 2XDXA 2YECA 4BQGA 2WI5A 3K99A 3R92A 5F5RA 2CH4A 4O05A 4LPBA 3D36A 5C93A 3T0HA 4MPEA 2YJWA 4NH8A 2FXSA 3R4NA 3Q5JA 3O2FA 1B63A 3SL2A 1I5DA 1I5CA 3EHHA 4AS9A 3KE6A 1UYIA 3OWDA 2YI5A 3O6OA 1S16A 4EFUA 4DUHA 4XE2A 2CGFA 1YT1A 1ZXNA 4QPKA 2E0AA 3TTZA 3T0ZA 4LWEA 2YE4A 4R3MA 4YKUA 3HZ1A 4GQTA 2YI6A 4P7AA 1BYQA 3WQ9A 4JQLA 1NHHA 4R3AA 4EGIA 3D2RA 3D0BA 1BKNA 3U67A 4PRXA 2C2AA 1YSRA 5F3KA 1YC4A 2WI1A 3FV5A 2IOPA 4XCLA 5FWKA 3EHGA 3EKOA 4WUCA 2XJGA 4HZ0A 4GT8A 1TILA 1UY9A 1TH8A 2YGAA 1UYGA 4E02A 5IDJA 4NH7A 3QDDA 2IWUA 4HZ5A 2Q8IA 4B7PA 1NHJA 1YC3A 5M4MA 2ESAA 4U7OA 4WUBA 1JM6A 1KIJA 3G7BA 2EXLA 1H7SA 3U2DA 2PNRA 3OW6A 3RLPA 1BGQA 2CG9A 2XHXA 1R62A 5J71A 3U2KA 5IN9A 2YI7A 2YK2A 3B27A 3K97A 3H4LA 3T2SA 1MU5A 3CWVA 2QFOA 4EGKA 5D7RA 4Q20A 4X9LA 1THNA 4NH9A 5M4EA 2YKJA 5M4NA 2GFDA 1TIDA 1QZRA 1YT2A 4FMTA 4EFTA 2QG2A 3ZKBA 2BRCA 2YK9A 4CE1A 3T10A 4WUDA 3TUHA 1GKXA 1UYKA 4GGLA 3O0IA 2Q8GA 3EKRA 2IOQA 3A0TA 4LWGA 4E01A 2XCMA 5CTXA 4KSGA 4ZVIA 4I3HA 1Y8NA 5FNFA 4KSHA 5FNDA 4KQVA 5IDMA 4XKOA 3A0WA 5L3JA 2YEDA 1YETA 4L8ZA 2O1UA 2BSMA 4QPJA 2YEHA 3K60A 2BREA 3BMYA 4BIZA 1B62A 1MX0A 1AH6A 5M4KA 1I59A 4URNA 3R4OA 2YGFA 1UYDA 5D6QA 2YEFA 4O07A 1Y4UA 2JKIA 3LPSA 1ID0A 1TBWA 3B26A 1BXDA 3G75A 4B6CA 4ZKIA 3PEJA 3VHCA 3VHDA 2YE6A 4FCQA 5D6PA 3PEHA 2YEJA 4W7TA 4XDMA 5GGZA 4LWHA 3FT5A 1AH8A 4XCJA 4O04A 2XDSA 1YT0A 1UY6A 2YGEA 2GQPA 2YE3A 2YE9A 4XC0A 3A0XA 2VCIA 1UYMA 4JAVA 2Q2EB 2XK2A 2YKIA 3R4PA 4GCZA 4L93A 3R4MA 3BM9A 3Q5KA 4JAUA 1ZWHA 1Z5CA 5M4HA 3T1KA 3FT8A 4O0BA 3INXA 4CWTA 3C0EA 5CTUA 4ASGA 2XDUA 2BTZA 1NHIA 2YKBA 1AM1A 2AKPA 4ASBA 2JJCA 3ZXOA 5BOCA 1A4HA 3Q5LA 4HYMA 2BU8A 4FCPA 3CRKA 4YKRA 4O09A 4CE3A 3A0ZA 1UY7A 2XJXA 2BU5A 4BXIA 2ZBKB 2FYPA 3HZ5A 1US7A 4MB9A 4MP2A 4LP0A 3H80A 4R1FA 1UY8A 3B25A 1GKZA 3TZ4A 4U93A 3RLQA 2HCHA 4CWPA 3GIFA 3TZ0A 1YS3A 3OWBA 5J6AA 2XDKA 3GIGA 4AWOA 3GIGB 4I5SA 2YEIA 2YI0A 3K98A 4V26A 4KP4A 4AWPA 1AJ6A 3OMUA 2WEQA 1TC6A 1Z5BA 2XX5A 2YE7A 5D7CA 5BODA 4ASFA 4URLA 4XKAA 2XJJA 1ZW9A 4JASA 3EHFA 4L90A 2XX4A 1PVGA 2CCUA 5CPHA 1Y8PA 4BAEA 2YEGA 4CWOA 4V25A 3ZXQA 1AMWA 2CCSA 4E00A 2WERA 3CGYA 3HHUA 4XITA 1UYLA 4U7NA 4LWIA 5FNCA 2XABA 3QTFA 4YKTA 3MNRP 2XHTA 3OPDA 2VW5A 5D7DA 3TZ2A 2XDLA 2VWCA 3A0YA 3B28A 1UYHA 2BZ5A 2CCTA 4EEHA 2YEAA 4HXWA 1Z5AA 1QY8A 4KFGA 4XD8A 3ZKDA 4ASAA 1YC1A 4HY6A 4CWRA 4YKXA 2YKEA 1UYEA 4PU9A 1KZNA 1U0ZA 2FWYA 1OSFA 2VCJA 4YKQA 1ZXMA 4HXZA 4H7QA 2ZDXA 3DGEA 4DZYA 1B3QA 5M4PA 2HKJA 3A0RA 1EA6A 1I5BA 2XHRA 2WI2A 2Q8HA 2H55A 3G7EA 3ZM7A 3LNUA 3RKZA 4K4OA 3HEKA 2ZDYA 4CWSA 4CE2A 1U2OA 4XIPA 2BYIA 4KTNA 3VADA 3R91A 5CTWA 4FCRA 4YKWA 5CTYA 4PRVA 4MP7A 4GFNA 2YE8A 4MBCA 2WI4A 1Y4SA 4CWNA 3HYZA 4YKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWD A;  4CWF A;  2WEP A;  2YKC A;  3NMQ A;  4HYP A;  4YKY A;  5CF0 A;  2WI6 A;  3RLR A;  4XTJ A;  3CRL A;  1YER A;  2BU2 A;  4XIR A;  4URM A;  4EGH A;  3JZ3 A;  3VHA A;  3WHA A;  2BYH A;  2Q8F A;  2XD6 A;  4BQJ A;  3TZ5 A;  2O1V A;  1Y8O A;  4XIQ A;  2HG1 A;  2BT0 A;  2YE5 A;  4CWQ A;  3B24 A;  4AWQ A;  4GEE A;  2QG0 A;  1UYC A;  2FWZ A;  3C11 A;  4LWF A;  4HY1 A;  3GIE A;  4H81 A;  1I5A A;  2BU7 A;  4PL9 A;  3IED A;  1L0O A;  4L91 A;  2WI3 A;  1YSZ A;  2YE2 A;  2IWS A;  3EHJ A;  1UYF A;  4EMV A;  3INW A;  1EI1 A;  4FPP A;  4H85 A;  4P8O A;  4MOT A;  2YJX A;  4MPN A;  2H8M A;  1YES A;  2ZKJ A;  2IWX A;  4L94 A;  2BU6 A;  1TC0 A;  2IOR A;  4BIU A;  2XX2 A;  2YEB A;  2O1W A;  2K5B A;  3CGZ A;  4MPC A;  2YEE A;  1Z59 A;  1QYE A;  4XKK A;  4EM7 A;  2QF6 A;  1S14 A;  3HYY A;  2WI7 A;  1I58 A;  1GJV A;  4URO A;  1H7U A;  2XDX A;  2YEC A;  4BQG A;  2WI5 A;  3K99 A;  3R92 A;  5F5R A;  2CH4 A;  4O05 A;  4LPB A;  3D36 A;  5C93 A;  3T0H A;  4MPE A;  2YJW A;  4NH8 A;  2FXS A;  3R4N A;  3Q5J A;  3O2F A;  1B63 A;  3SL2 A;  1I5D A;  1I5C A;  3EHH A;  4AS9 A;  3KE6 A;  1UYI A;  3OWD A;  2YI5 A;  3O6O A;  1S16 A;  4EFU A;  4DUH A;  4XE2 A;  2CGF A;  1YT1 A;  1ZXN A;  4QPK A;  2E0A A;  3TTZ A;  3T0Z A;  4LWE A;  2YE4 A;  4R3M A;  4YKU A;  3HZ1 A;  4GQT A;  2YI6 A;  4P7A A;  1BYQ A;  3WQ9 A;  4JQL A;  1NHH A;  4R3A A;  4EGI A;  3D2R A;  3D0B A;  1BKN A;  3U67 A;  4PRX A;  2C2A A;  1YSR A;  5F3K A;  1YC4 A;  2WI1 A;  3FV5 A;  2IOP A;  4XCL A;  5FWK A;  3EHG A;  3EKO A;  4WUC A;  2XJG A;  4HZ0 A;  4GT8 A;  1TIL A;  1UY9 A;  1TH8 A;  2YGA A;  1UYG A;  4E02 A;  5IDJ A;  4NH7 A;  3QDD A;  2IWU A;  4HZ5 A;  2Q8I A;  4B7P A;  1NHJ A;  1YC3 A;  5M4M A;  2ESA A;  4U7O A;  4WUB A;  1JM6 A;  1KIJ A;  3G7B A;  2EXL A;  1H7S A;  3U2D A;  2PNR A;  3OW6 A;  3RLP A;  1BGQ A;  2CG9 A;  2XHX A;  1R62 A;  5J71 A;  3U2K A;  5IN9 A;  2YI7 A;  2YK2 A;  3B27 A;  3K97 A;  3H4L A;  3T2S A;  1MU5 A;  3CWV A;  2QFO A;  4EGK A;  5D7R A;  4Q20 A;  4X9L A;  1THN A;  4NH9 A;  5M4E A;  2YKJ A;  5M4N A;  2GFD A;  1TID A;  1QZR A;  1YT2 A;  4FMT A;  4EFT A;  2QG2 A;  3ZKB A;  2BRC A;  2YK9 A;  4CE1 A;  3T10 A;  4WUD A;  3TUH A;  1GKX A;  1UYK A;  4GGL A;  3O0I A;  2Q8G A;  3EKR A;  2IOQ A;  3A0T A;  4LWG A;  4E01 A;  2XCM A;  5CTX A;  4KSG A;  4ZVI A;  4I3H A;  1Y8N A;  5FNF A;  4KSH A;  5FND A;  4KQV A;  5IDM A;  4XKO A;  3A0W A;  5L3J A;  2YED A;  1YET A;  4L8Z A;  2O1U A;  2BSM A;  4QPJ A;  2YEH A;  3K60 A;  2BRE A;  3BMY A;  4BIZ A;  1B62 A;  1MX0 A;  1AH6 A;  5M4K A;  1I59 A;  4URN A;  3R4O A;  2YGF A;  1UYD A;  5D6Q A;  2YEF A;  4O07 A;  1Y4U A;  2JKI A;  3LPS A;  1ID0 A;  1TBW A;  3B26 A;  1BXD A;  3G75 A;  4B6C A;  4ZKI A;  3PEJ A;  3VHC A;  3VHD A;  2YE6 A;  4FCQ A;  5D6P A;  3PEH A;  2YEJ A;  4W7T A;  4XDM A;  5GGZ A;  4LWH A;  3FT5 A;  1AH8 A;  4XCJ A;  4O04 A;  2XDS A;  1YT0 A;  1UY6 A;  2YGE A;  2GQP A;  2YE3 A;  2YE9 A;  4XC0 A;  3A0X A;  2VCI A;  1UYM A;  4JAV A;  2Q2E B;  2XK2 A;  2YKI A;  3R4P A;  4GCZ A;  4L93 A;  3R4M A;  3BM9 A;  3Q5K A;  4JAU A;  1ZWH A;  1Z5C A;  5M4H A;  3T1K A;  3FT8 A;  4O0B A;  3INX A;  4CWT A;  3C0E A;  5CTU A;  4ASG A;  2XDU A;  2BTZ A;  1NHI A;  2YKB A;  1AM1 A;  2AKP A;  4ASB A;  2JJC A;  3ZXO A;  5BOC A;  1A4H A;  3Q5L A;  4HYM A;  2BU8 A;  4FCP A;  3CRK A;  4YKR A;  4O09 A;  4CE3 A;  3A0Z A;  1UY7 A;  2XJX A;  2BU5 A;  4BXI A;  2ZBK B;  2FYP A;  3HZ5 A;  1US7 A;  4MB9 A;  4MP2 A;  4LP0 A;  3H80 A;  4R1F A;  1UY8 A;  3B25 A;  1GKZ A;  3TZ4 A;  4U93 A;  3RLQ A;  2HCH A;  4CWP A;  3GIF A;  3TZ0 A;  1YS3 A;  3OWB A;  5J6A A;  2XDK A;  3GIG A;  4AWO A;  3GIG B;  4I5S A;  2YEI A;  2YI0 A;  3K98 A;  4V26 A;  4KP4 A;  4AWP A;  1AJ6 A;  3OMU A;  2WEQ A;  1TC6 A;  1Z5B A;  2XX5 A;  2YE7 A;  5D7C A;  5BOD A;  4ASF A;  4URL A;  4XKA A;  2XJJ A;  1ZW9 A;  4JAS A;  3EHF A;  4L90 A;  2XX4 A;  1PVG A;  2CCU A;  5CPH A;  1Y8P A;  4BAE A;  2YEG A;  4CWO A;  4V25 A;  3ZXQ A;  1AMW A;  2CCS A;  4E00 A;  2WER A;  3CGY A;  3HHU A;  4XIT A;  1UYL A;  4U7N A;  4LWI A;  5FNC A;  2XAB A;  3QTF A;  4YKT A;  3MNR P;  2XHT A;  3OPD A;  2VW5 A;  5D7D A;  3TZ2 A;  2XDL A;  2VWC A;  3A0Y A;  3B28 A;  1UYH A;  2BZ5 A;  2CCT A;  4EEH A;  2YEA A;  4HXW A;  1Z5A A;  1QY8 A;  4KFG A;  4XD8 A;  3ZKD A;  4ASA A;  1YC1 A;  4HY6 A;  4CWR A;  4YKX A;  2YKE A;  1UYE A;  4PU9 A;  1KZN A;  1U0Z A;  2FWY A;  1OSF A;  2VCJ A;  4YKQ A;  1ZXM A;  4HXZ A;  4H7Q A;  2ZDX A;  3DGE A;  4DZY A;  1B3Q A;  5M4P A;  2HKJ A;  3A0R A;  1EA6 A;  1I5B A;  2XHR A;  2WI2 A;  2Q8H A;  2H55 A;  3G7E A;  3ZM7 A;  3LNU A;  3RKZ A;  4K4O A;  3HEK A;  2ZDY A;  4CWS A;  4CE2 A;  1U2O A;  4XIP A;  2BYI A;  4KTN A;  3VAD A;  3R91 A;  5CTW A;  4FCR A;  4YKW A;  5CTY A;  4PRV A;  4MP7 A;  4GFN A;  2YE8 A;  4MBC A;  2WI4 A;  1Y4S A;  4CWN A;  3HYZ A;  4YKZ A; 
#chains in the Genus database with same CATH topology
 2UWD A;  1LVC A;  1SIR A;  4CWF A;  3SXQ A;  2CX9 A;  3MDE A;  2WEP A;  2YKC A;  3NMQ A;  4HYP A;  4NXL A;  4YKY A;  1UDY A;  5CF0 A;  5K3I A;  4Q4U A;  2AZE A;  2WI6 A;  4HKS A;  3X0Y A;  3RLR A;  4XTJ A;  3CRL A;  1YER A;  2BU2 A;  4XIR A;  3EOM A;  4URM A;  4EGH A;  2EBH X;  3NF4 A;  3JZ3 A;  3VHA A;  2C1G A;  3WHA A;  2BYH A;  2FON A;  2Q8F A;  2XD6 A;  4BQJ A;  3TZ5 A;  4KSF A;  3Q23 A;  2O1V A;  1Y8O A;  1U8V A;  4XIQ A;  2VF1 A;  2HG1 A;  2BT0 A;  2YE5 A;  4CWQ A;  3B24 A;  3GM6 A;  4AWQ A;  4GEE A;  2QG0 A;  1UYC A;  2FWZ A;  2JBT A;  1K90 A;  3C11 A;  1K8T A;  3BNG A;  4XVX A;  4LWF A;  4HY1 A;  4RM7 A;  3TTB A;  3GIE A;  4H81 A;  5BRK A;  1I5A A;  4FF3 A;  2BU7 A;  4PL9 A;  3IED A;  1L0O A;  4L91 A;  2WI3 A;  1YSZ A;  2YE2 A;  2IWS A;  3EHJ A;  1UYF A;  4EMV A;  3INW A;  1EI1 A;  4FPP A;  4H85 A;  4P8O A;  3P4T A;  4MOT A;  3MMO A;  2REH A;  2YJX A;  1XFY A;  4MPN A;  1YES A;  1T9G A;  2H8M A;  2ZKJ A;  4L38 A;  2IWX A;  2YYJ A;  4L94 A;  2BU6 A;  1TC0 A;  2IOR A;  4BIU A;  2UXW A;  1PK0 A;  2XX2 A;  3FO3 A;  2YEB A;  2O1W A;  2K5B A;  3CGZ A;  4MPC A;  2YEE A;  1Z59 A;  1EGD A;  1BUC A;  1QYE A;  4XKK A;  2CJ5 A;  3MPJ A;  4EM7 A;  2QF6 A;  1S14 A;  3HYY A;  2WI7 A;  4E72 A;  3Q24 A;  1I58 A;  3M9V A;  1XFZ A;  1GJV A;  1Y0V A;  1H7U A;  4URO A;  2XDX A;  2YEC A;  4BQG A;  2F6L A;  2WI5 A;  3K99 A;  3SF6 A;  2R0M A;  3R92 A;  5F5R A;  2CH4 A;  4O05 A;  4LPB A;  3OWA A;  2JBS A;  3D36 A;  2OR0 A;  3D9E A;  5C93 A;  3T0H A;  4MPE A;  2YJW A;  4NH8 A;  2FXS A;  4L3Z A;  3R4N A;  3Q5J A;  3O2F A;  1B63 A;  1SK6 A;  3SL2 A;  3VKG A;  2C1I A;  3L1T A;  4JIO A;  1I5D A;  1I5C A;  3EHH A;  4AS9 A;  3KE6 A;  1UYI A;  4X28 A;  3OWD A;  3F29 A;  3PFD A;  3C46 A;  2YI5 A;  3O6O A;  1S16 A;  4EFU A;  4DUH A;  4XE2 A;  2CGF A;  1YT1 A;  1ZXN A;  4QPK A;  2E0A A;  3TTZ A;  2DDH A;  4LWE A;  2YE4 A;  3T0Z A;  2FP2 A;  4R3M A;  4DOY A;  2PG0 A;  4YKU A;  3HZ1 A;  4GQT A;  2YI6 A;  4P7A A;  4FF4 A;  1BYQ A;  3VKH A;  3WQ9 A;  3UU9 A;  4JQL A;  1NHH A;  4F0X A;  4R3A A;  1FS9 A;  2HJN A;  2LFW A;  4EGI A;  3D2R A;  3D0B A;  1BKN A;  2AO2 A;  3U67 A;  4PRX A;  5JEN A;  2C2A A;  1YSR A;  5F3K A;  1YC4 A;  2YYI A;  2WI1 A;  3B96 A;  3FV5 A;  2IOP A;  2R0N A;  3HWC A;  4XCL A;  5FWK A;  3EHG A;  3EKO A;  4WUC A;  2XJG A;  4HZ0 A;  4GT8 A;  3RKH A;  3N0R A;  1IXM A;  1TIL A;  1UY9 A;  1TH8 A;  2YGA A;  1UYG A;  4E02 A;  5IDJ A;  4NH7 A;  2XS8 A;  3QDD A;  4ZYJ A;  2IWU A;  4HZ5 A;  2Q8I A;  4B7P A;  1NHJ A;  1YC3 A;  5M4M A;  2R05 A;  3Q22 A;  1RJ4 A;  4P79 A;  5B6B A;  2ESA A;  4U7O A;  4WUB A;  1JM6 A;  3CE2 A;  1KIJ A;  3G7B A;  2EXL A;  4Q1O A;  1H7S A;  3U2D A;  1S26 A;  2PNR A;  2OEX A;  2J7A A;  1SC5 A;  3OW6 A;  3RLP A;  4J1V A;  3X29 A;  3SWO A;  1BGQ A;  2CG9 A;  2XHX A;  3S5T A;  1R62 A;  3AFF A;  5J71 A;  3U2K A;  5IN9 A;  3CYG A;  2YI7 A;  2YK2 A;  1RX0 A;  2R02 A;  5BRM A;  3LMM A;  3B27 A;  3K97 A;  3MXL A;  3H4L A;  3T2S A;  1MU5 A;  3CWV A;  2YYL A;  2QFO A;  4EGK A;  5D7R A;  2C0U A;  4Q20 A;  4X9L A;  1THN A;  4NH9 A;  4LQS B;  5B5V A;  5M4E A;  2IX5 A;  2YKJ A;  5M4N A;  4KSA A;  2YYG A;  2GFD A;  1TID A;  1QZR A;  1YT2 A;  4FMT A;  4EFT A;  2QG2 A;  3ZKB A;  2BRC A;  4JEK A;  3EON A;  1XFW A;  2YK9 A;  4HR3 A;  4CE1 A;  2QR4 A;  3T10 A;  4WUD A;  3TUH A;  1GKX A;  4CWN A;  4G97 A;  4KCF A;  1UYK A;  4GGL A;  3O0I A;  3BNH A;  2Q8G A;  3EKR A;  2IOQ A;  1GU6 A;  3A0T A;  2YYK A;  4LWG A;  4E01 A;  2XCM A;  2RFQ A;  5CTX A;  4Q5C A;  1FS8 A;  4KSG A;  4ZVI A;  4I3H A;  1Y8N A;  3R7K A;  1K93 A;  5FNF A;  4KSH A;  5K3J A;  1R2J A;  4KQV A;  5FND A;  5IDM A;  4XKO A;  3D1I A;  3A0W A;  5L3J A;  3LGQ A;  2A1T A;  2YED A;  1YET A;  3D9G A;  4IV6 A;  4L8Z A;  2O1U A;  2RDZ A;  2BSM A;  4QPJ A;  4FZ4 A;  2YEH A;  2BRE A;  3OIB A;  3BMY A;  3K60 A;  2JBR A;  4BIZ A;  1B62 A;  1MX0 A;  1EGC A;  4N5F A;  2E80 A;  1AH6 A;  5M4K A;  1I59 A;  4URN A;  3R4O A;  2YGF A;  4G5E A;  1UYD A;  1X8Z A;  4Q17 A;  1EGE A;  2JIF A;  3SCE A;  4JIZ A;  5D6Q A;  2YEF A;  4O07 A;  3AFE A;  1Y4U A;  2JKI A;  2VIG A;  3LPS A;  4L3Y A;  4Q5B A;  1ID0 A;  1TBW A;  3B26 A;  1BXD A;  1JQI A;  3G75 A;  4AKI A;  4B6C A;  4ZKI A;  3PEJ A;  1IVH A;  3VHC A;  1IS2 A;  4LQQ B;  3VHD A;  2EC5 A;  2EBA A;  2YE6 A;  2FP1 A;  4FCQ A;  4KS9 A;  5D6P A;  3PEH A;  2YEJ A;  4W7T A;  4M9A A;  2PO4 A;  4XDM A;  5GGZ A;  2E81 A;  4LWH A;  3FT5 A;  1AH8 A;  4XCJ A;  3MKH A;  4OO2 A;  4O04 A;  2XDS A;  1YT0 A;  1UY6 A;  2YGE A;  3MDD A;  2GQP A;  2YE3 A;  2YE9 A;  4XC0 A;  3A0X A;  5K3G A;  2VCI A;  1UYM A;  4JAV A;  2Q2E B;  2XK2 A;  2YKI A;  3R4P A;  4GCZ A;  4L93 A;  3C3L A;  3GNC A;  3R4M A;  3BM9 A;  3Q5K A;  4JAU A;  4O5M A;  1ZWH A;  1Z5C A;  5M4H A;  3T1K A;  2GBB A;  1RP3 A;  3FT8 A;  4O0B A;  3INX A;  3MPI A;  4CWT A;  3D9D A;  3C0E A;  5CTU A;  4ASG A;  2XDU A;  2BTZ A;  1NHI A;  2YKB A;  1AM1 A;  2AKP A;  3FCJ A;  4ASB A;  1QDB A;  2JJC A;  4FF2 A;  1XFV A;  5BOC A;  1A4H A;  2XQR B;  4IRN A;  3Q5L A;  4HYM A;  3ZXO A;  2BU8 A;  1OAH A;  3CRK A;  4FCP A;  2RF7 A;  3TOR A;  4YKR A;  4O09 A;  1F51 A;  4CE3 A;  3A0Z A;  2OT4 A;  1UY7 A;  2XJX A;  2BU5 A;  4BXI A;  2ZBK B;  1X91 A;  2FYP A;  4HKR A;  3LG1 A;  3S7W A;  3HZ5 A;  1US7 A;  4MB9 A;  4MP2 A;  4LP0 A;  3H80 A;  3GQT A;  4R1F A;  1UY8 A;  3B25 A;  1GKZ A;  3TZ4 A;  2EBF X;  2YYM A;  4U93 A;  3UBR A;  3RLQ A;  2HCH A;  4U83 A;  4CWP A;  3GIF A;  3TZ0 A;  1YS3 A;  3OWB A;  1X90 A;  5J6A A;  2CJ6 A;  3C2P A;  3BNF A;  2XDK A;  3GIG A;  4QIC A;  3GIG B;  4AWO A;  4L3X A;  4ZXV A;  4I5S A;  2ZAF A;  2YEI A;  2YI0 A;  3K98 A;  1XFX A;  4V26 A;  4KP4 A;  4AWP A;  1AJ6 A;  3OMU A;  2WEQ A;  1TC6 A;  1XG2 B;  1Z5B A;  2XX5 A;  3II9 A;  2YE7 A;  2DVL A;  3D9F A;  5D7C A;  5BOD A;  4ASF A;  4URL A;  4XKA A;  3Q0A A;  2XJJ A;  4Q0T A;  1ZW9 A;  4JAS A;  2OJQ A;  3EHF A;  4X28 C;  4L90 A;  1PI1 A;  2XX4 A;  1PVG A;  2CCU A;  5CPH A;  2Z1Q A;  1Y8P A;  4BAE A;  5GJW E;  2YEG A;  4CWO A;  4V25 A;  3ZXQ A;  4AI6 A;  1AMW A;  1R3B A;  2CCS A;  4E00 A;  2WER A;  3CGY A;  3HHU A;  4XIT A;  2OEV A;  1UYL A;  4U7N A;  2CJ7 A;  4LWI A;  2R03 A;  5FNC A;  2FTK A;  4W9U A;  2XAB A;  1RJ1 A;  2VR0 A;  4L1F A;  3QTF A;  4YKT A;  3BNJ A;  3MNR P;  5B5W A;  3KML A;  2XHT A;  2IX6 A;  2YGW A;  3OPD A;  3D6B A;  2VW5 A;  4WJY A;  5D7D A;  3TZ2 A;  2XDL A;  2VWC A;  2WBI A;  1SIQ A;  5K3H A;  3A0Y A;  3B28 A;  1UYH A;  2XS1 A;  2BZ5 A;  2CCT A;  4EEH A;  2D29 A;  2YEA A;  1XFU A;  1Z5A A;  4HXW A;  1WS9 A;  1QY8 A;  4KFG A;  4XD8 A;  3ZKD A;  4ASA A;  1UKW A;  1YC1 A;  4HY6 A;  4CWR A;  4YKX A;  2YKE A;  1UYE A;  4PU9 A;  1KZN A;  1U0Z A;  2C12 A;  5GJV E;  1OSF A;  2FWY A;  2VCJ A;  4YKQ A;  1ZXM A;  4HXZ A;  4AKH A;  4H7Q A;  2ZDX A;  4DZY A;  4KTO A;  1B3Q A;  5M4P A;  2HKJ A;  3A0R A;  3DGE A;  1EA6 A;  1I5B A;  2XHR A;  2WI2 A;  2Q8H A;  2H55 A;  3G7E A;  3ZM7 A;  3LNU A;  2CJ8 A;  3OWM A;  3RKZ A;  2CJ4 A;  2ZO5 A;  4AKG A;  2HHI A;  1W07 A;  3HEK A;  2ZDY A;  4K4O A;  4CWS A;  4FF1 A;  1U2O A;  4XIP A;  4CE2 A;  2BYI A;  4KTN A;  3VAD A;  3R91 A;  1FS7 A;  5CTW A;  4FCR A;  4YKW A;  5CTY A;  4PRV A;  4MP7 A;  4GFN A;  2YE8 A;  4MBC A;  2WI4 A;  1Y4S A;  4P13 A;  3X0X A;  3HYZ A;  4YKZ A; 
#chains in the Genus database with same CATH homology
 2UWD A;  4CWF A;  2WEP A;  2YKC A;  3NMQ A;  4HYP A;  4YKY A;  5CF0 A;  2WI6 A;  3RLR A;  4XTJ A;  3CRL A;  1YER A;  2BU2 A;  4XIR A;  4URM A;  4EGH A;  3JZ3 A;  3VHA A;  3WHA A;  2BYH A;  2Q8F A;  2XD6 A;  4BQJ A;  3TZ5 A;  2O1V A;  1Y8O A;  4XIQ A;  2HG1 A;  2BT0 A;  2YE5 A;  4CWQ A;  3B24 A;  4AWQ A;  4GEE A;  2QG0 A;  1UYC A;  2FWZ A;  3C11 A;  4LWF A;  4HY1 A;  3GIE A;  4H81 A;  1I5A A;  2BU7 A;  4PL9 A;  3IED A;  1L0O A;  4L91 A;  2WI3 A;  1YSZ A;  2YE2 A;  2IWS A;  3EHJ A;  1UYF A;  4EMV A;  3INW A;  1EI1 A;  4FPP A;  4H85 A;  4P8O A;  4MOT A;  2YJX A;  4MPN A;  2H8M A;  1YES A;  2ZKJ A;  2IWX A;  4L94 A;  2BU6 A;  1TC0 A;  2IOR A;  4BIU A;  2XX2 A;  2YEB A;  2O1W A;  2K5B A;  3CGZ A;  4MPC A;  2YEE A;  1Z59 A;  1QYE A;  4XKK A;  4EM7 A;  2QF6 A;  1S14 A;  3HYY A;  2WI7 A;  1I58 A;  1GJV A;  4URO A;  1H7U A;  2XDX A;  2YEC A;  4BQG A;  2WI5 A;  3K99 A;  3R92 A;  5F5R A;  2CH4 A;  4O05 A;  4LPB A;  3D36 A;  5C93 A;  3T0H A;  4MPE A;  2YJW A;  4NH8 A;  2FXS A;  3R4N A;  3Q5J A;  3O2F A;  1B63 A;  3SL2 A;  1I5D A;  1I5C A;  3EHH A;  4AS9 A;  3KE6 A;  1UYI A;  3OWD A;  2YI5 A;  3O6O A;  1S16 A;  4EFU A;  4DUH A;  4XE2 A;  2CGF A;  1YT1 A;  1ZXN A;  4QPK A;  2E0A A;  3TTZ A;  3T0Z A;  4LWE A;  2YE4 A;  4R3M A;  4YKU A;  3HZ1 A;  4GQT A;  2YI6 A;  4P7A A;  1BYQ A;  3WQ9 A;  4JQL A;  1NHH A;  4R3A A;  4EGI A;  3D2R A;  3D0B A;  1BKN A;  3U67 A;  4PRX A;  2C2A A;  1YSR A;  5F3K A;  1YC4 A;  2WI1 A;  3FV5 A;  2IOP A;  4XCL A;  5FWK A;  3EHG A;  3EKO A;  4WUC A;  2XJG A;  4HZ0 A;  4GT8 A;  1TIL A;  1UY9 A;  1TH8 A;  2YGA A;  1UYG A;  4E02 A;  5IDJ A;  4NH7 A;  3QDD A;  2IWU A;  4HZ5 A;  2Q8I A;  4B7P A;  1NHJ A;  1YC3 A;  5M4M A;  2ESA A;  4U7O A;  4WUB A;  1JM6 A;  1KIJ A;  3G7B A;  2EXL A;  1H7S A;  3U2D A;  2PNR A;  3OW6 A;  3RLP A;  1BGQ A;  2CG9 A;  2XHX A;  1R62 A;  5J71 A;  3U2K A;  5IN9 A;  2YI7 A;  2YK2 A;  3B27 A;  3K97 A;  3H4L A;  3T2S A;  1MU5 A;  3CWV A;  2QFO A;  4EGK A;  5D7R A;  4Q20 A;  4X9L A;  1THN A;  4NH9 A;  5M4E A;  2YKJ A;  5M4N A;  2GFD A;  1TID A;  1QZR A;  1YT2 A;  4FMT A;  4EFT A;  2QG2 A;  3ZKB A;  2BRC A;  2YK9 A;  4CE1 A;  3T10 A;  4WUD A;  3TUH A;  1GKX A;  1UYK A;  4GGL A;  3O0I A;  2Q8G A;  3EKR A;  2IOQ A;  3A0T A;  4LWG A;  4E01 A;  2XCM A;  5CTX A;  4KSG A;  4ZVI A;  4I3H A;  1Y8N A;  5FNF A;  4KSH A;  5FND A;  4KQV A;  5IDM A;  4XKO A;  3A0W A;  5L3J A;  2YED A;  1YET A;  4L8Z A;  2O1U A;  2BSM A;  4QPJ A;  2YEH A;  3K60 A;  2BRE A;  3BMY A;  4BIZ A;  1B62 A;  1MX0 A;  1AH6 A;  5M4K A;  1I59 A;  4URN A;  3R4O A;  2YGF A;  1UYD A;  5D6Q A;  2YEF A;  4O07 A;  1Y4U A;  2JKI A;  3LPS A;  1ID0 A;  1TBW A;  3B26 A;  1BXD A;  3G75 A;  4B6C A;  4ZKI A;  3PEJ A;  3VHC A;  3VHD A;  2YE6 A;  4FCQ A;  5D6P A;  3PEH A;  2YEJ A;  4W7T A;  4XDM A;  5GGZ A;  4LWH A;  3FT5 A;  1AH8 A;  4XCJ A;  4O04 A;  2XDS A;  1YT0 A;  1UY6 A;  2YGE A;  2GQP A;  2YE3 A;  2YE9 A;  4XC0 A;  3A0X A;  2VCI A;  1UYM A;  4JAV A;  2Q2E B;  2XK2 A;  2YKI A;  3R4P A;  4GCZ A;  4L93 A;  3R4M A;  3BM9 A;  3Q5K A;  4JAU A;  1ZWH A;  1Z5C A;  5M4H A;  3T1K A;  3FT8 A;  4O0B A;  3INX A;  4CWT A;  3C0E A;  5CTU A;  4ASG A;  2XDU A;  2BTZ A;  1NHI A;  2YKB A;  1AM1 A;  2AKP A;  4ASB A;  2JJC A;  3ZXO A;  5BOC A;  1A4H A;  3Q5L A;  4HYM A;  2BU8 A;  4FCP A;  3CRK A;  4YKR A;  4O09 A;  4CE3 A;  3A0Z A;  1UY7 A;  2XJX A;  2BU5 A;  4BXI A;  2ZBK B;  2FYP A;  3HZ5 A;  1US7 A;  4MB9 A;  4MP2 A;  4LP0 A;  3H80 A;  4R1F A;  1UY8 A;  3B25 A;  1GKZ A;  3TZ4 A;  4U93 A;  3RLQ A;  2HCH A;  4CWP A;  3GIF A;  3TZ0 A;  1YS3 A;  3OWB A;  5J6A A;  2XDK A;  3GIG A;  4AWO A;  3GIG B;  4I5S A;  2YEI A;  2YI0 A;  3K98 A;  4V26 A;  4KP4 A;  4AWP A;  1AJ6 A;  3OMU A;  2WEQ A;  1TC6 A;  1Z5B A;  2XX5 A;  2YE7 A;  5D7C A;  5BOD A;  4ASF A;  4URL A;  4XKA A;  2XJJ A;  1ZW9 A;  4JAS A;  3EHF A;  4L90 A;  2XX4 A;  1PVG A;  2CCU A;  5CPH A;  1Y8P A;  4BAE A;  2YEG A;  4CWO A;  4V25 A;  3ZXQ A;  1AMW A;  2CCS A;  4E00 A;  2WER A;  3CGY A;  3HHU A;  4XIT A;  1UYL A;  4U7N A;  4LWI A;  5FNC A;  2XAB A;  3QTF A;  4YKT A;  3MNR P;  2XHT A;  3OPD A;  2VW5 A;  5D7D A;  3TZ2 A;  2XDL A;  2VWC A;  3A0Y A;  3B28 A;  1UYH A;  2BZ5 A;  2CCT A;  4EEH A;  2YEA A;  4HXW A;  1Z5A A;  1QY8 A;  4KFG A;  4XD8 A;  3ZKD A;  4ASA A;  1YC1 A;  4HY6 A;  4CWR A;  4YKX A;  2YKE A;  1UYE A;  4PU9 A;  1KZN A;  1U0Z A;  2FWY A;  1OSF A;  2VCJ A;  4YKQ A;  1ZXM A;  4HXZ A;  4H7Q A;  2ZDX A;  3DGE A;  4DZY A;  1B3Q A;  5M4P A;  2HKJ A;  3A0R A;  1EA6 A;  1I5B A;  2XHR A;  2WI2 A;  2Q8H A;  2H55 A;  3G7E A;  3ZM7 A;  3LNU A;  3RKZ A;  4K4O A;  3HEK A;  2ZDY A;  4CWS A;  4CE2 A;  1U2O A;  4XIP A;  2BYI A;  4KTN A;  3VAD A;  3R91 A;  5CTW A;  4FCR A;  4YKW A;  5CTY A;  4PRV A;  4MP7 A;  4GFN A;  2YE8 A;  4MBC A;  2WI4 A;  1Y4S A;  4CWN A;  3HYZ A;  4YKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...