2Q8HA

Structure of pyruvate dehydrogenase kinase isoform 1 in complex with dichloroacetate (dca)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
383
structure length
365
Chain Sequence
b'GVPGQVDFYARFSPSPLSMKQFLDFGSCEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNADDWCVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 122
structure length 365
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8hA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8hA02
1TBWA 4ASAA 2BU8A 1PVGA 4NH9A 2QFOA 3HYZA 4PRVA 2H8MA 4H81A 3TZ5A 1H7SA 1H7UA 4UROA 2YE2A 2CCTA 4MB9A 4XKAA 1L0OA 4P7AA 3IEDA 4GGLA 4URMA 4LWHA 3C11A 2YK2A 2Q8HA 1OSFA 2BU2A 1Z59A 2IORA 3VHAA 3T0HA 3LNUA 1R62A 1BGQA 4YKWA 4ZVIA 3Q5LA 4LWIA 4MP7A 4EFUA 2QF6A 4U7NA 4YKRA 4O09A 4XCJA 4AWPA 4EEHA 3ZXQA 1Y8PA 3A0ZA 3FV5A 4L8ZA 4O05A 4NH8A 4XIRA 2WI6A 3ZKBA 1NHJA 2YKIA 1UYFA 4YKTA 3G7BA 1QY8A 2XX5A 3K99A 3B24A 2YE5A 1AJ6A 4MPCA 2WERA 4O07A 3D36A 4CWFA 1TH8A 4X9LA 4EGKA 5CF0A 2XX4A 2FYPA 1Y8OA 2FXSA 3VHDA 2VWCA 3R4OA 3GIEA 4HY6A 4R3MA 2VCIA 1YT1A 3TZ0A 1AM1A 4KTNA 2AKPA 5CPHA 3C0EA 4XTJA 3HHUA 5D6PA 4LP0A 2WI1A 2ZKJA 1U0ZA 3CRKA 4CE3A 3FT5A 3EHFA 4E00A 2IOQA 2WI4A 2IWUA 4BIUA 1NHIA 4LPBA 3K97A 2BT0A 2JJCA 2WEQA 2YKCA 5FNDA 4CE1A 4LWFA 4CE2A 5M4NA 4BQJA 1BYQA 1YC4A 2YI0A 1Z5CA 3T0ZA 4EFTA 1MX0A 1KIJA 3EKRA 5M4KA 4O0BA 1Y4SA 1I5BA 5GGZA 2K5BA 5F3KA 2XDKA 2WEPA 1ZXMA 4FPPA 4HXWA 2BU5A 5D6QA 3R92A 4JASA 2VCJA 2BRCA 2H55A 2JKIA 4JAUA 4DUHA 4CWSA 2WI7A 4XD8A 4PU9A 1I58A 3LPSA 1S14A 2QG0A 3RLRA 2XABA 4KSHA 5D7DA 4ASGA 4FMTA 4HYMA 1A4HA 3SL2A 4R3AA 2XJGA 3O0IA 2BYHA 2ESAA 1QYEA 2XDUA 5BOCA 4XDMA 4QPKA 1Y8NA 1TC6A 3A0RA 3A0TA 1TILA 4YKYA 3GIGB 1US7A 1UY6A 2YEFA 2WI2A 5IDJA 1YSRA 2YJXA 1S16A 2XDSA 3DGEA 3H80A 1EI1A 2BU7A 3R4NA 3MNRP 3INXA 3OW6A 5J6AA 4MOTA 4JAVA 3EHGA 3U2KA 1AH6A 5CTYA 4E01A 1YSZA 2YGAA 4L90A 1B63A 3GIGA 2BU6A 2ZDYA 4BIZA 3CGZA 5CTUA 4XKOA 1NHHA 4KFGA 1GKXA 3RLPA 4CWOA 4WUBA 2IWSA 3K60A 4L91A 2IOPA 3D2RA 3EHJA 3CRLA 3D0BA 3Q5JA 1YC1A 2YJWA 3O6OA 4YKQA 2FWZA 4H7QA 2XD6A 4FCRA 1Z5AA 4YKUA 2Q8IA 4XITA 3RKZA 3CGYA 4R1FA 2YI5A 4FCPA 4XIPA 2BTZA 3KE6A 4CWNA 5CTWA 1ID0A 1YC3A 1UYDA 2BYIA 4K4OA 4CWRA 3GIFA 4MBCA 2HCHA 2Q2EB 3BM9A 1UYEA 1ZW9A 4O04A 2YGFA 5J71A 2XDLA 4BXIA 1GKZA 2YE3A 3OWBA 3VHCA 4ZKIA 1UYHA 2O1UA 4Q20A 1ZXNA 2UWDA 3ZXOA 4LWGA 3B27A 4I3HA 2XCMA 4HY1A 4AWOA 5CTXA 1MU5A 1TIDA 4U7OA 1UYIA 2YGEA 2YEJA 5IN9A 2YEBA 5D7CA 3O2FA 2WI5A 4LWEA 2YKJA 5M4PA 1I5CA 4HXZA 3H4LA 5BODA 1I5AA 2GQPA 4E02A 2YE4A 1UYLA 3HZ1A 2HG1A 5C93A 4ASBA 3K98A 2ZDXA 3TZ4A 4PL9A 4KQVA 1BXDA 4MP2A 2ZBKB 1AH8A 5M4HA 3G7EA 3R91A 2O1VA 4BQGA 2Q8GA 2C2AA 5M4EA 3EKOA 2YEGA 1YT0A 3HYYA 2CGFA 4HYPA 3A0YA 1UYCA 4WUDA 1GJVA 3B26A 2CCUA 4I5SA 2YEEA 1JM6A 1B3QA 3VADA 2QG2A 3EHHA 3OWDA 3FT8A 2XJJA 2YECA 4NH7A 2WI3A 4MPNA 3PEJA 1BKNA 1THNA 2YE9A 1EA6A 2YK9A 5FNCA 4EGHA 4AS9A 3Q5KA 2BSMA 3R4PA 2YEHA 3NMQA 4W7TA 4YKZA 4V26A 3QTFA 3B28A 1AMWA 4L94A 3RLQA 1UYGA 3U67A 4CWQA 4BAEA 3T10A 3PEHA 2IWXA 2XDXA 4MPEA 4L93A 2FWYA 4B7PA 3JZ3A 4HZ0A 1ZWHA 2YKBA 3T2SA 4HZ5A 5L3JA 4QPJA 3HEKA 4XC0A 2YEDA 1YS3A 4P8OA 1I5DA 1YERA 3A0WA 4KP4A 3INWA 2CH4A 5FNFA 4GT8A 4U93A 1YT2A 4XKKA 2XJXA 3U2DA 3A0XA 1UY8A 2YI7A 2CG9A 1KZNA 4EM7A 5FWKA 4EGIA 4FCQA 4JQLA 1YESA 1UY9A 1I59A 3WHAA 3OPDA 2HKJA 3TTZA 3T1KA 4H85A 2YE7A 3ZM7A 4XCLA 1TC0A 1UY7A 4PRXA 5IDMA 1YETA 2BREA 2BZ5A 2YI6A 2XK2A 2XX2A 4ASFA 5D7RA 3G75A 2XHXA 1UYMA 2YE8A 3B25A 4URNA 4WUCA 4CWPA 2YEAA 3ZKDA 1Y4UA 4KSGA 2VW5A 2XHRA 2YE6A 3HZ5A 4CWTA 1U2OA 1UYKA 1Z5BA 5M4MA 2E0AA 2GFDA 4B6CA 3WQ9A 4V25A 2CCSA 4EMVA 2PNRA 3CWVA 2YEIA 3QDDA 1QZRA 4GFNA 5F5RA 4DZYA 4XE2A 2YKEA 3TZ2A 2EXLA 2O1WA 3R4MA 1B62A 2Q8FA 4XIQA 4URLA 4GEEA 2XHTA 4AWQA 3BMYA 4GQTA 3TUHA 4YKXA 3OMUA 4GCZA
chains in the Genus database with same CATH superfamily
4X28C 1TBWA 3SWOA 4ASAA 2BU8A 1PVGA 4NH9A 1S26A 2QFOA 3HYZA 2YYJA 1RJ1A 4PRVA 2H8MA 4H81A 3D9DA 3TZ5A 1H7SA 2ZO5A 1H7UA 2R03A 4UROA 3C46A 1FS8A 2YE2A 2CCTA 2FP2A 4MB9A 4XKAA 2C12A 1L0OA 4P7AA 3IEDA 2E81A 4GGLA 4URMA 1JQIA 3N0RA 4LWHA 3C11A 2YK2A 2Q8HA 1OSFA 2YYGA 2BU2A 1Z59A 2RFQA 2IORA 3VHAA 3T0HA 3LNUA 1R62A 1BGQA 4YKWA 4JEKA 4ZVIA 2AZEA 3Q5LA 4LWIA 4MP7A 4EFUA 2QF6A 4U7NA 4YKRA 4O09A 4XCJA 4AWPA 4DOYA 3ZXQA 4EEHA 4FF2A 1Y8PA 3A0ZA 3FV5A 3MKHA 4L8ZA 4L3XA 4HKSA 4O05A 4O5MA 4NH8A 4XIRA 2WI6A 2OJQA 2RF7A 3ZKBA 1NHJA 1K8TA 1U8VA 1XFXA 2YKIA 3PFDA 1IXMA 1EGEA 1UYFA 2PO4A 3G7BA 4YKTA 2FP1A 2CX9A 1QY8A 2XX5A 3K99A 3B24A 2YE5A 1AJ6A 2XS8A 4KSFA 5JENA 2IX5A 4MPCA 2WERA 4O07A 3D36A 4CWFA 1TH8A 3S5TA 1XFVA 1XFZA 5B5VA 4X9LA 4EGKA 5CF0A 5B6BA 2XX4A 3EONA 3SF6A 2FYPA 2WBIA 2ZAFA 1Y8OA 2FXSA 3VHDA 2VWCA 3R4OA 2IX6A 3GIEA 4HY6A 3TORA 4R3MA 2PG0A 2VCIA 4KTOA 2A1TA 1YT1A 3TZ0A 1AM1A 4KTNA 2AKPA 5CPHA 1T9GA 3C0EA 4XTJA 3HHUA 4Q5CA 1RX0A 2CJ4A 2Z1QA 4LP0A 2WI1A 5D6PA 3NF4A 3LMMA 2ZKJA 1U0ZA 1X91A 3CRKA 4CE3A 1UKWA 1XFUA 3FT5A 3EHFA 4E00A 2EBHX 2IOQA 2WI4A 2IWUA 4L1FA 2HHIA 5BRMA 4BIUA 1NHIA 4LPBA 3P4TA 4HR3A 3K97A 2BT0A 2JJCA 3GQTA 2WEQA 2YKCA 5FNDA 4CE1A 4LWFA 2UXWA 4CE2A 5M4NA 4BQJA 1BYQA 3D9FA 4IV6A 1YC4A 3HWCA 4JIZA 1FS9A 2YI0A 1Z5CA 3T0ZA 2HJNA 4EFTA 1MX0A 4L3ZA 1KIJA 3EKRA 5M4KA 4O0BA 3LGQA 2FONA 1Y4SA 1I5BA 5GGZA 4OO2A 2K5BA 5F3KA 2XDKA 4IRNA 1ZXMA 2WEPA 4FPPA 2OT4A 4HXWA 2BU5A 2XQRB 5D6QA 3R92A 4JASA 2VCJA 1F51A 2BRCA 2H55A 3II9A 2JKIA 4JAUA 4DUHA 3CYGA 4CWSA 2WI7A 2EBFX 4XD8A 4PU9A 1I58A 4W9UA 3LPSA 1S14A 1K90A 3OWMA 2QG0A 3RLRA 1X8ZA 2XABA 4KSHA 1XFWA 5D7DA 4ASGA 4FMTA 4HYMA 1A4HA 1SC5A 3SL2A 4R3AA 2XJGA 3O0IA 2BYHA 2E80A 2OEXA 2ESAA 2FTKA 1QYEA 2XDUA 5BOCA 3MDDA 4XDMA 4KCFA 4QPKA 1Y8NA 1TC6A 3A0RA 1K93A 3B96A 2D29A 3A0TA 2RDZA 3F29A 1TILA 4YKYA 1QDBA 4N5FA 4Q4UA 4L38A 3AFFA 3GIGB 1US7A 1UY6A 5K3HA 2YEFA 2WI2A 1XFYA 5IDJA 4Q17A 4FF1A 2XS1A 1YSRA 4WJYA 2YJXA 1S16A 2XDSA 3DGEA 4RM7A 3H80A 1EI1A 2BU7A 3R4NA 4Q5BA 3MNRP 3INXA 3OW6A 5J6AA 4MOTA 2YYLA 2JBRA 4JAVA 3Q22A 3EHGA 3U2KA 3VKHA 1AH6A 5CTYA 4P79A 4E01A 1LVCA 1YSZA 2YGAA 4L90A 3EOMA 1B63A 3GIGA 4KSAA 2BU6A 2ZDYA 4BIZA 3CGZA 5CTUA 4AI6A 4XKOA 1NHHA 4KFGA 4J1VA 1GKXA 4Q1OA 4FF4A 3RLPA 4CWOA 4WUBA 2IWSA 2YYMA 3K60A 2F6LA 4L91A 2IOPA 3D2RA 3EHJA 3CRLA 3D0BA 2OEVA 3RKHA 3Q5JA 1YC1A 2YJWA 3O6OA 4YKQA 2FWZA 4H7QA 2XD6A 4FCRA 1Z5AA 4YKUA 2Q8IA 3BNHA 4XITA 3RKZA 4FF3A 3CGYA 4R1FA 2YI5A 4FCPA 4XIPA 2BTZA 3KE6A 4CWNA 5CTWA 1WS9A 4LQQB 1ID0A 1YC3A 1UYDA 2BYIA 4K4OA 4CWRA 3GIFA 4MBCA 2HCHA 3MDEA 2LFWA 2Q2EB 3BM9A 3GNCA 3Q0AA 3Q23A 1UYEA 1ZW9A 4O04A 5BRKA 2CJ8A 2YGFA 4F0XA 5J71A 2XDLA 2CJ6A 2YYKA 4BXIA 4FZ4A 1GKZA 2YE3A 3OWBA 3VHCA 4ZKIA 1UYHA 2O1UA 4Q20A 1ZXNA 2UWDA 3ZXOA 4LWGA 4KS9A 3B27A 4I3HA 2XCMA 3AFEA 1OAHA 4HY1A 4AWOA 3OIBA 5CTXA 1MU5A 1TIDA 4U7OA 2R0MA 1UYIA 2YGEA 3FCJA 2YEJA 5IN9A 2YEBA 5D7CA 3O2FA 3GM6A 2WI5A 4LWEA 2YKJA 5M4PA 1I5CA 3S7WA 2C1IA 4HXZA 3H4LA 5BODA 1I5AA 2GQPA 3MPJA 4E02A 1Y0VA 5K3GA 2YE4A 1UYLA 3HZ1A 3UU9A 2HG1A 5C93A 2C0UA 4ASBA 3K98A 2ZDXA 3TZ4A 4E72A 1EGDA 4PL9A 4KQVA 2CJ5A 1BXDA 4MP2A 2REHA 2ZBKB 3LG1A 4QICA 2AO2A 1AH8A 5M4HA 3CE2A 3G7EA 3R91A 2O1VA 4BQGA 2Q8GA 2C2AA 5M4EA 3EKOA 2YEGA 2EBAA 1YT0A 3HYYA 2CGFA 4HYPA 4AKHA 1UYCA 3A0YA 1GJVA 4WUDA 3B26A 2EC5A 2CCUA 4I5SA 2YEEA 4P13A 1R3BA 1PK0A 1JM6A 3D6BA 1B3QA 3VADA 2QG2A 3EHHA 1RJ4A 2JBSA 4Q0TA 4G97A 3FT8A 3OWDA 2XJJA 2YECA 4NH7A 2WI3A 4MPNA 3PEJA 1BKNA 1THNA 2YE9A 1EA6A 4AKGA 2YK9A 5FNCA 4M9AA 1XG2B 1FS7A 4EGHA 4AS9A 3Q5KA 2BSMA 3R4PA 2YEHA 4X28A 3NMQA 4W7TA 2DVLA 4ZYJA 4YKZA 4V26A 3QTFA 3B28A 3L1TA 1AMWA 1BUCA 4L94A 1RP3A 2YYIA 3RLQA 1UYGA 2C1GA 3U67A 4CWQA 4BAEA 3T10A 5K3JA 2CJ7A 3PEHA 2IWXA 1GU6A 4XVXA 1SK6A 2XDXA 3MXLA 4MPEA 4L93A 2FWYA 3X29A 3KMLA 4B7PA 3JZ3A 4HZ0A 1ZWHA 2YKBA 3T2SA 4HZ5A 5L3JA 4QPJA 3HEKA 4XC0A 2YEDA 4HKRA 1YS3A 4P8OA 2OR0A 1I5DA 5B5WA 1YERA 3A0WA 4G5EA 4KP4A 2J7AA 3INWA 2CH4A 3UBRA 5FNFA 4GT8A 4U93A 1YT2A 3TTBA 2JIFA 3X0XA 4XKKA 3D1IA 2XJXA 3U2DA 2GBBA 3D9GA 4ZXVA 3A0XA 3M9VA 3OWAA 1UY8A 2YI7A 2CG9A 1KZNA 2VR0A 3SXQA 4EM7A 3C2PA 5FWKA 4EGIA 5GJWE 4FCQA 2JBTA 4JQLA 1YESA 1UY9A 1I59A 3WHAA 3OPDA 3C3LA 3BNJA 2HKJA 3TTZA 3T1KA 4H85A 2YE7A 3ZM7A 4XCLA 1X90A 3D9EA 1TC0A 1UY7A 4JIOA 4PRXA 2VIGA 3MMOA 5IDMA 1YETA 4LQSB 2BREA 1W07A 2BZ5A 2YI6A 2VF1A 3Q24A 2XK2A 1EGCA 2XX2A 4ASFA 5D7RA 4AKIA 3G75A 2XHXA 1UYMA 2YE8A 3B25A 4URNA 4WUCA 4CWPA 3X0YA 2YEAA 3ZKDA 1Y4UA 4KSGA 2VW5A 2XHRA 2YE6A 4NXLA 3HZ5A 4CWTA 2R02A 3MPIA 1U2OA 2R0NA 1UYKA 1Z5BA 2R05A 3VKGA 1IVHA 5GJVE 5M4MA 2E0AA 2GFDA 2DDHA 4B6CA 3WQ9A 4V25A 2CCSA 4EMVA 2PNRA 3CWVA 2YEIA 3QDDA 1QZRA 4GFNA 5F5RA 3SCEA 3BNFA 4DZYA 4XE2A 1PI1A 2YKEA 1UDYA 3TZ2A 2EXLA 2O1WA 3R4MA 1R2JA 2YGWA 1B62A 2Q8FA 5K3IA 1SIQA 3FO3A 3BNGA 4U83A 4XIQA 2QR4A 4URLA 1SIRA 4GEEA 3R7KA 2XHTA 4AWQA 3BMYA 4L3YA 4GQTA 3TUHA 4YKXA 3OMUA 4GCZA 1IS2A
chains in the Genus database with same CATH topology
1TBWA 4ASAA 2BU8A 1PVGA 4NH9A 2QFOA 3HYZA 4PRVA 2H8MA 4H81A 3TZ5A 1H7SA 1H7UA 4UROA 2YE2A 2CCTA 4MB9A 4XKAA 1L0OA 4P7AA 3IEDA 4GGLA 4URMA 4LWHA 3C11A 2YK2A 2Q8HA 1OSFA 2BU2A 1Z59A 2IORA 3VHAA 3T0HA 3LNUA 1R62A 1BGQA 4YKWA 4ZVIA 3Q5LA 4LWIA 4MP7A 4EFUA 2QF6A 4U7NA 4YKRA 4O09A 4XCJA 4AWPA 4EEHA 3ZXQA 1Y8PA 3A0ZA 3FV5A 4L8ZA 4O05A 4NH8A 4XIRA 2WI6A 3ZKBA 1NHJA 2YKIA 1UYFA 4YKTA 3G7BA 1QY8A 2XX5A 3K99A 3B24A 2YE5A 1AJ6A 4MPCA 2WERA 4O07A 3D36A 4CWFA 1TH8A 4X9LA 4EGKA 5CF0A 2XX4A 2FYPA 1Y8OA 2FXSA 3VHDA 2VWCA 3R4OA 3GIEA 4HY6A 4R3MA 2VCIA 1YT1A 3TZ0A 1AM1A 4KTNA 2AKPA 5CPHA 3C0EA 4XTJA 3HHUA 5D6PA 4LP0A 2WI1A 2ZKJA 1U0ZA 3CRKA 4CE3A 3FT5A 3EHFA 4E00A 2IOQA 2WI4A 2IWUA 4BIUA 1NHIA 4LPBA 3K97A 2BT0A 2JJCA 2WEQA 2YKCA 5FNDA 4CE1A 4LWFA 4CE2A 5M4NA 4BQJA 1BYQA 1YC4A 2YI0A 1Z5CA 3T0ZA 4EFTA 1MX0A 1KIJA 3EKRA 5M4KA 4O0BA 1Y4SA 1I5BA 5GGZA 2K5BA 5F3KA 2XDKA 2WEPA 1ZXMA 4FPPA 4HXWA 2BU5A 5D6QA 3R92A 4JASA 2VCJA 2BRCA 2H55A 2JKIA 4JAUA 4DUHA 4CWSA 2WI7A 4XD8A 4PU9A 1I58A 3LPSA 1S14A 2QG0A 3RLRA 2XABA 4KSHA 5D7DA 4ASGA 4FMTA 4HYMA 1A4HA 3SL2A 4R3AA 2XJGA 3O0IA 2BYHA 2ESAA 1QYEA 2XDUA 5BOCA 4XDMA 4QPKA 1Y8NA 1TC6A 3A0RA 3A0TA 1TILA 4YKYA 3GIGB 1US7A 1UY6A 2YEFA 2WI2A 5IDJA 1YSRA 2YJXA 1S16A 2XDSA 3DGEA 3H80A 1EI1A 2BU7A 3R4NA 3MNRP 3INXA 3OW6A 5J6AA 4MOTA 4JAVA 3EHGA 3U2KA 1AH6A 5CTYA 4E01A 1YSZA 2YGAA 4L90A 1B63A 3GIGA 2BU6A 2ZDYA 4BIZA 3CGZA 5CTUA 4XKOA 1NHHA 4KFGA 1GKXA 3RLPA 4CWOA 4WUBA 2IWSA 3K60A 4L91A 2IOPA 3D2RA 3EHJA 3CRLA 3D0BA 3Q5JA 1YC1A 2YJWA 3O6OA 4YKQA 2FWZA 4H7QA 2XD6A 4FCRA 1Z5AA 4YKUA 2Q8IA 4XITA 3RKZA 3CGYA 4R1FA 2YI5A 4FCPA 4XIPA 2BTZA 3KE6A 4CWNA 5CTWA 1ID0A 1YC3A 1UYDA 2BYIA 4K4OA 4CWRA 3GIFA 4MBCA 2HCHA 2Q2EB 3BM9A 1UYEA 1ZW9A 4O04A 2YGFA 5J71A 2XDLA 4BXIA 1GKZA 2YE3A 3OWBA 3VHCA 4ZKIA 1UYHA 2O1UA 4Q20A 1ZXNA 2UWDA 3ZXOA 4LWGA 3B27A 4I3HA 2XCMA 4HY1A 4AWOA 5CTXA 1MU5A 1TIDA 4U7OA 1UYIA 2YGEA 2YEJA 5IN9A 2YEBA 5D7CA 3O2FA 2WI5A 4LWEA 2YKJA 5M4PA 1I5CA 4HXZA 3H4LA 5BODA 1I5AA 2GQPA 4E02A 2YE4A 1UYLA 3HZ1A 2HG1A 5C93A 4ASBA 3K98A 2ZDXA 3TZ4A 4PL9A 4KQVA 1BXDA 4MP2A 2ZBKB 1AH8A 5M4HA 3G7EA 3R91A 2O1VA 4BQGA 2Q8GA 2C2AA 5M4EA 3EKOA 2YEGA 1YT0A 3HYYA 2CGFA 4HYPA 3A0YA 1UYCA 4WUDA 1GJVA 3B26A 2CCUA 4I5SA 2YEEA 1JM6A 1B3QA 3VADA 2QG2A 3EHHA 3OWDA 3FT8A 2XJJA 2YECA 4NH7A 2WI3A 4MPNA 3PEJA 1BKNA 1THNA 2YE9A 1EA6A 2YK9A 5FNCA 4EGHA 4AS9A 3Q5KA 2BSMA 3R4PA 2YEHA 3NMQA 4W7TA 4YKZA 4V26A 3QTFA 3B28A 1AMWA 4L94A 3RLQA 1UYGA 3U67A 4CWQA 4BAEA 3T10A 3PEHA 2IWXA 2XDXA 4MPEA 4L93A 2FWYA 4B7PA 3JZ3A 4HZ0A 1ZWHA 2YKBA 3T2SA 4HZ5A 5L3JA 4QPJA 3HEKA 4XC0A 2YEDA 1YS3A 4P8OA 1I5DA 1YERA 3A0WA 4KP4A 3INWA 2CH4A 5FNFA 4GT8A 4U93A 1YT2A 4XKKA 2XJXA 3U2DA 3A0XA 1UY8A 2YI7A 2CG9A 1KZNA 4EM7A 5FWKA 4EGIA 4FCQA 4JQLA 1YESA 1UY9A 1I59A 3WHAA 3OPDA 2HKJA 3TTZA 3T1KA 4H85A 2YE7A 3ZM7A 4XCLA 1TC0A 1UY7A 4PRXA 5IDMA 1YETA 2BREA 2BZ5A 2YI6A 2XK2A 2XX2A 4ASFA 5D7RA 3G75A 2XHXA 1UYMA 2YE8A 3B25A 4URNA 4WUCA 4CWPA 2YEAA 3ZKDA 1Y4UA 4KSGA 2VW5A 2XHRA 2YE6A 3HZ5A 4CWTA 1U2OA 1UYKA 1Z5BA 5M4MA 2E0AA 2GFDA 4B6CA 3WQ9A 4V25A 2CCSA 4EMVA 2PNRA 3CWVA 2YEIA 3QDDA 1QZRA 4GFNA 5F5RA 4DZYA 4XE2A 2YKEA 3TZ2A 2EXLA 2O1WA 3R4MA 1B62A 2Q8FA 4XIQA 4URLA 4GEEA 2XHTA 4AWQA 3BMYA 4GQTA 3TUHA 4YKXA 3OMUA 4GCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBW A;  4ASA A;  2BU8 A;  1PVG A;  4NH9 A;  2QFO A;  3HYZ A;  4PRV A;  2H8M A;  4H81 A;  3TZ5 A;  1H7S A;  1H7U A;  4URO A;  2YE2 A;  2CCT A;  4MB9 A;  4XKA A;  1L0O A;  4P7A A;  3IED A;  4GGL A;  4URM A;  4LWH A;  3C11 A;  2YK2 A;  2Q8H A;  1OSF A;  2BU2 A;  1Z59 A;  2IOR A;  3VHA A;  3T0H A;  3LNU A;  1R62 A;  1BGQ A;  4YKW A;  4ZVI A;  3Q5L A;  4LWI A;  4MP7 A;  4EFU A;  2QF6 A;  4U7N A;  4YKR A;  4O09 A;  4XCJ A;  4AWP A;  4EEH A;  3ZXQ A;  1Y8P A;  3A0Z A;  3FV5 A;  4L8Z A;  4O05 A;  4NH8 A;  4XIR A;  2WI6 A;  3ZKB A;  1NHJ A;  2YKI A;  1UYF A;  4YKT A;  3G7B A;  1QY8 A;  2XX5 A;  3K99 A;  3B24 A;  2YE5 A;  1AJ6 A;  4MPC A;  2WER A;  4O07 A;  3D36 A;  4CWF A;  1TH8 A;  4X9L A;  4EGK A;  5CF0 A;  2XX4 A;  2FYP A;  1Y8O A;  2FXS A;  3VHD A;  2VWC A;  3R4O A;  3GIE A;  4HY6 A;  4R3M A;  2VCI A;  1YT1 A;  3TZ0 A;  1AM1 A;  4KTN A;  2AKP A;  5CPH A;  3C0E A;  4XTJ A;  3HHU A;  5D6P A;  4LP0 A;  2WI1 A;  2ZKJ A;  1U0Z A;  3CRK A;  4CE3 A;  3FT5 A;  3EHF A;  4E00 A;  2IOQ A;  2WI4 A;  2IWU A;  4BIU A;  1NHI A;  4LPB A;  3K97 A;  2BT0 A;  2JJC A;  2WEQ A;  2YKC A;  5FND A;  4CE1 A;  4LWF A;  4CE2 A;  5M4N A;  4BQJ A;  1BYQ A;  1YC4 A;  2YI0 A;  1Z5C A;  3T0Z A;  4EFT A;  1MX0 A;  1KIJ A;  3EKR A;  5M4K A;  4O0B A;  1Y4S A;  1I5B A;  5GGZ A;  2K5B A;  5F3K A;  2XDK A;  2WEP A;  1ZXM A;  4FPP A;  4HXW A;  2BU5 A;  5D6Q A;  3R92 A;  4JAS A;  2VCJ A;  2BRC A;  2H55 A;  2JKI A;  4JAU A;  4DUH A;  4CWS A;  2WI7 A;  4XD8 A;  4PU9 A;  1I58 A;  3LPS A;  1S14 A;  2QG0 A;  3RLR A;  2XAB A;  4KSH A;  5D7D A;  4ASG A;  4FMT A;  4HYM A;  1A4H A;  3SL2 A;  4R3A A;  2XJG A;  3O0I A;  2BYH A;  2ESA A;  1QYE A;  2XDU A;  5BOC A;  4XDM A;  4QPK A;  1Y8N A;  1TC6 A;  3A0R A;  3A0T A;  1TIL A;  4YKY A;  3GIG B;  1US7 A;  1UY6 A;  2YEF A;  2WI2 A;  5IDJ A;  1YSR A;  2YJX A;  1S16 A;  2XDS A;  3DGE A;  3H80 A;  1EI1 A;  2BU7 A;  3R4N A;  3MNR P;  3INX A;  3OW6 A;  5J6A A;  4MOT A;  4JAV A;  3EHG A;  3U2K A;  1AH6 A;  5CTY A;  4E01 A;  1YSZ A;  2YGA A;  4L90 A;  1B63 A;  3GIG A;  2BU6 A;  2ZDY A;  4BIZ A;  3CGZ A;  5CTU A;  4XKO A;  1NHH A;  4KFG A;  1GKX A;  3RLP A;  4CWO A;  4WUB A;  2IWS A;  3K60 A;  4L91 A;  2IOP A;  3D2R A;  3EHJ A;  3CRL A;  3D0B A;  3Q5J A;  1YC1 A;  2YJW A;  3O6O A;  4YKQ A;  2FWZ A;  4H7Q A;  2XD6 A;  4FCR A;  1Z5A A;  4YKU A;  2Q8I A;  4XIT A;  3RKZ A;  3CGY A;  4R1F A;  2YI5 A;  4FCP A;  4XIP A;  2BTZ A;  3KE6 A;  4CWN A;  5CTW A;  1ID0 A;  1YC3 A;  1UYD A;  2BYI A;  4K4O A;  4CWR A;  3GIF A;  4MBC A;  2HCH A;  2Q2E B;  3BM9 A;  1UYE A;  1ZW9 A;  4O04 A;  2YGF A;  5J71 A;  2XDL A;  4BXI A;  1GKZ A;  2YE3 A;  3OWB A;  3VHC A;  4ZKI A;  1UYH A;  2O1U A;  4Q20 A;  1ZXN A;  2UWD A;  3ZXO A;  4LWG A;  3B27 A;  4I3H A;  2XCM A;  4HY1 A;  4AWO A;  5CTX A;  1MU5 A;  1TID A;  4U7O A;  1UYI A;  2YGE A;  2YEJ A;  5IN9 A;  2YEB A;  5D7C A;  3O2F A;  2WI5 A;  4LWE A;  2YKJ A;  5M4P A;  1I5C A;  4HXZ A;  3H4L A;  5BOD A;  1I5A A;  2GQP A;  4E02 A;  2YE4 A;  1UYL A;  3HZ1 A;  2HG1 A;  5C93 A;  4ASB A;  3K98 A;  2ZDX A;  3TZ4 A;  4PL9 A;  4KQV A;  1BXD A;  4MP2 A;  2ZBK B;  1AH8 A;  5M4H A;  3G7E A;  3R91 A;  2O1V A;  4BQG A;  2Q8G A;  2C2A A;  5M4E A;  3EKO A;  2YEG A;  1YT0 A;  3HYY A;  2CGF A;  4HYP A;  3A0Y A;  1UYC A;  4WUD A;  1GJV A;  3B26 A;  2CCU A;  4I5S A;  2YEE A;  1JM6 A;  1B3Q A;  3VAD A;  2QG2 A;  3EHH A;  3OWD A;  3FT8 A;  2XJJ A;  2YEC A;  4NH7 A;  2WI3 A;  4MPN A;  3PEJ A;  1BKN A;  1THN A;  2YE9 A;  1EA6 A;  2YK9 A;  5FNC A;  4EGH A;  4AS9 A;  3Q5K A;  2BSM A;  3R4P A;  2YEH A;  3NMQ A;  4W7T A;  4YKZ A;  4V26 A;  3QTF A;  3B28 A;  1AMW A;  4L94 A;  3RLQ A;  1UYG A;  3U67 A;  4CWQ A;  4BAE A;  3T10 A;  3PEH A;  2IWX A;  2XDX A;  4MPE A;  4L93 A;  2FWY A;  4B7P A;  3JZ3 A;  4HZ0 A;  1ZWH A;  2YKB A;  3T2S A;  4HZ5 A;  5L3J A;  4QPJ A;  3HEK A;  4XC0 A;  2YED A;  1YS3 A;  4P8O A;  1I5D A;  1YER A;  3A0W A;  4KP4 A;  3INW A;  2CH4 A;  5FNF A;  4GT8 A;  4U93 A;  1YT2 A;  4XKK A;  2XJX A;  3U2D A;  3A0X A;  1UY8 A;  2YI7 A;  2CG9 A;  1KZN A;  4EM7 A;  5FWK A;  4EGI A;  4FCQ A;  4JQL A;  1YES A;  1UY9 A;  1I59 A;  3WHA A;  3OPD A;  2HKJ A;  3TTZ A;  3T1K A;  4H85 A;  2YE7 A;  3ZM7 A;  4XCL A;  1TC0 A;  1UY7 A;  4PRX A;  5IDM A;  1YET A;  2BRE A;  2BZ5 A;  2YI6 A;  2XK2 A;  2XX2 A;  4ASF A;  5D7R A;  3G75 A;  2XHX A;  1UYM A;  2YE8 A;  3B25 A;  4URN A;  4WUC A;  4CWP A;  2YEA A;  3ZKD A;  1Y4U A;  4KSG A;  2VW5 A;  2XHR A;  2YE6 A;  3HZ5 A;  4CWT A;  1U2O A;  1UYK A;  1Z5B A;  5M4M A;  2E0A A;  2GFD A;  4B6C A;  3WQ9 A;  4V25 A;  2CCS A;  4EMV A;  2PNR A;  3CWV A;  2YEI A;  3QDD A;  1QZR A;  4GFN A;  5F5R A;  4DZY A;  4XE2 A;  2YKE A;  3TZ2 A;  2EXL A;  2O1W A;  3R4M A;  1B62 A;  2Q8F A;  4XIQ A;  4URL A;  4GEE A;  2XHT A;  4AWQ A;  3BMY A;  4GQT A;  3TUH A;  4YKX A;  3OMU A;  4GCZ A; 
#chains in the Genus database with same CATH topology
 4X28 C;  1TBW A;  3SWO A;  4ASA A;  2BU8 A;  1PVG A;  4NH9 A;  1S26 A;  2QFO A;  3HYZ A;  2YYJ A;  1RJ1 A;  4PRV A;  2H8M A;  4H81 A;  3D9D A;  3TZ5 A;  1H7S A;  2ZO5 A;  1H7U A;  2R03 A;  4URO A;  3C46 A;  1FS8 A;  2YE2 A;  2CCT A;  2FP2 A;  4MB9 A;  4XKA A;  2C12 A;  1L0O A;  4P7A A;  3IED A;  2E81 A;  4GGL A;  4URM A;  1JQI A;  3N0R A;  4LWH A;  3C11 A;  2YK2 A;  2Q8H A;  1OSF A;  2YYG A;  2BU2 A;  1Z59 A;  2RFQ A;  2IOR A;  3VHA A;  3T0H A;  3LNU A;  1R62 A;  1BGQ A;  4YKW A;  4JEK A;  4ZVI A;  2AZE A;  3Q5L A;  4LWI A;  4MP7 A;  4EFU A;  2QF6 A;  4U7N A;  4YKR A;  4O09 A;  4XCJ A;  4AWP A;  4DOY A;  3ZXQ A;  4EEH A;  4FF2 A;  1Y8P A;  3A0Z A;  3FV5 A;  3MKH A;  4L8Z A;  4L3X A;  4HKS A;  4O05 A;  4O5M A;  4NH8 A;  4XIR A;  2WI6 A;  2OJQ A;  2RF7 A;  3ZKB A;  1NHJ A;  1K8T A;  1U8V A;  1XFX A;  2YKI A;  3PFD A;  1IXM A;  1EGE A;  1UYF A;  2PO4 A;  3G7B A;  4YKT A;  2FP1 A;  2CX9 A;  1QY8 A;  2XX5 A;  3K99 A;  3B24 A;  2YE5 A;  1AJ6 A;  2XS8 A;  4KSF A;  5JEN A;  2IX5 A;  4MPC A;  2WER A;  4O07 A;  3D36 A;  4CWF A;  1TH8 A;  3S5T A;  1XFV A;  1XFZ A;  5B5V A;  4X9L A;  4EGK A;  5CF0 A;  5B6B A;  2XX4 A;  3EON A;  3SF6 A;  2FYP A;  2WBI A;  2ZAF A;  1Y8O A;  2FXS A;  3VHD A;  2VWC A;  3R4O A;  2IX6 A;  3GIE A;  4HY6 A;  3TOR A;  4R3M A;  2PG0 A;  2VCI A;  4KTO A;  2A1T A;  1YT1 A;  3TZ0 A;  1AM1 A;  4KTN A;  2AKP A;  5CPH A;  1T9G A;  3C0E A;  4XTJ A;  3HHU A;  4Q5C A;  1RX0 A;  2CJ4 A;  2Z1Q A;  4LP0 A;  2WI1 A;  5D6P A;  3NF4 A;  3LMM A;  2ZKJ A;  1U0Z A;  1X91 A;  3CRK A;  4CE3 A;  1UKW A;  1XFU A;  3FT5 A;  3EHF A;  4E00 A;  2EBH X;  2IOQ A;  2WI4 A;  2IWU A;  4L1F A;  2HHI A;  5BRM A;  4BIU A;  1NHI A;  4LPB A;  3P4T A;  4HR3 A;  3K97 A;  2BT0 A;  2JJC A;  3GQT A;  2WEQ A;  2YKC A;  5FND A;  4CE1 A;  4LWF A;  2UXW A;  4CE2 A;  5M4N A;  4BQJ A;  1BYQ A;  3D9F A;  4IV6 A;  1YC4 A;  3HWC A;  4JIZ A;  1FS9 A;  2YI0 A;  1Z5C A;  3T0Z A;  2HJN A;  4EFT A;  1MX0 A;  4L3Z A;  1KIJ A;  3EKR A;  5M4K A;  4O0B A;  3LGQ A;  2FON A;  1Y4S A;  1I5B A;  5GGZ A;  4OO2 A;  2K5B A;  5F3K A;  2XDK A;  4IRN A;  1ZXM A;  2WEP A;  4FPP A;  2OT4 A;  4HXW A;  2BU5 A;  2XQR B;  5D6Q A;  3R92 A;  4JAS A;  2VCJ A;  1F51 A;  2BRC A;  2H55 A;  3II9 A;  2JKI A;  4JAU A;  4DUH A;  3CYG A;  4CWS A;  2WI7 A;  2EBF X;  4XD8 A;  4PU9 A;  1I58 A;  4W9U A;  3LPS A;  1S14 A;  1K90 A;  3OWM A;  2QG0 A;  3RLR A;  1X8Z A;  2XAB A;  4KSH A;  1XFW A;  5D7D A;  4ASG A;  4FMT A;  4HYM A;  1A4H A;  1SC5 A;  3SL2 A;  4R3A A;  2XJG A;  3O0I A;  2BYH A;  2E80 A;  2OEX A;  2ESA A;  2FTK A;  1QYE A;  2XDU A;  5BOC A;  3MDD A;  4XDM A;  4KCF A;  4QPK A;  1Y8N A;  1TC6 A;  3A0R A;  1K93 A;  3B96 A;  2D29 A;  3A0T A;  2RDZ A;  3F29 A;  1TIL A;  4YKY A;  1QDB A;  4N5F A;  4Q4U A;  4L38 A;  3AFF A;  3GIG B;  1US7 A;  1UY6 A;  5K3H A;  2YEF A;  2WI2 A;  1XFY A;  5IDJ A;  4Q17 A;  4FF1 A;  2XS1 A;  1YSR A;  4WJY A;  2YJX A;  1S16 A;  2XDS A;  3DGE A;  4RM7 A;  3H80 A;  1EI1 A;  2BU7 A;  3R4N A;  4Q5B A;  3MNR P;  3INX A;  3OW6 A;  5J6A A;  4MOT A;  2YYL A;  2JBR A;  4JAV A;  3Q22 A;  3EHG A;  3U2K A;  3VKH A;  1AH6 A;  5CTY A;  4P79 A;  4E01 A;  1LVC A;  1YSZ A;  2YGA A;  4L90 A;  3EOM A;  1B63 A;  3GIG A;  4KSA A;  2BU6 A;  2ZDY A;  4BIZ A;  3CGZ A;  5CTU A;  4AI6 A;  4XKO A;  1NHH A;  4KFG A;  4J1V A;  1GKX A;  4Q1O A;  4FF4 A;  3RLP A;  4CWO A;  4WUB A;  2IWS A;  2YYM A;  3K60 A;  2F6L A;  4L91 A;  2IOP A;  3D2R A;  3EHJ A;  3CRL A;  3D0B A;  2OEV A;  3RKH A;  3Q5J A;  1YC1 A;  2YJW A;  3O6O A;  4YKQ A;  2FWZ A;  4H7Q A;  2XD6 A;  4FCR A;  1Z5A A;  4YKU A;  2Q8I A;  3BNH A;  4XIT A;  3RKZ A;  4FF3 A;  3CGY A;  4R1F A;  2YI5 A;  4FCP A;  4XIP A;  2BTZ A;  3KE6 A;  4CWN A;  5CTW A;  1WS9 A;  4LQQ B;  1ID0 A;  1YC3 A;  1UYD A;  2BYI A;  4K4O A;  4CWR A;  3GIF A;  4MBC A;  2HCH A;  3MDE A;  2LFW A;  2Q2E B;  3BM9 A;  3GNC A;  3Q0A A;  3Q23 A;  1UYE A;  1ZW9 A;  4O04 A;  5BRK A;  2CJ8 A;  2YGF A;  4F0X A;  5J71 A;  2XDL A;  2CJ6 A;  2YYK A;  4BXI A;  4FZ4 A;  1GKZ A;  2YE3 A;  3OWB A;  3VHC A;  4ZKI A;  1UYH A;  2O1U A;  4Q20 A;  1ZXN A;  2UWD A;  3ZXO A;  4LWG A;  4KS9 A;  3B27 A;  4I3H A;  2XCM A;  3AFE A;  1OAH A;  4HY1 A;  4AWO A;  3OIB A;  5CTX A;  1MU5 A;  1TID A;  4U7O A;  2R0M A;  1UYI A;  2YGE A;  3FCJ A;  2YEJ A;  5IN9 A;  2YEB A;  5D7C A;  3O2F A;  3GM6 A;  2WI5 A;  4LWE A;  2YKJ A;  5M4P A;  1I5C A;  3S7W A;  2C1I A;  4HXZ A;  3H4L A;  5BOD A;  1I5A A;  2GQP A;  3MPJ A;  4E02 A;  1Y0V A;  5K3G A;  2YE4 A;  1UYL A;  3HZ1 A;  3UU9 A;  2HG1 A;  5C93 A;  2C0U A;  4ASB A;  3K98 A;  2ZDX A;  3TZ4 A;  4E72 A;  1EGD A;  4PL9 A;  4KQV A;  2CJ5 A;  1BXD A;  4MP2 A;  2REH A;  2ZBK B;  3LG1 A;  4QIC A;  2AO2 A;  1AH8 A;  5M4H A;  3CE2 A;  3G7E A;  3R91 A;  2O1V A;  4BQG A;  2Q8G A;  2C2A A;  5M4E A;  3EKO A;  2YEG A;  2EBA A;  1YT0 A;  3HYY A;  2CGF A;  4HYP A;  4AKH A;  1UYC A;  3A0Y A;  1GJV A;  4WUD A;  3B26 A;  2EC5 A;  2CCU A;  4I5S A;  2YEE A;  4P13 A;  1R3B A;  1PK0 A;  1JM6 A;  3D6B A;  1B3Q A;  3VAD A;  2QG2 A;  3EHH A;  1RJ4 A;  2JBS A;  4Q0T A;  4G97 A;  3FT8 A;  3OWD A;  2XJJ A;  2YEC A;  4NH7 A;  2WI3 A;  4MPN A;  3PEJ A;  1BKN A;  1THN A;  2YE9 A;  1EA6 A;  4AKG A;  2YK9 A;  5FNC A;  4M9A A;  1XG2 B;  1FS7 A;  4EGH A;  4AS9 A;  3Q5K A;  2BSM A;  3R4P A;  2YEH A;  4X28 A;  3NMQ A;  4W7T A;  2DVL A;  4ZYJ A;  4YKZ A;  4V26 A;  3QTF A;  3B28 A;  3L1T A;  1AMW A;  1BUC A;  4L94 A;  1RP3 A;  2YYI A;  3RLQ A;  1UYG A;  2C1G A;  3U67 A;  4CWQ A;  4BAE A;  3T10 A;  5K3J A;  2CJ7 A;  3PEH A;  2IWX A;  1GU6 A;  4XVX A;  1SK6 A;  2XDX A;  3MXL A;  4MPE A;  4L93 A;  2FWY A;  3X29 A;  3KML A;  4B7P A;  3JZ3 A;  4HZ0 A;  1ZWH A;  2YKB A;  3T2S A;  4HZ5 A;  5L3J A;  4QPJ A;  3HEK A;  4XC0 A;  2YED A;  4HKR A;  1YS3 A;  4P8O A;  2OR0 A;  1I5D A;  5B5W A;  1YER A;  3A0W A;  4G5E A;  4KP4 A;  2J7A A;  3INW A;  2CH4 A;  3UBR A;  5FNF A;  4GT8 A;  4U93 A;  1YT2 A;  3TTB A;  2JIF A;  3X0X A;  4XKK A;  3D1I A;  2XJX A;  3U2D A;  2GBB A;  3D9G A;  4ZXV A;  3A0X A;  3M9V A;  3OWA A;  1UY8 A;  2YI7 A;  2CG9 A;  1KZN A;  2VR0 A;  3SXQ A;  4EM7 A;  3C2P A;  5FWK A;  4EGI A;  5GJW E;  4FCQ A;  2JBT A;  4JQL A;  1YES A;  1UY9 A;  1I59 A;  3WHA A;  3OPD A;  3C3L A;  3BNJ A;  2HKJ A;  3TTZ A;  3T1K A;  4H85 A;  2YE7 A;  3ZM7 A;  4XCL A;  1X90 A;  3D9E A;  1TC0 A;  1UY7 A;  4JIO A;  4PRX A;  2VIG A;  3MMO A;  5IDM A;  1YET A;  4LQS B;  2BRE A;  1W07 A;  2BZ5 A;  2YI6 A;  2VF1 A;  3Q24 A;  2XK2 A;  1EGC A;  2XX2 A;  4ASF A;  5D7R A;  4AKI A;  3G75 A;  2XHX A;  1UYM A;  2YE8 A;  3B25 A;  4URN A;  4WUC A;  4CWP A;  3X0Y A;  2YEA A;  3ZKD A;  1Y4U A;  4KSG A;  2VW5 A;  2XHR A;  2YE6 A;  4NXL A;  3HZ5 A;  4CWT A;  2R02 A;  3MPI A;  1U2O A;  2R0N A;  1UYK A;  1Z5B A;  2R05 A;  3VKG A;  1IVH A;  5GJV E;  5M4M A;  2E0A A;  2GFD A;  2DDH A;  4B6C A;  3WQ9 A;  4V25 A;  2CCS A;  4EMV A;  2PNR A;  3CWV A;  2YEI A;  3QDD A;  1QZR A;  4GFN A;  5F5R A;  3SCE A;  3BNF A;  4DZY A;  4XE2 A;  1PI1 A;  2YKE A;  1UDY A;  3TZ2 A;  2EXL A;  2O1W A;  3R4M A;  1R2J A;  2YGW A;  1B62 A;  2Q8F A;  5K3I A;  1SIQ A;  3FO3 A;  3BNG A;  4U83 A;  4XIQ A;  2QR4 A;  4URL A;  1SIR A;  4GEE A;  3R7K A;  2XHT A;  4AWQ A;  3BMY A;  4L3Y A;  4GQT A;  3TUH A;  4YKX A;  3OMU A;  4GCZ A;  1IS2 A; 
#chains in the Genus database with same CATH homology
 1TBW A;  4ASA A;  2BU8 A;  1PVG A;  4NH9 A;  2QFO A;  3HYZ A;  4PRV A;  2H8M A;  4H81 A;  3TZ5 A;  1H7S A;  1H7U A;  4URO A;  2YE2 A;  2CCT A;  4MB9 A;  4XKA A;  1L0O A;  4P7A A;  3IED A;  4GGL A;  4URM A;  4LWH A;  3C11 A;  2YK2 A;  2Q8H A;  1OSF A;  2BU2 A;  1Z59 A;  2IOR A;  3VHA A;  3T0H A;  3LNU A;  1R62 A;  1BGQ A;  4YKW A;  4ZVI A;  3Q5L A;  4LWI A;  4MP7 A;  4EFU A;  2QF6 A;  4U7N A;  4YKR A;  4O09 A;  4XCJ A;  4AWP A;  4EEH A;  3ZXQ A;  1Y8P A;  3A0Z A;  3FV5 A;  4L8Z A;  4O05 A;  4NH8 A;  4XIR A;  2WI6 A;  3ZKB A;  1NHJ A;  2YKI A;  1UYF A;  4YKT A;  3G7B A;  1QY8 A;  2XX5 A;  3K99 A;  3B24 A;  2YE5 A;  1AJ6 A;  4MPC A;  2WER A;  4O07 A;  3D36 A;  4CWF A;  1TH8 A;  4X9L A;  4EGK A;  5CF0 A;  2XX4 A;  2FYP A;  1Y8O A;  2FXS A;  3VHD A;  2VWC A;  3R4O A;  3GIE A;  4HY6 A;  4R3M A;  2VCI A;  1YT1 A;  3TZ0 A;  1AM1 A;  4KTN A;  2AKP A;  5CPH A;  3C0E A;  4XTJ A;  3HHU A;  5D6P A;  4LP0 A;  2WI1 A;  2ZKJ A;  1U0Z A;  3CRK A;  4CE3 A;  3FT5 A;  3EHF A;  4E00 A;  2IOQ A;  2WI4 A;  2IWU A;  4BIU A;  1NHI A;  4LPB A;  3K97 A;  2BT0 A;  2JJC A;  2WEQ A;  2YKC A;  5FND A;  4CE1 A;  4LWF A;  4CE2 A;  5M4N A;  4BQJ A;  1BYQ A;  1YC4 A;  2YI0 A;  1Z5C A;  3T0Z A;  4EFT A;  1MX0 A;  1KIJ A;  3EKR A;  5M4K A;  4O0B A;  1Y4S A;  1I5B A;  5GGZ A;  2K5B A;  5F3K A;  2XDK A;  2WEP A;  1ZXM A;  4FPP A;  4HXW A;  2BU5 A;  5D6Q A;  3R92 A;  4JAS A;  2VCJ A;  2BRC A;  2H55 A;  2JKI A;  4JAU A;  4DUH A;  4CWS A;  2WI7 A;  4XD8 A;  4PU9 A;  1I58 A;  3LPS A;  1S14 A;  2QG0 A;  3RLR A;  2XAB A;  4KSH A;  5D7D A;  4ASG A;  4FMT A;  4HYM A;  1A4H A;  3SL2 A;  4R3A A;  2XJG A;  3O0I A;  2BYH A;  2ESA A;  1QYE A;  2XDU A;  5BOC A;  4XDM A;  4QPK A;  1Y8N A;  1TC6 A;  3A0R A;  3A0T A;  1TIL A;  4YKY A;  3GIG B;  1US7 A;  1UY6 A;  2YEF A;  2WI2 A;  5IDJ A;  1YSR A;  2YJX A;  1S16 A;  2XDS A;  3DGE A;  3H80 A;  1EI1 A;  2BU7 A;  3R4N A;  3MNR P;  3INX A;  3OW6 A;  5J6A A;  4MOT A;  4JAV A;  3EHG A;  3U2K A;  1AH6 A;  5CTY A;  4E01 A;  1YSZ A;  2YGA A;  4L90 A;  1B63 A;  3GIG A;  2BU6 A;  2ZDY A;  4BIZ A;  3CGZ A;  5CTU A;  4XKO A;  1NHH A;  4KFG A;  1GKX A;  3RLP A;  4CWO A;  4WUB A;  2IWS A;  3K60 A;  4L91 A;  2IOP A;  3D2R A;  3EHJ A;  3CRL A;  3D0B A;  3Q5J A;  1YC1 A;  2YJW A;  3O6O A;  4YKQ A;  2FWZ A;  4H7Q A;  2XD6 A;  4FCR A;  1Z5A A;  4YKU A;  2Q8I A;  4XIT A;  3RKZ A;  3CGY A;  4R1F A;  2YI5 A;  4FCP A;  4XIP A;  2BTZ A;  3KE6 A;  4CWN A;  5CTW A;  1ID0 A;  1YC3 A;  1UYD A;  2BYI A;  4K4O A;  4CWR A;  3GIF A;  4MBC A;  2HCH A;  2Q2E B;  3BM9 A;  1UYE A;  1ZW9 A;  4O04 A;  2YGF A;  5J71 A;  2XDL A;  4BXI A;  1GKZ A;  2YE3 A;  3OWB A;  3VHC A;  4ZKI A;  1UYH A;  2O1U A;  4Q20 A;  1ZXN A;  2UWD A;  3ZXO A;  4LWG A;  3B27 A;  4I3H A;  2XCM A;  4HY1 A;  4AWO A;  5CTX A;  1MU5 A;  1TID A;  4U7O A;  1UYI A;  2YGE A;  2YEJ A;  5IN9 A;  2YEB A;  5D7C A;  3O2F A;  2WI5 A;  4LWE A;  2YKJ A;  5M4P A;  1I5C A;  4HXZ A;  3H4L A;  5BOD A;  1I5A A;  2GQP A;  4E02 A;  2YE4 A;  1UYL A;  3HZ1 A;  2HG1 A;  5C93 A;  4ASB A;  3K98 A;  2ZDX A;  3TZ4 A;  4PL9 A;  4KQV A;  1BXD A;  4MP2 A;  2ZBK B;  1AH8 A;  5M4H A;  3G7E A;  3R91 A;  2O1V A;  4BQG A;  2Q8G A;  2C2A A;  5M4E A;  3EKO A;  2YEG A;  1YT0 A;  3HYY A;  2CGF A;  4HYP A;  3A0Y A;  1UYC A;  4WUD A;  1GJV A;  3B26 A;  2CCU A;  4I5S A;  2YEE A;  1JM6 A;  1B3Q A;  3VAD A;  2QG2 A;  3EHH A;  3OWD A;  3FT8 A;  2XJJ A;  2YEC A;  4NH7 A;  2WI3 A;  4MPN A;  3PEJ A;  1BKN A;  1THN A;  2YE9 A;  1EA6 A;  2YK9 A;  5FNC A;  4EGH A;  4AS9 A;  3Q5K A;  2BSM A;  3R4P A;  2YEH A;  3NMQ A;  4W7T A;  4YKZ A;  4V26 A;  3QTF A;  3B28 A;  1AMW A;  4L94 A;  3RLQ A;  1UYG A;  3U67 A;  4CWQ A;  4BAE A;  3T10 A;  3PEH A;  2IWX A;  2XDX A;  4MPE A;  4L93 A;  2FWY A;  4B7P A;  3JZ3 A;  4HZ0 A;  1ZWH A;  2YKB A;  3T2S A;  4HZ5 A;  5L3J A;  4QPJ A;  3HEK A;  4XC0 A;  2YED A;  1YS3 A;  4P8O A;  1I5D A;  1YER A;  3A0W A;  4KP4 A;  3INW A;  2CH4 A;  5FNF A;  4GT8 A;  4U93 A;  1YT2 A;  4XKK A;  2XJX A;  3U2D A;  3A0X A;  1UY8 A;  2YI7 A;  2CG9 A;  1KZN A;  4EM7 A;  5FWK A;  4EGI A;  4FCQ A;  4JQL A;  1YES A;  1UY9 A;  1I59 A;  3WHA A;  3OPD A;  2HKJ A;  3TTZ A;  3T1K A;  4H85 A;  2YE7 A;  3ZM7 A;  4XCL A;  1TC0 A;  1UY7 A;  4PRX A;  5IDM A;  1YET A;  2BRE A;  2BZ5 A;  2YI6 A;  2XK2 A;  2XX2 A;  4ASF A;  5D7R A;  3G75 A;  2XHX A;  1UYM A;  2YE8 A;  3B25 A;  4URN A;  4WUC A;  4CWP A;  2YEA A;  3ZKD A;  1Y4U A;  4KSG A;  2VW5 A;  2XHR A;  2YE6 A;  3HZ5 A;  4CWT A;  1U2O A;  1UYK A;  1Z5B A;  5M4M A;  2E0A A;  2GFD A;  4B6C A;  3WQ9 A;  4V25 A;  2CCS A;  4EMV A;  2PNR A;  3CWV A;  2YEI A;  3QDD A;  1QZR A;  4GFN A;  5F5R A;  4DZY A;  4XE2 A;  2YKE A;  3TZ2 A;  2EXL A;  2O1W A;  3R4M A;  1B62 A;  2Q8F A;  4XIQ A;  4URL A;  4GEE A;  2XHT A;  4AWQ A;  3BMY A;  4GQT A;  3TUH A;  4YKX A;  3OMU A;  4GCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...