2Q8PA

Crystal structure of selenomethionine labelled s. aureus isde complexed with heme
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
258
Chain Sequence
b'GEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant E
publication title Heme Coordination by Staphylococcus aureus IsdE.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
total genus 71
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8pA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8pA01
3ZK9A 5B58T 1MIOA 2XY4A 2MINB 4UDNA 1G21A 5BVGB 3AEQB 3MFQA 5M3BA 3MINA 3AERB 2PS3A 5CX1B 3K1AB 4WESB 5BVHB 4FNAA 1K7SN 1N2ZA 2PS9A 4N01A 1KAEA 4WN9B 4MLZA 4MO9A 2Q8QA 2XQVA 3AEKA 2OV3A 3AETA 4WZBB 1FP4A 5HDQA 2XDQB 3HH8A 5M29A 1H1LA 2XH8A 3R5SA 4INPA 4UTOA 2MINA 1M1NA 3MINB 5BVGA 4UTPA 4TKVB 3MWGA 3AEQA 5CX1A 3ZTTA 1XVLA 2OSVA 5JJ5A 1TOAA 5CR9A 2YNMD 2AFIA 3AETB 4DBLE 4WZBA 4MX8A 4TKUB 1H1LB 2XDQA 3U7QA 1M34A 3HXPA 3ZKAA 1N4AA 1M1NB 3TEFA 4TKVA 5GGXA 3PSAA 1K0FA 5FLYA 4NNPA 2PS0A 1K2VN 4PM4A 2AFIB 1QGUA 2YNMC 4G07A 3CX3A 2WHYA 3PSHA 4MDYA 4HMOA 2R79A 4NNOA 3PDIB 1M34B 3U7QB 4TKUA 1PQ4A 4FILA 3MD9A 4M7OA 4HMQA 3UJPA 3BE6A 4OXRA 1KAHA 3G9QA 3NU1A 1EFDN 3HJTA 1QGUB 4PAGA 3TNYA 5KOJB 2XV1A 5KOHA 4FKMA 4UDOA 3PDIA 4WZAB 4G09A 3TLKA 4HN9A 3ZK8A 3LHSA 4HMPA 2AFHB 5M34A 3LI2A 4FI3F 1KARA 4OXQA 5KOJA 4BBPA 4CL2A 5KOHB 1ESZA 5JOQA 2PRSA 3EIXA 1K75A 4WZAA 2QI9F 5M2QA 2OV1A 4OVKA 2AFHA 5AFSA 2Q8PA 1M1YB 4XPIA 4B8YA 5HX7A 1G20B 4LS3A 3AEUB 1QH8A 4ND8B 3EIWA 3MWFA 3AESA 1QH1B 2RG7A 3R5TA 2X4LA 2OGWA 5JPDA 3GI1A 4GICA 4H59A 4INOA 2M6KA 1L5HB 1N2CB 2ETVA 4WNAA 1MIOB 2O1EA 4XPIB 5KHLB 2PHZA 1G21B 1M1YA 2R7AA 1PSZA 1QH8B 1G20A 4K3VA 1N4DA 3AEUA 4ND8A 3AESB 3BE5A 3AERA 2WI8A 5JG7A 3K1AA 4H0FA 1QH1A 4WESA 5BVHA 3ZK7A 4IRMA 5GGYA 5I4KA 4LJSA 2XUZA 3AEKB 4WN9A 4WNAB 1FP4B 1L5HA 2M6LA 1N2CA
chains in the Genus database with same CATH superfamily
3URMA 4GKAA 2BGIA 4XTRA 4EPVA 4I81A 1DV2A 3NLLA 2ZT7A 3EJWA 3LDUA 1ADJA 3UHJA 1NRXA 3CG4A 2B36A 1F6BA 3ZWVA 1A9YA 2WLTA 2OV6A 1PWYE 3I9LA 2LUOA 4DCOA 1HEUA 4ZZIA 2RC5A 3T99A 4HX5A 4EOGA 5IYZA 2ZCUA 1KP9A 1N9KA 1SR8A 1T3TA 2IXFA 2X42A 2WD8A 4ZEXA 4EJSC 2XMQA 1FOEB 5ELXA 2P67A 2AZ4A 1MEJA 2VZLA 2GSDA 3ABOB 3CMMA 4G56A 2HUNA 1M2GA 1QRUA 3OPVA 4Z7OB 3MOGA 1D2RA 4JROA 4Y0VA 1SPXA 3JARB 3I2YX 2X0NA 5IYZB 3AJ9A 1E1LA 1QHIA 3IQEA 2Y0PA 4D9HA 1B8VA 1OLUA 2Q3HA 1VA5A 3W6PA 4YQZA 2EEZA 4E5YA 1ADGA 4E7PA 4N4AA 2W2VA 1PJTA 3DQZA 4ZT2A 1Z2NX 3N59A 4N03A 4RLQA 1KE2A 3QEAZ 3VPSA 3PR2B 4DDMA 2GYUA 4W6ZA 5K1ZA 5K6RA 3UT6A 1RE1A 2DHRA 3AUJB 5GGXA 3H16A 1KZ1A 1WB6A 4L9WA 4MYUA 4P0PB 2EJWA 1MDBA 1NRWA 1V43A 2WHYA 3MGBA 4QKQA 1ONSA 4HVTA 3RWMB 4JH0A 4ND4A 3L4KA 4BLOA 1I6KA 2F2TA 4QYSA 3K72B 3T52A 4D56A 2H2WA 2VPQA 1T26A 2WTNA 3PNKA 3WGUA 4R41A 3KDAA 3EH1A 3PPWA 5LNK1 4FNMA 4M9QA 1UZNA 1Z0ZA 4LRSB 4W6QA 3B3QA 1KVSA 2VYCA 3OQJA 4D97A 3IAXA 1X86B 3A27A 1IZ9A 3QEKA 1SC3A 3M83A 3R4VA 4K26A 5I4BA 1IBKB 3W2HA 4W5HA 1V0JA 3UJCA 4BLVA 2HBRA 5L53A 3ER6A 1UKVY 1NV9A 1UFQA 4QRDA 5JSQA 1ENOA 3FPBA 4RV9A 5CVDA 1IBMB 1K88A 2FJUA 1HRKA 1J2YA 3MELA 1TUBA 4MWBA 3HO1A 2NXEA 2PSFA 4KFUA 2GJ4A 1AY0A 1HNWB 1AA9A 3BMOB 4IZOA 1RJGA 3M6LA 4I19A 4IWYA 3VZDA 5K8CA 3ZHCA 4EX7A 3MA0A 4D98A 2WG1A 1SQ5A 3GOQA 3VYRB 4P7JA 4E2ZA 4BPBA 4L4YA 1Q92A 2WY2D 3TQQA 4P7KA 4IICA 4OHRA 1PJAA 2R00C 1TK3A 4RBNA 1TUBB 1LBTA 3DW3X 4R9VA 3C3MA 4KNYA 5LYYA 2QV0A 2ZIXA 4CHTA 4OHKA 2Q7XA 3HMQA 1ICIA 3BMNA 2DUUA 3WLEA 1WE2A 4EMUA 2ZROA 1HORA 2DFKB 5T6BA 1KFJB 2HLHA 4XYBA 1JKJB 1T4MA 2ZKIA 2BJWA 1VKNA 1GZ4A 2KBEA 2Z58A 2ASVA 3KL2A 4XWAA 3GVXA 2YOGA 1XTZA 2ETVA 2ZIXB 3C3CA 4FOOA 5CDFA 3AM5A 2WHPA 4RH3A 2BLLA 3ZWQA 3H3FA 3V8QA 3SM9A 2XE8A 4HQ0A 1KWGA 3OEEA 7GPBA 3PGA1 3HFSA 1KI7A 3P0IA 4RGVA 4YRLA 3D0QA 3R7LA 3BRCA 1PR9A 3FBGA 3PEVA 1E96A 2WIJA 3BQNB 2Q50A 3PJDA 2WKRA 4D3FA 4IOJA 3VI3B 5CM9C 4CQMB 3EOAI 4HPWA 2XUZA 3DAGA 4L2IB 4UNPA 4G9BA 4URVR 4D9IA 3I0NA 1E6WA 4YAJA 3KQVA 4NE9A 5L3RA 1HNXB 1H6BA 4OHMA 3ZLVA 2ZDHA 1ZJWA 3RS5A 1Q83A 2BGKA 2AC2A 1L1FA 3OFVA 4M46A 2WMOB 2OCGA 4CU5A 3HYNA 1ZN2A 1E2QA 4F2PA 1E2HA 3D0RA 1KDYA 1XXLA 3S27A 3KB8A 1E7QA 2EF1A 2HA2A 3L1JA 2LCFA 3N6XA 2B2CA 3NYIA 4I2NA 4QWWA 4BJHB 2AVNA 4GSYA 2Y68A 2VRBA 2AT1A 2FRDC 2IF0A 4NG4A 2A5JA 3C7CB 4RKWA 4O59O 5DTMA 5JY6A 1PNRA 2AQ8A 1NBWB 3NAGA 3JQEA 4FN4A 4GBGA 2IZOA 2ZITA 3GD5A 2YUTA 3UMJA 4BQEA 5HZGA 1PG2A 4AJKA 1ZK1A 4WWHA 5JDIC 2ZI3A 3L4EA 2XVAA 1J2TA 3MMPA 4KKVA 3SFZA 5H3CA 5EIAA 2GD0A 4DJDC 1WVMA 4O29A 1VRCA 1MAWA 4HXGA 1BYIA 4MIOA 4RD3A 5F35A 3TW0A 1K0FA 2ZU6A 2FPIA 3OQMA 1E2EA 1WHTA 3EQ6A 3KS9A 4MW0A 4DCPA 3C74A 1T4GA 4CEIA 4DARA 1T6YA 5H59A 1RLJA 5IKMA 2I2AA 2II6A 3FJOA 3R6TA 4EBBA 4TMFA 3DM5A 2P4UA 3GZNB 3OJEA 3LBFA 4RXTA 4XM1A 4X6XA 1C2YA 2FPIB 4WUTA 1WHTB 2FK8A 4X1KB 3Q7SA 3X1ZA 3GLFE 3HKBA 4JLSA 1R10A 3ESCA 2QV7A 4PQGA 1JFTA 4FGUA 3L4BA 3PD0A 1QH9A 5L6LB 3H2SA 4R68A 1IXYA 1EK6A 1NVFA 3R0XA 1NPYA 1RWNA 3VSAA 1FDSA 1J9GA 1SWWA 2HMSA 3LWNA 4AB1A 3WIBA 1Q0TA 3AVXA 2ZUFA 4L72A 1OW3B 5M34A 1NXPA 5F5XA 2YWXA 3DPIA 1A9OA 4FDAA 5IJAA 3WXBA 5BUCA 4EVIA 4PLFA 4BBPA 3EFBA 3D8SA 5JCOC 3BXOA 4FFNA 2GO7A 3MHPA 4YRQA 2HADA 3NWJA 4EY8A 4YUVA 1X1QA 2X5KO 4LYHA 3WWCA 7ABPA 3KJNA 4DVJA 1KSGA 1YGPA 5KCMA 4CCYB 2JCVA 1EFRA 3I5AA 1V47A 3B1FA 3KHTA 1BQEA 3PQ7A 3ZDAA 5JS2A 2HX1A 1W9HA 4M6WA 1J8QA 3VAAA 1QONA 3AJEA 2AGVA 1W2HA 4KXNA 2JBWA 1XU7A 1BXKA 1VCMA 4RSHA 5EUMA 4WOCA 5IANA 3JAMA 4RELA 1NOIA 2JIMA 4KXQA 5KYYA 3A1TA 2AK3A 2GVDC 2K4MA 2QIPA 2TMYA 4UAVA 3RB8A 3RFFA 1LF5A 3HP1A 4YAIA 2PX2A 4LHVA 3AVOA 3PVSA 4IGIA 3RAPR 1PP4A 4RZ2A 2GEKA 1LPPA 3H3XA 2X23A 5DYTA 4YP9A 3E1GA 5KYYB 1QH1A 2WJAA 3DBRA 2NO6A 3KTAA 3RS2A 3PENA 1FPQA 3ESQA 3G2IA 1MAAA 3DTTA 4O4HF 3UMSA 3DZDA 4I3HA 1B6TA 2OZLA 1HLFA 1Y3CE 2IS4A 2C88A 3G9UA 3QVGB 5EE5B 4G5FA 2Q28A 5TRTA 2B2NA 2C9BA 2VVTA 4KACA 1E0DA 2XVZA 1YIOA 4TWIA 1P8AA 2MOKA 4RKFA 5BSRA 3ZGOA 3FF1A 3DBRB 3FDZB 3V1YA 2O0JA 1ISPA 3P19A 4ZJUA 4Z3OA 1UAGA 2JBHA 4FTWA 4QYXA 4PEVA 4OFXA 2Q8QA 3I01A 5DN9A 1T5HX 2Y67A 1QGOA 4AKTA 1D4ZA 3DUWA 3OZSA 4TXJA 4BGEA 2OZLB 2X0EA 3H7IA 4RLSA 2YJZA 4L5BA 4AMGA 4AWBA 2ZPTX 1RQPA 4QBKA 4CUJA 2QRQA 1ORRA 1RHKA 3FUTA 3OTGA 2VK8A 1QP8A 4OJMX 2EZTA 3I62A 2EZ8A 3MWEA 4U2FA 2RKBA 4K6KA 5G53C 3E8SA 3WFJA 2C1XA 2J9GA 1E3JA 4CM3A 4ZI3A 2XAUA 3HADA 3KDPA 4R81A 4TMWA 1K68A 1SOVA 1U2ZA 4HAZA 4U7PB 3S68A 3WYDA 4BZQA 1G4AE 4CG3A 3G7NA 5BW8A 3VZQA 4Q01A 4B5LA 5J3JA 2ZJ1A 3CXRA 3UGJA 4IZIA 4QOHA 3JQFC 1U4NA 5C0OE 1J42A 5J23A 1B41A 1U5BB 5AVJA 5KNDA 1P45A 1PQ4A 1TZCA 1K8QA 3KUCA 2IBMA 2WZCA 1ECLA 1M2EA 1OFTA 1FBNA 2QPLA 3A9VA 3HHEA 1H65A 4OHFA 4X7RA 5AJVB 4L1KA 3X1JA 1F8YA 3QA9A 4ZT4A 4P5PA 4BMVA 2PLFA 3EF0A 3FVRA 3COWA 2PWZA 3C15C 3QFRA 2VHXA 1FYFA 2HL6A 1ZU5A 1I9CA 2RH5A 3F5MA 4IG9A 1P2GA 1V39A 2Y6VA 2EKZA 4TSFD 1JHVA 3H83A 3R7FA 4COOA 5IXYA 5KNCA 4AECA 4DL9A 3R5XA 1QGAA 1IEXA 3O74A 4RXUA 5L4SA 1JH9A 2DPLA 1NOKA 2OORA 3QX9A 3ROKA 3O2NA 5AUPB 3KHSA 4B48A 2WTEA 3KG2A 4ZYVA 3TLEA 2KQUA 3CG0A 3C43A 1QO7A 2XVMA 1SU7A 5BWNA 1OXVA 1PG5A 2OOSA 3SIWA 5MGNA 2VQSA 1T4DA 3BRSA 4FJ1A 1F2TB 1AB6A 1ZAKA 4REOA 4ZEMA 3RHFA 3RVNA 3NNNA 4Q3KA 5IULC 5K0ZA 1GGNA 3E82A 3RFUA 4URFA 5G4KB 4AYTA 3VOTA 1HE8B 2CF5A 3KT0A 1Y6FA 1WMDA 2D8AA 2IUTA 3EGOA 3P9ZA 3GP5A 4ISCA 3IX7A 4UVHA 1KGSA 5ILGA 2XUOA 2F3QA 2NLOA 4MVXA 2R0QC 3A7DA 3TTTA 2ISCA 2DGDA 1YVPA 3VR6H 1QB8A 4E5MA 4OAOA 4G0PA 2PJDA 4PN7A 4HRYA 2HD4A 5TX7A 4PBRA 2XKKA 1AXRA 2F9MA 2R65A 3LDHA 4KFTA 2BCGY 4PONA 4RABA 1WB4A 1Z6GA 3JZIA 5JNVA 5CDTA 1HYQA 4O6VA 4PNEA 5L3QB 4QEKA 1IZ7A 5F1YA 1R5JA 1U4SA 2FN4A 4KK3A 5JATA 3SN6A 1D4OA 4UMFA 5SYMA 1REQB 4IYRA 4K81B 4WA8A 3A3KA 2ZIEA 3P20A 1T5BA 3NKLA 2V7GA 1RI4A 1DRWA 3RU2A 1L4BA 2PX6A 2AC4A 2UYQA 3R75A 3U3JA 4PCLA 2L17A 3FR7A 3WHLA 4C6HA 5K99A 3R3ZA 4NLLA 3N2GA 5JVDA 3B3GA 4L15A 3DVAB 3SPXA 4Q9JA 4YRBA 3L1VA 1BIFA 4EI9A 2VSFA 3MIIA 2DQZA 4DV2B 2IP1A 1GAQA 3NUZA 1XLTC 5KI6A 1MJ5A 1PZNA 1E20A 1ZQ1A 5BW5A 3TQOA 3LBNA 4S1TA 3N87A 3QELB 3C14C 4K88A 3BIXA 5CH3A 4J3JA 5HILA 3A1NA 3UO8B 2DR2A 2W2NA 2H0QA 2QTGA 2FHPA 1NVDA 3WGGA 4CV1A 3UCFA 2AV6A 1MNQA 1HY3A 1RM0A 3B9BA 2UYOA 4HNHA 5KTKA 3E61A 3PD1A 5F2NA 3IAM6 2PT5A 2HSJA 3C3EA 3FVWA 5AJZA 1A5AB 2HDOA 1N0IA 3GRUA 4EYQA 4FMBB 5LVAA 2XCSB 2ZI7A 5DNCA 4HSEA 1WSWA 5D00A 2D4HA 3EX7C 1OWLA 5JALA 4RVDA 2OV8A 1Z0AA 3W1EA 1U8YA 3CNLA 5ITZB 1ECFA 4LE2A 2QWXA 4MUEA 4NHOA 4B85A 2ZS8A 1H4QA 2IHNA 3GX1A 4Q21A 1QK5A 1AGPA 5EZ5A 4JI4B 3CF0A 3QU5A 4BVKA 1Y4AE 4PNZA 4TMVA 4INJA 3IIIA 1UMDA 4NBUA 2MSDB 2ANCA 4A92A 1FLVA 4CV3A 1A2OA 3TR5A 2AG8A 3RVBA 5BUQA 1JR3A 5A1TA 3H86A 3CKMA 5AKEA 5HGXA 5ALKA 4BATA 2GDJA 2OVFA 2Z2IA 1M33A 3F6RA 1DU4A 3CIFA 2Q4TA 5CVCA 1L1EA 4ETMA 1NVBA 1UMDB 3EEBA 1P91A 2O0MA 2XNJA 1QLHA 3NGMA 3I1YA 4ZV4A 5HJEA 3SX2A 2PMDA 3HJRA 2JCBA 4X94A 2X9VA 4F8YA 4GI5A 3GDFA 5JH7B 5ALDA 4KMOA 4Z7QB 1JZQA 3R9XB 2O8VA 3SKYA 3NDPA 2ICAA 2FN8A 3M5CA 3EZLA 1C3EA 2WFLA 3V3KA 1PTKA 1RHUA 1YC2A 3QPVA 3L41A 1IJBA 1UBKS 1Y6QA 3LUAA 1LB1B 3LLMA 4MP6A 1Y8RB 3L92A 4BUZA 4DG5A 1E0AA 2YW2A 1OA1A 3IFSA 2A0FA 1UWLA 5IK2D 4DV5B 2I6FA 2R11A 1CY8A 4LRTB 3S2IA 2PY6A 4RESA 2RH8A 2QTMA 4BY9E 1PZEA 1M6NA 1IVYA 4Z3DA 3VKFA 2FKAA 3UB4A 4Y30A 3UYKA 3F8SA 2EC5A 2B61A 3VNAA 3ZU6A 3G5LA 4NS4A 4RKQA 4F60A 2O07A 1UBCA 1LI5A 2CNWD 1US8A 4QDXA 3TW8A 1P3JA 2G5TA 2DC1A 7AT1A 1OV4A 4PCAA 2WPDD 1V16A 3SDZA 2Q3LA 2E5FA 2C2BA 1MIOA 2I80A 3BWBA 3TAUA 5D3MA 1EZ1A 1T34A 1CFJA 3FZNA 5FUWA 4DM4A 2HQOA 3EPRA 4ECEA 3MFQA 4D25A 3BFPA 2HJSA 3K09A 3OPQA 3R9WA 3TGWA 5C18A 5KYKA 4DJJA 3M5DA 3TW8B 1R8QA 4IWXA 4NH0A 3C6QA 1KAMA 2FW7A 1V16B 1P3DA 1MX1A 2YR0A 3PTLA 4WZBB 5EUQB 4LC9A 3JZAA 1N25A 5D3MB 1ODCA 1YL7A 1Y6RA 4TTVA 5ECGC 5KNLA 3I73A 4RVGA 4L3OA 5EHQA 3O4IA 2PGAA 4PZPA 1O58A 4P81A 5IG2A 4AQYB 2PZLA 4HB2A 1MFZA 1FE8A 4J1QA 3ILYA 3GUZA 4UHDA 4MKHA 3RIEA 3R23A 2CSXA 4KPUA 1ENPA 5CLLA 1OFGA 3GPIA 4HYYA 1JDUA 2AFIA 3EIQA 1PVDA 2VEOA 3TLZA 3ZIAA 3QXSA 4KW7A 4U00A 5FUBA 3IT0A 3BUSA 4YMWA 2MR6A 2C07A 1FDRA 1Z8NA 5BRAA 2BHNA 4RHEA 1H8ED 4AULA 4FZ5A 3STWA 3RAFC 1CUWA 4I4NA 4W5WA 1XG5A 3M6FA 4CT0A 4YDSA 5J4HA 5ARDA 4KPUB 1MJHA 4V39A 2AFIB 4AJ1A 13PKA 4I4IA 1JG1A 2WUWE 4BQFA 3IQXA 3X3HA 3D6FA 5HR5A 1DKPA 4BZZA 3JALA 1Z06A 2IH5A 1D0SA 1BG6A 1DZ3A 3NRJA 1V8DA 3ON5A 3PKIA 4K9MA 3DWEX 2YHBA 3OU2A 3I2GA 4XQGA 1GDHA 1NUTA 3TOSA 1J39A 4D5GA 5CIYA 5KOJB 1SOWA 1ZA2A 1GNRA 3WAKA 4K9PA 1K6EA 5I01A 3JALB 3IEPA 4ZGBA 2G28A 4LK2A 5M04A 1EHCA 1X3LA 4F3CA 1F06A 3K05A 4JHXA 5IJZA 5ALUA 3JQBC 1SZDA 4ICIA 4NJMA 5GVRA 3RT7A 4DV6B 1NOJA 3PA6A 4J90A 1PJLA 5K0LA 4BQOA 2PKYX 1E7YA 4BUJA 1PGJA 4YDQA 4K6HA 2OFPA 3BXPA 4LDQA 4MJXA 1GUYA 2FJPA 4CG1A 5ARBA 1OYVA 4TT8A 2XW6A 4MINA 5AM0A 4OGKA 4B35A 1Z7GA 4TVBA 2B8WA 5C37A 3DAYA 4WJKB 4G63A 4FYMA 5I8ZA 4TX1A 4NJMB 4NV1A 3ISTA 3FDJA 4X7BA 1OV6A 2O8CB 2PQMA 4G4IA 3DFIA 4H1VA 1OI7A 1DWUA 1NNUA 2F64A 3ADKA 4K9RA 1UWCA 1QP0A 4W9RA 3K70B 2IZ6A 4QUIA 2QQ5A 2J32A 3B2NA 3WK5A 2AZXA 4J29A 4JVMA 3D2BA 3LUKA 3UICA 1GP2A 2IH2A 1PJSA 3B8HA 4C7MA 1SHLA 5G02A 1TL7C 2M2IA 3FFXA 3JQ9A 1EP3B 5ECWA 1H2ZA 2IEDA 3G0DA 1BCRB 2M98A 1J8MF 4R1UA 3SZ3A 1UT6A 4D9MA 2DXIA 2A92A 3ZKWA 4XIFA 5JZ9A 4G4SO 1PAUA 1P0IA 2QD3A 3H65A 2NO4A 4ARSA 1Y3DE 4KMMA 2A4KA 1P7WA 3LO5A 2VWGA 3ZI7A 2GKSA 4OD0A 5EJ9A 4GRAA 5FAXA 3BAZA 1U9YA 3QWBA 2QM3A 2ZBQA 3GD7A 2B1QA 2PK3A 4KYVA 5KNBA 5JLAA 3VBEA 3WKAA 5EFZA 3UM9A 2PA0A 2XCRB 4M36A 3LZCA 3KQSA 3N8GA 5I3ZA 1SHUX 1FQWA 5IPFA 4YROA 4XTCS 2B3TA 2D1YA 2ZAGA 3H5OA 3QVTA 2FWIA 2JLBA 1TLTA 4XB1A 4Y0AA 4DA7A 3BS4A 2C2ZA 4PLZA 1E99A 3ZVKA 3LS2A 5DIFA 4KLRA 3M4YA 4YVFA 1C50A 3MQ4A 2PGNA 3QOWA 3PC3A 4MVJE 5BORA 5IJWA 1NQAO 3I28A 4IFBA 1LV8A 2XRFA 4ARVA 1E64A 2PR7A 4ZI5A 1ABBA 5BVGA 2RGNA 3DR3A 3I6QA 4J49A 5KWIA 3WGJA 2UZIR 1P77A 3DSRA 5KDDA 1OU0A 4FN5A 4OOEA 4URZR 1G0NA 1EE9A 1G64A 1TCCA 3ANXA 2Q7OE 1ANKA 3NHAA 2CB0A 1QTRA 2DAPA 4FGWA 4JL6A 4RZQA 3ZWAA 3PWZA 3COPA 4MYTA 1MEOA 4MIYA 3E8XA 1ZR4A 3H05A 3HDJA 5LQCA 4OU4A 4QJ4A 5FOXA 3PRYA 3DKPA 1R0LA 3G2OA 3ICOA 1ESDA 1L8XA 3KELA 4H16A 3WGNA 1JEEA 2NZJA 4C6TB 3ADDA 4PM4A 1S2OA 5F1OA 5TB5A 2CBZA 3QI7A 4TQUS 1PN3A 4LIPD 4RHCA 2YCBA 3TM4A 3UJBA 3VYWA 5BMOA 4WXHA 2AN4A 4X3PA 4KXLA 3CY6A 2PT9A 1BOFA 2CFIA 2H3HA 3FTDA 1E6MA 3ZJTA 1B23P 3KK0A 3Q10A 3GP3A 4ZKEA 3AIMA 2JLYA 2X5XA 5K2OA 2BGNA 1NC1A 4L8FA 2QENA 3QXCA 4PAGA 1LBQA 4R1SA 5FLKA 3Q7EA 1BJTA 5EMMA 4CFYA 4F4FA 2X15A 1U2GA 4YIHA 3D64A 4TXNA 2SNIE 3TJRA 2C4TA 2C31A 2F3TA 3GPCA 2YJTD 1XSEA 1LPOA 2VPZA 4HI0E 5LZ2A 3JZFA 4CKCA 5I4CA 4WADA 2ZP1A 5JZBA 2PUCA 3LU1A 1I3CA 1GV1A 1U2QA 2XLCA 3KJEA 4MB2A 1EXVA 5EVJA 4AKGA 3KTOA 2QL7A 3K6JA 5KYUA 2ZJ3A 3G1WA 3R9IA 1V7CA 1W5TA 4ECAA 3RF6A 1PW7A 2IKSA 4B4VA 5LBUA 4CKCB 1SBTA 8LDHA 3HNPA 3MOIA 5IJXA 2PR2A 3L0OA 1X3SA 2JB9A 4LS3A 5T4BA 1NDUA 4I1IA 4GVXA 3WQRA 3U7GA 1KY4A 5KYUB 4LNHA 1C1HA 3EMDA 4BYGA 4ZDIA 2RG7A 1IJFA 4YRFA 4ARCA 2B35A 1ONBA 2VRCA 1XK7A 3GN1A 3HU2A 3BSSA 4KH1A 2H5JA 4R8MA 2O7VA 4Y9RA 3S2UA 1FP7A 4M2LA 4LWOA 2Q9AA 2ODAA 5A9RA 4FZJA 3D02A 3IO5A 3I4CA 3S29A 2B34A 2XYHA 1U0BB 1KPGA 1WB5A 4WAUA 4Q3OA 5HM8A 4P38A 1DUVG 3AUFA 1Z5OA 1Z29A 3VJMA 6GPBA 3R7WA 3U1BA 3QE0A 1SMKA 4C2UA 1GZDA 4XVCA 1Q1ZA 3AJRA 3QQPA 1LLUA 4CN8A 4N18A 4WNYA 3HXQA 4G26A 2XTJA 2HAEA 4HX9A 4NDZA 5B1EA 3CLRC 4L8WB 4Q7KA 4QFBA 4R0VA 5FLXA 3SVLA 1HE4A 2H2HA 3AEQB 1D09A 3KSAC 1EH5A 1PQPA 2F9LA 5J4LA 5JYDA 1PQWA 4MWGA 5DGCA 4WXYB 2JI6A 3MWYW 4PXAA 2X2EA 4Q1EA 3RVSA 4UNRA 2DWPA 2FR0A 3FG9A 2ZE6A 2VYQA 2ZJ2A 4B45A 3OCXA 1G3QA 3U7RA 5EP1A 2EP8A 4BPRA 3M6AA 4C0KA 3WC4A 2F67A 5K6TA 3USZA 1I7DA 1CZOA 2QTBA 1NT4A 3FGPA 4KEAA 3EOZA 4J0FA 1B00A 5AKLA 2CXNA 2OPBA 2R7KA 1C4WA 4H3VA 4D0RA 1U2SA 1FLDA 3UMFA 1XMOB 2C2KA 1IBSA 1TEHA 5LZ8A 4AZ0A 1JZTA 4GOOD 1YE8A 3JX9A 1OH7A 4TKUB 4UASA 1L7EA 4LWZA 5J9FA 5CCDA 1Z36A 1H94A 4ZRDA 2HGSA 2R84A 4JQOA 4RVCA 5H83A 3DEZA 1EX7A 5EFOA 1TU0A 4JC8A 2DPYA 3CNEA 3K5IA 1GKIA 3MXTA 4IDPA 2JFUA 3RRBA 5HYVA 1O8BA 4BMOB 6ABPA 1FA9A 1TCAA 2JAUA 4OMDA 3RUPA 2IEYA 2ZWIA 4D3ZA 4RJTA 1RYMA 2Q5EA 3MD9A 3O1HB 3T4UA 4MQMA 1E9RA 1BWQA 1TADA 1SELA 3BE6A 1N6HA 3MTDA 1H6AA 4G36A 3RS4A 1F4PA 2RJOA 2XRMA 1XAIA 1Z25A 2WF5A 3ZOZA 1TKBA 1VL2A 4AP5A 1VZ2A 2FVYA 3QBJA 4KMRA 4QGHA 2WPNA 3W7VA 1ZOLA 2IIVA 4EKGA 2C29D 3IP8A 1RR6A 1UXHA 1SCBA 2CGEA 2DPGA 5LLDA 5JFOA 2CSUA 1YT5A 5BR8B 4GLOA 4D9JA 3AY6A 3ZD9A 4KN5A 3BG5A 1KE1A 2LV8A 1IATA 1JTEA 3BB1A 1HI9A 3B9RA 1IU9A 2IHJA 1EM8A 1XTBA 2QG6A 2VSOA 2WFMA 2ZTHA 3COZA 3M8KA 1NJ5A 4LDPA 4DG9A 2XD4A 3KXIA 2JLSA 5KJCA 1SG9A 3PI7A 1TAQA 3A25A 1RXUA 3DZKA 2B37A 3FE2A 1VP9A 2C61A 2QVCA 2AQHA 3U26A 4DA8A 4LJKA 2QX7A 4UOEA 5DW0A 3C8UA 5G3ZA 4CT4B 4ZJPA 2Q27A 5FR1A 1WCWA 4LFCB 4L0MA 3RYHA 4JGBA 2DEUA 5AKHA 3NWOA 4C4TA 2J0UB 3CEAA 4ZJZA 2BMWA 3E18A 2DJ5A 1CNFA 4NYJQ 1LI4A 4CL0A 3T0FA 1YZTA 5D6NA 3P2YA 2JJ1D 3MWJA 5SV2A 1KFEB 2VOEA 2IZ0A 4Z2YA 1PGOA 1GITA 2PLRA 1OBCA 2G1JA 1JWBB 1W4AA 3RYHB 5A1JA 3SC2A 5EJ5A 4RY8A 4LHXA 1KETA 2ZWPA 2CNNA 3QTLA 1G19A 1Z5VA 4G37A 4LJSA 2O3UA 2W48A 4C30A 3ZV7A 1LA2A 3D3NA 1VLLA 1W4RA 1WXEA 2ZQ5A 3KB2A 3RUDA 3B5JA 1AURA 1EQ2A 1XE3A 2ZVQX 4OO3A 5F1KA 1XFDA 3ZE6A 1I4LD 3SC2B 3OOJA 4X44A 2NTYC 5F78A 3T5BA 1UOOA 2E4XA 3KUKA 5KQPA 4D9NA 1NE2A 1E5XA 1XOIA 2E85A 1HF3A 2LCIA 3OETA 4V1CA 3D59A 1A4UA 2EBUA 3MNFA 5F2OA 5GZ1A 1NONA 3CE6A 3AH8A 1P3Y1 4DA6A 8MHTA 1UQUA 2XZPA 2O2ZA 3QPCA 2QTTA 2FU5C 3TLYA 1CDZA 3PITA 2IXTA 3OX4A 1L7NA 5HS6A 4DHWA 1H22A 4F3TA 3TQTA 3A2MA 3GAZA 4L76A 1U0EA 5EZQA 2JARA 4V1CB 5KTPA 1CQZA 4ZWNA 1SVKA 1OR8A 3H2BA 4YAOA 2BHSA 3W2FA 2ET6A 3KPYA 2GYYA 4Y3UA 4EA7A 4Q6BA 3CNOA 4BO9A 1V95A 2W90A 4RDIA 3VHRA 1DKUA 2OCYC 4TTRA 3VBCA 4XWKA 1J2RA 5JZVA 3IAM1 5B6PA 2P6UA 1K2VN 1M0TA 2PYZA 1PD1A 2VRWA 3BWEA 3EGCA 2NU6A 4PZZA 4WZBE 5FTMA 1TEZA 1NTRA 5BPFA 2OHJA 2OCIA 4RJLA 3OSUA 1DAIA 2C78A 2WBLC 5JJKA 1QRRA 3BK2A 3ZW7A 4MULA 2QRVA 1M0EA 1HLPA 4ETNA 1EFAA 3AHCA 1QIIA 3P0HA 1FDUA 3UHFA 1MIHA 5JARA 4DCSA 2JHGA 4D0GA 4Y1EA 1IOZA 1YBVA 2C58A 1VKRA 4HDNA 4UUPA 1T4BA 3BCSA 3ZY2A 3EFHA 3GH3A 3ESRA 5CIQA 3WRVA 3OPMA 4M1OA 1YMVA 2G7MC 4PF1A 2QRVB 3SU8A 5IMBA 3ILHA 1V3VA 1TC2A 2DUJA 2I1WA 3QVMA 5BY2A 2QLJA 2L69A 3T61A 4U7FA 2HWXA 2F1KA 3UUEA 1W5AA 4H0NA 4HDNB 1RC0A 1VYUA 3MJTA 4FEEA 4JCCA 4ZMRA 4O1HA 4AP9A 1TZMA 5EA2A 4V0LA 1E2NA 3AR8A 2ID7A 3VKHA 3VR3A 4NOJA 3RWOA 4A6XA 4XJSA 2WUVA 3LCRA 2GZ1A 1ISFA 3N74A 5H3LA 4DNQA 3WA7A 4Y9SA 3K6SB 2BL4A 1UOQA 4YCAA 3U1VA 2Z3VA 2FWJA 1HR0B 3SLRA 1T5DX 3KR0A 4QXMA 2C97A 2C3UA 4FXPA 4UDXX 1USKA 3C6MA 4ZVSA 2WAXA 1DKNA 1E4EA 1L2TA 1Z6QA 4GC9A 4MP8A 4I6EA 4RYDA 5BSTA 1SQFA 4F1WA 2FQXA 3RKSA 1RYEA 2ZRKA 5AVZA 1DPFA 1GCAA 4J0QA 3N7UA 1KFBB 1JWAB 2X2PA 5L40A 1E2JA 3KD3A 3VAYA 1RHJA 4O8ZA 4B44A 5IDXA 1F8XA 3S1LA 3I6ZA 1DC5A 4A82A 4PW0A 1FTQA 4MMZB 1UEIA 5ERYA 5JG7A 10MHA 2F1HA 4LRUA 3STTA 1SCJA 1JKFA 1OJLA 1Z37A 3BGIA 4MV4A 5ECYA 5I7RA 1KKUA 1CQWA 4J0KA 1U90A 4UDYX 1NATA 3A6HA 3D1LA 1U7PA 2YWFA 4TOIA 2HSEA 3CLUC 1J8VA 4HEHA 1GT6A 1YNOA 4JP5A 4YK7A 4CM9D 4KR6A 1OXUA 2C4HA 2FZVA 3IDAA 3PXEA 4X6LA 3TX2A 3KETA 1ULHA 2J7PA 1PUXA 3IA7A 5FOSA 3R74A 2F8MA 3Q1KA 1PJRA 3MQFA 4LI0A 2GLUA 2IYUA 2ZJ4A 3OVMA 2D1RA 2VJMA 1Q1QA 1LXCA 3D1VA 3GNQA 4MIKA 3SEAA 3S2EA 5JMOA 3QMWA 3TF5A 3FSGD 1D07A 3FETA 1ZR2A 1R6TA 1RW4A 4JUDX 4EQZA 1Z74A 721PA 1GRVA 2OD9A 4PPYA 4WACA 4WL0A 1VIAA 3U49A 1KEVA 3R7NA 3WVNA 2C5HA 3K9HA 3BL5A 3I9OA 4BLQA 2RAVA 1YUMA 3BC1A 3E3NA 1RABA 4RE6A 3DYBA 4WVFA 3OH8A 3MXOA 5K6AA 5BOVA 4FS3A 4DM7A 3HSKA 4LF5B 4NQRA 2IV7A 4C22A 4CTNA 4OCZA 3L7BA 4I1YA 1CNEA 4XGNA 1N4AA 1L5OA 1QG0A 1YONA 3JD3A 2Q8NA 4BP9A 3PSAA 1Z0FA 2N47A 1O0BA 3NIGB 2PMFA 1M6HA 2CVQA 2FMUA 3QLUC 3CQ9A 1P9OA 1XZDA 5F73A 5D85A 4EG8A 5HBRA 5CURA 4C6RA 5JASA 1NVXQ 1JFFA 3V97A 1NUAA 4KPYA 2I2DA 1RSZA 4P4TA 1DO2A 3OTQA 2Q6IA 1M2OA 2RGCA 3NTQA 4P3XA 1PJQA 4EMSA 3D6JA 2WOJA 4P34A 3LSYA 3BBPA 5E1BA 2PE5A 4QU8A 2P6OA 4AKHA 2EATA 2WMDA 3JZDA 4DMHA 4DJAA 1M66A 3MRVA 5EPUA 1NASA 2PRJA 3BF8A 1G4HA 1C7ZA 1WBDA 1ULTA 4A8JC 2IL1A 3O93A 4RQBA 3R5HA 3RGGA 3L0CA 3IJPA 2ABWA 1YS9A 2WU4A 3IB6A 1H4SA 1DCKA 3WLTA 3CE9A 2VOJA 3KQMA 2H4XA 3A3YA 3I72A 4F9FA 4TSRA 1RZRD 2H48A 1NBAA 2RHTA 4G89A 4YT5A 4MDEA 5KUTA 2B98A 2JFQA 4ENWA 1HFWA 3RVJA 3UJ3X 4LOLA 1HNZB 4QIHA 2DFVA 1TF2A 3TE7A 4C03A 2FMIA 3EZ2A 1KC1A 2R1VB 1GG9A 4UUOA 2NQ8A 2XHZA 1M1YB 4PYNA 3RG8A 1RQRA 3EE6A 4G0UA 2GX6A 4P6VF 3UWOA 3KUXA 1R1DA 3MMSA 2V3VA 3X2EA 4B31A 3AKZA 4BNDB 2XIQA 2JIZD 3C3XA 3FHLA 2Z6QA 4QLOA 1N6KA 1SUFA 3G23A 4PLTA 4D8UA 5E3HA 1TI7A 1UC8A 1N9GA 5CHYA 4QPDA 4I5EA 4II7A 1KR5A 5KTNA 1XF1A 1VOTA 4I4TA 2YV3A 4TQ9A 1EUDA 3E9ZA 3SF0A 3AZQA 4ZVUA 1UPUA 2Q99A 3IJEB 3ZWBA 1OFIA 2LR0A 1USVA 1VI2A 1ZMTA 1UXKA 1PR2A 1RI3A 1T2DA 3FFWA 1GIAA 3PPIA 4N3NA 5EE0A 1UCFA 1JNYA 1T3HA 1ZK0A 2WZBA 4I4TB 4YYEA 4A0SA 3ABRB 2BPOA 3QE4A 4WHMA 1YR9A 3ZHQA 5CFOA 1LX7A 3JU3A 1N2ZA 1ZNZA 2OGSA 1Y42X 3FRHA 4HGNA 3UW3A 4EVSA 1R88A 2JI8A 2PL1A 4NCIA 1FU8A 3WL3A 3TFQA 1HQKA 4PZAA 3VH1A 4PG5A 5FBRB 4LY0A 1QDLB 2NTJA 5J58A 4IJUA 4TT3A 1LFAA 2OILA 1XCGB 2C9YA 3E2IA 4ZVOA 2QBYA 2IYSA 2QTRA 1Y1LA 4DSUA 5IUNC 5A3RA 1DTWB 2V8BA 2TECE 3IBYA 5C7LO 1YAJA 3CO5A 3QEBZ 2Z30A 3K7EA 2HA6A 5E1OA 1SU6A 3ROTA 3V2GA 3F74A 1M2NA 3BMCB 2N75A 2JA2A 4ASUD 1QHGA 1TD9A 3KT8A 1O94A 1GVNB 1OCEA 2A0XA 3ODPA 3S55A 3ZN2A 2Z6AA 3IXLA 1JEAA 4HP8A 3ZE8A 4JT4A 4IUCS 2IBSA 4PTZA 1F20A 1AKUA 4IOLA 4MYDA 4NYJR 4P4SA 4R5HA 1WABA 1GUBA 1M7BA 2QYHA 3B1JA 4HDOB 4QQFA 1NWHA 2QJTA 4BMDA 1MAUA 4EKEA 5IVKA 2YZ7A 2VZ8A 4MPRA 2X6RA 3B36A 4Y6LA 2V7TA 3B2QA 4OQYA 2R6HA 2WIGA 4D4IA 2GEJA 1FTYA 1LQUA 3CT6A 3D8TA 3DDSA 3N6VA 3Q5GA 4G0OA 4AX8A 3NVMB 2LD4A 3FYSA 3WHIA 4TKMA 4L4UA 3TLKA 4R9UC 5COBA 4TTTS 2AFVA 3ZHUA 5HNKA 4P54A 1KY3A 5E1DA 1Q11A 2RC6A 4BU1A 1R9MA 3E0QA 4XVQA 3EG5A 4M7PA 3KQKA 2ZOSA 3DZHA 1XDGA 2W2PA 4K86A 2EBFX 1IQUA 2Z5GA 4MB6A 2HT1A 1JAZA 3TD6A 1QKKA 2DOKA 2BTQA 3N1UA 4M38A 3BULA 1OBVA 2QRJA 3UGTA 3QQ5A 1D5WA 4L0CA 4Q00A 3CRW1 1AQIA 1DE0A 3CV3A 2O8FA 2CYBA 3FYUC 2ZSEA 4NTZA 3CH6A 4DY4A 4B6PA 2OXFA 5ER9A 3IBSA 3VC3A 1U6JA 2ZCJA 1T0IA 5CYOA 5LUAA 2BTQB 2VPIA 4UU0A 4S0ZA 1UBTS 3OWHA 4Q9IA 1FYEA 3IQFA 3SXUA 1N5DA 4M0EA 2JJ2D 2QUHA 4P82A 1L7AA 5A4AA 2O8FB 4I1VA 3IKVA 2XYQA 2IVZA 4DADA 2OWDA 5JNWA 2X8LA 4BQIA 1G1AA 2HNKA 4K3VA 1N4DA 5EJ2A 4F4JA 3GPLA 5ES3A 3PPYA 1Z5GA 4OXXA 3STHA 2WQ7A 1DP4A 4O08A 5GM2A 2FSVC 1Z4JA 2G04A 2GILA 4FE4A 3WYFA 2WD7A 4P4UA 4UBIA 3RRYA 3EWAA 3BJZA 3A11A 5DIZA 4GZMA 2HHLA 2XOXA 2JVIA 5EHZA 2FZLA 1Z34A 3FHCB 4H7HA 3HP4A 3MCUA 3G59A 3FOEC 4JYBA 4O4HA 4LC1A 3MINA 1HSZA 3KYIB 1NN0A 4IDHA 1WUYA 2CL7X 1PIWA 1YZVA 2WD7B 3EVZA 3Q7RA 1CY6A 1QPBA 4GX0A 1RD4A 4B3JA 4C7BA 4RMHA 2PWPA 5LWQA 1ULSA 1WJGA 1GFWA 1MVOA 4CLHA 3UW1A 4EA6A 4UEQA 3THSA 1NW3A 2PGOA 2VAWA 5CDUA 3MINB 5DTIA 4AZTA 5C3MA 5DJ5A 4V02A 2XAAA 3IT3A 1H2FA 2RHLA 3B5IA 3PCXA 2OUKA 3SQNA 3WRYC 4XUGB 2DVMA 2Z8ZA 4MUYA 4JQYA 4NDAA 5H68A 2GN6A 4KQXA 3FCYA 4LN1A 2ACVA 1BHSA 1SQGA 1W75A 4MDHA 5AJWA 5LCXA 2JIOA 1EDZA 3F7OA 4G4JA 3CVJA 3G9XA 3HN7A 3WJ7A 5HKKD 2ROQA 2LIVA 1C1XA 1RAGA 3QVXA 3EAQA 4GXQA 1NVTA 3AHDA 1JU4A 3WGLA 4G8CA 3R4CA 3TCKA 1T0PA 1JAIA 2OM6A 4Q05A 1RWKA 5B1YA 2P11A 1VG8A 2IYTA 3FPKA 1BKDR 1M6YA 1G7TA 1K4KA 3HJAA 5BXQC 5KQRA 2EW8A 1T29A 2JEOA 4L8YA 3ZWWA 2ZSBA 2CXSA 3AIIA 1C1XB 5LDGA 3U39A 3MT7A 1DBSA 3BTOA 4I50F 4CM7A 3IEMA 1ECGA 4CN9A 5FD8A 2LZ0A 1U0OC 4H7PA 4TYMA 1E2KA 3I12A 5T8KA 5JEEA 3AM1A 3U09A 2YXPX 5IBQA 2Q9BA 3TNYA 4X64B 3M89A 3IAAA 3D7LA 4XGIA 4LZJA 4ME6A 1JT2A 1SKYB 2PANA 4WDRA 2DTEA 1IZZA 1ATIA 2R47A 3FSRA 3WL6A 1H66A 1SB8A 2FP4A 3PE4A 1KP3A 4OV6B 4GEGA 2O3QA 2PX5A 1U6IA 3V4RA 2HBYA 3RK0A 2ZIWB 4LG1A 4B0PA 3HHPA 1IN8A 4M8KA 5JCJA 1J90A 3H7AA 3PNBA 3R76A 1H85A 5B57C 3NHMA 4I8IA 3NYRA 1H4TA 1U9JA 3OJXA 4WOJA 1GFSA 1RXWA 3NPAA 4M0UA 4I1UA 4D42A 4DKXA 1E9EA 2FP4B 1YZNA 3KWJA 1HE1C 3KLNA 3L9XA 5EHGA 1JX6A 1PL8A 2M32A 5BV7A 1N8KA 1U6KA 4N7RA 3ZHZA 2PU7A 4O1IA 4DYHA 3T5MA 2Q07A 1BE8A 3DQPA 1RWOA 2WTXA 2X9GA 4FBMA 4RSMA 5EXSA 3MOSA 2NV2B 1PFUA 3NHFA 3WK9A 1ONNA 2WV7A 3ICCA 4HAXA 5EMHA 3A9UA 2ZYWX 4E1AA 3HUTA 1NBHA 5J40A 2C92A 1JU9A 2E4WA 4OSOA 1JMKC 4P8RA 4FUTA 2VHWA 3T1QA 1MG5A 1N6IA 2CXRA 3VDQA 5AW1A 2POQX 2VP2A 3MN1A 5IUJC 4KG7A 3HGTA 2AC7A 1Z45A 3KYCB 5AMXA 2M1ZA 3C4QA 3AHHA 3RRMA 4CM5A 2QX6A 4U3JA 3KP1A 4HAVA 1UT5A 1ZHHA 5AHXA 2WD9A 1WPRA 2DF8A 4R1TA 5AI0A 3OIFA 3O75A 4TXHA 4XJVA 4EARA 1YJAA 5B2FA 1CUSA 4IIJA 3BCRA 3AMVA 3A06A 3NS7A 4ZVRA 4X00A 1YKSA 1XT6A 5IF9A 2WWTA 5A2QA 4D6PA 3AB8A 1J1UA 4RLHA 1UPCA 2PKRA 4Y2XA 2FUCA 3O95A 2X40A 1XNRB 4R7GA 2PX4A 1YA4A 3ZGZA 1XJWA 1R50A 1CIJA 4DQUA 1QVWA 2I1QA 3IB3A 3K9WA 4P7FA 1QRTA 4IIJB 1PGQA 4OAQA 1DDIA 3V9PA 4I9NA 3FWZA 1FFCA 1R16A 1WUKS 1E7MA 1AIPA 4G2NA 5TT1A 4F2GA 4AJPA 5GMOA 2ZG6A 4TYYA 3FMVA 2Z8YA 4HQ6A 3EIUA 2XNKA 1CLEA 1CUHA 1CUVA 1H5QA 2HSWA 3G8AA 4CUKA 2V0CA 1MABA 4AI6A 1Y4UA 2PT6A 2Q5JA 4EHJA 1RQ7A 2C9DA 2D5CA 5IBCA 3KCNA 4HNSA 4KAJA 4FCCA 1E9SA 3AK4A 4Q3DA 3S28A 1V5EA 1CHNA 1GN9A 2EF0A 4B6EA 4S3MA 5IARA 4E94A 3ENNA 4HHEA 3DL7A 3CKLA 3E7PA 3OQPA 4YMVA 2TSYB 4PTYA 5EJIA 4DR7B 4ZEOA 1DKOA 3W3AH 3WWOA 4EZIA 3WJ2A 3P96A 1MABB 5IFKA 5I48A 5FNVB 4ZAXA 4TLMB 1E0KA 3V6MA 4YJDA 4PX5A 4UEOA 3F6SA 3CCFA 4RETA 1Y7PA 1O77A 3BK7A 3U4CA 3ICPA 3LY9A 4OB8A 4CM1A 1MRNA 4G0ZA 3MLEA 1YMQA 2NPIA 3TGPA 1KQPA 4BGDA 4E88A 3RCBA 1MTOA 2FPSA 1W0KA 1YE5A 4KQEA 3WGZA 5KQSA 1A96A 3IE1A 1QIGA 2EWVA 3RC1A 1QHEA 5JD3A 2VHVA 2OO5A 3KRTA 2BD0A 2BH2A 4EGSA 2Z83A 3AC0A 4HN9A 1KH2A 3ZK8A 2H6EA 5ULLA 4UNNA 4C6SA 5J1SB 3NTXA 3THWA 3R6DA 5EKSA 3VJLA 1DV1A 5ELMA 3RC9A 3UJDA 4OQNA 1KARA 1XKTA 2GM4A 2VA8A 1T91A 1XZPA 4MVJM 3IRUA 3E5NA 3LY5A 4HB4A 2WWWA 1XYYA 1G5PA 3ZJVA 1ESZA 1KMIY 5IJ0A 4CW7A 1NNEA 1TT5A 4X8LA 1FPMA 4TL9A 5U9CA 4FYXA 4BO5A 3K0SA 1B0PA 3RSCA 2H1LA 1XN1A 2I1LA 4UM5A 5HA5A 1WM1A 2AX4A 3A4LA 2LP4Y 4MP3A 4CODB 3H1BA 1WCIA 4LOIA 2UZ1A 1TECE 4U0KA 2RJNA 1TKCA 3T35A 4TTJA 2WE7A 2YYZA 3ZDQA 5IJ0B 2HJVA 1J97A 1FZTA 3W5BA 4PC1A 4C29A 4GLFA 1GQQA 2Y0DA 3O9MA 3RRJA 4QZVA 2RD2A 5DV9A 3MBOA 1A5TA 2CHEA 1IN5A 1TW3A 4ZA2A 1WCIB 3FNIA 4LZZA 3GLQA 1MFPA 1LWNA 2YMLA 5CA1A 2YN2A 3J7AC 4KJXA 2Q4DA 5FUYA 3AVWA 2WT4A 1H0KA 1L4GA 2WILA 4HQLA 3A8TA 1Y3HA 5LU9A 2DUMA 2OXEA 1QGZA 1Z0KA 1QGYA 3SDSA 4BNLA 3KWMA 1EX9A 1E5LA 1M1YE 4K87A 3G82C 3GJSA 4W5NA 2ZJ5A 1RT9A 1ILWA 1V71A 3NOQA 3QJYA 1WXFA 1ND6A 2GN4A 3KUDA 4R05A 5FXMA 5C8YA 3UWMA 1MX9A 1Y7LA 1AMNA 2QX4A 3M6IA 3VJKA 4IRXA 4EATA 4EYKA 1QTIA 1MDFA 1QR2A 4L57A 3DLIA 1T9KA 4MLZA 4YCLA 1CE8A 3OF3A 4TLBA 2B9VA 2OBBA 1SHKA 2G9QA 4AKEA 4GI1A 2RHWA 2MINA 1KYVA 5AR1A 4EVQA 5C8YB 4KR0A 1LFDB 1NFFA 2D7CA 2EVWX 2FEMA 3EFEA 4II3A 4B6OA 2JFFA 1NV8A 1T1IA 2ZI6A 4PZ0A 5JO9A 3ZS8A 4A7PA 1J06A 2RKOA 2ZM6B 2ZUEA 1H8HD 4BVJA 4ZOBA 1D8TA 1I0ZA 1OXTA 1Z6AA 2PGXA 1N2EA 4JJIA 1NMSA 1FDVA 4KUHA 3RTEA 1JFRA 2WJ3A 5BMVF 1E2MA 1TPZA 2PMBA 4U6NA 4U7DA 1RI5A 3PB3A 1E3SA 5WRFA 4KB5A 4N40A 6REQB 1B1AA 3OEED 3TIVA 5JAOA 1M2WA 2FPGA 1C8BA 4CTOA 4I36A 3WLSA 1RBZA 4M60A 3CZ5A 5IDQA 5CYFA 2MHCA 4I1RA 3P9XA 1PKXA 3KKKA 1NKSA 3RYCA 1NVVQ 1R0KA 4EL5A 5IZCA 4H18A 3TN7A 3ZXIA 4PYQA 3WWYA 5LU8A 3EB9A 3T4XA 1O0SA 4M8LA 4DDWA 3AF1A 4O5OA 3FBTA 2BR4A 3HA2A 5EJFA 3K73O 4QA9A 2FPGB 3A10A 2C2YA 5M5BA 3VKGA 5K01A 1LW7A 2Q3CA 4A8TA 3BORA 2PS1A 3ONNA 2J3EA 2WABA 5FIUA 3OQNA 3RYCB 1MN6A 3TQFA 2QR2A 1VJ1A 4YYZA 3O8CA 4DA4A 4HLUA 1E3WB 1ZMRA 5DNVA 3C8HA 4MWEA 2OMKA 1P1JA 2G70A 1K5HA 2WM3A 4C0WA 2Q3JA 1U0HC 3AFGA 4YAWA 4C0QC 2Z0MA 1TM4E 4RULA 4NCBA 2I3DA 2RBKA 4MGKR 4YAKA 4Q9HA 2GKOA 3OFNA 1K7XB 3ND7A 3NIWA 4JC0A 4QUAA 5B3LA 1GRQA 1KZ4A 2E4UA 2H1HA 4JDUA 5AVTA 1XD9A 1BH6A 3FGNA 4RIGA 1A27A 1JQDA 3ZZTA 1KVTA 1IJKA 3K4PA 3NVKI 2Y2UA 5IRCD 1NBMA 4ARZA 4BVEA 1I3LA 4L27A 2VNHA 4FQ8A 4CKWA 3CO0S 4KREA 3P9KA 2O52A 1GZHB 1XFAA 4U6SA 4YJ3B 2VHQA 3A4IA 3QEJA 4J3NA 4HD8A 3VV3A 1J2JA 2I3GA 2P27A 5KSWB 1J23A 4MIEA 2JFVA 3ZYCA 2ILVA 3EDQA 4CKWB 5BV1A 4FM9A 1KORA 1W76A 3CPSA 3S8YA 3PQCA 4LVUA 1T35A 5L3ZA 4MCIA 1P4RA 3GXOA 4BLPA 4ZCQA 1ZICA 2YDXA 3DOIA 2VDMB 3MLBA 3WE7A 5JJLA 3ER8A 5J47A 4KPEC 2GCPA 1EIZA 3ZY5A 3FTEA 2R25B 5HRAA 2ZUBA 2WUFA 1GSHA 4IRMA 4XM0A 3STXA 3N2YA 5IKEA 3RSQA 2VDWB 2OAQ1 1KSJA 2CVOA 1Y9DA 3PFNA 2XUAA 4JJEA 3RHTA 4H31A 2YWBA 3KKNA 3KZXA 3O90A 3WYEA 3GF4A 2XMPA 3G8YA 5IT5A 2YTZA 2GM9A 1JG3A 1OUMA 5DHRA 3RTGA 1BNCA 3STUA 3URKA 3DBIA 2C99A 1PR6A 3CM0A 4QXOA 4RD2A 3LIIA 1ZGJA 2EFYA 1RLOA 4BRUA 5J2UF 1XYGA 3KE9A 1CP3A 2XKJE 2ZBUA 1YBHA 1YIAA 1ZD5A 4NI5A 3A9RA 5CHEA 3VUFA 5IXSA 1NF3A 2HK7A 3EZ6A 3HGQA 3W9BA 3ET4A 5GPBA 3TTUA 1BYUA 1VL5A 1W4ZA 5AK0A 1F0YA 4EITA 1AKVA 3C3WA 3GIDA 5TPZD 2XOKA 5KVAA 3VPGA 1EIWA 2XZOA 1GZ3A 2IHTA 5AVXA 1NMEA 1NN3A 2IA5A 1BCSA 3OUTA 4BAGA 1TZKA 4MWZA 1IN4A 2I0FA 2WJYA 3CKYA 3MW8A 3NAZA 4JLAA 4LVNA 4GS5A 3BKWA 4V2UA 1MLDA 4M7RA 2OXIA 1WXIA 3RU3A 1H6DA 4G0VA 3SF8A 3Q98A 4OQEA 2R1TA 3BRWA 1JIXA 5KTOA 2C9ZA 2H8KA 1LU9A 3QX3A 1VIYA 2W6IA 2JNWA 2JHCA 3A9WA 5KYGA 5H4HA 1GUDA 3UPUA 4FW8A 1E3LA 3RUFA 4IIXA 1ZGBA 5FP0A 5C2JB 2E7ZA 3SF8B 3CRRA 3ORFA 4D3XA 1AKRA 4IJKA 4CQNA 2XB9A 1QM5A 1GG2A 1B15A 1ZBDA 2R1TB 2ZAIA 1H93A 3FZGA 4HYEA 1ODSA 4OATA 2O0LA 4B17A 5DI3B 1OT5A 1YE3A 1PZGA 2NYAA 3ENKA 3FRIA 3W5AA 1Q0SA 2EW2A 2JCSA 4Y1GA 1BE6A 2Z09A 4ZVVA 4E2YA 3EQ7A 4YCDA 1DJMA 1FMFA 3KB6A 1XD8A 4MV3A 2Y05A 2DHDA 2AOTB 2ZRDA 3IPCA 1Z2EA 3JQAD 1IZ8A 2QTZA 4EG4A 1TPYA 3CUWA 1Q0QA 3ROQA 1CSEE 1EBBA 2Z1DA 4O4LB 1JNXX 1HDYA 3UAYA 3GVHA 3Q3IA 3ZHVA 1UMBB 2DG2A 2QIOA 3T5TA 5DHPA 3GFQA 2X41A 2YZMA 1KK1A 1I30A 1Z6PA 3OCWA 3FPSA 1R8XA 3JQQA 1FFGA 2XMBA 4LAFA 3OLQA 2P9HA 4XX0A 3ANNA 1XZKA 4J1TC 2JAQA 4DBVO 1G8GA 2D2VA 2QRZA 5GVSA 3P2JA 6ADHA 3E03A 3JQDA 2NSHA 4K9NA 4XUDA 5FO0A 5FNVF 4E4YA 4LHZA 3PHJA 1Z5NA 1RCUA 4W1PA 3UC5A 1CIPA 1MC4A 5DTJA 5HX7A 2ZZNA 1IB0A 3ICEA 4LYJA 1SKYE 2PIDA 5FQNA 1YO6A 1GCOA 4MRSA 2R62A 4DIEA 1JDTA 1YOVA 3I83A 4P22A 5KNDD 2O8EB 4G1UC 4KH0A 1Q91A 1E1RA 4MHSA 1PNQA 2Z98A 4YRSA 5EXPA 2B5WA 2I3ZA 5K3DA 3E3MA 4K40A 1UF9A 4ZICA 2PTHA 1XPJA 2GHTA 1E79D 4GLBA 5HFAA 1OQAA 1YOVB 2IYZA 3BAFA 5IS2A 1N2OA 5EKDA 5KNCD 4R8SA 3A32A 3GNSA 5H0IA 3VC2A 5JD6A 1N3IA 4LJ9A 1DQYA 4LVCA 4QAJA 1BVYF 2DH6A 2D06A 1L5HA 1Y5NA 3E9MA 1T9AA 2O9JA 1VQ1A 3O6VA 3M34A 3BWYA 1N78A 2CXOA 3OSZA 4KBFA 4B3DA 4TUYB 2F8TA 4JZYA 2QM8A 1NJ8A 1V4VA 1A76A 2Y1FA 5TQ2A 4CIDA 3F6BX 4LZWA 1M0SA 4YJHB 2YVAA 1KY2A 2BBOA 3MILA 5MN6A 3ZHRA 2BF7A 2CVFA 5CGQB 5ILOA 3DXZA 4I55A 3S6JA 2UUBB 1QU2A 2ZK7A 5HOQA 2YBDA 4RIEA 1DCTA 3A31A 3K0FA 4DLZA 1H1LA 2O23A 5TS2A 3REFA 2POCA 1WMBA 2SHKA 1AKNA 3AI1A 5TQ2B 3QMMA 5AI4A 3W6OA 2RH9B 4GP9A 1HDIA 2BLNA 3GHHA 1JJIA 1EM6A 2GWRA 3NBXX 4BJ5A 3P71T 4RVSA 3BCUA 3F46A 2M9MA 1MV8A 1ESMA 2P8JA 3AYXB 1BVRA 4MW6A 1T9GR 3OBIA 3EBPA 1H1LB 1BMQA 2VZ0A 3F6YA 5G1OA 1OI3A 2YL2A 3MB5A 4RO0A 2G4CA 5E4FA 5A4MS 1DJLA 1V8OA 1UKYA 3W8NA 2OKCA 1W0JA 1G8MA 5CX4A 4JI7B 3HZHA 3W8FA 2MJLA 2AUTA 4INZA 5ER6A 3TXAA 2ZXFA 2QOEA 1MEEA 4QPPA 1JDJA 2YNMC 3E35A 2Q5LA 4NP6A 4NYMR 4ZCSA 2RCNA 2NXNA 4IXWA 1E9BA 4MTLA 2I9PA 4F6RA 1GSIA 4EF6A 3GROA 3IYLW 2B4QA 3WBBA 1FNMA 4QU0A 1BRMA 4A8PA 2PFSA 3AW9A 1UPTA 1XNJA 1OVGA 4HSGA 4N6OA 2XSZD 1IB6A 4LCEA 5DYIA 3ZE0B 2Q6KA 4BQPA 4BFZA 1I1HA 2UDPA 5HF8A 4URUR 2JGRA 3QUAA 2VUUA 1E8NA 3DTVA 4WSOA 2QUIA 2FPPA 4YGYA 2ZQZA 1RQGA 1F5SA 1CDOA 1VMKA 3H5LA 3PJEA 4NJEA 4P32A 2CD7A 4MYRA 4Y2PA 3W9UA 4CMEA 3RABA 1HH4A 4E03A 5EGSA 1LDEA 2FZGA 4KLAA 3W2GA 4F38A 3GU3A 1Q17A 5CVTA 5BW6B 1E4OA 4Z1OA 3G85A 1DC7A 3T38A 2TRSB 2HWWA 2O54A 2ZYTX 3H2ZA 2FPPB 2BIFA 2QYOA 2PRIA 2X58A 2YC2C 3KXLA 4KSYA 3LNCA 3QG1A 4NJEB 4INAA 3LLSA 5B30A 2BMDA 2XF2A 3MTQA 1ACJA 2JLAA 3OIYA 2C83A 1CZNA 1WETA 4F2HA 2VDLB 1KI2A 2XCOA 3ZTWA 2NSDA 2TMKA 3N0XA 4HN4B 3NNSA 3M6VA 3IUQA 2BONA 5LYJB 1Z39A 3O8RA 3GT3A 4BECA 4K0KB 1OXXK 3EEIA 3H1EA 3OM8A 4OEHA 4EPWA 3N6RA 3DMGA 1YHYA 4RQUA 5HZMA 4ROTA 2HGZA 4JWKA 5EG5A 3RYIA 2J3JA 3F47A 4W1RA 3Q8XB 1Z6ZA 4LXGA 1PEKE 4WOKA 2ORVA 3K94A 2O0KA 3WL4A 1IQRA 3NVDA 3TQRA 5K8VA 4LF4B 2ZJ7A 1Z6TA 2VYNA 1K8ZB 1N2CB 4X5OA 3WQBA 1KEZA 2KJQA 4YB8A 1YKGA 2VJNA 4P7GA 4WJZA 1FP1D 2G07A 2WKPA 3AUYA 4U4AA 1XP8A 2BZ0A 4EGQA 1JPUA 3RYIB 1NR5A 1U0JA 1FP2A 2MSEB 4JUFA 2UVQA 5FYQA 3O9VA 1W36C 2DB3A 4X62B 1KIFA 3I8XA 1JDZA 4AN1A 1CQXA 1JR3D 2QRUA 3FUUA 2N9UA 2RHGB 1B74A 4G25A 4H77A 4WJLA 4PG6A 1P33A 2G1KA 4OXYA 3AFHA 2QW0X 1PDOA 4XYEA 2NUTA 4P3NA 1CJCA 4M1SA 2OECA 4JKYA 1T2CA 5HF5A 2OZVA 4MVCA 2J3KA 3ZVNA 3BJRA 3DO6A 2VP9A 2BR3A 2YV5A 4FKZA 3JWJA 4BBZA 4EUNA 3FM9A 5SY4A 4QQ8A 1NYRA 1MOZA 3AM3A 2F90A 1QFMA 2K2WA 3DMYA 3ES9A 2X5OA 4NDNE 3D4OA 2NUTB 4IF6A 4O2RA 1QGED 2A3RA 4ZOLA 4RAOA 3T95A 2JFZA 3IDSA 5K0JA 2X5NA 1HUQA 3OIUA 1XTQA 3D2CA 4YDHB 4B82A 1XZQA 3Q3EA 1VB5A 1KZ9A 3I9FA 5FWYB 3MM4A 2I34A 4DYVA 1DIGA 1J0XO 1XPRA 2PVCA 3D9QX 1T9GS 4M8IA 4ZOAA 3DFFA 1TQHA 2F7SA 1N2SA 3QBEA 2MYUA 4ZOLB 1NQ5A 3RVKA 5DU2A 3KL4A 4GR4A 3HKEB 5LL6P 2Q1XA 1PJ4A 4DE5A 3CCCA 1FNDA 3KPUA 1PU2A 5LQUA 4B7ZA 4C5CA 2B7BA 1E1DA 1LBSA 1MJFA 2WK1A 4ANFA 2K2QB 3ZXYA 3VYUB 4UPDA 3VC7A 1JJ7A 1QZZA 1RWQA 1BHQ1 3TR6A 1OE0A 2E1PA 2W4IA 2X8JA 2Z6VA 4KXYA 3UC9A 3IS3A 4OUKX 3FW1A 2H2IA 3VDNB 4W5TA 2R3SA 3JQGA 4KP7A 1O97D 1ZL2A 2CLDX 2XDAA 4BIMA 4OQDA 5K8UA 4L4RA 2BM9A 1KO5A 2PA3A 1GLGA 1ZZEA 3KV3O 4LE1A 2BSQA 2Y4OA 3H1TA 4JASB 5ELLA 5EE9A 3UWKA 5MF6A 4MR7A 2KWIA 1AXGA 3B3JA 4NF2A 4KR2A 1XKXA 5D8DA 2KM1A 4OIMA 4G97A 2X8JB 1XO1A 5AI5A 1MH1A 1PNOA 4DAEA 3JQGB 2ZYGA 2BDUA 1O4VA 1W29A 5HGJA 1SNYA 1KJ9A 4ZT5A 3BD9A 2QQGA 5FTWA 1EFPA 2RGUA 4R2XA 3CW9A 2GPBA 3R44A 2VJKA 1N6OA 1ZN7A 1U7XA 2WB4A 4MR7B 4RNDB 3OE1A 3S1AA 3T3DA 3UQYS 6CHYA 3C85A 1U7UA 4B7AA 5E8JA 4JYAB 1OFVA 3ZIAD 5JT1A 3ELBA 3F6CA 3UEOA 2I6QA 4J07A 1F8GA 1O6ZA 3LFUA 4RC9A 2FY8A 4DPKA 4X60A 5BYKA 1OFUA 3C7AA 4KDFA 5F51A 1EFPB 3A6GA 2QVGA 3VTZA 4ZFNA 2Q1TA 3OKCA 2AEFA 3PC2A 1R6AA 5ESWA 4NXMB 4HXFB 1JLRA 3TKAA 2IYVA 2DHQA 1KBOA 3KKOA 5F7JA 3ROMA 3ZXUB 5BQXA 3KQYA 3WP0A 1S2IA 1E2PA 2EP5A 3KE8A 4KUGA 3F1KA 1YRLA 2CW5A 1VYVA 4ACBA 2NGRA 1KU0A 4F91B 4F92B 2W2LA 3WK8A 2GRAA 1BGVA 4QASA 4XWOA 1ZM7A 3LFHA 4JUBA 5DYYA 4B84A 2O0HA 1L1QA 3JQ8B 3R0VA 4TMXA 1LS1A 4PC2A 4TZ0A 4EUFA 2PKQO 1ZMXA 2Y1EA 1YTLA 1HQDA 2FEPA 3Q15C 1N1DA 1QZ3A 4DXAA 1FLAA 1AZWA 3IMFA 5KSOA 1NR7A 3FPGA 1VRVA 4LJ6A 4NBNA 5I4KA 4Q15A 5KWVA 1JQKA 4RTKA 4L95C 1DGQA 2GVZC 3OTIA 2G6BA 3OPYA 3HL0A 1K7YA 2VXOA 1HGXA 4ZAFA 4BFCA 1YA8A 3B38A 1Z83A 1B0AA 1OT3A 4IIVA 1TVKA 2EHJA 4LZOA 4QXAA 5DH9A 2J67A 3L93A 3KTDA 1X15A 4B33A 1ODTC 4XJXA 2C0QA 2PUWA 2PX3A 3GZJA 2A9VA 1NLYA 3PBKA 4EIWA 1S8AA 4XX1A 1I2ZA 1C30B 2V6BA 1JKIA 3OPYB 4GMKA 4H2DA 1I1QB 5LZ4A 2FUG6 3CUTA 1VG0B 2A5DA 2XLBA 4ZI7F 1ZESA 4P84A 3VGPA 1KDVA 2IRWA 1YHZA 1TVKB 3RSLA 2FPOA 4KWEA 4TN5A 5H5JA 3W6UA 1AGRA 2F1OA 4R51A 2XCTB 2J0SA 4QXRA 1SUEA 2I7TA 1XGKA 2PBZA 2QPAA 2WVGA 2DFNA 1V1MA 4RPIA 3RIYA 3SZMA 2DWUA 2G9VA 2JAWA 2W93A 1UJ4A 3ZHTA 5LLTA 4BZWA 4RF3A 5IM4F 3I1FA 4LZPA 4CTJA 3K35A 1UMKA 1SXJA 1VBKA 4PPGA 4IXTA 3VR4H 2HO4A 1N9ZA 2PFGA 4U39A 1UXJA 1PGPA 4EG5A 4D9BA 1M8KA 4UFNA 1HLDA 1V1MB 4E0BA 5HKAA 1P72A 4WKPA 3F3KA 1E1YA 2O2YA 3I9KA 1E6CA 1XEXA 1UBSB 2NTNA 4ZDWA 2IU6A 3CF6R 4Z7NB 5JC1A 2CN1A 1RAIA 5K20A 1KZ6A 2JLXA 5DLEA 2JDIA 4OQMA 1II9A 2O3TA 1GL9B 2QZ4A 3GRYA 4YALA 1G17A 4Y2GA 4E5SA 1QO9A 5DOVA 4HFJA 4ENUA 2GCOA 1YZLA 2O05A 3C2QA 1SHJA 1XMQB 2Q4OA 2E0IA 1UBFA 2HJGA 2SKEA 1FSGA 5BP7A 4D9EA 5DPMA 1P73A 2DQ4A 3MMNA 3RARA 3OJOA 4G09A 5CLGA 1H2XA 2ECKA 5A05A 1EWRA 3PX2A 2GCOB 2PWAA 2OCKA 2ZJ0A 4PC6A 5EUCA 1UMCA 4CCAA 2V5UA 1O8CA 3CWCA 3M3PA 1NQOA 2Q9UA 3M1AA 4KOAA 3B51X 1QLJA 1NWCA 3MJHA 3WLPA 2FGJA 1P5RA 5AK3A 1P61B 1T6XA 2ZRFA 4EB0A 4IP0A 1DRUA 3UFXA 4QREA 3PRKE 1X42A 1FXWA 2ZIZA 3GJYA 5A4KA 4P0QB 1UMCB 2XWBF 1N7GA 2B8EA 3NANA 3RFCA 1PWHA 1E1QD 2HLNA 2O7RA 3GEMA 4PFKA 4C7OA 1HV8A 1SOMA 5GINE 1G59A 2ODQA 5NULA 1NY6A 4L5JA 3AVPA 4UXHA 1CJVC 1D6JA 3UB2A 3DFMA 2GA9A 1ISSA 2HCFA 2IEAA 2R66A 1QFJA 1RHRA 3KPVA 3OCJA 4G0QA 4I5IA 5AXAA 3RBVA 2QVLA 2VYFA 3CJQA 3Q5DA 4HH3C 3OD5A 2OZKA 5CB8A 3VHXA 2M1XA 1IHDA 4DEXA 3VR5D 2GN8A 1QX4A 2RB5A 2W83A 3NGLA 3P45A 1I8TA 3GCZA 4HYTA 3VDRA 4LMRA 2QT0A 4WFIA 4Y2VA 1N0UA 1OPXA 1O2DA 1Z2OX 2G0NA 3QKSB 2YW9A 3H1FA 4RHXA 4R84A 4R3WA 1EAYA 1BFDA 2PH7A 3JYPA 2R86A 3GGCA 3K1AA 2VAMA 2BELA 4GYKA 1HURA 4IVPA 4X71A 1G9SA 4TWBA 4DR3B 2Q2VA 4MR9A 2G9ZA 3PC8A 1T5SA 3VVLA 4CT5A 3EW7A 2V65A 3ZV4A 2XX3A 1VPDA 3GWZA 1EFTA 4FQ7A 3QW4B 1ZPDA 4UHHA 3SR3A 3EN0A 3VU9A 3PFCA 2J5QA 3K1AB 5KX5A 1XQVA 2WA1A 4KOEC 1M10A 4LUCA 3QHAA 3GJZA 1XQ6A 1R6DA 6LDHA 1KAEA 1R6BX 4MR9B 3HSSA 5IAJA 3D5QA 2UVPB 3FTCA 1C0LA 2DQKA 2CFOA 1I4DD 5IF3A 1H3NA 2QJWA 1F2DA 1JYFA 2JKYA 1Y4SA 3B5EA 2HF9A 3KAPA 5CW1A 3RNOA 3VU9B 3B1XA 4O1MA 1AO0A 5KX5B 5H70A 1UINA 4NZMA 1I3MA 4GZ6A 3NO4A 1TU4A 2VHCA 3ZE1B 3HLYA 1G5FA 2H9AA 3LP5A 5I8WA 2J48A 2O6HA 2VRCD 3EA5A 1R0SA 3HRIA 1EGQA 5EZYF 3E81A 4TLDA 3D54D 1ZVQA 1FRQA 4EGCB 3GGJA 3ZKAA 4JVLA 2W6MA 3N8HA 4ALJA 1V4BA 2EKBA 2EX4A 5DWDA 2P75A 2OG1A 5G41A 5LN1A 1OHHA 1ADBA 1MUUA 1EVZA 4R9SA 2I87A 3HDGA 1E8DA 1XZGA 3FCSB 5FFMA 8AT1A 1GGJA 1THTA 2ARKA 3I53A 4X61A 4LI3X 5B1HA 2JA1A 3MPUA 3GYBA 4C7KA 4YRNA 4ZCMA 3FI0A 4YV2A 1XWWA 2AZDA 3SZOA 3UHPA 3D2LA 1WPGA 1L4EA 1RLMA 3RPEA 4CR7A 2TS1A 2XDYA 4MS1A 1DELA 3GJ5A 3ZZUA 3V2UA 4KDEA 2JPDA 1UPBA 2P9ZA 3F4KA 3QWAA 4Q7MB 4F85A 2PSSA 4GMXA 1OFHA 3LPDA 9LDBA 4YCCA 2GD1O 2R6R1 1GNLA 3PIDA 4LHSA 4OAPA 1GY8A 2GEVA 2WYHA 3AR3A 2SCUB 3BTSA 1ZW1A 2CDCA 4QL3A 2G09A 3TFWA 4JVNA 4PANA 4MS1B 2E4AA 3IMCA 3KKQA 2OO7A 4WX2B 3ROXA 1Z3IX 1Z07A 1JI0A 2P7HA 4OXKA 5TR9A 3Q7IA 4P7BA 3WBJA 3ZXSA 4NBLA 4QJ3A 2A1TR 2GMWA 3IRVA 2W98A 3CLSC 1RVDA 1VSQA 2YWJA 3GO4A 4BNHA 1Z4MA 3KD2A 1CF9A 4DIMA 3OLXA 1GCGA 3K30A 1JQBA 4NBKA 1ETHA 1USGA 3GUHA 2GWHA 5C5IA 3I58A 3T1YB 1WBJB 3G0BA 3I9MA 5H8WA 3L0IB 3UQZA 1JBEA 3U4DA 4WKCA 2X86A 4DZZA 1F9AA 3L0PA 2V6JA 2D00A 1JMYA 3OCZA 2QRGA 1RAFA 4EZEA 3NC0C 1FNNA 1DTSA 4DBZA 4B76A 2P68A 1CRZA 5AOVA 4CMAA 1HFKA 2O4UX 3PUYA 2H65A 3A1DA 2O57A 4INOA 1YZGA 2D0OB 2CZCA 3GDGA 2AVDA 5ADHA 3EEQA 2B30A 2HJRA 2FWAA 5HQJA 1NHGA 3A6FA 3QEOA 1PWZA 4MGHA 1XEWY 1DQSA 2QL9A 4PZCA 4WCFB 3ZV3A 4BV8A 1YA6A 4JEUA 5E6SB 4NMLA 3PEEA 2C7RA 1QQBA 4E11A 5BUSA 4H3HB 4CF3A 4N0DA 1XWFA 3OURA 3AFNA 4IIEA 5A9TA 5FBQB 1CR4A 1N0WA 4J0DA 4DPLA 4BNXA 1JR6A 2QN8A 1JVSA 5J1TB 1S2DA 5CT5A 1TF5A 2VPTA 1TUGA 3BDIA 3JYQA 2YXDA 3ANSA 2BM8A 3QOXA 4MUJA 2LVBA 4ARUA 3W5VA 5FYDA 3NJ4A 3V32A 5KYNA 3SWWA 2VS1A 2WE8A 5CMLA 4PZLA 5HUJA 3PNOA 4RMNA 3KZMA 3CJRA 4PV7A 5LB4A 4E32A 4RWZA 4BQRA 4NK5A 2WA2A 4DRZA 1Z7WA 2CB9A 3WWPA 4FB4A 4B3HA 3ER9A 1J00A 1WZNA 2IVFA 3ABIA 4JD5A 4QG7A 3NYQA 3WBKA 7ADHA 3NVAA 5JDCC 5BRJA 1LGYA 5JNSA 4Z0NA 2BI8A 1I4OA 2X0KA 3VUEA 1PLLA 2OYSA 5L7WA 1FNSA 3IEXA 3QM1A 4WLNA 3W0LB 2HXSA 2LE0A 3QEMA 1AHIA 2BMVA 4AKSA 3L4BC 5HUHA 1F0PA 1RJFA 2IPAB 3SYRA 2OYRA 2OAGA 4HWRA 5TMPA 5EPOA 4DLSA 1KTIA 4S05A 4V38A 5IKXA 1O0CA 1U3FA 2ERXA 1UKBA 1YRYE 1TRKA 2GKGA 3D1JA 3ZJYA 2VH2A 3P9QA 4PYJA 3AP1A 1DRKA 3P27A 4F5DA 3WGTA 1PLJA 3QEMB 1OGIA 4OFBA 4LKRA 4FS8A 3VNQA 1XTSA 3EPHA 4ZRNA 4PYLA 2HMTA 3NHPA 3BFXA 3R1IA 4I50A 3WKDA 3ZE9A 3WFIA 3MS2A 1N32B 4PPNA 2AKYA 2W0SA 1NJFA 2P9BA 1E5QA 1IRXA 1E63A 1SD5A 2H7CA 1WF6A 2NT3A 1DFHA 1QANA 3UAGA 4MVJH 5JS8A 2ZM5A 5CBPA 1FUUA 3DL4A 1RWPA 4HMPA 4LJ5A 2A1TS 5CA1B 2X1MA 4R40A 4B46A 4BLWA 3BCHA 3DB2A 5DGHA 2I62A 2JH9A 1KKLA 4FC6A 3M2PA 3W90A 2PM8A 4IVNA 4JLPA 3EPLA 2A84A 2QEQA 2QR5A 5C8VA 4X41A 4RIFA 5TEWA 2NYUA 1HDXA 5L7TA 1CERA 4FD3A 5JBNA 2ZGVA 2ZE5A 3EGEA 2J59A 3UYLA 1RC8A 1VPWA 2FOXA 2FWRA 3B48A 3MCTA 4Q1BA 5KVQA 1XXHA 3LA6A 2HM7A 1QP4A 3CRNA 4M1KA 5AW2A 1N92A 1USWA 1YDEA 4OBXA 5JCXA 4K2AA 3T7AA 1OX4A 2ZIAA 1UBUS 1NW6A 1GN8A 2BVNA 4AYWA 5JISA 2H2DA 1F4LA 1IVNA 2X22A 5D1NA 1PBNA 1W581 4P98A 2Y1LA 1KFKB 5HG0A 1R0XA 5BT9A 3VOBA 3ZZ0A 1T0UA 3BXXA 4QELA 4EVRA 1DQNA 3AXTA 1XXHB 2VDKB 3QJ5A 4EB6A 2KSQA 3Q0TA 3C8ZA 3RKRA 4JQZA 3F7NA 1L7DA 3GUYA 4L9SA 1TIPA 1OX4B 4QXPA 1NMZA 3H9GA 2ZJOA 4MUHA 4YUYA 1G18A 1I4EB 2I67A 4DR5B 3TD9A 1P1FA 3FNRA 1WMSA 3K8OE 1OI4A 3LCVB 4TVKA 4IMIB 5EE1A 3W4KA 3NHYA 4XVHA 4D99A 4EB6B 2YH2A 4WBNA 2BBSA 4UDNA 1XEAA 1VSTA 4N8EA 3USCS 1B73A 1QH0A 1VBNA 2OOKA 1QFSA 4V2IA 1CJBA 4Y6OA 5J5VA 2PZGA 4A36A 2VSQA 4DQ0A 3P9YA 3H99A 3I2FA 4UHEA 4UTRA 3VR3D 2X7XA 5EP3A 1P6XA 3SOPA 5IK2A 1YD7A 4NULA 2D6FA 3KZNA 5FFFA 2IP2A 4WBNB 4E1BA 4MOWA 2G5GX 3UK2A 4MUAA 4INPA 1P80A 1E3IA 1C8KA 2GN9A 4EEXA 1WEHA 1KZYC 1ZIYA 2ZSAA 2GJ8A 5CVVA 2AOUA 1NJ6A 4M1ZA 1BXRA 4HNAA 5AW5A 1UM8A 4Z51A 4IX9A 5LJLA 4GDFA 1TE2A 3B1VA 3RDPA 4JA2A 2PH1A 1CZKA 3PWTA 3V4ZA 2IV3A 4K9QA 2CNWA 3TBHA 1J56A 2XDQA 1M34A 1FMTA 5LMUB 3N8DA 4G24A 4LSGA 5D5QA 4EFKA 4CM6A 1NX9A 4CIXA 2QAIA 2AOUB 3E27A 4ESOA 1BXRB 4ZCRA 2ZAOA 1VDMA 1KI9A 4NFHA 1MU0A 1RYDA 2F1JA 1X38A 2WINI 3AJDA 3DTYA 3E84A 5DM1A 4AD8A 4CCWA 2R8ZA 2IYYA 3ZZNA 2HDWA 2OORC 3HG7A 4G5SA 1DS6A 5KYVA 1M34B 4CEJA 4RZXA 3KKZA 1W5EA 5EWLB 1Q2XA 1QV9A 3PP8A 4F3NA 4W5OA 4O5AA 2ORYA 1HYBA 5HE8A 1TJNA 3WRWA 4DC0A 2C3MA 1A9QA 1G1MA 1R8SA 1BN7A 2PXAA 3GBVA 5JJCA 4CUZA 5LP6B 4HQNA 2J7PD 4JOCA 5LJIA 3HEBA 1E9CA 1U3GA 2VC2B 3OF5A 4HNRA 1Z4IA 4OGGA 2BJHA 5LC1A 3HCWA 3K1JA 1GPJA 4QEZA 2DT5A 1QTNA 5D3QA 5DK4A 4DWOA 1X1SA 1XTTA 2XUDA 1SVLA 4A4DA 5LQAA 3D81A 1KYIA 3WHPA 2EFJA 3LUCA 4GP6A 4IXMA 3FVVA 5JRJA 3VKVA 3GLHE 5KO2A 4UKDA 4U1RA 4ROSA 3E7FA 2WF9A 2ZXUA 2UUPA 4ED9A 4IGKA 2BGRA 3M1LA 3GLGB 2FFQA 2LKCA 2PQ6A 1OLSA 4OVKA 1TXGA 2JL1A 3HWWA 3FTPA 5ESDA 4OK3A 3MMZA 2CXTA 4MRNA 2OV4A 4YI3A 3FYUB 1GPBA 2G5PA 4MS3B 3AHJA 1L8AA 1PX0A 2W37A 2G4VA 4RK5A 2WSSA 4BC0A 5E7IA 4F6CA 2PO5A 1FY2A 4JITA 4O2AF 2YVQA 1OLSB 4H59A 2WKSA 5LSAA 2AWNA 1R6UA 4GL4A 2ZR9A 2BGMA 2B0CA 3TK1A 2JH3A 2CVHA 2PHZA 2E37A 5LXTB 2WTUA 5E3IA 1DX4A 4KGXA 2BYTA 2ZETA 4WNAB 1CFZA 3PXDA 4B4WA 2AG6A 4KR7A 1WZEA 1FMJA 2KE5A 3EY9A 3QNWA 3U37A 2PSHA 2WIDA 3TVDA 2BTEA 4MRAA 1C0IA 3TI9A 4RF2A 1XAJA 3H8WA 5B3KA 1GCUA 4ID9A 2YJ6A 2C77A 2YQ5A 2P4HX 2QMQA 1IM2A 1RWVA 4G5XA 4DNPA 3HZRA 1JW9B 4ZAGA 4AZ3A 2JFOA 3WLOA 3PT5A 2PV0A 4WLUA 1Q0PA 5FPSA 1RVV1 1K4MA 3PGLA 3R0ZA 1VMEA 1P2BA 1EU1A 3L40A 1YCHA 4ZYZA 2DFPA 3GZTB 1D7AA 2FUG1 3P8ZA 1QIEA 1W94A 2IITA 3LQFA 2WV9A 3HBFA 3H8VA 1E2IA 2XMDA 4AZ3B 3CGGA 1M1NA 5AJHA 3C70A 1K98A 1LLCA 2JK1A 4EY5A 5ICSA 1I7QB 1WUHS 3QV1A 3DW1X 3NCHA 1TM7E 4MV7A 1K9SA 4GYJA 1TOAA 4E5PA 4CXMA 1HDGO 3VKWA 1EUQA 3A4VA 3V4PB 3KOMA 2QM7A 2GZ3A 1AKQA 1EWQA 1V35A 4F7DA 3DBHA 1M1NB 1J1IA 2NTVA 4I1PA 2IPMA 4C21A 1NE7A 5BMVA 3ABQB 1V45E 1ST2A 4PYMA 2IWRA 4RY0A 3QY0A 4HUJA 3IP1A 3OWXA 4A1FA 3LQKA 3IAS6 2QTHA 5FHQA 1EVKA 1Q0ZA 1PL6A 4QOEA 3D3KA 1NW5A 3KVRA 4KVGA 4DCNA 3GLIA 5KKCA 4S2UA 1QUEA 4D3DA 4DR2B 3FCEA 4YCJA 2WWFA 2OBFA 2ZRHA 2EJVA 3IR5A 2GZHA 5TQ0B 2WB2A 5E9AA 3FJYA 4MV6A 4Q4DA 5FFNA 4B5KA 3D8BA 3ZDRA 3K0EA 2V59A 3H6GA 1E9DA 3KKMA 4YHBA 1U9CA 4B73A 3TRIA 4CL8A 2W2QA 2H85A 1XCOA 2HK8A 3SHQA 3RNLA 3KZOA 5LQJA 2VDVE 4F9EA