2Q8PA

Crystal structure of selenomethionine labelled s. aureus isde complexed with heme
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
258
Chain Sequence
GEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heme Coordination by Staphylococcus aureus IsdE.
pubmed doi rcsb
molecule keywords Iron-regulated surface determinant E
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
total genus 71
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8pA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8pA01
3HJTA 1QGUA 4UTPA 4TKUA 4N01A 4DBLE 2QI9F 3TLKA 3AEKA 3K1AA 3BE6A 5CR9A 3UJPA 1ESZA 2AFIB 5JJ5A 1QH8B 2Q8PA 1N4AA 3ZK8A 4FI3F 5M3BA 4PM4A 4UDNA 5M29A 1G21A 2RG7A 3MWGA 5KHLB 3AETB 2XDQB 1QH1A 2XH8A 3PDIB 4XPIB 3ZK7A 4PAGA 2PS3A 4WZAA 1H1LA 3LI2A 4OXQA 3GI1A 1TOAA 1KAEA 5KOHB 2O1EA 4FNAA 4H0FA 3TNYA 3LHSA 5KOJB 4MO9A 1PSZA 2OV3A 5I4KA 3EIWA 2AFIA 1QH8A 3PSAA 1M1YB 4GICA 4K3VA 2YNMC 5JG7A 2OV1A 4IRMA 3AETA 4WESB 2XDQA 2XQVA 3PDIA 4XPIA 1K0FA 3AEQB 3BE5A 3MINB 4WN9B 1N4DA 1N2CB 2M6LA 1N2ZA 4CL2A 5KOHA 4G09A 5CX1B 3MD9A 5KOJA 2YNMD 3PSHA 2MINB 3ZTTA 5AFSA 1K2VN 1M1YA 3R5TA 4MLZA 1M34B 5GGXA 3TEFA 5HX7A 3AEUB 4WZBB 3MFQA 1FP4B 4WESA 3ZK9A 1KAHA 1K7SN 4WNAB 5JPDA 2OSVA 3AEQA 3MINA 4WN9A 2XV1A 3NU1A 4LS3A 1N2CA 1EFDN 2AFHB 2X4LA 3CX3A 2M6KA 5CX1A 4ND8B 4MDYA 4NNPA 1G20B 2MINA 5M2QA 3MWFA 1M34A 3R5SA 3AEUA 4HMOA 4WZBA 5BVGB 1FP4A 5BVHB 2ETVA 2OGWA 3EIXA 4G07A 4WNAA 1MIOB 4NNOA 5GGYA 2XUZA 1M1NB 5FLYA 2Q8QA 2AFHA 2WHYA 2XY4A 1K75A 4FKMA 4INOA 5M34A 5JOQA 3HXPA 4ND8A 2PS9A 1G20A 4FILA 5HDQA 5B58T 3AESB 1L5HB 4MX8A 3G9QA 1PQ4A 1KARA 3HH8A 3AERB 2PRSA 4TKVB 4UDOA 4UTOA 2WI8A 5BVGA 5BVHA 1XVLA 1MIOA 3U7QB 4LJSA 1QGUB 1M1NA 2PS0A 4TKUB 4INPA 2R7AA 3AEKB 3K1AB 4OVKA 4B8YA 4HN9A 4HMQA 3ZKAA 4OXRA 2PHZA 3AESA 1L5HA 2R79A 4M7OA 1G21B 3AERA 4TKVA 4HMPA 4BBPA 1QH1B 4H59A 4WZAB 3U7QA 1H1LB
chains in the Genus database with same CATH superfamily
1W5TA 4PFSA 3RK1A 3ZUGA 4D4LA 5ELXA 1Q20A 1J2EA 1VP9A 2BCGY 1LBHA 2QUAA 1LK7A 2GBLA 2BCJQ 2OO5A 2RGWA 4EHHA 4ABTA 3KQSA 3BQMB 4OGFA 4F2HA 5C8YF 4MR7A 1N75A 4PGMA 2D62A 4F11A 3UMJA 3LWNA 4DMKA 1N8NA 1VL0A 2C98A 2ZFUA 3AI2A 4S2UA 4QODA 2JGDB 1X7YB 4KXVA 3NT4A 4KQ6A 2RHOA 1DKMA 1DZ3A 1NRXA 2WEKA 3I37X 3LSTA 1UC8A 2C2HA 4XVQA 5CH5A 1PNOA 4MPTA 2FGKA 2QUBA 1ECBA 4PAGA 4JJ8A 4R1PA 3TSWA 3TVTA 4CI0B 4CYMA 1A5SB 3CO5A 4F71A 1KPGA 2D0OB 5JNVA 3N2GA 4H15A 4AFNA 1XZAA 3BKXA 1YZKA 4E7OA 2OYSA 4IKEA 5G4KA 3V7NA 4CM8A 4I0WB 3TLAA 2ZRNA 1IPFA 1ZRHA 4DUYB 5IP5A 1MEJA 1QIEA 4R05A 3H9UA 1T36B 3ZIUA 4UATA 3NKVA 4G5QA 3PU6A 1A0OA 3PQ2A 3VA7A 4MULA 4EW6A 3GLFE 3QXCA 3IQGX 1R9GA 1ATIA 3FOWA 3OFJA 3OOJA 1G7TA 2V8BA 2W2QA 3GUYA 3ETEA 3HN7A 3PD1A 2MYUA 3R3JA 1JAIA 1PW5A 1SXJA 2R60A 3AFNA 3EJWA 4IOMA 4QTTB 2X8WA 3TEJA 4DA7A 4TYWA 1XI2A 2D0IA 3B5IA 4U2EA 2YH2A 1Q83A 1BX1A 2FLKA 2M9MA 2XQJA 4R1QA 2A8YA 4BVBA 3JRWA 1ZO8A 4JHLA 2O57A 2FJPA 3R40A 5IXSA 3KALA 4GDMA 4QDZA 5I7HA 4YRIA 2IS4A 4WLVA 3I30X 4IFEA 1XJWA 3CTMA 3V4PB 3QFTA 4DC0A 1B76A 4BV2A 5DYWA 3G0CA 4MGKR 2F3UA 1T4BA 3BB3A 1PGJA 3RVPA 1FMJA 4X1IB 5HKKD 2BGUA 1KYTA 3FNHA 1I3KA 3O31A 1IZ8A 2GUGA 4UUBA 5JECA 3IDAA 5LQRA 3TRJA 4XLLA 2JGEA 1FP4A 3H8JA 4CM6A 4EG6A 4JLKA 4I4TA 3KVRA 4FQ8A 4QBFA 4BEWA 4UULA 4WN3A 5CMLA 4I1IA 3I1JA 1J1UA 4NYIQ 4M54A 1SOUA 2ZJ5A 1ZOPA 1B3RA 1Z0IA 2VBGA 2YWGA 4E08A 4YV2A 2RI6A 3NR2A 3ZDYB 5L6MB 4C01A 4WZZA 4Z9BA 4F84A 4G1MB 5K8VA 3TW8B 1ZOLA 3L93A 1W30A 3T5PA 1CY8A 1CVRA 3M34A 1QM5A 3ADPA 1PJ8A 4P4TA 2LGJA 3SQDA 3VZDA 4UM9B 5BSWA 2P90A 3R3UA 5DYGA 3CPJB 2O5VA 4D02A 1E2PA 5FTWA 2GA9A 5JPCA 3AOGA 4P3PA 3U7QB 3D0OA 3BL6A 3H13A 5KMGB 1MW9X 4ND4A 3PQ8A 3IIMA 3SE0A 2F3TA 4LCEA 3FYSA 1X1AA 3I52A 1E5TA 2XUAA 4Q9DA 1XQVA 3AU8A 4RXUA 2A4MA 1QP4A 1I2ZA 1NSYA 3HXKA 1NE2A 1A5AB 1JA0A 2H4YA 2B37A 1JNXX 2C29D 2IUEA 1S2GA 3LLCA 4I66A 4D79A 1ZICA 1ZRSA 5BN3A 1QUFA 5JJKA 3HL4A 5C5IA 1S2LA 1YJQA 3OX2A 4MHSA 3ZEAA 2BMAA 5JNSA 3HI6A 4GGMX 2FWRA 5TNXA 4JGIA 1VJ0A 4B6RA 3Q2IA 4OQQA 2B1QA 4C30A 3I92A 1I3CA 1NXOA 3PFIA 1NX6A 3GRRA 1MC4A 1QLWA 2G9NA 5TVGA 3ZCUA 1YE8A 4BFCA 5E4TA 4O4IA 3KV3O 3PKIA 3MGGA 4EX6A 1FBTA 3FHJA 3JR3A 2OWEA 2XEDA 3MWGA 3IR7A 5FULA 3UTDA 1GKIA 2WWVD 3ZHZA 2Z4RA 3BD6A 1N5MA 3DAOA 3KQQA 5DHQA 3AJDA 3I5MA 5EIWA 4PXAA 4UFOA 4RF4A 4KMMA 5EJGA 4BPRA 3AJEA 1ULSA 3GMDA 4JX9A 4CMHA 4DCCA 5BV8A 1V7PC 2YUTA 1H1DA 5L7TA 2GYWA 4HY3A 1H65A 2XCSB 4NPCA 1QAQA 2FSGA 1GA1A 5LP1A 2H06A 3DHEA 1YNOA 4II3A 4XWGA 4AJ2A 3GA7A 3ME5A 2GN0A 1FFGA 4PZ0A 3ZGXA 2Z6VA 1FMCA 4Y0AA 3BXPA 1CZNA 1BXRB 4ZQFA 1IHPA 3WWCA 1PDWA 4GRDA 3AWDA 1QGED 4N0PA 5FOUA 2ZWIA 4H6VA 1ODLA 3PC2A 1P4JA 3LP5A 1VE7A 3BTSA 3DYVA 2H2IA 4R7ZA 2BR3A 2FAXA 4UJ3A 5AKIA 5BWCA 5K3CA 3W6UA 4KR7A 3NFYA 1L7QA 4GP7A 2J6BA 3SYRA 4MVWA 4MUXA 4TWZA 2J3IA 2FJUA 1T9DA 4RULA 4QPCA 1RZRD 4IWYA 1TEZA 5FAKA 3W4KA 2AC7A 1YR9A 3TIGA 2PE5A 2BGKA 2ZGVA 3PQCA 2FMTA 3KLOA 4JL5A 5BR7A 3CXUA 4IQ4A 1XDBA 4YLYA 1C80A 3KCQA 2IZ7A 4AZ0A 1B0UA 3RM3A 1XKLA 2BKEA 4RMGA 1WQ4A 5EMLA 4MVJH 4I1OA 2ZCVA 3LLMA 1YDGA 4HB4A 4DMUB 4M3NA 3UJ8A 1WKCA 4EJMA 1SQ0A 2O0KA 1HOTA 1LC0A 2A9KA 2FZEA 4OHPA 1RHKA 2NZUG 2IV7A 2XXJA 5CTJA 4WK4B 1VE3A 2ZTUA 5ERXA 1G3UA 1EHYA 1DG3A 2A0KA 2E2WA 4K8OA 4EQ6A 3WWDA 2JA1A 2BVNA 1JQ5A 3GT0A 3SHOA 5BPFA 2PVPA 4DV4B 3OQMA 3LKZA 4AMGA 5IEBA 3HCPA 3PIRA 5D6OA 1ONNA 4GQBA 2IEDA 4CT4B 3COJA 1TVMA 1GKLA 3KYCA 4GPD1 4WCVA 4YP0A 4MNTA 4A91A 2W8BA 2DCMA 4BCBA 4XWWA 4E30A 4JJ4A 3U0BA 3C7AA 1UFVA 1UQRA 1AZSC 2IPNA 3QPCA 5T57A 4C2AA 1YKGA 3IDSA 1E3EA 2IUYA 2H4ZA 2E6KA 2M6SA 2Q5QA 3GN1A 3KSDO 2OM6A 1C2TA 4FFWA 1ZINA 5JHHB 1H4SA 2NMVA 3EUFA 4H7HA 1YKFA 2CMHA 1IQRA 3BIWA 1U3TA 3L3BA 3LVRE 4MGZR 4YDSA 1GL6A 1NAHA 4XA8A 5EWLA 3LT4A 2AXEA 2W8ZA 3CCBA 3M5CA 4HMQA 1RVDA 1WD5A 3MWLA 3NV9A 4C89A 2Q5LA 5J4HA 3QWBA 2B4TO 2F48A 3DV9A 4O2BB 2O4CA 1DIAA 4NKRA 5HF6A 3CIOA 1TKRA 2NO0A 4YO8A 5L7YA 3USZA 4FB5A 1ICEA 2JZNA 4J4BA 4AUNA 4DB2A 2ZB7A 1E6MA 2WFLB 1WVIA 4KGZA 4L9AA 1GNQA 4KIFA 4FE7A 1S4MA 2GQ0A 2YINC 3IA7A 5KNCH 2XVMA 1XPOA 1OZHA 3CISA 4QDKA 5G1OA 1JHQA 4FZJA 1CZKA 1JHUA 1EM8B 2ILVA 2V7WA 3VNSA 1Q17A 3O47A 3R0VA 1PZMA 5ER9A 1G66A 1R0WA 2B1IA 1XSEA 1ZEMA 1DFIA 1PEYA 3QMMA 1W8IA 3MYRA 3WYDA 1Z2AA 5TQ0B 1ENOA 1L7PA 2WTNA 3MQ4A 1KIFA 4YP9A 1J00A 3FTQA 5E1BA 1JLMA 5A5GA 5IULC 2QYSA 1II9A 1CHDA 1KAEA 1NUHA 1Y7TA 4ZZ0A 2NPOA 1XVAA 3P4XA 4ZT5A 4JELA 4OJQA 3S1AA 4O4LF 4MV5A 1X74A 1TQHA 5FEUA 2R62A 3DBVO 4U5XA 1C9EA 1M6HA 1NVMB 4F9EA 2ORWA 3QEMA 5AHOA 2D4HA 2GD0A 3VOBA 3LBYA 1C7QA 3EEFA 3RASA 4D41A 3T1NA 3D4PA 4TVBA 4BQEA 5K0JA 2GVNA 2H4JA 1O0CA 1X92A 2MSKA 3ENKA 2RHLA 1EWTA 2FMHA 4G6ZA 1F51E 1VA4A 4QBHA 4EHBA 2EG9A 1HT2E 5BSHA 4A6DA 4AMBA 1KHHA 2HHLA 2UUPA 2ZRIA 4WBNF 1EFLA 4LZPA 3TRIA 4J0QA 3TZLA 4HRAA 5EVJA 5KQGA 5JZSA 2H8KA 1BYUA 5F51A 3OPYI 4JUIA 1MOPA 3WDKA 5LQDA 2OC4A 2YW2A 2BFPA 3A14A 1ZIXA 3CLTD 2GEFA 1MTOA 3EIQA 1QC5B 1UMCB 4N0MA 3WTBA 1ESMA 4FINA 4R1TA 1EFDN 4OM7A 5CT9A 3QJGA 3IQFA 4C03A 1GJRA 3RABA 2EOAA 2P2DA 1ORRA 4ND8B 2ZZMA 3ZIAA 1R6XA 1NUSA 4M8NE 4WJKB 1GPUA 1TRHA 3F74A 4IS3A 2PT5A 4IO1A 2EC5A 2XYRA 3GBPA 1Z2EA 4ARZA 4A2CA 2W43A 3BK1A 4Q5IA 2B36A 4UU0A 3MWKA 3TI9A 1VL6A 2HV9A 4AY4A 3AHEA 1M2KA 2QRVB 5AM4A 1NXSA 5MDHA 1BMQA 3LYLA 4HFNA 1U3DA 3LPCA 5A6SB 4J2OA 2CSUA 1Z18A 1YJAA 1BS9A 2Y8EA 3GA0A 3CR3C 3N2EA 1AMNA 2FMIA 1IVYA 1BAPA 1YK1A 2Y1EA 3KU1A 5DKFA 1OYVA 4K26A 4XJVA 2EWMA 4BMXA 5K5EA 2VG8A 3JAMA 4KO3S 4RWEA 1IUKA 2XVXA 4LSWA 1G3MA 3VVLA 4B7ZA 4GPEA 2IXFA 2CMGA 1O0BA 2D1SA 2FUCA 4GVLA 4DIMA 3DDHA 4M49A 2BGMA 2Q2OA 2Q4DA 3URKA 1BWPA 1C9YA 4UBMA 2G80A 3I83A 3ZOZA 5KPJA 2PUAA 2PUGA 3MGKA 4MH0R 4TMTA 3M4XA 4GLBA 2D2EA 4ZODA 1YR3A 1L1EA 2IP4A 5B2FA 1YC2A 4WY8A 5JNRA 3M3HA 4U5QA 4IJKA 3P9RA 1H8EA 3D4BA 3IEUA 1BHJA 1RYMA 3QFFA 1SCUB 3LCJA 2O2EA 2QJWA 4LDNA 2XNSA 2B21A 4YMWA 5KOIA 4ZVSA 2BFOA 2X7JA 3F6RA 2ZJBA 2FWJA 2ZYVX 2R84A 4HEA1 4XWAA 2VXYA 3ZNOA 3I8XA 2XMGA 3UHAA 4QM7A 2Q46A 4I5IA 2FSIA 4L8VA 1JDNA 1VDZA 2YTZA 2QPTA 3E58A 3MLAA 1KEZA 4GOOD 1XRJA 3GAZA 3F97A 2OMKA 5DU2A 2D2XA 3A6GA 2VRBA 4QYSA 1ZUWA 2DQZA 2CLHB 2RAFA 4HZUB 4LXIA 4RNCA 4OTZA 4OQFA 3DUWA 4EUHA 2GSDA 1GPWB 2DE0X 1B2RA 2Q5EA 2B1JA 4IHJB 1VQ1A 4OHCA 3SICE 5I4KA 1K2WA 3ZX5A 3IAHA 4ZYTA 2OL4A 3CPEA 2W2KB 3K30A 2OUIA 1AT1A 1U0JA 1QHSA 5CGQB 1W5AA 4Z5XA 3P4YA 3U9SA 1ZA2A 2F1RA 2XQIA 2H54A 5A1TA 1TZCA 4JT2A 2ZTVA 3U19A 4RVCA 3GQVA 3CNQS 3KPWA 1WCIA 3UJ9A 4B3GA 5KCMA 4GOKA 3EY4A 3JYOA 2JBAA 4UBIA 1E77A 1MD9A 2AEMA 3DC2A 3QW2A 2ODEA 3VV3A 3PUKA 3QF4B 1VHLA 2DPYA 1IY9A 1ZH2A 5K1ZA 4C4PA 3DE4X 3WIUA 1VZ2A 3HSYA 1IQUA 1X3LA 2LPMA 1YB7A 3N8HA 1DAMA 1TIPA 1QCDA 1CDDA 1SRRA 2NYVA 1QOZA 4JDPA 3WLEA 3TLMA 3VPCA 3KQTA 3H0CA 2BEVA 3K2BA 3WRYA 3JVVA 3TNJA 1C3VA 2H57A 4LHXA 4O2LA 2H29A 2A9OA 2HIMA 3VR5D 3CKLA 2EWVA 3KAKA 1GG8A 1HTTA 2UZ1B 3LDFA 5ALSA 1GUFA 2H31A 1X2EA 4C76A 2A1UA 2QN8A 4EAAA 5H9WA 2YHSA 4AJ4A 3GIWA 1U28C 3PXUA 3C4QA 2ISCA 4KYTA 4B09A 1ML3A 1SCIA 2EQ5A 4Y7DA 4WV3A 4WEOA 3F6SA 3ILHA 4ACBA 1WZCA 3Q87B 1FC0A 2HPZA 3U6KA 4EO7A 2H9AA 1JYSA 2AJBA 3ENNA 4FZVA 4FBMA 4BQRA 4WBXC 3CUYA 1VPWA 2GJ8A 4GH5A 4RDIA 3M9XA 3PP8A 2CKMA 1OT5A 4FOPA 1PLJA 3A1SA 2BKAA 1Y81A 1XWIA 3BG5A 2BPOA 3JVEA 1GZ3A 3ICVA 4Y6QA 1DBRA 1KORA 5E38A 4AG5A 1NATA 2FG7C 4S2EA 2XRMA 2JFBA 1EUDB 4MWEA 1AHNA 1F8FA 2C4MA 2XTZA 3F47A 3S28A 2ZITA 3K1AB 1TK2A 4O1IA 4QO7A 3F4BA 4LK3A 2BEWA 3VNBA 1FVFA 3CNNA 2ZLBA 5JH7B 4LOAA 4AJPA 4R2XA 1QIHA 5D2CA 2HTEA 2Q2QA 3G88A 1KWGA 1UKYA 3HWWA 1Z39A 2HDNB 4PAQA 3CF0A 4W5TA 4H08A 4ZOLB 2RGXA 3RJMA 3ZVLA 4KE9A 2DJIA 1GDDA 2FWAA 4DDUA 3BWDD 5I5GA 2WNSA 3EG9B 1G18A 1JHRA 2XDWA 4E2YA 1E9RA 5HQ3A 1DCTA 4NX2A 4WLNA 1J2RA 3LWBA 3C16C 4C5CA 2LKCA 2P65A 1CYEA 4C3ZA 1R4MB 3L79A 1JJVA 5JUWA 2CNDA 3ZIDA 4DDMA 4YAWA 3NDRA 4OHVA 2PGIA 3ZK7A 2PJZA 3NAQA 4RETA 3K09C 3C3WA 3T7TA 2Q3CA 2AFVA 4HNHA 1DARA 1U8ZA 3KZKA 4CV3A 5SYAA 3H2YA 5CHYA 4XYBA 1XAGA 5HK8A 3VMMA 3HUEA 2PZJA 3BBLA 1KZ4A 2QRHA 2JW5A 4Z4GA 4G0MA 2ZS9A 3I4LA 4K40A 4UUNA 4PE5B 2RHMA 5CFQA 4P4SA 4JSRA 4AK9A 4BLWA 4HJXA 1K5HA 3P5BA 2GTIA 3WLPA 3V6MA 1OFGA 1Z5ZA 3GWGA 2PWAA 1L8OA 2L18A 4N7MA 4RAQA 5DWDA 3AEQB 5J47A 4RVNA 3M1YA 3VZSA 3MBOA 4DJTA 2DPLA 1UT6A 1Y1TA 1PFYA 4LQCA 4P3XA 3LKVA 5C9ZA 4GLOA 5DBFA 2QMEA 4AP9A 1NG1A 3KQHA 1XTQA 1BE8A 3U7IA 4MV3A 4ZGBA 3TSYA 3NASA 3W5SA 1FS6A 1WU8A 4WDQA 4ZU6X 5KAMA 5HZKA 3ZCSA 1JX6A 2E85A 3G23A 4GPIB 4Q19A 1K7SN 1TTQB 2P6UA 1LVUA 5CAEA 3PEVA 4EVRA 5KWVA 2WJWA 4JDUA 4MOWA 4M0MA 3CEMA 1JDVA 1KDPA 1IAVA 3K9QO 5U4QA 5LP6F 4J1QA 2D0DA 3KT3A 2JLWA 1FFDA 2IITA 1R4NA 2H1HA 4DMGA 4E32A 5CFMA 2QZPA 3FI9A 4W8GA 1P2DA 2SKEA 5K7SA 1KQFA 2FMUA 2DQ4A 3I2IA 3HNRA 3GNSA 2GBPA 4BRSA 1MX1A 4RFVA 5GTDA 5FLXA 1RFLA 4IIGA 1AIPA 1NI3A 1JZSA 2OHJA 3CLTC 5I9SA 4N49A 4DLPA 4DM4A 2QX6A 2VYQA 3BIXA 4M0CA 1U0RA 4KPUB 1WXWA 1GO2A 3H1GA 4CL3A 1ZD8A 2Q6OA 1TCBA 3UAXA 2A5YB 3TUJC 4HVCA 2D2VA 2WZQA 1CJCA 4CLRB 5JATA 2D8MA 2WABA 3K8ZA 1EGQA 3WRXC 3GBVA 5KVSA 2P9ZA 1ORTA 1ZC3A 5HFJA 4F5DA 4FEAA 3IEKA 4IMIB 1XJ0A 1ECJA 3G5UA 1WQ1R 2CSXA 1DO8A 4BYGA 4IO0A 4R6XA 4W5OA 1WLYA 3CZ9A 2G08A 3SKVA 2G7MC 3UVEA 2CJWA 1P5ZB 1EFTA 1WZEA 3RG2A 2B9VA 2BZSA 4P93A 3HJAA 5G0UA 3JWEA 4EYOA 3GGJA 2GS9A 2QRMA 4PEVA 5C3MA 4BVEA 1IWPB 2C4UA 3C3JA 5LLSA 5B64A 3BICA 1RXSA 1QX3A 2ZDQA 4ZHSA 3GFBA 5EJFA 2JCGA 4LBYA 3JU3A 5DGCA 1Z7BA 1L4GA 3DDZX 4OD0A 4HLDA 3WWZA 4PO3X 4MV6A 5F21A 1WP4A 2OHGA 3WO0A 2CHEA 2YQ4A 1TAGA 1U6JA 3DBLB 3U0VA 2FXVA 4RK0A 1I7DA 3B3FA 4JKIA 3R3HA 4DR3B 4D3XA 2WYUA 2WVGA 3DZ8A 3PD7A 3MS4A 2R2AA 3K6SA 2NSDA 5DT2A 3AQ4A 3RSQA 2Y9MB 4KR0A 1RQXA 5K8IA 2L19A 3WLQA 4CE6A 2YJ4A 5KHLB 3BWBA 3W0LB 5ITZB 1Q1GA 2OCLA 5SV2A 3S8YA 3L7BA 2P1RA 4NDNE 4CU5A 3EWAA 4R40A 5EZYA 3EZ6A 1A9SA 1J5EB 4O6VA 3AVYA 2YZMA 4YCJA 5DISB 4BJHB 2WV7A 5K8CA 4Y0VA 4PF1A 1W1IA 2IGTA 1OREA 3UW1A 4RTLA 4JEUA 1CDEA 2R7MA 1KAOA 4WNCA 2PANA 2BGIA 1B26A 1GL9B 3QBDA 3QU2A 4K86A 4XTCS 2I4OA 3H2IA 2QR5A 2HGSA 2GXUA 1A8UA 3KZ1E 4KDEA 4M1EA 5COAA 3NBAA 1I7PA 5C31A 3BXHA 2W93A 4S04A 5JVDB 3P9YA 5KSPA 1HDYA 2ZUTA 1UXHA 4WACA 4MEAA 3CKYA 3ZHTA 1HYBA 2AI3A 4C6HA 2O2DA 5JJBA 2NV2B 2IH5A 2VI5A 5DYNA 5HIKA 2PRIA 5L4SA 2GUWA 3EISA 2NVUB 2ZRAA 4CBVA 5AXCA 1IWBB 2C42A 1EE1A 4WGFA 3TW4A 4MEJA 5A4JA 4TYMA 1EFRD 4BKRA 2HK8A 1VI6A 2JB9A 3KE9A 4H6XA 3EVBA 1R1DA 2J0EA 1FRNA 2JD0A 4Q05A 2A7XA 4LBVA 4CMBA 1AN0A 1X38A 2CCJA 3CZAA 3E9RA 3K0AB 3R3WA 4KYIB 4ETNA 1TMKA 3ZH2A 1JFVA 3A9WA 3QLVC 1GRCA 3ND9A 2XPCA 3DL4A 1NNEA 3G2OA 3IEXA 2GN2A 3IJRA 1DVRA 1PGOA 3FYCA 3I2JA 1SZPA 4M37A 4D0GA 4B6PA 1KO7A 3IP7A 4RKYA 3IKTA 1YZHA 2HCJB 8GPBA 1Q0PA 4FYXA 4UJ5A 5JCPA 2NVBA 1JFFA 4JCCA 2IW1A 5J2UF 2I4LA 4DLVA 5EESA 5JO0A 4BTLA 3BN3A 3Q7PA 4JI3B 5CXXA 1P9OA 1AQNA 4EDHA 5B58T 2WAAA 2V45A 2WU3A 2HMYB 3AESB 1Z63A 1HKHA 4LPSA 1ID8A 2FSFA 2NADA 3WVNA 1JDBC 2BRUA 2E49A 2P40A 4RELA 1JQEA 3JALA 5JXGA 3RK0A 2J3QA 1RM0A 3P0RA 1KAMA 4KGXA 1I1QB 1EWVA 1DCKA 1JQAA 1LF5A 1XMPA 3A6ZA 3RVMA 2W11A 3OZDA 4Y9DA 1JHMA 1V5FA 4GYKA 5DI3A 1JYFA 4QAJA 1O97C 3G5AA 1NBIA 2PMBA 2VOJA 4L4XA 4F86A 1MABB 2WWTA 2J9YB 2IX3A 4HH1A 5JT1A 3O74A 4KQHA 5KYYB 1V16B 2AXPA 9ATCA 1BJTA 4K8RB 3L7KA 2NZWA 4XX1A 1QS0B 1Z2OX 3FY4A 1L4BA 1QH1B 4TWRA 5F78A 3DOHA 4UEWA 4JENA 1TYZA 2F9FA 2FJ0A 1QHHB 3SVTA 3AKZA 4NQRA 5CITA 2UYCA 1S96A 5DTMA 2DSNA 1GXSA 4ZAZA 4ALIA 1VMKA 3I9OA 3S7ZA 5IT9A 2FKNA 4MYCA 4DQVA 3PJGA 2C4TA 1M3SA 1INLA 3F5QA 4MRAA 4MS3A 2IBTA 3OM1A 3NHZA 1QG2A 3NHYA 5M3BA 2OC9A 3DEJA 1BXZA 3P0FA 2FX3A 2Z2ZA 2QD5A 3IAS6 5DWQA 1YBVA 4R8RA 5DK4A 4YA6A 1U8AA 3UK2A 1QJCA 4DMFA 3FYUA 3MS2A 2ZJYA 1E2HA 2HPVA 3IV7A 4D42A 3A1CA 2N42A 5T64A 2QKYA 4XPZA 5IK2A 3GH1A 4WNIA 3CZQA 3G8DA 4ZPJA 1HNWB 1WXFA 1J49A 1F0YA 1VIVA 2VZLA 1RHJA 3LJKA 4LRQA 4BN0A 1WY7A 1JVNA 1XLTC 2EQAA 3L0PA 4WY5A 5I7UA 3M4ZA 4WAUA 4AX4A 5AIAA 4Y6GB 2ZUSA 2ZJFA 2O54A 1A9TA 4W4TA 2Q5IA 1X42A 2PZEA 5ARBA 4RTJA 2Y71A 4R68A 4ZI7B 1D1PA 5TIIA 1GCGA 2HV8A 1LX7A 1N2ZA 1NUAA 2HFKA 1SXGA 1NTRA 3B48A 5TR9A 3R7SA 2QN3A 4E14A 3S8MA 1CQPA 5EZQA 4Z1MD 3KAQA 2PX0A 2G40A 3E7PA 3JYHA 1O8CA 1D0VA 3I2YX 3LWDA 1RBYA 1WF3A 5ITWA 1Y8RA 3KTDA 2BGNA 4HKTA 1E1MA 3EVCA 1U7PA 3GEIA 4WFKA 5JCJD 1DHRA 5JSHA 1D1SA 1OKKA 4E6PA 1CLUA 4W9NC 5B1HA 2FE4A 2TMDA 3LC0A 2VHQA 4DLZA 3DMTA 3OE4A 2V7BA 3UB3A 3HFSA 1KH2A 4IZHA 4OIFA 5SZIA 5SY4A 1YIAA 2AT1A 4FJ1A 1U5AA 3KAPA 4YRNA 2FUG1 1DOAA 1Y6RA 1Q74A 4I1PA 2QTCA 1XA3A 2YHIA 3OKCA 4BBAA 3AC0A 1WZIA 3OCJA 5MFZA 4OXXA 3DE1X 3TM5A 4JLPA 3L7DA 5J5CA 5K8LA 1CEEA 4WXMA 4B84A 5DRYA 1XT6A 3GDWA 4FCVA 1M9NA 5NLLA 5GJBA 5JJLA 1OX6A 4YWJA 2C9ZA 3E82A 4EYGA 5AD1A 1YA6A 5IDXA 3QIAA 9MHTA 1R9MA 5EMNA 2HQSA 1TIKA 2YN4A 4K6OA 2WOJA 3MMNA 4UVHA 3SIXA 1T5BA 4AAYA 3N87A 4BNLA 3EY9A 3Q8XB 3BMXA 5HDQA 1UBKS 4ZP1A 1MB3A 2RGUA 2X5JO 5AW5A 3ORSA 3UPUA 3MWJA 1RI5A 4MLPA 5FTJA 5J59A 1N5JA 2UVQA 4LCBA 3TMYA 4BASA 2IZ5A 1CUYA 4N03A 3VDQA 1IEQA 3FCUB 2IZ1A 3AZOA 3HR8A 4HXFB 1MB0A 4Q9AA 1HSZA 2NAFA 1LQUA 3OOWA 5E3JA 2HK6A 1CEXA 2AX3A 2VDLB 4S3MA 4UNSA 5EHQA 2D7DA 5GVSA 4OXRA 2HA3A 1LBTA 4HAWA 5AI6A 2GESA 3DWEX 3EPJA 4BLUA 5IN4A 1UKBA 3EQ2A 2JHCA 2RH5A 1USKA 2GEBA 2A1TR 6REQA 1UMKA 3KX2A 1HK7A 3LBFA 5B3AA 3E61A 2OCYC 3T7EA 4ZT3A 4EF6A 1JG3A 2IXAA 2G0TA 3KOUA 3Q3HA 3RODA 1RAAA 5AOBA 2QGFA 3PGJA 1HBJA 3V3TA 2C2OA 4MITA 3VR2A 5A4FS 4DIEA 1PR3A 2DSTA 1K89A 2Q4EA 2PPLA 3C3EA 3DZKA 1E60A 2Q3JA 1TCCA 1UMBB 3H5IA 1PWXA 3K9WA 1TVKB 1V43A 3WNCA 1HYQA 2V59A 1ZD9A 2X6TA 2VAPA 1AUPA 3LUBA 1YSCA 3OJLA 1AGXA 3GG2A 3CZRA 4QQFA 1DV1A 2WU1A 2WF7A 1WMSA 5C80A 3AV3A 1NTOA 1SKBA 2JLRA 3B6EA 3DEYX 4EPVA 2BKXA 1IZ7A 1WHTB 1NKVA 4KXQA 5FV7A 2A5LA 3LI2A 2Y67A 3STWA 1SAYA 2FPIB 4KX3A 1HQYE 1M76A 2PKEA 1EBFA 4MIEA 4RJTA 1X0VA 1J23A 3RRJA 3WYFA 4I55B 3T06B 5KTPA 1YBFA 4UM9D 4EEXA 1KJWA 4O2BF 1N7JA 1FDUA 5G0WA 1E20A 1CE8B 1GTVA 1UWLA 1ZY2A 3LLUA 5EE1A 2VNIA 2H52A 4ID9A 2WJAA 1NVAA 3DBRB 3AETA 1KDVA 1I3OA 5BQFA 4MQ5A 1DWUA 1Z47A 2OV8A 3VNAA 4B17A 1TQ2A 4AN0A 1P1IA 3GPDG 4NYJQ 3ZGZA 2NIPA 3HJGA 1G1MA 2RCYA 3D0RA 1PD1A 3AM4A 4WOBA 4AP6A 1O9GA 2WMYA 5HEKA 3WNQA 2NQ2C 1RXUA 4PZYA 4CM4A 4DIFA 4CTNA 1N6OA 3DEZA 4NYIR 2G1AA 1L7OA 2I2WA 4PIMA 1DBIA 5LZ8A 1ZNXA 3SZOA 3FYDA 5B6PA 1W4RA 3E3NA 3WP0A 4L57A 3HVIA 1LV8A 3KXLA 3OETA 2WSMA 5D1NA 4A15A 1J2YA 3PEWA 4KK3A 3M1LA 3ORQA 3PVZA 4ZU1X 3T5MA 4DWWA 2FEKA 1RPTA 2WYIA 2HSWA 4YN3A 3RF6A 1FTWA 2OSVA 2GKSA 2AYYA 2WD7B 4FGSA 4UW9A 2F43B 3TQIA 1Z4KA 4CUJA 3O8LA 3LBHA 2QTWB 1EEHA 4NJMB 2PH7A 3WYEA 2DECA 3ST7A 1RHMA 2D2IA 1HE8B 1M6WA 1UPTA 2KWIA 3DEAA 5B6JA 4KR6A 1RBQA 1UL1X 1NP3A 3O7MA 3BHNA 1XDSA 5E8JA 3S2YA 3UZUA 1MH1A 1ISGA 3E1GA 3N3AC 1GFZA 3GJ6A 1JTFA 2J9FA 1N34B 4RQAA 2ZE6A 1WULS 3J7AC 2Y99A 4FFVA 1W44A 4XSHA 4JP5A 4K6FA 4BY9E 1A5ZA 4Y67A 4M7RA 4M0DA 4XJXA 3GMSA 1DQYA 1ATZA 3GLFA 5CIWA 2C2YA 1NMXA 3RBZA 4AKEA 2CJFA 2AFRA 2P9EA 5B7QA 3GAFA 2FUEA 4FC6A 2CCGA 2GBFA 1Q3TA 2WAOA 3G2KA 4PIVA 4UTOA 2X41A 1KP2A 3THSA 1W36B 1RAGA 2BD0A 1VMEA 2YRWA 5AK4A 4URZR 3VH1A 3O91A 2ODPA 2I3GA 2G72A 1EX6A 5CGZA 3GF4A 2R7AA 3C5EA 4KYVA 4MYUA 4P5DA 4ARBA 3UJ3X 5KZMB 1HORA 4J3FA 1KYVA 1Y7IA 3C15C 3L7MA 2VPTA 1MGOA 5A62A 2O8NA 1SKUA 4OH7A 3DR3A 5JQGA 4D43A 1V71A 2GETA 4W7IA 1YS2X 3W3AD 5MF6A 1DQRA 1VGQA 3N8KA 4IW3B 3FNIA 5IVPA 1R6VA 4HTAA 1ZUNA 2EJCA 2R2GA 1JH8A 1MOSA 3NDPA 5EQJB 5CDHA 1DKQA 3PF9A 4OQXA 1BMDA 1DAGA 1EA5A 4JIMA 2XTJA 4EW2A 5JHGB 1NW4A 1O94D 1QRRA 2AWNA 1QVAA 2IZ0A 3UGTA 4KPEC 4IOJA 3CE6A 3VSEA 3ZZTA 3TI7A 2P67A 3CG0A 5AM1A 1OBOA 3LUCA 4X94A 5E6SB 4E5PA 1VLLA 1YVEI 3D7KA 1SVIA 4TMYA 3PGMA 3M6UA 2HLNA 4D2IA 3U09A 2H3EA 2XKAA 3S2EA 1W581 3AZPA 1NQVA 2NO9A 2YL2A 4EEZA 5AVRA 3ADKA 4CGYA 1QDUA 5C8DA 5KNLA 1M33A 5FF9A 16PKA 4RHEA 4IGAA 4W1RA 3EX7C 2O3TA 2OV3A 4LE1A 3M1AA 1YQTA 3W8NA 1GFIA 4DY4A 3NRBA 3IURA 4HDMA 4INAA 3IODA 3ROEA 1P1RA 4PFKA 4BVGA 1SCJA 3JWPA 1WCWA 2W0SA 4C0JA 3WA7A 2NG1A 1OOEA 4JQYA 4YECA 3DSRA 1T6BY 4B4WA 2VHUA 3DC7A 3GUZA 3CLKA 1NYQA 1G8KA 1DE0A 2Z2XA 4YVFA 4ZT4A 3TTVA 1Q95A 2GJ4A 4LV6A 1KDTA 4X85A 2W4IA 3WYBA 4V2IA 2C7QA 2YC2C 1EWQA 1OXUA 4OREX 3RSGA 5KWIA 1B23P 2I67A 4KV7A 3DFUA 2FW9A 4D9FA 2MINB 1U4OA 3DD1A 2DG2A 5KSWB 4FMDB 4L2IB 1IM5A 1JEQB 2I2CA 5LZ4A 3K3PA 3O21A 3KKLA 3EF0A 4K88A 1JEEA 3A6DA 1KMCA 1GUDA 1H6BA 1XB2A 1GUZA 2ALJA 4X20B 5EZSA 1ZGZA 4IHJF 3NETA 1CQZA 2GO7A 4XYLA 1WBDA 2EP5A 1G98A 3VKUA 1YS7A 2QM7A 3RKRA 3UT5A 4ZVLA 2XTAA 4TTTS 2Y66A 1CRQA 1Z7GA 4KQWA 2AYZA 3BSYA 1R5BA 3DE3X 3MB5A 1OZGA 5J43A 1L6RA 3F7OA 4YYZA 5LR6A 2NP7A 3EWSA 2F67A 3P52A 3U2QA 4O2RA 5TX7A 2FGJA 3AR2A 4RD6A 2VO1A 4RHUA 2A5FA 3BL8A 3B8EA 3EVDA 4KI7A 5DIZA 1POWA 1C4KA 1XZLA 5K01A 4FOTA 3WC4A 4M4SA 2YHAA 1UC5B 4C9BA 2PLRA 1W76A 3BCRA 3D81A 3KYBA 3NBZC 3QU7A 4RHTA 5KB3A 1SK8A 1VECA 2GCGA 2W2PA 4QDOA 1C0IA 3LQRA 3QVWA 1EGHA 2NTVA 1FNBA 1OGYA 4AJIA 5CLFA 5ITVA 1G3RA 4QWWA 4D25A 3H42B 3IQXA 1OFUX 1OROA 1GQOA 1EGAA 2VBFA 2ZP1A 2YWJA 2ZS7A 4OOEA 1QH0A 5FBLB 2B92A 1JMVA 4RSMA 1U8YA 3ZQUA 2NUTA 2ZU6A 4GEKA 1GAEO 3HL0A 1N6LA 3M5PA 4C5AA 1IEVA 1E1NA 1L5ZA 1ZAKA 2VT6A 4L6AA 1PS9A 2I76A 2WD9A 2CVFA 3QY0A 4F4UA 2SICE 1NLFA 2GX6A 4OFZA 5KINB 5CW1A 2EBUA 3EPLA 1E62A 3QQ5A 4O3FA 3WMEA 5F1YA 2IU3A 2B5VA 2ZBEA 2ZRLA 3LNCA 4FEEA 4EZEA 3QPWA 1EUCB 1L0BA 1HKUA 2BKLA 3A36A 2A59A 4CQLA 3A4LA 4N01A 3LWZA 2FOIA 3OECA 4TXLA 1P2GA 1KJNA 3AKYA 2QG6A 2OQIA 3NTRA 4C6SA 3R4VA 3T4UA 1IG0A 2ZSHA 1RQLA 1ILEA 2YY5A 3EQ7A 2J85A 4WZ6A 3GRZA 3TSOA 1A2KC 4IVRA 4BE9A 4BO2A 4HUQA 2QL6A 1CVLA 4B46A 2VYNA 3FVWA 4Q34A 1F2DA 4C78A 3AYXB 4FFOA 3D2AA 4EUKA 2A1TS 3EEBA 1XG5A 1FTYA 1ZHOA 3VGPA 1KZ6A 1SEVA 2JANA 4B3BA 3DA8A 4F38A 3QXSA 4XWKA 5ALPA 4ZCSA 4U6SA 4C3UA 1Y3AA 1JRLA 2QE7A 1VI2A 3AM1A 4FE4A 5EWMA 3VTAA 3ZX4A 2L2QA 3P0HA 1FFXB 5AESA 1YB6A 1MVOA 4Y6LA 3AUTA 4ZOLF 4E13A 1QH9A 2VXOA 3B6ZA 1N25A 2VTBA 3DR5A 2BGLA 3MTEA 4PZDA 4YCBA 1IH8A 2KHZA 4WA7A 4NAVA 4KZKA 4MRRA 4F56A 1E9DA 4ZYUA 4YT8A 4C3VA 1H23A 1HNNA 1MAHA 3BTUA 5I45A 1YB2A 1DMSA 3OU2A 4QRHA 3FSGA 1V5IA 4WL0A 2PTGA 4F72A 1X6VA 2PQ6A 4B83A 1U2TA 4HS9A 2EBHX 3ZS8A 2C92A 3PPYA 3QYFA 3P9KA 4REQB 1C50A 2WM8A 2XMRA 3QPBA 5FPTA 5IAJA 4RTRA 3QTBA 4N3AA 1YFJA 2B1RA 1KP9A 4F1JA 2IOYA 1NI4B 4WVFA 4C07A 4WN9A 5B4VA 4QUAA 3CNOA 1NJ8A 3WWEA 4B6EA 4Y0NA 4MQFB 3RO7A 3SU8A 3K8YA 1YI1A 2FI1A 3D6FA 2FSVA 5LQJA 2KS6A 2Z08A 1QFXA 1IN5A 1RWQA 1RJWA 1DKUA 2H3HA 4OAOA 2C84A 3E8SA 4FZRA 4HP8A 4RH0A 4V2UA 3A3OA 2PFGA 4NSNA 4BKQA 1G9XA 4EIWA 1X87A 2Z43A 1NF2A 1EVLA 2AD5A 1RLMA 2H17A 3FYTA 4TRMA 5GGYA 3IEMA 1ODFA 2ENWA 2OM2A 3W5IA 3CLSC 1E2DA 2PD6A 3ZCQA 2PPVA 2QNIA 4MO2A 1KQPA 2PDAA 2F8LA 3KEFA 5CHEA 2GGSA 4JUFA 4I3GA 1M5TA 5I9MA 1V96A 2M1ZA 4JP8A 4YNBA 1L5HB 3CFYA 4PC1A 4NCBA 2GTHA 1KRWA 3LUJA 2QRQA 5EC8A 3DV2A 2V3WA 3AY3A 3GVPA 1CJSA 1ZMXA 4KIGA 3RU3A 1DJPA 1PDVA 1K92A 2XOKD 2PUTA 3ECSA 3F3KA 4GE0A 3T0IA 2BTEA 1YDMA 3KT8A 1N7HA 2FFRA 4NG5A 4B8YA 1TQ6A 3H2KA 2JFHA 5JAMA 1DP4A 5KKAA 2BGTA 2Q6LA 4PW0A 5KTKA 5L40A 3U7FB 1S1MA 1LNQA 1L2TA 1EI9A 1Z88A 2IYWA 1H3EA 1U1DA 3I39X 2O1XA 2XCIA 3OY2A 4M7OA 5AICA 4YMVA 2IPMA 1WX1A 3G9TA 4AMUA 4D56A 4BNIA 2GWRA 1Y63A 4OBWA 1S3IA 3ITEA 4ZYXA 2FFJA 2TYSB 4R4JA 2B7BA 2DWQA 2OFOA 3NGMA 1GR0A 1GTZA 3R44A 1M0WA 1EAMA 3GVHA 3K53A 3KOMA 3SHTA 3WISA 1EX9A 5JIBA 2PT6A 2ZRJA 4ZO4A 1XCMA 3HUDA 1I4TD 2C04A 2BI8A 4JVSB 4LCJA 2X19A 4QG7A 1UDCA 5FO1A 3HDJA 2X2OA 1R0SA 3PFHA 1KVQA 3L8GA 5B4UA 2DUMA 8LDHA 1ML4A 3D7SA 1QVVA 1A9XA 2NW6A 2AOWA 3FUTA 3LP8A 3MGCA 3OT1A 1H0HA 3L04A 2Q9UA 4E5YA 4DV5B 2PUFA 4GZ5A 1MIHA 3JPWA 3A6PC 3FZNA 2OGUA 4NH0A 2VQ3A 3E03A 4RIEA 1GKUB 3O90A 3KEOA 3F8TA 3TD9A 1WM1A 2H7XA 1H85A 3OIFA 4BUJA 4DEVA 2X58A 1IEXA 1TA0A 1AKRA 2WM9B 1FFEA 3LQYA 2ZBUA 5CB4F 1W0KD 3DDNA 5E2BA 2HCTA 3EFBA 1YRBA 3WTCA 1ZJJA 3E9EA 1EBUA 3EWNA 2HZBA 5F9FA 1PR5A 1K3UB 1K4MA 4O1MA 5J5VA 3VV2A 4E07A 1KEEA 1YGYA 2P6OA 1VLMA 2KJQA 5B2ZA 1M1XB 5EXDA 3PNSA 3V55A 1AC5A 1NAIA 3QKWA 3FGOA 4TRRA 1YRLA 4K1XA 2W6JD 2QT9A 2QPAA 3CB2A 2JGFA 2Z2IA 3TGPA 621PA 2QNBA 4D9JA 3MPOA 5DHSA 1M0EA 1S2NA 1XZGA 4L76A 4CG0A 2Q07A 1XTUA 4PTYA 1VP3A 5AKXA 1Z33A 4BB9A 3USCS 2GLTA 2IEBA 2H2DA 2ZB3A 3H6HA 3ZKWA 4LXHA 1A8PA 1FX0B 3LX4A 3SBXA 2ZI3A 3QGMA 3LXXA 4CKXA 2XR1A 5M2QA 2Z56A 3GFOA 3M4YA 1EK5A 3CF6R 1P19A 5K4GA 5E8RA 3AW9A 4G85A 4O4JA 1QFZA 1N6IA 2EBFX 3LQKA 4QFCA 4R2IA 2OESA 3E2IA 4S1TA 4U0JA 3GL9A 2Y27A 1MIOB 2JIRA 4NI5A 3RJ5A 3ZVMA 2OAGA 2XCTB 3THRA 2IDZA 5LA6A 5LNK1 1VKHA 3ETDA 3K9HA 4G8BA 4LHWA 1AE1A 2QRPA 3OIDA 1ZCZA 1P8JA 3A2NA 4LMPA 1MBZA 3VSAA 5ECYA 3V7WA 1Y5NA 2Q21A 4DTCA 1M7BA 4JUDX 1F4LA 2C00A 1W87A 4DLRA 3IKMB 4MCHA 3GJZA 3I3OA 4QVIA 3QE3A 4TKVB 4JNKA 2VUHB 2FN4A 2VEOA 2PU7A 4FSXA 5GV8A 3WJ1A 2ATVA 2C8VA 3H87A 4XCXA 3GLUA 1MO5A 1QGUB 1CY0A 2GZAA 2R8XA 3KHUA 2XT6A 1B43A 1P0QA 2JCBA 4PHCA 4BN5A 3KZCA 3GLGB 4P0QB 1T5IA 3HUTA 2J46A 3NCHA 4M6WB 5GM1A 1YR2A 1ZJ4A 4F92B 4CF6A 4MQ4A 4HDRB 5LXTB 4FZ5A 2PSFA 3ED1A 3BERA 5JAOA 2R79A 3GQBB 4QELA 1DSSG 3TD6A 4D8YA 3RC8A 3RE1A 4IF4A 5REQA 5FPYA 5AJHA 3GK3A 3A4IA 2L17A 4FYPA 4IS2A 4R3WA 4TMXA 1G8PA 1PDOA 2Z30A 3SAJA 1Y5IA 5JADA 1OWOA 1NOJA 2FZ5A 1BKYA 3PPXA 1XL0A 3URMA 1P9LA 1MXFA 2ZBQA 2VAWA 3B1XA 4QLBA 2BT4A 5TT0A 3UWSA 2HA2A 3LAWA 4Y2XA 5AJWA 4ZVPA 3Q3JB 4HGNA 4YWHA 3D7LA 2NU7B 4MS4A 5JJ5A 5D3MB 4FI3F 2QMZA 1S8FA 4ENSA 2GVZC 3GCWA 1IPHA 2EJUA 1ZN2A 3NTUA 5KYVA 4NHEA 3NP7A 1XHEA 2CFIA 2HADA 2DPXA 3RU9A 1DTWA 2LRHA 2OCGA 2QTGA 4PYIA 5A1JA 2A3NA 3O82A 4KWIA 4WKOA 1Y4DE 4BN4A 3NOVA 4OQYA 2A0UA 3U44B 2OAQ1 3S5JA 1L7XA 3A7EA 5JRJA 4JP1A 3HJRA 1BW9A 2PV0A 2O20A 2VUTA 4MJXA 3I76A 2ZI5A 1UJ4A 3O8NA 3KSBC 3L40A 3OWOA 3SZ3A 3PXXA 3KQLA 3T7RA 4HWPA 2ZIZA 3AVPA 4ODIA 4ZV9A 1PS0A 4KIWA 1IY2A 1PZNA 3EQ9A 2RONA 5FWYB 1P0MA 5AUOB 2YOGA 4IIDA 1UBFA 3MUEA 2Q7OE 1NN5A 2WF5A 4W5RA 3BORA 4DQUA 2VWHA 5CIQA 4KR3A 3LKBA 1QHEA 1P77A 2C2ZA 4PLTA 1L5RA 2OCXA 2RE8A 3U3ZA 4YRPA 5LD2B 1PVOA 3JQ9A 3RBAA 3CM0A 1HDZA 1ZJ6A 2NZVG 5I9BA 3ZCTA 1Q0ZA 1XAHA 1XD9A 1XZFA 2BSAA 3I53A 2WMNB 4P86A 5IN5A 2RI1A 2ONCA 1FVXA 2VDOB 3LC1O 3CUSA 1NVVR 1U2PA 3I0ZA 4RZUA 3AUJB 3R75A 3A1FA 4OA8A 5BMOA 4ZCMA 2WICA 3HTXA 2IYLD 3VZPA 1P2BA 4R69A 2XB6A 4RV9A 5BSMA 2BEUA 2J4CA 3L8HA 4NE2A 2NUAA 1CQXA 2NU6B 1Q1QA 4OB7A 2O8BA 4P7JA 4PYJA 4RFSB 2DP4E 2XY4A 2XZPA 4I4NA 4U1RA 4ZJZA 4JYAB 3JQQA 1LSSA 2OXIA 4TT3A 5B3JA 1B8UA 3WGJA 3P9IA 4TQGA 1XD8A 4XKJA 2EAUA 2BFWA 2HLDD 3EPRA 1NASA 1TLFA 2ZRGA 5JYDA 5KTRA 2QTZA 2Q9CA 3BVPA 4K9LA 1RM5A 4U2CA 3ZWQA 2C77A 4ZMRA 5JAZA 2EKDA 2XDAA 1PQ4A 3GRVA 4LYGA 4DQKA 5A9TA 3A6EA 1YCFA 1KO4A 2Q1TA 5GY7A 3RKUA 3M4JA 1G38A 3NBKA 4JT4A 2XA9A 4JBGA 4IQ0A 1B1CA 4NTZA 4GX1A 3SC4A 3SCZA 4NJEA 4UXHA 4C6RA 2OK8A 4EP1A 3K16A 1O95A 2O3RA 4BVKA 3IVMA 2XYGA 3A25A 3WADA 2GAJA 4MJ3A 5FOXA 4KWTA 4XIJA 1KJZA 3OTWA 3U62A 2WTBA 1FJ2A 5HQJA 1OW3B 2Z5LA 3RVSA 3U80A 1M8FA 1UKCA 2BWJA 1RC0A 3JRXA 3LZDA 3QEJA 4Z4IA 1M34E 1K7XB 5BYKA 3LHFA 1M10A 1C1YA 3DV0A 3OQ6A 3Q10A 1P5RA 1G0NA 1PG2A 2ONZA 2I3DA 2VA9A 2V58A 5JBIA 1GG2A 3V8RA 1BS1A 3OSUA 2I1QA 1U9IC 2ILTA 1G6KA 4X6LA 4P82A 2AOVA 4OXKA 1DX9A 1YQ9A 3AUXA 3KHTA 2YNMA 3K0SA 3O8OA 3H5RA 3EZXA 4MKIA 2VJKA 1QHYA 3FWPA 4TLMB 5ES3A 4F96A 4URXR 1TADA 2FHSA 1O08A 4HNAA 1MOZA 2HHCA 2JHGA 1AV7A 2E21A 3P9ZA 2Z0MA 1OFHA 1OJ7A 1P8AA 1U04A 4Q9KA 2A3RA 3SKXA 2O8DA 1K7CA 2OKCA 3N0RA 4HRVA 3UAOA 4JI6B 1YO6A 1UAAA 4DARA 2NU8B 1PI3A 1RZVA 1TF5A 3DDSA 1R6UA 5CBPB 4ZJYA 3EZNA 4GLFA 4IKPA 1ZK2A 4YT5A 3WDSA 1P5JA 1T5OA 3PR2B 1ISRA 1QTRA 4LHYA 4ZVQA 1MO3A 1VJDA 2B35A 3I6ZA 1QK5A 3E9DA 4L5YA 2GSWA 2UAGA 4NARA 1GKKA 4UMVA 5L6LB 3NPMA 4UAUA 3W78A 2W6NA 2P2LA 4KC0A 3GLIB 2PKYX 3W5VA 3IV9A 2FZGA 5K4AA 2I91A 1FX1A 5A02A 1DAHA 1DJOA 1U81A 3VM6A 1ZBQA 2OZLB 3V3KA 3ZGVA 1A2BA 2BUAA 3OF2A 4NCAA 4ZAFA 1XMOB 3L2OB 2FPLA 2CK3A 4QTUB 3V2UA 1B3BA 1YACA 3IPAA 3Q3VA 4DQXA 1GGFA 4MW1A 2AJTA 1RKXA 1XXHE 2EJBA 4BFUA 5JC8A 5JMOA 3ZHBA 3M6AA 2CXXA 2GPYA 3GFPA 1P1KA 3R0XA 4HX5A 3LA6A 2O9JA 2XHZA 2E4ZA 1PK8A 2GJ9A 1L7AA 2VDUE 3NBMA 4RJKA 4O59O 3L1KA 5ALRA 1V1RA 2J4FA 3B9BA 3SXJA 5BNTA 3JQ8B 1DRJA 4EFKA 4ITRC 5EA2A 3ZZUA 4Q1AA 1VBFA 3C5HA 4QL3A 2PBZA 5EXPA 5C81A 1VLHA 1C7ZA 1U1CA 3JX9A 2PRKA 3OP4A 4M9ZA 1D2NA 2HRBA 2JFGA 4MVJI 4RGBA 3VR4H 1ST2A 3IP9A 4XQGA 4GOLD 1XNQB 2J4DA 3CUEF 2WVHA 1DL5A 2FLWA 2ZIFA 5C34B 2GZMA 4X64B 2FN3A 2C0CA 2H5JA 1USWA 3MRVA 2IU0A 4TXHA 2XTMA 3BF8A 4HEHA 1OD6A 3PC8A 2BE9A 4MVJF 3FFAA 1X7XA 2JH8A 4U9UA 5JANA 3GV0A 4CMKA 4OQDA 4MINA 1KH1A 4EA8A 5ILGA 5B55A 1JWLA 1LBIA 1N9GB 1W35A 1Y3FE 1EHIA 2B5OA 4QX6A 5ILQA 4E11A 1BU5A 4F5EA 4Y1EA 1CWUA 2B8JA 1WCV1 4DPKA 3R23A 1RQ7A 4KQKA 3THXA 2Z6QA 2VAXA 1VJ1A 3QOXA 4KJXA 1GLGA 1KJQA 2H1RA 4R8MA 5IFLA 3TAHA 2X8BA 3G0BA 1OLUA 1ABFA 3B53X 4RK4A 1OX4B 4ALLA 4DSZA 2OORC 1SBYA 4JU9A 4MZXA 3NYIA 2Q0XA 1U7DA 2A9QA 3C7TA 4TUYA 3REFA 3C1TA 3EZ9A 2HF8A 3CURA 4WOPA 1Z8DA 3CW9A 4OGKA 5DB4A 2QAGC 2RH9B 4MVJG 4YIKA 1HFKA 4M0EA 1LI5A 4Q21A 3EG5A 4KE7A 5DSXA 3B36A 4ZT6A 2R44A 2J0UA 2OVBA 3S2SA 1F1JA 3ZK8A 4U2DA 3ZW9A 5LDHA 1IJKA 1WMDA 2OAEA 2VL7A 1SU4A 1Y1KE 2AOTB 1OY1A 1QFJA 4YO7A 4LGYA 4CKEA 1V39A 2QRJA 2QG4A 3PGLA 2GFQA 4YLGA 1AGYA 1G2QA 1F20A 4NV0A 3UHJA 4DMHA 3GO4A 4M8SA 4RMNA 1AQUA 3IKVA 1NN1A 5B1YA 3LHKA 3D0KA 1Z34A 4X7RA 3VZQA 4EFNA 3W5DA 3GFTA 3D3WA 3VYVA 3VR6H 1KVSA 1QF9A 1P3JA 2W6OA 2Y1XA 4HAVA 4JOCA 3DO6A 3V4RA 4DVGA 1XDDA 2VNKA 4YK7A 1S7CA 1GNRA 2CXTA 3FNEA 5GONA 5J40A 4PLPA 4B2YA 2Q4TA 5KSYA 3A37A 1PWYE 4EUFA 5JYBA 2R1VA 3M2TA 1R8YA 2I5PO 4PPFA 3SD7A 4I2VA 2XEXA 4UREA 3V8BA 3UGQA 4BXOB 2I80A 3NVDA 2MYPA 1CBUA 1EK0A 1UKAA 2ZR8A 2VZ9A 5B1IA 3VSDA 1MB9A 4LWPA 4JLBA 2DAPA 2JRLA 2XE4A 1E59A 4UEKA 3AUSA 2X1MA 3DE2X 1Z0FA 3BIOA 2B2XA 1IJEA 1G16A 4ZC8A 5HTOA 2BELA 3L0IB 2IXBA 1GZ6A 4OXNA 1GSOA 1KFBB 1EWKA 5IT4A 1OBVA 1CQIA 1U2QA 4A03A 3LF2A 4WOKA 3E53A 4NNPA 3RYFB 4E2WA 1E1YA 1W85B 2VPQA 1YQGA 3E27A 1SKYB 3NIGB 3T7AA 4AO6A 1E3DA 2Z3WA 3UWMA 3BWMA 2VJNA 1Z17A 2Y6VA 3JAKA 3KRTA 2VHXA 3JASA 4K7JA 4N0DA 4CTMA 1T0UA 3PA6A 2HKIA 4C21A 2UZ4A 2ZUEA 3AF0A 2Y76A 1TFUA 3LUFA 2REQB 4OIMA 1R3UA 5CLJA 4D6PA 2HU5A 5BW5A 4YCNA 5JD3A 1XQYA 1POXA 1XTKA 3TKLA 2G4LA 5G0VA 4JT9A 3H8VA 1T29A 2QG9A 3GEBA 3M3DA 1U2EA 3RT9A 2YIJA 3T3IA 4ZOCA 7AT1A 4ADSG 4FMDF 3B1YA 4YEDA 1G41A 3EA5A 1MN6A 1Z3IX 3NNDA 3ZD9A 2HW8A 4JGGA 1SQSA 4P34A 3L6OO 2UZAA 3FVTA 5HJEA 4HGOA 4MI1A 2OB2A 4RS4A 5KIAA 1FFBA 3E7WA 1EG7A 1JQBA 5IJ0A 1TJ5A 1FJXA 2XNKA 3TX6A 4BL5A 4QBGB 4XE5A 2B94A 3AEKB 3OZEA 4W9RA 1LRKA 3KOYA 1X7WB 2R6JA 3A9VA 4MVJD 3D8UA 4G25A 3IX7A 2F8MA 4QXQA 3HKCB 4Y2GA 5CJPA 3TOZA 3V34A 4AZSA 3VAYA 4E4RA 2GEUA 1ESCA 3AF1A 4RHCA 1KC1A 2P69A 2B1GA 4LG1A 1LLCA 1OVMA 1EG2A 4FEYA 3GZJA 4LV8B 1PL8A 4TS9A 2ENUA 4GGPA 4QU8A 4BTVA 1M66A 2AW3A 4Y8VA 5A05A 4D5GA 5K9ZA 2P68A 3IUJA 4HB3A 1B0ZA 2VYCA 1L5GB 3QNUA 1UQTA 2IW3A 3L18A 4IY1A 3MJCA 1CZRA 1M1ZA 1ZZEA 4MMZB 4PGHA 3CS3A 3JD2A 5DWVA 1XU7A 3ANSA 1YASA 4NYJR 1Y4SA 4RJIA 2R751 1JG6A 4GIBA 1AUXA 1XQ6A 3EAQA 4PQRA 1TVCA 2BR4A 2X8JB 5IEJA 2PSSA 3T34A 1CJVC 5U9CA 4EPXA 1U6IA 4FC7A 2VDKB 2PM8A 2HQBA 5E9JA 4Q48A 2ZYRA 2H5EA 1QF6A 5FI1B 4JJGA 5E6UB 1ISJA 1U9ZA 4RBNA 3RTDA 1IK6A 3I9JA 3QKRB 4QBTA 4R6WA 2D3TA 2GBLC 2OO5C 3UUGA 3KQKA 5KYXB 1SCDA 1N1DA 2WSSA 2I7TA 3LQ4A 4M9SA 4Q12A 3TB4A 5IX8A 1V7QA 4R84A 5CA1A 5JI2E 1IY1A 2ZVJA 2JAHA 3B3JA 2W2XA 4UM8B 3QJ5A 1W36D 4QUBA 3OQIB 4Q3EA 1I4WA 3SR3A 4B2LA 5G3ZA 3ACDA 2W98A 3CF4A 3DYIA 3N5CA 5LZ2A 4I08A 5F23A 3I01A 1CQJA 1F8UA 4XOUA 2ETXA 4GE3A 3LDUA 2OMEA 2R8PA 4IXNA 1QV9A 2YWBA 3N59A 5C8VA 2Z5FA 1D1TA 3DS8A 1CZHA 1TD9A 1GADO 4CMAA 3LD9A 1JP7A 3MAAC 4NVRA 2PSEA 4LJ8A 4BNXA 2HMAA 2KBEA 3FGZA 4DPLA 1F8YA 2R1TA 1V1JA 2Q41A 4D4KA 1O7JA 3ADBA 2CDAA 2Q3HA 1NVKA 3NWPA 4NV1A 4J1SA 4B0PA 2OYCA 4H0CA 4PLGA 1RJEA 3P0IA 3UGKA 1H2EA 2HK9A 3K0KA 3RG8A 1T3ZA 5J3JA 2RGRA 1SXJC 4HDAA 4MDFA 5KVCA 4PGGA 3Q41A 1G20B 2WWGA 4Q93A 1U0LA 1WD7A 4YDHB 1COWA 1G3IA 3I2HA 4QOSA 1B0PA 3H3XA 3HBJA 4JITA 4FDTA 4PS1A 3S2IA 3VH2A 3QQPA 4ZZIA 3TCXB 4U0KA 5IZCA 4EI9A 3B3AA 3IEPA 1GL3A 5FR2A 4ZWNA 4FYWA 4RXTA 1TU4A 3W79A 3HBFA 3LDAA 2OENG 4Q9HA 5YASA 1J0XO 5GJCA 1NQTA 3H17A 2OCDA 5LBTA 3DVAB 3WSVA 1MQ8B 3ZE8A 1P5FA 1UZAA 4G0XA 4LYAA 3V7FA 3FPAA 4BUCA 4EG0A 1JW9B 2PGDA 2PX8A 1JDSA 1A7UA 1LDMA 3IULA 4FILA 4AY6A 1VJ5A 1CUGA 2YVUA 2FY8A 5LB4A 4OMUA 3X1ZA 5CM2Z 4LVOA 1Z0AA 1FQOA 4QKQA 2JEYA 3CVYA 2GF0A 2DFPA 2R7LA 3L0DA 1WEKA 2IS6A 3VAAA 2QTAA 4OQNA 4Z53A 4JI0B 5AI5A 2DWPA 4WJZA 3FXAA 4ZA2A 3C45A 2JAOA 1GP2A 5KYWB 5LQAA 1CRZA 2YHUA 4BNDB 1Y48E 5ALEA 1UBMS 4B71A 1EXMA 1P4HA 2DVMA 2NT3A 3A6FA 2QOEA 3ROXA 5HM6A 2X42A 1NXVA 3DZCA 4AVYA 1JQLB 1NV9A 1J33A 4JK3A 1R0BA 4OLJA 4WD3A 3V97A 1X8XA 4ER7A 2UUBB 2Z4TA 4UTPA 2XCQA 1HH4A 5HK9A 3W2IA 1V3QE 1QBGA 3DMFA 3RIYA 3EXEA 2FDRA 1QCZA 2QS9A 4GYWA 2P2GA 3R09A 1NI5A 2R68A 4YQYA 2UYHA 1P73A 3AR3A 3VBEA 3RJTA 1UJCA 3LCUA 4K6CA 5EIOA 3LT0A 5D8DA 1E2KA 1G2OA 1M74A 5BV7A 5COQA 4KGVA 3U4CA 1LCIA 4NFYA 4Z6KA 2WKSA 3ER9A 3NB0A 2ASEA 1GLVA 4ZO7A 2ZR9A 1PV2A 1O0SA 3K1TA 5BQ5A 3CG4A 1VLJA 4ARVA 2HU8A 2QIPA 2EHJA 4B9EA 4CT0A 5JISA 8ADHA 1R9NA 5KYUB 4M1TA 3X2FA 4MIKA 5GMOA 4C88A 2OR3A 3HCRA 1XC7A 4Z9AA 5E6RB 2OG2A 1XEXA 4GM0A 5CX4A 5I7SA 5HIMA 3KHKA 1DCFA 5HKKA 2OXCA 1YJ8A 3KJIA 4CIBA 2YZNA 3V4OA 3A6KA 5HG0A 1I6WA 3Q40A 5B4TA 4U8GA 1IK4A 1II8B 3JY6A 1TF7A 1ADGA 1YBHA 3A3NA 1MZVA 1U2RA 4GL4A 3RTBA 3FCYA 4TZ0A 1Q50A 3CX6A 1YOVB 3PNOA 1IMJA 1UZMA 4NDZA 5B1SA 4ZMSA 1P81A 1PBTA 2IV3A 4EQZA 3QU4A 2G1PA 3CXRA 4GMFA 5IZ4A 2GOYA 3A1VA 4Q7KA 4TLDA 3H2HA 4EW3A 1SQFA 5E0OA 1HETA 2ID8A 3QBVA 3L5KA 5D7BA 4FLFA 5JZBA 4DR2B 1ZSYA 3TZ6A 1E66A 3QP9A 1H2HA 2GFHA 4G0YA 2AFHB 3IUNA 2JLBA 3DAFA 3GJQA 3MXOA 3A9UA 4N9WA 3E1KA 4LISA 1P1FA 3V7UA 5CJJA 2VLBA 4PS0A 5JCOA 4D0NA 1G59A 1E5LA 3MTGA 3NEJA 1ZU4A 2G8LA 4JR0A 3JYNA 3S81A 2DH5A 3OTOB 1X1QA 1VJCA 4LOJA 4LX0A 3V42A 1FOEB 2I71A 3P94A 2A30A 4N9QA 4BHTA 4TX1A 3V1LA 2OBXA 2WJYA 4QJ4A 1NVFA 1X9IA 1P0CA 2GM3A 2LIPA 3BAZA 4HNGA 4JZYA 4NMHA 1YMQA 3TKAA 4AJ1A 4AMVA 5A4KA 1XDGA 1V4BA 2OZKA 3OUTA 4P2BA 1RCFA 4ZANA 3D0QA 2BFFB 1GT6A 4YP1A 1DI0A 1MPTA 1OLXB 2PUWA 4MWGA 2XMCA 4R1NA 5HJ2A 3CYFA 2WFAA 3DLCA 1UC9A 2P91A 3SEZA 4I4LA 1LY1A 1UWCA 2CF6A 5JAUA 1KJYA 1LI4A 2GEVA 2OP1A 1HQDA 3NP9A 3VVBA 1CB7A 1UP4A 1FDWA 1EZ1A 5KDLA 3WMFA 5AW9A 1BTOA 3QLTA 4FTWA 4XW2A 3DHNA 1ZL2A 1BGXT 2O05A 3E3OA 1GPNA 2PL5A 4KRXA 2A7QA 4OU5A 1NXQA 5C8YA 4B6SA 5EUBA 4YPVA 1X0XA 4NCXA 5BWNA 4MR8B 4BECA 4YTEA 1NRIA 2ZJ8A 3AERA 1V2GA 3KHSA 3FOEC 1GSHA 3KWLA 1F14A 3LX8A 2JLAA 4NPHA 3HYTA 2RAUA 1YJ5A 2H1VA 1CUWA 1E98A 3OX1A 4FCTA 3GDGA 3ND6A 5DXJA 1R18A 2V03A 3S2FA 3DLHA 4C29A 1MO2A 3KWJA 4KDRA 2PJRA 4MUEA 3ORFA 4WDRA 1AKWA 1J8DA 3H5AA 1UT8A 3KLBA 2XNHA 3ZY5A 4RFLA 5ANRB 4YYEA 4EW1A 4KWEA 1WUIS 3U4HA 3WGZA 3KJQA 2J5QA 3TB6A 2VAVA 1ECCA 3B5JA 1D2HA 1IBRA 4FR2A 4OJTA 1QFSA 3EPKA 4F9FA 2XDQB 5A3SA 2EKLA 1RZRA 3KKPA 1YJBA 4PYLA 3O26A 1SQGA 4RH3A 2WKWA 2LCQA 3QE0A 5FNZA 3K0FB 3WOHA 1T5DX 3RS4A 3N07A 3U4MA 1DC8A 3G8CA 3ZV6A 1ECFA 3A1WA 2UU9B 2GEJA 2VP4A 4RKEA 5LXTF 3EVGA 2J08A 2YZ7A 3WAGA 4LDZA 1QVRA 4Y2VA 1G8SA 2C96A 2C7PA 2FWPA 1G2PA 2KLBA 3C7CB 3LUPA 1TLLA 4GXTA 4CIYA 4CG1A 3R0QA 2QP4A 1SA0A 4JLWA 3GC6A 1IU9A 3UGJA 3CKMA 3N86A 3KEGA 2JCVA 2DOKA 1RZ3A 1TEVA 2P3SA 1E7MA 2FSUA 2Q3FA 4PAMA 5EIFA 1PQUA 1XMJA 4GOMD 4L74A 1ETHA 1IAQA 5DM4A 2WDPA 4HAYA 5JMPA 2JJYA 3D2LA 4GI2A 4ZMBA 3NFRA 4XOIA 4MP6A 1O58A 2VJLA 4KXFB 3UF0A 2CLFB 3PJRA 3P9NA 4WE3A 3EIUA 5KJ6A 2C20A 1IL0A 5E3IA 3L01A 2XI4A 5LWHA 3WV5A 1ZL0A 4G1UC 4I1YA 4G1EB 4G23A 4HSGA 3TQTA 4DR4B 1NBHA 2FPPA 4GG1A 4IDQA 2FR8A 1OSNA 1T2CA 3I3SR 4PCVA 3TNDA 2JFVA 1T8RA 3HB1A 2F6RA 4GAEA 4FDLA 3RVDA 1JEYA 1ODCA 2G88A 4JJIA 2C58A 4RCVA 1JJAA 3L7JA 4ISBA 2X3FA 5KQRA 1RWBA 3BA1A 1P60A 3OLZA 4HTFA 2FZWA 2QN1A 3EIXA 4ZVTA 4DSUA 5JRDS 4INZA 5IAKA 4HNSA 3EEOA 4FNOA 2GB4A 3MGAA 4HNRA 1QXSA 1O54A 5L3VA 1L5WA 2B69A 2DETA 3F9IA 2V74B 1V95A 2HF7A 1ZISA 3IELA 4H4DA 5A5EA 1G7RA 1E61A 2CHUA 1ZKDA 3MJVA 1XRLA 3K09A 5PNTA 3SX4A 4UBLA 2N46A 2IA5A 2NO4A 3AB3A 3QTLA 1HEUA 4L15A 4QUIA 2K4MA 2CKDA 3N6XA 4Y9UA 2WYHA 1R50A 2JAQA 3FJYA 1KI9A 5IC5A 3HJFA 1WPRA 1DC4A 2CUKA 3BMNB 3EAFA 3PWTA 4NU0A 3IL2A 2PUJA 4UNQA 5A71A 3B82A 3W6PA 1X7HA 5HOQA 1C8KA 5LJLA 2EJVA 4PHTA 4YHHB 1M75A 5LLTA 1E0SA 2GO1A 1VG8A 4L8YA 2Z95A 3PRYA 1Y9ZA 3JQGA 4K5QA 5DH9A 5HM8A 4ZDJA 5CVTA 2GK7A 4G5HA 2IPAB 5HZGA 3K0BA 4QGHA 1F0NA 1FNNA 1GARA 3WLLA 4ASUD 4OJKA 1TLTA 6CHYA 4EY4A 1AM4D 1ZNWA 2JGLA 2V0NA 2XMPA 4URUR 1ZX1A 5GIPE 2GCOA 3IAEA 4QHSA 3EZLA 1WSBA 1ZM3A 4JJAA 3P2JA 3TIFA 1BFKA 3GZTB 4DMMA 1G3QA 2YQ5A 1ZXBA 2BP7A 3EULA 2GILA 4JMPA 4L16A 3TOCA 5BN5B 2H2GA 3ZHQA 4L5JA 2EKPA 4MWSA 3STXA 1P0FA 4ZI3A 3DGEC 2CJYA 1T1RA 4NAHA 2PUDA 3RS3A 1L7VC 4RVFA 1YAHA 1DAFA 2IJGX 2SCUB 5HBRA 1RPJA 2GD6A 2ZJ4A 4CF3A 4MA0A 1L5NA 4K3UA 4TS3A 1D6NA 4DSNA 1CU1A 1SUIA 2GZDA 3QSGA 4U9HS 5FOSA 1XR3A 1VRWA 2DERA 2WE8A 5F3RA 3GJRA 1K9SA 4M7PA 4AO7A 3INNA 2X5XA 2XGMA 2J48A 4IPTA 4AWBA 4J2HA 1L4LA 2ACEA 2BF7A 3SM9A 4D26A 3LY5A 4X6UA 3TJMA 3C6YA 5F5NA 3L1IA 1OXSC 3IUQA 3ABZA 3J81A 1OF1A 1TT7A 1J7KA 1KI7A 2R97A 5EQFA 1Z5GA 3A31A 1MJFA 3PHCA 3L1VA 4KRGA 4YPOA 4FGUA 1TM5E 1RYHA 3KL4A 4P8RA 3VU1A 5K3EA 3TQFA 3T9CA 1M1YA 3D6JA 5EUQB 2QAJA 3G0DA 3WB9A 1PJRA 2DWOA 4URYR 3ZQJA 1YQUA 4L27A 4BMDA 4QA9A 4TL9A 2FDXA 1M6EX 3A0RB 4L75A 5DHAA 4IUYA 3SDZA 3VHLB 3WGTA 4Z4EA 1JL3A 2ZUBA 5D87A 3TE6A 3DE6X 3SSNA 1QBKC 4MP8A 3WRWA 1KEWA 2NNWB 3D7RA 4QFMA 2O3JA 1XCGB 3HS3A 3H11B 5AOAA 2FUNB 2OEPA 4I50F 4YMIA 1IWOA 5DM1A 4S1WA 2B98A 3DV0B 4KG7A 3CCFA 3BBPA 4BLSA 1HO3A 3PPVA 4Y98A 4EHFA 1K27A 1TQ4A 1U98A 4MQEA 3ZD6A 5EHXA 1XDWA 1AZTA 3FUWA 3IV6A 3SHFA 5BVHB 3EQ6A 4R9RA 3WRYC 2OFXA 3WMGA 4XGNA 1TEHA 3FDJA 2B3TA 4DCOA 4I6GA 4N65A 3NHKA 3JD0A 3U4AA 5KJ1A 3DZBA 5HHTA 1IHDA 2RSLA 3H6KA 5HZHA 4X3OA 3QVMA 2FKAA 1EXDA 5FUWA 4WFJA 2BBWA 1XCJA 4B44A 4C06A 3LKDA 5A4AA 4R2JA 5EXEA 1OJLA 3BJIC 3D6UA 3KKKA 5TQ2A 1V25A 5CJ2A 3BREA 4Z9YA 4JSYA 2ZDHA 3KQVA 2P6PA 1SB9A 2JDIA 1N2OA 3IT1A 3BFJA 4LE0A 2D1TA 3WMXA 1GOTA 1J5XA 2JHPA 3E6AA 821PA 1JLKA 5FLKA 2O0LA 4E94A 4OGWA 3GLVA 2ZRKA 3DMHA 3SHVA 1JLSA 1Z12A 2C54A 2WVAA 2H7CA 3RVJA 2MSWA 2WIJA 4JGBA 3RVOA 1Q0TA 1NU8A 2ST1A 4BBZA 4RPCA 4NZOA 2CLIB 2PMEA 3NWOA 2WT8A 3QVGB 4MB6A 5D51S 1P7YA 3AY7A 3DKKA 1EGMB 3HU5A 3FMVA 3IVGA 4Q47A 5HVNA 1B6SA 1DFGA 4WKGA 3PX2A 4HNTA 2DZDA 5HNKA 2W4MA 3FTFA 2IS2A 3AF2A 4O4LA 1MF7A 2FTKE 1A72A 1Z8NA 3PXCX 4FCCA 4MICA 4Y1FA 5EZ5A 4KOEC 1U7ZA 2EL9A 3CSSA 4IZ6A 2CNNA 3Q9LA 4N5DA 4ZT7A 2MYNA 3QLVA 3H5VA 3CRZA 2AG5A 3CX7A 3A05A 3BQ9A 1NY5A 3MOGA 1PR6A 3E2PA 5F1OA 3DBIA 5A4IS 1NMZA 1ISSA 1NDQA 7MHTA 2IDKA 3CRRA 1U7WA 4TLBA 2PLNA 1DRKA 3JYPA 1KYZA 3VR5A 1DJLA 3DL0A 2QR3A 2O2ZA 3DWGA 2JCYA 3Q9NA 3QI7A 2RD2A 4DV7B 2II6A 4L8GA 3H4VA 4WRRA 2AJ8A 3PDIA 3H5NA 4DCUA 4EABA 5LZ5A 2ZVPX 2WK1A 3BS4A 4F1WA 4Q4CA 1IBCA 2I1VB 1SULA 4P0PB 4C1NA 3R9XA 1TTPB 3BD8A 5JDIC 2ZCJA 1TMGE 4MCJA 2FWIA 2OBLA 4QNNA 4D8WA 1MUUA 4OU4A 1XUOA 1T2DA 4Z99A 1PQPA 2ZUCA 3HGTA 2FG6C 3JWGA 3LRTA 3CF2A 5DLPA 4ZHQF 4O4HB 4PNPA 3PTZA 5FO0A 1AK2A 1ZMBA 1N78A 4PZUA 4Z0HO 4BIIA 3OJWA 2VJMA 3W04A 3VPSA 1MAVA 3HCDA 1VPVA 4IIJB 1RTTA 5CXQA 4RA9B 4DC1A 4GX5A 3QPDA 1P72A 2N75A 4BV9A 4F85A 1ZA1A 4IEFB 4JASB 2Y92A 5AI0A 3ORHA 1UK6A 4LJRA 4HWOA 4X60A 1Y42X 2INGX 3BGIA 1J1ZA 4UXIA 3QVKA 3RVBA 4MR9A 4DA9A 5I7OA 1RQ2A 5CA0F 1LB1B 4UUQA 3IPCA 2YN2A 4AQDA 2ZJOA 1P17A 1LTKA 4AM8A 1LPPA 1BU8A 4YUXA 3S2ZA 3UK6A 2KMLA 3AJ8A 3ASUA 3RBXA 3WKCA 1GITA 4CM1A 4ECAA 3IS3A 1M6VB 1C9NA 4FCWA 1XP5A 2E89A 3E5RA 1M6NA 1CLEA 3LC7O 3P45A 3CRVA 1ZJ5A 2AB0A 2IL1A 5KTOA 1G7CA 1L9KA 1U02A 4TMKA 1S9DA 4TKMA 2GK6A 4X63A 2I1WA 1E3QA 5IAEA 1ECPA 5K0EA 3FPLA 1WZ2A 1Q44A 1SUCA 3QNWA 2OPHA 1AK9A 5B3KA 4IRXA 3VH4A 4EYEA 1OTHA 4XQ0A 4YV7A 1YULA 3ZDCA 3Q0TA 1WV1A 5IPFA 2I6UA 4V03A 1RYEA 3QVXA 1VE5A 2VP5A 1R5JA 4QFDA 2Z9BA 4NCNA 5J2TB 3QELB 4A8JA 3ONWA 2HDOA 1A50B 1JVBA 3CE9A 2XOEA 4RF3A 1J8YF 4S1OA 3UJHA 2JLQA 3SP1A 2V4ZA 2J3MA 4BKUA 1FDIA 4IDDA 1F12A 1M73E 2R9VA 1DXYA 1Q0UA 3BE8A 5HKLA 3VPAA 2GCPA 3OTQA 2QBYB 3CJQA 5CR9A 1D2AA 1XAJA 3ZGYA 3G2MA 1P1BA 3SDBA 5JZMA 1TYAE 1V3VA 1TUGA 5J1TB 1EB8A 2X3YA 2OOSA 1TYDE 3EXFB 3N8NA 4Z51A 2VBCA 4Q0MA 2WY2D 2VCYA 2WHPB 4UMDA 3JQ6A 4PM4A 2P3OA 2TMGA 2FPRA 4XAQA 1IHOA 2FP4B 3DKPA 1R6AA 5KYKA 3Q1KA 4J16A 5CP8A 2G63A 4DS3A 2F1HA 1EVKA 4N18A 4D4MA 1NJGA 2IE0A 2D1FA 3D31A 2QXYA 2X22A 3G1WA 5EXTA 1KFEB 2VPIA 5EGSA 2O1EA 4EF4A 5I01A 4YJKA 4CKYA 3H2JA 1YZFA 2DT5A 4B7UA 1RPNA 2QM0A 3MCZA 3R41A 4KW7A 4IILA 2JH3A 3E7XA 3DXYA 3EXIB 5DIFA 2AN3A 1NC3A 3P9PA 5FUVA 2FR1A 4AS2A 2ZIAA 4OKNA 1M54A 1DQZA 2OV1A 3B7WA 3NNNA 4PV7A 4UU7A 5EXSA 4CM9D 1ANKA 1OMOA 4XPIA 1CJTC 1G1AA 1Y8QA 3PNBA 4XVCA 3GFSA 3X3HA 1SVUA 1SRQA 2ZUVA 3TTSA 1QQBA 4RJJA 1SZCA 1U0EA 4M0LA 1JMYA 4NU8X 1IIRA 3LDGA 4JKOA 4B9AA 3GA5A 4DXHA 4D9KA 3U4IA 4F6RB 1UPBA 4G81A 2ADFA 4RDCA 2OHIA 3AR4A 4EARA 4DL9A 4EHLA 3N75A 1UMDB 1QRUA 1PVVA 2FPWA 4TT8A 3LPMA 2YBEA 2XCLA 1ISMA 4UXJA 3K2IA 2AQKA 2OD7A 3I12A 4U63A 5HIIA 1ORWA 5H3HA 2A86A 2BFBB 3C0KA 3H6GA 1G55A 4HDSB 3OD1A 4HZIA 1V11B 5C7IO 3KTFA 2EKQA 5HF8A 1XRPA 3ESXA 4MKGA 5EJ2A 5AJYA 3FCXA 2LDXA 2FZVA 1PT6A 2XSZD 4N76A 2I3BA 3S5UA 4C20A 4PCUA 1BFUA 1Y1PA 1M7GA 1M1NB 3MUFA 2QPOA 3W2EA 3SBEA 2BEKA 3N2KB 1JLHA 1BN6A 2C8KA 2MR5A 2VSXA 4LDAA 5EFZA 3YASA 1EH5A 3FNGA 4CEJA 4H7EA 2ODTX 1RCUA 1E8MA 3VPDA 1KKLA 1Z6YA 4BS9A 2QF7A 2X13A 3QVTA 1HE4A 3X1KA 2VZ8A 2WR8A 4HRYA 3M82A 1E0JA 3HKEB 1EDDA 4NBRA 2HB6A 1OI4A 3I8SA 3JATB 5IHPA 3UFXB 1AKTA 4KSBA 2ZTLA 3WB1A 5DYIA 3WK6A 1RKVA 1QUEA 4YREA 4TKUB 5BQXA 3GZ4A 1E3WA 4W7SA 2AMJA 3VVMA 1FMFA 4MJ7A 2VDRB 1DKNA 1W46A 2AOXA 3FB1A 2EV9A 2IHTA 1DT5A 1EFHA 2YMMA 2XKJE 4ZIRA 1VA5A 4ENUA 3W06A 4UQLA 1N8SA 2BRUC 2FEMA 4ZQHA 2P8JA 3AH8A 1BCSB 4LY0A 1BN7A 2DB3A 1RLUA 2NUPB 1Y5LA 4HDKA 3FLBA 1BA2A 3OZWA 1Y7LA 4CT5A 4HT3B 3PNLA 1OC4A 4LHSA 5KTYA 4QUJA 5KTSA 1T35A 5DLQC 2A0WA 4RTOA 2AHOA 3DHVA 3D8NA 3QXXA 2UUCB 4BGDA 3FIUA 4Z3KA 3F2VA 3H86A 3HY4A 4HN4B 4ZKEA 2RG7A 2ZK7A 2Y4NA 3D2BA 4FX2A 1Z0ZA 4R0VA 3VO8A 4WBNA 4YIHA 1GPDG 2XLBA 2Q0QA 3KYJB 3VUFA 5AVSA 1L9XA 5ES4B 2KI5A 1UT5A 2YV2A 4BMOB 4MV4A 5DCUA 4MYDA 4MWCA 5EUCA 3MWDB 2V7PA 1FDOA 1LW6E 1PGPA 4IDAA 4JA2A 3J80A 3VKFA 1O6FA 4JJEA 4OUDA 4U2GA 1B8VA 1T9AA 1BDJA 1SU6A 5GZ6A 2EVWX 4HBGA 2BI7A 2MJLA 3WB0A 3I6YA 6LDHA 2HDHA 4CMIB 4BGVA 2IBSA 1ZS9A 3FYUC 2I2DA 2P11A 5IH7A 1HDIA 1V5EA 2XKKA 3DJYA 1GQYA 1I3MA 1ZONA 2G7ZA 1CR4A 2ZKIA 3DOFA 3FUUA 3N2NA 3TCKA 5HRCA 3H97A 3H5WA 3RSSA 3BMCA 3EXG2 1QHXA 1GZ7A 2PXAA 5I4IA 2HEIA 4JIGA 3VR3D 4HQNA 4ENQA 3JYQA 4WNAB 1RC8A 2QTVA 4IMRA 5JSZB 2PSHA 3L7AA 2X0IA 1NURA 1Q84A 4GC5A 5AW1A 4AY3A 2IODA 1V0JA 4EPRA 1YHYA 1PJQA 3QLJA 4ZQIA 1Q6YA 5L3QA 2PAAA 5IVIA 2ZIEA 4IDBA 1K63A 4M98A 4MRMA 4NL4H 4BWVA 2ODBA 4EB6B 2QP9X 2RBEA 4BMSA 3OCXA 4YCSA 3NM6B 1H69A 3KB2A 5IDYA 1QZZA 3T9FA 3TQHA 2WJJA 3UO8B 4O8ZA 3UV6A 5IJ9B 1K8ZB 3DMTC 4GXRA 1T3LA 2BM1A 1I10A 4UM5A 4RKWA 3ESQA 4KN5A 4U7DA 4M0FA 1B6RA 3FFBA 1FA9A 1QP8A 3K4QA 5G3YA 3U7RA 5HFAA