2Q8PA

Crystal structure of selenomethionine labelled s. aureus isde complexed with heme
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
258
Chain Sequence
GEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heme Coordination by Staphylococcus aureus IsdE.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
molecule keywords Iron-regulated surface determinant E
total genus 71
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8pA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2q8pA01
2RG7A 2YNMC 3BE5A 3MWFA 4WZBA 2WI8A 3HJTA 3GI1A 5CR9A 3TLKA 1N2ZA 4HMOA 4FILA 3K1AA 5CX1A 4NNPA 5KOHB 4WN9B 2OV1A 1KARA 4TKVB 3UJPA 1G21A 1K0FA 2AFHA 2XDQB 3PSAA 1TOAA 3LI2A 5KOHA 2MINB 2PHZA 3AERA 3TNYA 2PRSA 1H1LA 4UTOA 3U7QA 3AETA 5GGYA 2YNMD 5JOQA 4IRMA 4N01A 3HXPA 1XVLA 3ZK8A 2OGWA 3U7QB 5BVHB 1K7SN 4OXRA 3R5SA 1MIOA 4INPA 4B8YA 4PM4A 1QGUA 3PDIB 4UDOA 4PAGA 4K3VA 3AEUB 4OXQA 1M1YB 4WNAB 4BBPA 5GGXA 2R79A 5B58T 1KAEA 3EIWA 3AEQB 2M6LA 5M2QA 2XV1A 1QH1B 3NU1A 3ZK9A 2QI9F 1M1YA 3MFQA 4MX8A 4MLZA 4WESB 4GICA 5BVGA 1EFDN 2AFIA 4OVKA 1M1NB 4CL2A 5FLYA 2PS0A 3AERB 1QGUB 3PDIA 2Q8QA 4MO9A 2MINA 5AFSA 1G20A 1N2CB 1QH8B 1N4AA 1G21B 3R5TA 5HX7A 1M1NA 3PSHA 5BVHA 2AFIB 3AESB 4HMPA 4WZAA 1N4DA 3CX3A 2OV3A 3MINA 4FI3F 5M3BA 3HH8A 2PS3A 1M34B 1QH1A 5M29A 4INOA 4WZBB 2ETVA 2X4LA 5M34A 1M34A 4WNAA 1K2VN 5HDQA 2AFHB 2XDQA 4DBLE 1L5HA 1PQ4A 4TKVA 2WHYA 5KOJA 2PS9A 4ND8B 4HMQA 4XPIA 4G09A 4ND8A 1MIOB 2XH8A 4HN9A 5BVGB 3G9QA 1L5HB 3BE6A 3EIXA 5KHLB 5JG7A 4G07A 3AETB 3MWGA 4H59A 5I4KA 1ESZA 4LJSA 1FP4B 1KAHA 3AEKA 4M7OA 3LHSA 3ZK7A 4TKUA 3AEQA 5JJ5A 2XUZA 2OSVA 4FNAA 3TEFA 1PSZA 1FP4A 4MDYA 4UDNA 4UTPA 1K75A 3MINB 2XY4A 2Q8PA 4WZAB 3AEUA 3AESA 3K1AB 4H0FA 4WN9A 1QH8A 5CX1B 4FKMA 1G20B 1N2CA 4XPIB 2R7AA 2M6KA 2XQVA 5JPDA 3MD9A 4NNOA 5KOJB 4LS3A 4TKUB 4WESA 3AEKB 3ZTTA 2O1EA 1H1LB 3ZKAA
chains in the Genus database with same CATH superfamily
1P9OA 4OB7A 4AS1A 3BE5A 3CT6A 3P2JA 3VSAA 3E3OA 3WGZA 3ELYA 1RWXA 5GY7A 4WE3A 1QFMA 1WZ2A 2WWWA 5DN6D 2Q6LA 2P75A 4LJLA 4RKRA 4HEQA 5EXDA 2HQOA 2CLCX 4XWYA 2NUPA 4E32A 1C3LA 4E5VA 1IQUA 4M38A 4R40A 2Q99A 4MI9A 4XKJA 1Y9AA 3FCEA 3CB2A 3HYCA 3QFTA 4L57A 4XVHA 4IINA 5JNWA 2C7OA 3NV7A 3AWDA 4UHDA 3PEYA 4L28A 1SXPA 2YZGA 5ERXA 1D2NA 4UM9B 4XCQA 2RCNA 3R5SA 4W5QA 4R1SA 2PVSA 3ZKWA 4ESOA 4Z7OB 1U3VA 5F35A 3JAWA 4CKXA 2IH2A 4J4BA 1GPKA 4I7EA 2H85A 4I1UA 1QOZA 4XTCS 4W5TA 2JA1A 4B31A 2ZYRA 4O08A 3WZLA 1G3MA 1I4LD 1KI2A 2GPWA 4W5JA 2IXDA 2F9FA 1TFRA 3D0KA 4G0XA 1ZU5A 1ZC4A 4WNAB 4Y9RA 3VZDA 1J0CA 5HZMA 5JNLA 3VDQA 1F9AA 1RM0A 2Y6UA 4NZ9A 1WBDA 2BR4A 5ES3A 4XB6B 1PYGA 2B25A 4IOMA 2Z98A 5TE9A 5MN4A 1RPTA 1TCCA 4YUXA 1JQJC 3RODA 1F5SA 1TF2A 1RI2A 3BL6A 3MWJA 2C07A 4IBOA 4MWDA 1O96B 3U4CA 3HN7A 3DXYA 1NZJA 3JVUA 1WM1A 3N2GB 3R5JA 4I8IA 3SSAA 3WV5A 3QBDA 3JZDA 3R0QA 2P3OA 4H7KA 4DSNA 4UUNA 1UQRA 3HB4X 3QKSA 3HJHA 4CF6A 3NDIA 4BU0A 2WBLC 3AJAA 2ZZMA 3O1LA 2YJ6A 3Q11A 5KAPA 3CCCA 5FA8A 1JLRA 2ISQA 1SRRA 4KLAA 1PBNA 3TRHA 4EF4A 1SKUA 3QXHA 1G18A 1PJSA 3V46A 5KKNB 2G1UA 4I1YA 4MB0A 4QPPA 4W8HA 3AGQA 3HY6A 2J9FA 5J47A 1OY1A 2C9CA 2DTEA 2GNPA 2NZXA 4QYWA 3CPHA 4P4NA 2Q2VA 3LPDA 2BKEA 3HRIA 3DWIA 1JT2A 4BNNA 1GZSA 3AHEA 1ORDA 3UAYA 1PDOA 3H2KA 1A5SB 1GL7A 4DA4A 1T0HB 2P11A 4F9GA 1D2GA 2PKQO 2A1TR 2X2FA 1HQKA 2D62A 3R3HA 3G17A 4I9GA 3LZDA 4K2AA 3I34X 3LKDA 4AJ4A 4Y6SA 1GDDA 3VYSB 1GU7A 2JLCA 2YYZA 4C03A 3FXAA 4C6SA 3RSCA 3CKLA 2Z2KA 4FMDF 4BKPA 4UAJA 3DSRA 4ZDJA 3LIPA 4MYUA 3DMHA 3JATB 1T26A 1NWHA 2RGYA 2F43B 3PL5A 4ZVUA 1J9EA 1O87A 2NT4A 5HK8A 4D9GA 2JGFA 3KQHA 221PA 3WYFA 3OSUA 4PHGA 3W2IA 4CEHA 5KYVA 4FS8A 2GHIA 2GZAA 1HE5A 3BK1A 4DBZA 4D57A 1KOFA 2OD7A 4RD3A 4BIMA 4LNUB 5CAEA 1QQBA 1DTWB 2EKPA 3A2NA 4YALA 1TAQA 2M6SA 1NY6A 4GT1A 4H7EA 4OXKA 2PNJA 4BLOA 1YASA 5G1OA 3G9TA 4NYJQ 1AA9A 1X14A 2C3UA 2QLMA 4MQ5A 3A1TA 3WG9A 4DWJA 3EX7C 3SR0A 1J20A 2B78A 2VHWA 4G1CA 4KQMA 3RVMA 3SQNA 1M3SA 1VI5A 2PX6A 2W2OA 5JANA 3IKTA 4GOMD 4H6XA 4IV5A 5KZMB 1L5FA 4YAEA 1SCAA 3ZU5A 1DIBA 4OI1A 3EDYA 5JJBA 2BHRA 1L4MA 4H0NA 2A4MA 2P9TA 4H35A 3GLVA 3B3AA 1T5LA 2OB1A 2P6UA 4MPPA 1XMSA 5D7BA 2CFRA 5HG0A 4CDMA 3GJ0A 5DIZA 1CIPA 2ATIA 1USKA 3HS3A 3MPUA 2H0AA 5KTKA 3CIOA 4II3A 5G41A 2XW6A 4WOJA 3DLIA 2QT0A 1IN5A 1WS6A 2I6SA 4FYJA 5HF6A 3IPRA 2EGHA 3NDPA 4C7VA 5DCYA 3PFIA 4NCIA 3P0FA 4MZXA 3USZA 4DNPA 4YRTA 4I19A 1YNOA 1B8PA 1JE1A 1EWRA 2ZVDA 1R7RA 3LHKA 1E7QA 4M22A 4Q02A 2PUWA 1WX1A 4GOND 3ZXYA 5CFZA 1Z4JA 5FNZA 1XEXB 4MUAA 4K03A 4UZEA 4X54A 2IXFA 4EL5A 1NUAA 2XUHA 2XV1A 2OAQ1 5JFOA 5IM4F 4AY3A 2CHFA 4EA7A 2G63A 3BWMA 4JROA 2IW3A 5B57C 2Z30A 4ZK2A 1CHNA 5HJ5A 3KEMA 3RTBA 4ZALA 2AQKA 2EOAA 5TARA 3VPSA 4FT4A 3I92A 4WIAA 2VHZA 3CLHA 4V0LA 5ALUA 5SY6A 3N2KA 2HSDA 1E6WA 1WXIA 1WMEA 3F9RA 1RYHA 3HA5A 4P2BA 4ZJYA 4FOTA 5JRZA 4ZO7A 3GT3A 1KEWA 2FSVC 4G01B 1ZXBA 1XPOA 4HUQA 4ZOLA 4MQ6A 1P4HA 3J7TA 5DN6A 4EYEA 3DE0X 3CRMA 3FVRA 4G1MB 5A1TA 4NBUA 4WLFA 1PS8A 3T7EA 4YEDA 2F1JA 3UK1A 1W36B 5JMPA 3VZBA 4IH9A 1WP9A 2FZ4A 1XEAA 2JCYA 3KKQA 3NAZA 4LHWA 4PTZA 4XJXA 5DXJA 5EJ4A 2NVUA 4WMLA 5DWVA 4JJZA 4XVRA 3IELA 4IIBA 2P6RA 2I8CA 4GX1A 1SKBA 4HLCA 2H2HA 4F4IA 2HL6A 4LZOA 4KAFA 4FDAA 2IKSA 1OYYA 2MSDB 1GTZA 4OHVA 4OYHA 1IZ8A 2C20A 4R2LA 4RZSA 4DQVA 1GTJ1 1IJEA 1T3GA 5DEOA 3HDVA 5B55A 4ISCA 4KTVE 3C8MA 5PNTA 3GHHA 2IZ0A 2M98A 3G1WA 4NV3A 2X4DA 3GOHA 1XCBA 3RF6A 1XRQA 3DC2A 5HZHA 4ES6A 3E61A 4D7AA 3UFBA 3CRZA 4YRFA 1W4BA 2Z56A 5I4BA 5F21A 5LUBA 2W0MA 2GS9A 4GLBA 4HB4A 3S99A 5FH9A 2XRZA 3WFZA 4JJKA 3PQ5A 4KG7A 5EE3A 1K6EA 1BO6A 2XITA 4TYMA 4FX5A 2J5BA 3I01A 5CPFA 3T61A 2ZXFA 4UQPA 4JN6B 3ZI7A 1WVIA 3DPIA 3ZD6A 4ZOEA 1I5OA 4B73A 2EL9A 4Q4DA 1V48A 1VPVA 1SC9A 4JQSA 5AJWA 3X1KA 1HO3A 2PUAA 1HDZA 3IR7A 3V55A 5T4HA 1NI4B 1G3QA 4ERNA 3HC7A 4TWAA 5I5GA 5K8UA 1RC1A 2O1EA 3V9PA 1H1LB 1UM8A 3G8DA 5E7QA 3DJYA 3TLGB 3OMWA 1TKBA 4G8BA 2D1FA 5CK5A 3FUXA 2JJQA 3OE5A 4H15A 5HKOA 1UT5A 5FWXB 2Q46A 3OIWA 2TSYB 1BKYA 2B8NA 1W5EA 4H7IA 2AFHA 3A36A 3JZFA 1RWMA 4MSUA 4Z8XA 4X41A 1TYZA 2IYSA 3WLIA 2KMLA 1FFEA 1KKLA 4WK0B 5ILGA 2POQX 3NHYA 3ZNOA 4F3KA 5HIJA 1DQZA 1NONA 1PNRA 4TL6A 2OCGA 1A77A 1SXJE 1X6VA 2VSXA 2O2DA 3NVAA 3LCRA 3OHMA 4JLSA 3TDNA 1HNZB 4V2UA 1M1UA 1GCAA 1MAUA 3BBLA 3LQRA 1K63A 3OD5A 1P9NA 1C30A 1TYEB 2BEVB 1U3TA 2PIDA 3PFWO 5C46F 1WZIA 5BSKA 4TTPA 5F5LA 2QNBA 5AVRA 5F7XA 3P9SA 4JI7B 3FRJA 1NJ6A 3WMXA 2EIXA 4EBBA 4V2IA 3T4UA 1GLNA 3ICPA 3KR1A 4D9BA 3DZBA 1ESEA 2H8GA 2Q0HA 3K35A 3OM9A 1TGYA 1UDRA 2P9HA 3AM1A 4RNCA 4X3CA 2G9UA 3LF2A 1FJGB 1B41A 2DULA 3VTZA 1YT5A 2CE2X 2C9YA 4EUSA 4W6QA 1D1SA 3IJ5A 2YRFA 1UR5A 2VAPA 4JLWA 3CR8A 4NQRA 1N2BA 2YJTD 1S2DA 1XCJA 2PN1A 3K7EA 4MW6A 4ZC8A 2NU7B 4PC7A 3WDKA 1IJBA 4QARA 1EB8A 1NURA 1WMBA 1MRNA 1UZNA 2VSNA 4A6PA 1GU1A 3WAGA 3D02A 1UOQA 2FQYA 5CW2A 5AT1A 4WECA 4FBGA 1BTOA 4HQLA 4B45A 3VNSA 4B79A 4AF8A 1X8LA 4FTWA 5EY5B 4LZZA 4PYJA 4BV3A 5JJCA 2FPMA 3LUKA 4FDMA 1YR7A 1ZR4A 1HZZC 4EJ2A 3GWGA 4ZK6A 4BPRA 1WSWA 1E32A 3M49A 4JR0A 3W8NA 2G1KA 4RKWA 3T7TA 4Q21A 1U6JA 4FJ0A 5K0CA 4H31A 1HT0A 3KL2A 3SEZA 1OLXA 3FPSA 4DV6B 3CB4A 1QTQA 5CM2Z 3SLKA 4TVOA 1G2IA 2WVJA 4JC8A 4NG5A 2HUNA 5FWAA 2CNWD 3KB6A 2GCNA 1T1IA 4BWFB 5B2FA 5KNLA 1JB9A 4BO4A 5D1HA 3IIJA 1FFGA 3RIYA 3EXHC 4KX3A 4ZI3A 1WOMA 3HCEA 1YUNA 5CVDA 2WVHA 4H1UA 4KNWA 4PQYA 5CH3A 1G8FA 2B36A 3GEGA 5ILQA 2PSDA 5SYMA 2G3YA 3WXMA 5F1YA 3ZK7A 3HZZA 2Z9BA 1B00A 1SXJC 1H1DA 2VJAA 3RD5A 1BVYF 1JEJA 2BL4A 3ESCA 3IEKA 4INJA 4LWOA 3NFRA 1PE0A 1DFGA 2VJBA 5DM0A 1W85A 2ENWA 4EA8A 3U60B 1BQ3A 4QOEA 1QF7A 5EZ5A 2VUTA 5F98A 5DB4A 4PLZA 3VOTA 3ZX5A 1T8TA 3E48A 1DELA 4LY0A 3KQYA 3OLZA 2Q8PA 1X39A 4TWZA 3HDTA 3R3VA 3AR7A 3PC3A 1PHPA 4RD6A 1GGFA 5L6MB 2WUGA 3BKXA 3M3DA 5B5SA 2JD1A 4FR5A 3PT5A 2BJVA 3LX6A 4I8XA 1QP8A 5G2OA 5FF9A 4LCJA 2CHGA 1C0KA 4FGJA 1S4MA 4GXQA 4R4JA 2IXGA 2WIJA 3OJXA 3PTLA 2VP2A 3GFQA 3LCVB 1JS1X 2WR8A 3OPVA 3AVOA 3KFVA 1B26A 5EGNA 4ZA2A 3K1AA 3RFFA 1JIJA 1W36D 5EXPA 2OQ2A 2AG5A 2BW0A 3QMWA 4DIUA 5EFZA 2GBIA 4BNGA 4C9BA 3HBLA 4LDQA 4FDVA 2C2OA 5JCPA 1EX1A 1Z83A 2YHBA 3E9MA 2WUEA 3L7NA 4JL5A 1YR9A 3OSZA 2A5LA 3H9EO 3HRKA 3NFYA 3GJ6A 3A6ZA 3NWOA 1T5DX 2FN4A 4FZRA 5CTAA 5BYBA 2QB5A 5H0IA 4XLTA 1HH4A 3QYFA 1UBHS 1XD2B 1M1YE 2FPGA 2H7CA 2XNCA 2ZBDA 3GPDG 4GPZA 5DWDA 1MIHA 2M1XA 4KQ6A 4J0DA 4I1OA 3JQBC 4RZQA 3HDGA 4ZVQA 4D0GA 4YECA 2JZCA 4QOJA 5MGNA 4B7UA 5AK6A 4LOAA 4NI5A 3ZDRA 4H6PA 1GQOA 1Q7RA 2VNJA 1JU9A 4B34A 1G20E 1TNDA 1SR8A 1U2QA 1KMHA 2Y27A 1OXXK 1PTKA 2NXWA 2WTNA 3F0TA 4RHFA 2FSHA 2N9UA 1UAAA 3MWKA 2IS2A 4CCYA 1BC5A 4KFRA 4I3HA 5K0FA 3E82A 4HSGA 1AQIA 1NDQA 1HE8B 2DU8A 4GXRA 3CCBA 4TLDA 1J22A 3FHCB 1NI4A 1W5SA 2B5WA 5ALFA 1K68A 3PTAA 4NOLA 5F73A 4YAGA 3H5OA 2YIMA 1TD9A 2DKOA 1T36B 4A0FA 4LVNA 1OZFA 3L92A 4ROSA 4PAMA 5IJ9B 1XQWA 3BMOB 2EFYA 4DT1A 1UOOA 4DJFC 2NNLD 4WAUA 3IODA 4D96A 1U0OC 1GCUA 3HFJA 4URXR 2TMGA 1OWNA 1AOXA 2OBYA 1RYMA 4K0RA 1KOLA 2G7ZA 3T1HB 5K2OA 1K1EA 4TLEA 2O50A 4FSHA 4LC9A 3KZVA 3KTAB 5EUQB 4EUEA 2N3ZA 5ENVA 1N9GA 1LDYA 2AQHA 3C3DA 3ZHRA 4FB4A 1UPFA 4LV5B 5ECDA 2ACEA 5C4GB 3ROFA 1RAIA 1K7CA 5CDFE 3T12A 4QFDA 5EGSA 4DYDA 5FUQA 2OBXA 4GDMA 5GPBA 3FNRA 2PMWB 2IPNA 4JQOA 1Q74A 4LSWA 5EG5A 4BO0A 1SD5A 2GTHA 4NJEA 2Q5CA 4BV9A 2EKBA 3MAJA 5JO9A 5AQ1A 1NX6A 3QKRA 3EUWA 4G0QA 4J0JA 3SYMA 5G4KB 1DB3A 1B74A 1I0IA 2INGX 3DXXA 3I73A 4L6AA 2IHVA 1Z5OA 2C5LA 4M7OA 1U4OA 3HUUA 1FMCA 4YP7A 3T7IA 4D97A 3THYA 1EDDA 3HMKA 2QA5A 3DEFA 1DC3A 2E4ZA 2I4IA 1FNBA 3KDAA 2LE0A 3KQWA 3CX4A 3QVMA 3BJMA 4WCFC 3V8QA 5L3VA 3E9NA 1LPSA 2FEOA 3ZCVA 3ESAA 3PV0A 4E1AA 1ISGA 1YA4A 2YYSA 1N1GA 3BZBA 3K5HA 4N82A 4Y67A 1US8A 1W1UA 3VO9A 3G1UA 5BSVA 1OI3A 1SUIA 4CDGA 2V74B 3IJRA 4PQEA 5CLQA 1UQTA 2DG2A 3EQ9A 3UM9A 5I7UA 1M10A 2JLVA 2PWYA 1AK9A 1OJ7A 1A97A 4P4UA 1KFJB 4XEUA 1RXSA 4KPYA 1SCBA 3HCOA 5E1DA 4DLBA 1GZDA 1HDEA 2AH5A 5CDGA 1BDJA 2B4YA 4K0KB 3BIFA 1OXUA 3DMDA 2D0OB 2O05A 1FS6A 2IDJA 1KDPA 4JLDA 3ML1A 2W37A 3QTLA 2GNOA 5GM2A 1GOTA 1FQKA 3ISJA 3OE4A 3QIAA 1Z6QA 3R7BA 4EYKA 1HNXB 3D7KA 5JAOA 1HR0B 5AYVA 4MRSA 4KQWA 1UQUA 2FK7A 1O6BA 1TO1E 2VYQA 4OFWA 1Z6PA 3MJ4A 1NHGA 4OK3A 2YWJA 3FVVA 1ADJA 1AF4A 1C7EA 3B52X 1PL0A 4PO3X 3OQMA 3ANYB 2QJWA 2QKYA 4FNOA 2YDYA 2YV1A 3OFKA 4NEQA 1E1DA 1XQXA 4QBTA 2BF4A 2WOOA 4KQ9A 2YVUA 4NZMA 5K2MA 5GV8A 1YVRA 4EPYA 3N0WA 4QULA 5JZOA 4BB6A 1VLQA 1V7ZA 3HBAA 3LBYA 3TI7A 4GLJA 1Z8FA 1PUIA 1YNSA 2FW8A 3LC0A 3A05A 3OJWA 2XLBA 4PQFA 3OF2A 3NOOA 4U2GA 4BEWA 1YQDA 1SGWA 1SQFA 1EQAA 1LX7A 2FZEA 2HFJA 3JVEA 2YWCA 4RL4A 5C34B 4OHBA 3M9LA 5A5EA 4XQ0A 3F96A 1EGVB 3DE2X 1NBHA 4EB6A 2G82A 2AW5A 2WFAA 5JNRA 1P62B 2JH3A 2Y67A 3UT6A 1EDEA 4Q47A 1GNVA 2YICA 3VUEA 4MW2A 4ZJUA 1GGNA 2I1QA 1JLLB 2E87A 3CEAA 3FPAA 3LS2A 3V2GA 3TUZC 3VKHA 4GRIA 3NQ41 1THMA 1UODA 2BMFA 3R3ZA 5DGHA 3O8QB 1A2QA 2FSFA 1JAIA 3K32A 4PSCA 4ZXPA 3HHPA 4DLSA 1ZITA 3K0HA 4GEKA 3MINA 2ERYA 4N0EA 4CMIB 3IVXA 1I7LA 3H8SA 1N7HA 2ZVQX 5CXSA 4M1EA 1P18A 2GN2A 4KDRA 1I13A 1GAJA 4EL0A 2C5SA 3QJ5A 4J9UE 1PF7E 2GN8A 1VL1A 4RD4A 4UDYX 3TL3A 1YHYA 3GY0A 2ODAA 5T8KA 4AO7A 3H13A 1RQRA 1NNSA 1X42A 2J7PA 3N86A 1CSEE 2RKBA 4K9LA 3WVNA 4RTLA 4IL5A 5IXYA 2ILVA 5KTOA 3L79A 2Z83A 4AZVA 4N3NA 4ZQEA 1K6XA 4KYUA 1JLKA 4YDHB 2J6IA 4TT3D 1E2KA 1AZTA 1EP1B 5IANA 4PGFA 2Z95A 3NEAA 3NJ4A 2CVFA 2X8WA 4W7HA 4XIGS 1C7IA 1KAHA 1EINA 4E12A 2F2TA 1CXZA 1JHVA 1PVDA 2I0FA 4REQB 1G8AA 3MAAC 4JMLA 3U26A 2HRCA 1T2NA 3WV4A 2QRVA 1KAGA 4BB0A 3NM5A 4GEGA 1DBQA 1S8NA 4AO8A 1G2QA 1M2WA 2DPLA 3UQZA 1WR8A 2V8OA 2ZROA 3LQFA 4A6DA 1QQ7A 1WKCA 4PNEA 4OAQA 4BCCA 1WHSA 4P4SA 4BKUA 3TCKA 1BOFA 4LK3A 1YAHA 1QG6A 2LRHA 5JAZA 4OSPA 2WYUA 4QRDA 3JQPA 1XTVA 1SG6A 3ZTTA 4HAIA 5CD1A 5CVJA 1DIGA 2EFHB 1YS2X 2QRGA 5LYJB 1NXPA 2IEDA 5H81A 2Y1EA 3WAJA 3P4XA 3IOMA 1O97C 1JU4A 1BQEA 3ON5A 5F2EA 5FA5A 2PIAA 1PKEA 5KOHB 4AKIA 1GUDA 3AYXB 3WYDA 4AJNA 1DAMA 1DAFA 1VJDA 3U2QA 1F8YA 4N6NA 5HQ3B 4NZOA 3WLTA 1IHXA 4JB0A 3P8ZA 5F9MA 3FFAA 5HJEA 2PJUA 2P4UA 3CBQA 1NPTO 5ER9A 3K5PA 3I61A 3WSTA 3AETA 3ZLJA 2UUOA 4Z7NB 4QEDA 2AN5A 4BKRA 4GBGA 4FW9A 3QPWA 1T91A 2ZSFA 4PFQA 1FTWA 3A0UA 3NHFA 2ZWPA 1AB6A 4UHHA 3RDPA 2PX4A 2XB8A 2IOHA 1JI0A 2AB0A 1B6TA 6REQB 1FP1D 2J9FB 1L5MA 5JCJD 5DW0A 4OXQA 4FGWA 1N75A 4KXUA 1H4TA 2VA9A 2R6FA 2OV2A 3H11A 1TYCA 3DZHA 1HEYA 3M89A 3GVIA 1OWOA 3OZRA 3AXSA 4DDKA 2XCTB 2VH1A 4PO8A 8AT1A 2E1PA 2A5GA 4BKMA 3UB4A 3AHFA 3JWIA 3HFGA 1V39A 4JB8A 4MQMA 2GPAA 3KDSE 2C5BA 3L1IA 3O1JC 1JA1A 4NMMA 4OU5A 4RMJA 1JV2B 1LLFA 1U1EA 4DKXA 2DF8A 3ETEA 4RHEA 2FGJA 2GGSA 2W2VA 3C7KA 3DT6A 4HEHA 4IIFA 5I7EA 3Q1KA 3IVMA 3K0AB 5FL3A 2J3EA 3TDMA 2WAOA 1IY0A 3ETJA 3CX3A 3BBPA 2GN4A 2VA8A 3DEHA 5JVDA 1JEYB 2VPIA 1FNNA 2UYGA 3CWZA 3NVMB 1Z33A 3HVUA 3WL4A 1VJ0A 3ZE9A 4D3ZA 3T99A 5I8PA 4WNAA 2R25B 1K2VN 4L7VA 3ONDA 4OATA 1CT9A 3AUSA 4MIKA 3MJSA 4R2HA 3UHFA 5CT8A 1ULAA 1S9HA 1Y89A 3LLCA 4NDAA 4YJ2B 1SIWA 3SMVA 3LBIA 3EC1A 5JNTA 2RGRA 1CB0A 2NO1A 2ZWVA 4U6NA 3SYKA 2HA3A 1EFVA 3W06A 5E95A 4MWGA 2XB9A 3BAZA 5AO9A 3ZE7A 4BO1A 4AWBA 4C89A 3DQPA 3HJAA 1LRLA 3CF2A 4CF5A 3T1TA 3ZIAD 2VG8A 3KZXA 5BUCA 1MTOA 2PSHA 2YWGA 4I50F 3ZCTA 1RM3A 2YCLA 4WINA 1C7QA 1CZUA 1UBTS 1E4VA 3E2PA 4CU2A 2P4QA 2XLCA 2EX0A 4L8VA 1X86B 1NVDA 1CJUC 4L08A 1QLJA 1JFTA 4BGEA 3AR8A 1J8MF 2I7TA 4AMVA 1ZGBA 3O31A 2VDWB 4QAQA 5FI1B 1KJNA 3UBTA 1Y98A 3ZD7A 4FCTA 2V7UA 4L4ZA 1TEZA 2BMVA 2OE2A 3VHXB 3B13B 3MD9A 1NRJB 4RFSB 5FX2A 4PTLA 5AESA 1MG0A 1YC5A 1S8OA 2W2LA 2XCIA 2ZETA 3NC4A 4QICA 3FMOB 4UTZA 4Q9LA 1KZ6A 4R7GA 4YACA 2YY5A 3ZKAA 2DHEA 3X3HA 1KFEB 1ZA2A 3QUTA 3RWOA 3SR3A 5BSEA 5JZSA 5ALSA 1UBEA 3WLNA 3L07A 4NXMB 5ENDA 2G6BA 4AICA 1BDHA 1R9NA 4AMGA 3GZTB 4KDEA 4MI1A 1Z6AA 3RS5A 5C8VA 4HDNA 4N54A 2YMMA 3BWEA 4UC0A 3G2OA 2W2NA 4FFSA 3STHA 4D74A 5IH7A 1WO8A 1WUHS 4IOJA 2CE7A 4IEIA 3N8IA 3UG6A 5EINA 1Z0DA 1IULA 1ZPDA 5C4MA 1C9YA 2J7PD 1RPZA 1FJHA 1NQAO 1ACMA 5AOCA 1MENA 1SO8A 2OO5C 2RB5A 3KKOA 1MOZA 3UJDA 3ZEIA 4HT3B 2WD9A 3C5VA 4JX8A 4PY2A 3H86A 3NAQA 3BD7A 3LCMA 2R84A 4HC4A 1ZUD1 2XEXA 4K6MA 4NU5A 4IDOA 4NBLA 1JLHA 1F60A 2LXNA 3UUFA 3R8FA 3EH2A 1NULA 4FQ5A 3FG9A 3NBKA 3VYUB 5K5EA 3FPHA 1T5TA 16PKA 2FX2A 3CTPA 1E92A 3DF7A 4BNKA 1I01A 1Z62A 4PAGA 4DLXA 2PGIA 3T4XA 1O0CA 2DEUA 3PWTA 3KK0A 4HNGA 1Y9DA 1FRZA 2GXAA 1IM5A 1NI3A 1S8FA 3QVVA 4TMFA 3EZYA 5J9FA 3UN1A 2A0UA 3LKVA 4MV7A 4HDQB 1M2JA 2QLFA 2R3SA 4Q4JB 5BSUA 3X2EA 4BYMA 3N58A 4XJVA 3O1IC 1T3TA 2I33A 4YH1A 1RKVA 2IXBA 3NBXX 6Q21A 2M9MA 3W1VA 2FHSA 5FPYA 1E79A 2E82A 2VJLA 4ZVMA 3VOBA 5TSDA 3AY7A 1ORHA 1KP3A 3BH6A 1CETA 2H2AA 2OGZA 3GPIA 3LLSA 3T0IA 1JFSA 4P0QB 3C3BA 1C1YA 3CWCA 1M8KA 3FHOA 3HU3A 1A4UA 1FFSA 4YT4A 3GLFE 1WB4A 5HX7A 1WMFA 3O4FA 1M6YA 1TU3A 3SBOA 4F9TA 1PT9A 2ZSEA 4C2AA 1T0IA 4HBZA 4EGCB 1XTKA 1KBQA 5TDHA 1N2OA 3MM4A 4G8JA 1I9CA 1CQWA 2ZJBA 1V8BA 1LLCA 2YCBA 5F78A 3RAPR 3LO5A 3V1KA 1KH2A 4JMPA 1TIPA 4PZZA 5HDBB 2GXUA 3V3KA 4M7WA 1Q19A 3H5NA 1MHTA 2CZGA 2O0JA 4QVKA 3RFCA 1BDMA 5EZYB 4DADA 2AG0A 4ZYTA 3ER9A 1QCYA 3B7GA 2GZSA 1C0PA 4JASB 1RAAA 2C4TA 4I55A 1JHPA 2ADFA 2BGJA 3K6RA 4PICA 5AVJA 3KALA 5BPFA 2QI9C 3V7NA 4YLEA 1PJ4A 3OQ6A 3ZY6A 4R1NA 2VAVA 5EPEA 1Y1RA 3K0BA 4R41A 1QQ5A 1TYDE 1QIKA 2LW7A 4XLLA 5CYGA 7REQA 5LXTA 2A30A 1T25A 3AW9A 4OQPA 3W79A 4ARZA 2GHRA 2HY7A 4ZKDA 4UHCA 3ILSA 4MTCA 1C0LA 3FR7A 5DK6A 5FP0A 5ALMA 4EMBA 1XKQA 4RA6B 5EWLA 3FKQA 1QX4A 2PUFA 2BBTA 1D7AA 3PHIA 3FFTA 2JBHA 5CNMA 1UCFA 3B8EA 2YWFA 4S2EA 2GPTA 5DTEA 1E5QA 2IYRA 4D6PA 2QNRA 3FVQA 1XP5A 4B6EA 4UD6A 3GRZA 4Q4CA 2IEZA 3EZ2A 1HFKA 5KSOA 3CW2A 3FVTA 3PWZA 3U9LA 4BNIA 5K8JB 6AT1A 4C6RA 2RFLA 2X0EA 3N28A 1AIPA 1NFRA 2IIQA 3AFIA 5L3RA 1KZGB 3IQHX 1CS0B 2VH2A 3H3JA 2GRJA 1QFSA 1PZEA 2I3ZA 1BXRA 3FPEA 3PC7A 4Q1AA 3HPRA 4RVDA 4EHAA 1US8B 4EKNB 5KTYA 2RD2A 4GKBA 1GUYA 2CL7X 5E9JA 4NV0A 1W88B 4RPCA 3MFYA 2FMIA 1XWIA 4EATA 4O8ZA 4F6RB 2ZLBA 4JIGA 3AEYA 3H5RA 5GQSA 3RC9A 3RM3A 5BWMA 1ONPA 1QK5A 1QSGA 4RPHA 1OI4A 3EXIA 3MWYW 2DM6A 2Q2WA 2JJMA 3OA0A 4X61A 5KYNA 1W8IA 3DP7A 2CDRA 3DL7A 1QH9A 1W2HA 2GRAA 2I6GA 3AWIA 1PI3A 3PPWA 4G9EA 5ISMA 4CN8A 4I2NA 1ZJZA 3D4LA 3QMVA 4GM0A 1WXGA 4X7BA 1FNCA 4CM4A 1VBFA 3AI3A 5FUWA 1JQ5A 1WEHA 1E2NA 3PF8A 4HYYA 4TUYA 3TRIA 3T5PA 3AVVA 2JDID 5GTDA 5AH0A 3SKVA 1O77A 3CRW1 3MCWA 4BMYA 5BUSA 4GKVA 1XKTA 2OK8A 2WTXA 4JLMA 4K6KA 4RPGA 5E8JA 5EMLA 1FYFA 5I3CA 3TW8A 3RSGA 1AC5A 1Q0LA 4Z9BA 5AVZA 4NATA 3VKGA 2FR8C 4UZFA 1EHIA 1NUTA 4FYIA 1CZRA 1ZKDA 4HWGA 2AA3A 3OKFA 2QN7A 4DC1A 2W2LD 2EFDB 5C1PA 1BKDR 1N6HA 3ITNA 3DFZA 4D0NA 4DWVA 2WM2A 3LPMA 3VZQA 1WHTB 3W8EA 4E7OA 4EYOA 3UMMA 1B43A 1OKKA 5BXQC 2HXSA 1GTL1 1RCUA 3RFVA 5L45A 4FYXA 3W1EA 4CIVA 2P4SA 2MSCB 3WJ7A 5FR2A 5FQOA 3ZGNA 1NOKA 4HNTA 4OHCA 2GQ0A 2NZ8A 1DEXA 2BFAA 2QTCA 2WQZA 2NYUA 1PJCA 3F47A 3OHSX 3TLZA 4BN4A 4O4HF 1DKNA 2WABA 2XTZA 3UJCA 3CPEA 4L95C 2J3MA 4OTZA 4ARAA 4RM2A 3A9UA 2PT6A 4ZEMA 1QANA 2AEMA 3TUIC 1CIVA 1E2DA 4E2WA 1C9NA 1YVDA 4N0QA 5EJGA 2X0RA 4D3FA 2PA3A 1Z12A 3EIXA 4J29A 5EVCA 5REQA 2PRKA 3G2KA 2DH5A 2GN1A 3A6HA 2PCLA 3IDQA 4LNUA 5G0SA 4CF7A 3HTXA 4UEJA 1IQ0A 4PWZA 5C31A 1W49A 2MTBA 3OZFA 2AR9A 3JQ6A 3AIIA 3INRA 4D9NA 2QQGA 3IEPA 1NC1A 1E58A 4CETA 1QZUA 4II7A 4YJFB 4FBMA 5MFZA 1UZUA 3A6GA 4O2BA 2R1VB 4MUXA 4R5MA 4KE6A 1OMOA 5C80A 3VNQA 1QH8A 4HRYA 4URZR 3T3EA 3SHTA 2C2BA 1B14A 3MNFA 3BB1A 3NM4A 1M73E 1DV1A 2C61A 1HE3A 3B7PA 4UOZA 2ZW9A 1XQ9A 5KOJB 2XCLA 1DTSA 1VJRA 2OHHA 2PJRA 2QN1A 1PG2A 3AUJB 1OBOA 4WASA 3JS5A 1YRYE 2VKQA 3DG9A 4M83A 4P6VF 3RRJA 5GZ6A 3A04A 5B6IA 3AINA 2PUBA 1WVMA 2WTUA 2NUPB 3SYTA 5E1OA 3TSZA 1UXJA 4KYVA 4B6JA 4BLSA 1CY7A 1N2EA 1RAHA 4U2EA 4F1WA 3C6YA 3BGVA 4GYJA 2HMTA 1G5PA 2VCYA 4NU8X 4KR9A 4ZTUB 2WWVD 1U8YA 2CXTA 2WSBA 4U7FA 5HJ7A 3SWWA 6LDHA 1TM2A 1XZPA 3W5DA 5D2CA 1S2GA 5BXYA 2ZT7A 1YL6A 4IJKA 2QGNA 2XMPA 5JNVA 3FWHA 4NXNB 4LYJA 3RIGA 1L1EA 3JX9A 3K1ZA 5HTKA 2PQ0A 2WFLA 2NOAA 3H9GA 3Q9NA 4HXEB 4BMXA 1RYBA 1QMGA 2W42A 3CZPA 3JAKA 4OHOA 3ZVNA 1R3DA 3FNFA 4QGHA 1AM4D 4LZAA 4MW1A 5TVGA 4F5YA 1T4CA 1TDJA 2WYWA 3I6YA 1CE8A 1V5IA 4LE0A 3BEOA 3LX4A 4P81A 5CIWA 2EJUA 3TNLA 4D9EA 3RIHA 2IOFK 2RONA 2RGDA 1VZ2A 4KPFC 2REQB 2DQZA 1RPAA 3IT0A 3SNHA 1KC3A 1HQYE 3E1GA 2KWIA 1WNFA 3LUPA 2X9QA 4JP5A 4LF6B 4P93A 5DHTA 4RELA 3R7WB 1Q16A 4BNFA 4TX1A 5BNIA 3FFXA 4DLAA 1RAGA 4YGXB 4DLWA 1JQ3A 5F2OA 3QW2A 4KVAA 1GQYA 1EZ4A 1PR0A 4MS1B 5CA1A 1RLIA 4HQNA 3NGMA 1XZFA 1DRUA 1UDXA 4MICA 3BG5A 4PIVA 3DFFA 2AE2A 1Z6GA 4NHEA 1U4NA 4NH4A 5CA1B 4KTTE 3KP1A 3QOXA 1AQ6A 1R16A 1W5FA 1X7WB 3OY7A 2QX8A 4BUCA 2AFIB 2QLNA 4FCCA 3WGKA 3SHWA 2LBPA 2CFOA 2RGGA 1PD1A 1M8GA 3FRIA 3KCNA 4NAUA 5DHFA 3AHGA 2IT1A 4A5SA 1G17A 2QUHA 1OHHD 1Z2DA 5AI9A 1PJLA 1Q0QA 3C41J 3L4EA 2IHUA 2W2MA 3RJ9A 3LY9A 3NOQA 5JATA 4A03A 1JQLB 2AF4C 4TMXA 5A4DA 2AR0A 2B1JA 4IPTA 4Y6QA 1W2WB 2C4NA 1SCDA 2HV9A 5KYXA 3SPXA 1QRDA 1SAYA 2X0IA 2IFTA 2ZTVA 3C14C 1VIYA 4L27A 5P8WA 4LF5B 3V7FA 3ASVA 2YXDA 4Q3LA 3T5DA 3R3JA 4KZPA 1J1IA 1RZRD 3GG2A 4JFAA 3FYCA 3LA8A 2D8AA 4M9UA 4Q3DA 1W2GA 2XPCA 1T5SA 3A9RA 3O9ZA 4XYEA 2VATA 3AQ4A 4QJ4A 2FUKA 2PX3A 4WXYB 2JDIA 3OQOA 3NTXA 4D4IA 3BFXA 5BNZA 2BFBA 3QXXA 4TKLA 5KNBD 4ZYUA 2ZBUA 2IUTA 1KOJA 2VJPA 2Y0BA 2I34A 1C3VA 3D1VA 4TQAA 4BVBA 4LFAB 4ITVA 4H0CA 4U7WA 2WHPA 5FEMA 1TC1A 4LJ4A 1Z16A 3AH8A 3Q7SA 1Q20A 4B3GA 1U0FA 4QT0A 3G49A 2FH5B 1MQ9A 2O3SA 3AEKB 4KHZA 4UFOA 4RXTA 3ANSA 3W78A 4LBZA 3ONNA 2O06A 3LXRA 3ZXIA 2J31A 4ESEA 3NJRA 5FYDA 5EYPA 5FBQB 4FNMA 4G8DA 4RK1A 5GWXA 4J0KA 4O02B 1TMGE 2NLOA 1DXQA 3OQHA 2BCEA 4GOJA 1VB3A 3F5SA 3UATA 5F3RA 2BEUA 3DUWA 3R9XB 2OK7A 3T3NA 5FLKA 3ISTA 3IQGX 1KDRA 2GBCA 5FL7A 2QMQA 4MA4A 4Z9AA 1U7OA 4R3WA 2RBGA 2BVNA 1R18A 1OI2A 1KJJA 3OU6A 4Y1FA 4EGFA 4S05A 2RH9B 3K2QA 4H16A 4TTIA 1AV6A 1F6BA 5K01A 1Z28A 1UJCA 1F4PA 3M33A 3G0DA 4MMXB 1TTPB 2ONJA 5FUYA 1YA8A 4P5DA 4PZEA 2FPPA 4OXRA 3ZZ1A 1KL7A 3P0JA 2J9YB 3FHTA 2SBTA 3I39X 2PSEA 3NXKA 2RB4A 4PAQA 3HDHA 4O29A 4AG6A 2C5FA 4MQBA 4PM4A 1W48A 2BWJA 2VT7A 4P3PA 1N5JA 1ZIOA 1J33A 4WZZA 3FZEA 5HCUA 1NYRA 3R5KA 1LD3A 2ZANA 1QFJA 3C4VA 3R1IA 4IIGA 2YXNA 2WP8J 1RJEA 7AT1A 1R74A 2ECQA 2HWWA 3AEQB 4BO6A 4OSEA 1LDBA 2CLSA 4B33A 4CQMB 3BXEA 5KNBH 1U0NA 1TF7A 4DNOA 3B70A 3MFQA 1V2HE 4HZUA 3STUA 2ODTX 3V4SA 1MC8A 1XF9A 2QTMA 1ZM4A 3CNBA 4EVQA 3O94A 1TL7C 3HB5X 2WWIA 3EEOA 3HKCB 1CNMA 1DAEA 1PDWA 1M8FA 2CDAA 4MO9A 4CEIB 2JHFA 3WKAA 1E5DA 1Q6ZA 2CJWA 5DYGA 5BN5B 3PVSA 4OQNA 3R9IA 1L5QA 1KH3A 4B3CA 5KCZA 1GL6A 3BQMB 2C5HA 5ICGA 4KVFA 3NDJA 3PITA 3L6EA 3MGCA 3LOQA 5E2IA 3U81A 2QZSA 4ZODA 1PUXA 3CKYA 1TMKA 3ZQKA 1FDUA 2RHBA 1RPNA 5K7SA 2W2PA 4IUYA 3WISA 4CNBA 5K99A 4OO3A 4LECA 2HB6A 3I5AA 4NBKA 5DNWA 3C6KA 2P5UA 1N2CE 1DMSA 3OJLA 4RTNA 3KSBC 2FR1A 1LGYA 2WKQA 1CUWA 3K4HA 4QGBA 1IMOA 4J9VA 2OKGA 2D4AA 2OENG 2VPXA 4QUGA 1N1EA 4WY2A 4HMQA 1LNZA 2P8JA 2ZT6A 5CJ2A 4ZPXA 3YASA 4INAA 3TD2A 4PGGA 1Z75A 5TQJA 1PEKE 1OV6A 4MNTA 3ND8A 3A4TA 1CLUA 1DP4A 2XYHA 4TXNA 4V0KA 4I1PA 1K3TA 2H5LA 5CUQA 4P0PB 4BP1A 1ZUHA 1U1GA 1OXKB 3BVPA 2P30A 4R6WA 3PFNA 2ZBVA 4RS3A 4JUFA 4DPKA 1N2IA 3H1AA 4ZU6X 3KHTA 3NAGA 3PJFA 4LJYA 4QOSA 3EW9A 4DV4B 1S4QA 2IUFA 3QQPA 1M0WA 1XXHA 4B40A 1ODIA 4JBYA 1X0XA 2PQ6A 1XZJA 4PYOA 4CDRA 5JROA 1KJ9A 1G20B 1WZEA 2WU8A 4HAWA 2C0QA 2Q8NA 3PRJA 1E9CA 5FOTA 2WIKA 4URFA 3KETA 4NE9A 1ZI9A 3MTGA 1RYZA 3RAJA 3MF4A 3UYLA 3VPCA 4IV8A 2A6PA 3GQBA 1XHFA 4FD2A 4GC5A 3ETDA 4AMZA 4HLUC 5DSZA 3ZIUA 1OFIA 1F6WA 4BVLA 3HCBA 1LDMA 1I1OA 1E99A 2QN2A 3ZCSA 3F98A 3PZRA 4L22A 4CM7A 1CBUA 3TLKA 4E46A 1D6MA 3V8VA 3GRPA 4OIMA 3EOBI 1JSLA 4YJGB 5CA0B 4M8KA 3KFXA 3HA7A 4LVCA 4P7JA 5DISB 2H0RA 3L7DA 5DFAA 1NDHA 3IAM1 4HAVA 4AJKA 2FCRA 2C4KA 2FRXA 3KFLA 1EESA 3NW9A 1UOPA 4ZHSA 4A7PA 1W35A 1ZZGA 4EA6A 5CT6A 3AJ9A 2WMDA 4RVOA 1VL6A 3L4BC 2ONKA 3U4HA 2J0SA 1CPYA 1SBYA 4N40A 3OP1A 4JA0A 1LNSA 1IZ0A 4JQCA 3RYTC 1LBQA 1V7CA 4D5GA 4EUFA 5FCDA 5K0JA 4I66A 2PX8A 5FADA 3L04A 2TYSB 1LC0A 4IMRA 4WJKB 5GOZA 4D9JA 2C8KA 3R7SA 1JLLA 3VH3A 1RZRA 3ABZA 4AD8A 3KQNA 1KHTA 4YI3A 4G6ZA 5F5XA 1BE1A 1H2WA 5IVPA 1VBMA 3P19A 1S9DA 3IAAA 4N7RA 2XAAA 2CVQA 3DHEA 5B2EA 5IT9A 4DEVA 1NVGA 3T7RA 1FTNA 5KNBA 5DX8A 1G7RA 1R27A 2QUBA 3KE8A 1TA9A 1TM3E 3QXSA 1HFJA 1VCIA 4MR8A 4UW9A 3TD9A 2F8SA 2Y9PB 2CNBA 2OCKA 1FVHA 4KUGA 4KXWA 2EHJA 4XYBA 4ALNA 4RWEA 2GKOA 2P5YA 1AHNA 2W83A 2XMGA 1ICEA 3E9RA 3WA7A 1N6OA 3OBIA 3RH0A 4N39A 4NULA 3CJRA 3CPJB 4LJAA 1BNCA 1C7ZA 5DGCA 2WWGA 5FJIA 1NF8A 2R8BA 2G4LA 2WAAA 2FN3A 1BE0A 3GUZA 4HAUA 4U9IS 3WK9A 3PX7A 4H6WA 4WKPA 5E0KB 3H65A 3FSEA 1RWNA 3TW8B 4OAPA 2DETA 3ABRB 5HCIA 2VK4A 3TLEA 1AKYA 1RW4A 4TYNA 2JB9A 3JRNA 1MRZA 3TD6A 1W36C 3K9WA 2VS1A 3EA5A 3KSMA 1FNSA 4IX1A 4N8SA 1YU9A 3IXLA 3NPMA 3R41A 4GMGA 5B7GA 3SDSA 1KMNA 1IEVA 3T1QA 5FPTA 4YP5A 3H8VA 3GJQA 1UM9A 2JFGA 4W4TA 1EFUA 4NG4A 4LPKA 1EFPA 3IQFA 4W1PA 5F76A 5EMJA 3IV6A 3KYJB 9GPBA 5JNUA 2P62A 5E6RA 4J6EA 4DCNA 1AKEA 1A5BB 4B7ZA 5AUNB 5IUNC 2OCBA 2Q5LA 3MZ0A 4RZUA 4ZDKA 3EPHA 3A26A 5FPKA 1MORA 3CYFA 1RWVA 3AR4A 4MLPA 1GEGA 2EGUA 4QOGA 4K9NA 5KQSA 2H4HA 4DPMA 5ALYA 1SUCA 4RTOA 4ZGBA 5E1MA 2BR3A 1RXYA 3UUWA 3NASA 1NYLA 3ZS9A 3H5VA 5FWYB 3ORYA 2QZ4A 2I99A 3PUZA 1NVVR 3EFOA 4WY5A 3UMGA 2R7AA 4WNIA 5AR1A 4KQEA 4BNTA 1WKVA 1N5IA 3PFCA 1WXHA 2C78A 3M4ZA 1BJRE 2WG0A 2A3RA 1M5UA 2BCJQ 2KPOA 4MROA 1PJ3A 4UAVA 2A92A 2V6JA 4J2OA 3Q72A 3HJGA 5DO9A 2VF8A 4EENA 3T1OA 4RFSA 3D0OA 3OTGA 1VHDA 2VNIA 1XT6A 3SC6A 3OQNA 4NSNA 5AJZA 4JFRA 2Y68A 2I55A 4LW8A 4RD1A 4FILA 2R8XA 1M74A 1XBTA 5KVAA 1KE2A 1XNJA 5L4LA 1WL8A 3O4VA 2B8JA 4D2IA 4FWBA 4BKOA 1M7HA 4TVKA 1Q2UA 1SCIA 3A0RB 2BY4A 3H17A 3LGSA 1KJIA 1KORA 3FZQA 1XLTA 3NAMA 2VSYA 2J3KA 5C1IA 1FNDA 3Q12A 2X6RA 3ADOA 4YROA 4A8JA 5LOVA 3PTZA 3H1BA 3TH5A 2XJ9A 5EJ7A 3ROEA 3IAFA 3DEAA 4DE5A 4LJ9A 1QYDA 5BN4B 5JBIA 1XAHA 3BJIC 3LYHA 3QNWA 4OJMX 3VKWA 4JLPA 4IHAA 4BMZA 3D5EA 1H65A 3DAYA 1HSZA 2H1SA 3QI7A 4WOPA 5A6SB 2E18A 3KKNA 1VXRA 5CLGA 4ZQGA 5FTMA 1L4LA 4CMJA 1AGPA 1TYBE 1ZNWA 2AW3A 1XXHB 4QFCA 3CRVA 3DMFA 3P4UA 1ULTA 4KRFA 3K8YA 4B46A 3QIVA 1AHPA 4XSGA 3DW3X 3I0MA 4CUJA 4FQ7A 1JEYA 4PEVA 3T4EA 1EVQA 1KYZA 3SCZA 3UT5A 3ICQB 3QBVA 1URPA 1VKHA 1FVOA 2CV1A 1FDSA 1MT0A 3DOCA 4LJKA 4RORA 1NZDA 2E0IA 3LPAA 3V8EA 3RC7A 1THGA 1YI8A 1VP9A 2X8LA 3AKCA 5D3QA 3IIKA 4C21A 5K6TA 1I3OA 5LP1A 3BORA 2FZWA 1L4YA 4S2UA 1QO9A 2IF0A 2QE6A 3FB1A 4EX7A 3PUVA 4Y2TA 3BMQB 4CUZA 4L51A 4RDHA 5CNJA 4M49A 4MHOA 5JD3A 1XVVA 1H1TA 1DKRA 4G37A 3D4NA 5ELMA 2J67A 1R1DA 4LY3A 4FOSA 5M3BA 2ZR9A 1ZH2A 4KPUA 4IIXA 5ALKA 1J07A 4INOA 1U0RA 4RTRA 4OLAA 2JH8A 1HDCA 4JLNA 4V0ME 1J2RA 1OLSA 3S55A 2OZLA 3C6XA 4EF5A 4YXWD 2PE5A 4PQGA 2BBWA 3IBGA 3MCUA 3WKBA 2J0QA 4PLYA 4NZPA 3A1VA 5GJVC 5FFFA 3TM5A 2Q4EA 1W5AA 3AT1A 3TNFA 4FEEA 4OHMA 5I7VA 2QVGA 1LSSA 2WIGA 1EXVA 1XRLA 3RTAA 2HBRA 1ABBA 4TLCA 1GDHA 2NQ8A 3H5IA 3PGLA 4C0JA 2K7FA 1Q1ZA 1E66A 3HZHA 3OTOB 1QRAA 3OMXA 3ZBTA 1T36A 2XTAA 2AOUB 4G23A 4B2YA 3AEKA 3O1HB 3ZXUB 5K0GA 1VYTA 5IM5A 4MDEA 3V4LA 5EQDA 2XF8A 3CKKA 3R7WA 2ZKIA 1E4EB 4DNQA 1GNLA 3ZZNA 3ZU4A 3F74A 4EARA 4XH9B 3ZTYA 3TEFA 4PC3A 1TQ6A 5BYJA 3WL3A 3R9WA 4EJSB 1G0NA 4KFUA 2OV6A 1V9SA 3W1WA 2G8LA 4BN0A 3S8EA 2V65A 4Q9DA 1MN6A 4N3GA 1I2BA 2EIHA 2X86A 4OHYA 3HR4A 5FBRB 3THSA 2VZEA 3E5RA 5KJEA 3U44B 4JENA 5ILOA 1UWCA 2HU8A 2P0YA 3PC4A 3OWHA 3P9NA 5TY0A 3BULA 4EUNA 4TKUB 3WOVA 1H05A 3IMKA 2XA9A 3TX2A 4L9RA 5C8YB 2JEZA 2O8CA 5T57A 2K7ZA 2COEA 2OHGA 3WKCA 4AUMA 3U6KA 2XUJA 2R6R1 3I53A 3LOPA 2XT6A 4Q1FA 2UXCB 1KRXA 3PNKA 2BEWA 1AQYA 2Y77A 4OA8A 2CNOA 5BWLA 2GBGA 2WYVA 1AH2A 4PBTA 5DLEA 1Y4AE 1RKXA 4GBMA 2D7DA 4E5MA 5E6UA 3IV7A 4ZI7A 1G5FA 1JKXA 1WSDA 1MVOA 2ZRHA 4FFMA 3S5JA 1EUQA 4LF8B 2MINB 3BCUA 1H5NA 5EEHA 2IWHA 1Q7CA 1GTVA 2HWUA 2NYVA 1WBJB 4FS3A 3KUXA 1E69A 4G67A 3RNOA 1DX4A 3CNHA 3D6AA 4G4GA 2RI1A 4FN5A 4RVCA 1Q1BA 1UDBA 1PKXA 2X0JA 4PBRA 1R2QA 5AUQA 1K7SN 1JBKA 3F6PA 4ZC1A 3VU9B 2IP2A 4BGVA 1GTG1 4HQKA 1Y42X 2LCIA 3DOIA 5EMNA 5JT1A 1KETA 3JQEA 1DAPA 1HYEA 1WLYA 3O4RA 4NABA 4QL3A 3R8CA 3QBEA 4NPAA 1JHDA 1T8UA 3LOUA 2EW8A 2I5PO 5LUAA 2WWHA 4KSCA 1QV9A 1HTBA 4G5OA 2PA0A 3DE7X 2Y1XA 4JH0A 1GA6A 4WKGA 1P74A 2Y6VA 1PR2A 3GBVA 2AFRA 2EARA 3OJCA 4OYRA 4RH0A 3GJXC 2H1IA 4V38A 1OH5A 3RTGA 4CL8A 3O9VA 1M6NA 3V4FA 4EOGA 1W85B 4MV0A 2GH1A 2XKAA 1NKVA 3T7SA 2ZBRA 1P44A 5K8LA 3NGXA 4L5AA 4MVJG 4RJKA 1IXYA 1RP7A 3LVQE 5C8YA 1Z25A 2WF5A 2WJZB 4DAOA 4U7TB 2Z43A 3GZJA 1A8IA 4X45A 5NULA 1YJ8A 4IO0A 4Y9DA 1ZW1A 1UJMA 2QJRA 3ROTA 1I7DA 1MPTA 2NPOA 4U8HA 2VNKA 3EBLA 4DPLA 4YMTA 2WDPA 4XDGA 1I5EA 4Z7QB 4XARA 1PD0A 5IYZA 3T7CA 1AUPA 3AZOA 1AF7A 4HPJB 4RTSA 2A1UA 3K9GA 3EZGA 2QHXA 3GDWA 3I76A 4D98A 1T0JB 2CWWA 2EDCA 2HK9A 3QLVA 3W6NA 3DNMA 3S70A 4PG5A 4J0GA 3BJZA 4KXLA 3A14A 3MTQA 4ZVPA 5CB0A 3G5AA 3SIWA 1C8KA 4UHBA 4WFJA 4G84A 2DWCA 5IAAA 3HDQA 3I9V6 4JR2A 5IHPA 2FE4A 2QTGA 1ZR2A 2FDRA 4LK2A 1IG3A 4FHFA 3NS7A 2UZIR 3FYDA 1U7XA 2GZMA 1MEOA 2ISCA 4AB1A 2BMDA 4ETIA 1F4VA 1EUDB 3L0OA 3NCHA 4GZ6A 4LMRA 1N34B 1DKQA 1X7ZA 5IC6A 5ITVA 3U49A 1AA6A 2GPYA 3P2IA 2X14A 4OMUA 5AVTA 5L7TA 1HTTA 2HI0A 3WNCA 5D85A 1EEHA 1UPXA 3GB9A 3KEOA 3QW4B 2QYTA 4UBNA 2ZTHA 2O2ZA 3OCZA 3NTVA 4OI4A 3TJRA 4K9OA 1MABB 4OL0A 4XUEA 2C7VA 2ST1A 3A7EA 3ZY3A 1LK5A 2G5GX 2JJ8A 1RJGA 3B82A 4XJTA 1SKMA 2JK0A 1L6RA 1SPXA 1V35A 1IZ9A 1OOEA 4XA8A 4W5HA 3U1VA 2OO3A 2XGSA 3T3HA 2UDPA 1LH0A 2JAUA 1FLNA 2D1YA 1RCTE 1OSNA 2GZDA 1BE6A 2C3YA 1ZYUA 2HF2A 2KB0A 3GT4A 3TQRA 3VZSA 3KQUA 1ESMA 3DWFA 5EJMA 4PYIA 3Q88A 1BKSB 1O94A 3PGKA 1AXEA 5MHTA 3L7MA 2Q6TA 2ORIA 1LLDA 5DTRA 2JS7A 3A9VA 4JC5A 4F2DA 3T4PA 1SVKA 2FFAA 4RK5A 5EXSA 1SHZA 4P7GA 4A0QA 5IEBA 3O73A 4JSTA 3FUUA 4IOLA 4TTAA 1QHSA 1P80A 4OQQA 3T54A 1D2HA 3UICA 1II0A 3TXAA 3PGJA 1ODSA 3LIIA 1DVRA 3JWPA 4KMRA 3RC3A 1ZRMA 1QFYA 1OLUB 4G24A 4GGPA 3KV3O 5EE5B 5CAEB 2C82A 1J8QA 4C4AA 1H8EA 5JFTA 4MKZA 2OGWA 1K7YA 2QAJA 3R7DA 1V4NA 5KO2A 4HYTA 3CXRA 1WW3A 4OKSA 2AXEA 2DUNA 2A0XA 4XDZA 1M0SA 5F7ZA 5EKUA 2X7HA 3GFVA 3C3MA 2AFVA 5TPZA 2NAPA 3DBIA 3HYNA 3N70A 4K3VA 4BNXA 2AWOA 3NHPA 2GTIA 2DGDA 2HLPA 1ILEA 3NTQA 4G1UC 4WLNA 4ZIRA 1MJ5A 3R0XA 4RIFA 2EHDA 2ZQ5A 4DR4B 5FPQA 1KPIA 4LRSB 4HFRA 1ZQ1A 1HT2E 4KGZA 3B85A 1DX6A 5NLLA 5AHOA 1NATA 1MX5A 2QVXX 4ZICA 4RGYA 4NENB 3ZQJA 3DOFA 1KJZA 2R87A 3UGJA 2BKXA 2JHPA 4CIDA 3JD2A 2NVUB 2DPYA 4ZMBA 3AIMA 2YXPX 1UAYA 1D8AA 3LMKA 3CLKA 4HN4B 1GIAA 4M1TA 1FRNA 3RIXA 4M8IA 4KR0A 3UWSA 1ZH8A 3KOMA 3WGHA 3GZ4A 4B3IA 4Q1EA 3SQOA 3WK5A 5KTTA 1Z17A 4RTJA 3P5SA 4GGMX 3WGNA 1NA5A 5BV2P 5JMWA 1V3VA 3ICEA 1TO6A 4X9XA 2XNJA 4FUTA 1UBKS 3SOZA 2ACKA 5F1PA 1GDTA 3HCDA 4MIEA 2XNDA 3ESXA 5EWMA 4GE3A 1LDNA 1XD9A 4L0MA 1FYVA 4GLOA 3EHDA 5JISA 1BVHA 2R48A 1CB7A 4JLBA 5JC8A 2CZQA 1QS0A 3K9QO 3UK2A 2B0JA 4IHJB 4N9QA 2CFCA 2DT8A 2ORVA 2Q3BA 3TIXB 2O0MA 4TMYA 1A88A 1USVA 2HJHA 2IU3A 3R0IA 3HUDA 4DMKA 5K0BA 5E4FA 1V2GA 3I5YA 1UKVY 1T4MA 1EE1A 3L01A 5CX1B 4FKMA 1GPAA 5AW2A 1LK7A 1E3WB 4L4RA 2ZRQA 3RSLA 1HDGO 1OZHA 3LC7O 1DV2A 1N5LA 1GUFA 5B1IA 1KMIY 2RSLA 4LC1A 1BA2A 2YN2A 4UAGA 5A0VA 3CT4A 2X5OA 3EXIB 2H1FA 3G5LA 4WXEA 3RVBA 1AZWA 2PEZA 3B6KA 3DZFA 3I5MA 3MQ4A 3PPYA 4WXHA 1QLHA 1R6UA 2YHAA 4LI0A 4B7CA 2ZRIA 4O8CA 1XTJA 1Y8CA 4PNPA 2JF0A 1KDZA 4UHEA 2WUVA 4MVJI 4AMYA 4LDPA 3OJOA 4RMHA 3TB4A 3V80A 2HX1A 1QOPB 2GUGA 1H9CA 3U3JA 5DI3B 3AGPA 3GDFA 5ADWA 4EYQA 1PTJA 4X1YB 4MIYA 4KOEC 4DZTA 5IASA 2Z1MA 2OO7A 1NJGA 2PG3A 1CFZA 1OA1A 5IDXA 3VI3B 5ITWA 3ZHZA 3T5BA 3JYLA 3A32A 4DDWA 3DLHA 3GP5A 1PS0A 3G3EA 3HJUA 2L0XA 3PGMA 4QQ8A 5T41A 3TI9A 1P1BA 5JS1A 1WUKS 5HIIA 4CEJA 1VMEA 3L8GA 3RE1A 2IS1A 2XUOA 2YOFA 4QYXA 4CTNA 4UM9D 1LV8A 3CUYA 4G5SA 4U8GA 3P20A 4U2BA 4CKEB 3QYJA 1CYDA 3D54D 3HL4A 4WY8A 2X0FA 4TS4A 1XZGA 2OESA 3KKEA 5AKYA 5DTJA 4QC2A 3ZI0A 5JUWA 5I51A 3OECA 4PN3A 3TZ6A 1CUZA 2BFWA 2QVYX 2JVKA 2X2PA 1GZ6A 3LUDA 1F14A 1VHJA 3H4TA 2IEIA 2Z8YM 4EK9A 5JHHB 5LU8A 4OSOA 2P2NA 4W8OA 2W8BA 4AC9A 1U2EA 5EJ8A 2H1HA 3LHDA 2E49A 5KUTA 1AQLA 1EQUA 1Y37A 1IAVA 2XQFA 1DQPA 1K6MA 2H0QA 2XVZA 2J0VA 2I62A 3IYLW 4KAJA 4D45A 3V34A 4K5QA 2NSDA 2OM2A 3RFUA 2O0HA 1GRRA 1WXQA 5FBKA 2B4TO 5G1PA 3GWZA 2FP4B 2I71A 3O26A 3ER6A 4Y2HA 1BDBA 1E9DA 3BGWA 3EF3A 1PQWA 4LKRA 3CY6A 1A8SA 5AKIA 2NTYC 2YVKA 3OFND 1DDOA 3HI6A 1LI5A 4L9AA 3ZZMA 4RY9A 4U00A 4CIXA 1YKFA 1S89A 3RT9A 3VKVA 5LR6A 4KQJA 5F9HA 3JALA 1A8UA 1GNPA 3UH0A 3V00A 1Y81A 3O38A 1JG6A 3FCXA 3F49S 4IAOA 3F3SA 1DJQA 1GPDG 4QM7A 5BN3B 4B3JA 5C7LO 2FEKA 2X1HA 4AP9A 3DR5A 3H6HA 4L8GA 4BQFA 5DBGA 4CBVA 3E2MA 1L4UA 1ZISA 1NVVQ 3GAAA 3NALA 2JLSA 1H8ED 4G09A 4ZT4A 2JGMA 3FYSA 4B2IA 2VAXA 4JYMA 5HUJA 4DV3B 2I9PA 5T4BA 3BMCB 1WB5A 5CNIA 5K3FA 4G07A 1R5OA 1CW2B 4NZNA 5LVAA 1UMDB 4PSKA 1OC2A 2IYUA 2ID4A 4UCFA 9LDBA 1HE4A 5K20A 1IUKA 2FMKA 3CLTD 1PP4A 1F3LA 3ZWMA 1O0SA 1YHZA 1OZGA 3ZS8A 5BSFA 1ZX1A 5JSZB 4YCCA 1IHPA 3CC8A 2O48X 5B7NA 2CXNA 3L6UA 4WWHA 3WDSA 3EPRA 3HDJA 3WRVA 4DV7B 2HU7A 3AY0A 3IUQA 2Z2IA 1KYIA 4WN9A 3I04A 4QGSA 4CPDA 5KS2A 2FSGA 3L8CA 1P45A 1RAEA 1GSAA 2LZ0A 3AFHA 4MZDA 3TLCA 5ICMA 4PAWA 3U61B 1BYIA 1MGPA 3LDUA 2NU7A 3NBQA 4FEYA 1U28A 3V5NA 4BFVA 4G5QA 4JJ7A 3WGIA 1YB4A 3IA2A 2VT3A 3ZQUA 3MJFA 3EGCA 2J3HA 3RRYA 3DBOB 2DB3A 1J49A 2GASA 4HWPA 1T0PA 2EBHX 2AEEA 2R6JA 2CNLA 3C4QA 5EUBA 1DC4A 5LB2A 4A23A 4E30A 1GRQA 5ABPA 3GJSA 3O95A 4YMIA 3BIXA 2FOXA 2M32A 4CWAA 4MS3B 2Z6VA 4WLOA 1LLQA 5KTMA 5DDIP 1YQXA 4L5IA 5ED4A 2MYNA 2MSKA 2V58A 4IEEA 4B5LA 3LVBA 4ZYWA 3T7AA 4Q39A 3CF0A 1BMQA 4XGIA 1AE1A 3W6ZA 4HVCA 4RY8A 5ER6A 5CEFA 1E20A 1ZFNA 721PA 4DV0B 4UBJA 1P0FA 2XUGA 4YRLA 2IC5A 2XKKA 4KRGA 2XNDD 4WLUA 1F2TB 4HUTA 4JOQA 4KUHA 3RBAA 1LRKA 4AJ2A 3QFFA 2H51A 3Q2KA 3PXXA 3KL4A 3HA3A 3PZBA 3CGWA 4DDVA 2B98A 2PFSA 2VNSA 5AM5A 2C8VA 1KHHA 3P2MA 5T8KC 2V4ZA 3EBOA 1ZM2A 2WY2D 1WPRA 1U5BA 2VNAA 3T9BA 2PZMA 1Z13A 2C94A 3EIEA 3LLMA 4I5FA 1SVSA 3GGJA 3K15A 1Y48E 1CRZA 3C5CA 1W5TA 1RMQA 3IKVA 1X1RA 3MUEA 3SP1A 1ISIA 3ZK9A 4PXAA 3ZNNA 1E3EA 1M1YA 3W7AA 4OBEA 2GEBA 4BLRA 1ID8A 2YWRA 4W7IA 2JG3A 3DDNA 4HY3A 5KDLA 2X6QA 5BV7A 5C53B 2ZDGA 1PN3A 4YLYA 1FUKA 1FFHA 5A71A 3J80A 4AQYB 3UEOA 1TQDA 4RAOA 3DEKA 2HREA 1NNLA 1U8ZA 3UAXA 4AS2A 3EMBA 1VL5A 2OBFA 3MSCA 4H3SA 1YCFA 4YMSA 5IBCA 4UPEA 1TT5B 2ZJZA 3P1JA 3P9IA 3K73O 5ALJA 3B60A 5IS2A 3RRZA 4O2BF 2DFPA 5FKJA 1ULBA 3WGUA 1LBEA 5JCXA 4EUHA 3HFSA 3LDAA 4C5CA 2AZXA 2PLRA 2ETVA 2VVTA 5DN9A 521PA 1AQUA 3VR6D 3MJDA 2CFSA 2YV5A 4TUYF 1TVMA 1K8YB 4M1OA 4TYQA 3TG8A 1L5HA 3R6LA 3CUTA 5DASA 3UB2A 2KI5A 1V25A 1YQGA 3GLHE 3JU3A 3QU9A 3RS2A 3RSFA 4FFLA 4E21A 2Z5LA 1Y0BA 4YPFA 1AQNA 3CW9A 3DFMA 3HQ4O 3GJZA 3JWEA 1VKNA 4ZT6A 4MJLA 4HKTA 3ZCQA 2B61A 4PFSA 1YIDA 2JAQA 4FFPA 3KYIB 1QG2A 5KNCA 2ZUCA 4PFKA 4BQRA 4BFXA 2ET6A 1FB5A 2GM5A 4MWCA 3L6DA 5A2GA 4KZKA 3NVKI 1JBEA 1A9XB 1PNOA 3BX1A 1GPJA 1RADA 2E48A 3FTQA 4J7UA 4QLOA 4RSMA 4CMCA 4DMCA 2J30A 3QE3A 1TJ5A 2QWXA 1AN9A 2ZB2A 2W2XA 1NW4A 4EVRA 2JGIA 3AKYA 3KAPA 1DEKA 3TUJC 4F3YA 4ASUA 1YGYA 4GWLA 5KQGA 3Q41A 1JYFA 3R5HA 3UZUA 5KVSA 1JEQB 5EHZA 1UP4A 2Z2ZA 3IEUA 3RABA 1H6CA 3OEYA 1YFLA 4EPXA 3SQXA 1B93A 5ANRB 5F1OA 3Q0TA 4M0DA 5ALPA 2W11A 1W4LA 1NPYA 4QTXA 2R6ZA 3HJTA 3F9IA 4RYDA 5I9TA 1CNFA 4I4NA 1M6HA 1XSEA 2FOIA 3R5XA 5EJFA 4KV9A 4QPNA 2FPLA 4K7JA 2CXQA 3DDSA 1D4ZA 1VRCA 1E2MA 2RH5A 3WLKX 1T0BA 2YC4C 1PZXA 3LSTA 3CEMA 2OXIA 1BEZA 5K03A 2O2GA 1RXVA 5CFRA 3B3FA 3RSOA 3O4HA 2CEKA 2WB2A 3GRYA 3OCXA 4FK8A 4FMDB 1YDGA 2NV2B 2Q9UA 3U9SA 3WP0A 1T4CB 1TCVA 5IXSA 1SIUA 5JFGA 1VLLA 1Q92A 1P0MA 2AYYA 2BSXA 2C77A 1PK7A 2WV7A 4IVNA 2AN3A 2JCBA 3ONWA 3HCRA 1ADBA 1CR4A 3OZIA 5ALQA 3ASZA 3E7DA 5HHTA 2J0UA 4GP7A 4QXRA 2JATA 1OH6A 1EH5A 1QGUA 3PDIB 5B1YA 3WLLA 4RFLA 5TQ2A 2VPZA 2YW9A 2DPMA 3FCUB 4WDQA 4KDFA 4CM8A 5JSFA 4FNGA 4Q4AB 1Z4PX 1DT3A 5T6BA 1ZN2A 3A9CA 3RCBA 3LBHA 1SOVA 4JP3A 1D09A 4FFBB 4A2QA 1H2YA 1WPQA 4OL9A 4QELA 3VOAA 3IXQA 5M2QA 3HCFA 3QHAA 1E2IA 1XCGB 2OBLA 2W6OA 3CLUC 2HPVA 4F4DA 2V6BA 3VU0A 4K9QA 5EJ9A 1W1WA 3QTBA 1F7VA 3C45A 3AERB 4Y8VA 3BICA 4U3JB 2Q28A 3N5CA 4UUBA 3NHAA 4CRWB 4K6CA 3SD7A 3NCTA 4HPWA 4KQ2A 4C4OA 4R84A 3GMTA 3L4BA 3BF8A 4MUGA 3HO6A 4OHPA 1FYEA 5TB5A 1V5FA 2HQ1A 2B34A 1NR5A 2WWXA 3ES9A 4NEHB 4UMEA 4YP9A 1C8LA 3SBDA 3PL1A 1O57A 3HH8A 3SE7A 2PL5A 3H5WA 4YRMA 1QHEA 1B6SA 4LXGA 3M5WA 4FLFA 4QECA 2C95A 3V3TA 3GXOA 3PQ8A 4IMPA 4NU0A 3CHYA 1JA0A 2AC2A 1HBJA 2CK3A 4B87A 2HA7A 2ZRNA 4WV3A 2EYUA 2HZBA 1GILA 4JJGA 5ECGC 4Q15A 4NEGA 2ORED 4MI3A 1DBRA 1USUA 1XTRA 5DGTA 1ZL2A 3T0FA 3UGQA 3SFVA 2IEGA 4RLHA 3S1AB 3AI7A 5CM8B 3A1FA 3EH1A 4JKOA 1O03A 1P29A 4WZAE 3UWKA 1HMPA 1Q12A 1KY4A 4C78A 1COWD 2ZJ8A 4IZ6A 1NTOA 3AEQA 1I4OA 1NW3A 3LL7A 2QPLA 1B15A 4GQAA 3AVTA 2MWMA 2QXUA 2WVGA 1P2SA 4X84A 3KEFA 2E4VA 1H42A 5EIXA 4CR8A 1NVFA 2BZGA 1JHAA 2K2WA 2JLZA 3KOXA 1NV8A 1Y4UA 2IUEA 2O52A 3D6UA 3F6RA 4W5RA 4CLXA 4I5GA 1Z5VA 4I9NA 1IAQA 1RJDA 2A9VA 2F1OA 1O95A 1P2GA 5BWBA 3SXUA 3D6FA 2B92A 2FRVA 2VFAA 3BGSA 4KBFA 1L7VC 4G89A 3PT9A 2O8CB 3C98A 4PZ9A 3VDXA 4N49A 4TRRA 5FLXA 3U3OA 5G0WA 3II6X 3UOWA 5C7IO 2PBZA 2SKDA 2VUIB 1QP4A 2JGJA 1KBZA 2P9BA 1G5IA 4LAFA 4CXMA 3IO5A 2PSJA 2PRZA 4X0EA 2LNDA 1G19A 2OAEA 1JDSA 4LMAA 1WIWA 2P2SA 3BFJA 1JHXA 4ZT7A 5SZKB 1Z4LA 1I3CA 3UNXA 1EE9A 2BFFA 4K6OA 5FV7A 3SEAA 3KQMA 3UIEA 1E2UA 4IIVA 3A4IA 4UNIA 4FD3A 1FVXA 1R4NB 4PPFA 2P9ZA 4DREA 4PW0A 4O3FA 3M1IA 3ZZ0A 4RZ2A 3C24A 3QNMA 3UPTA 3CG0A 1YQTA 2G88A 3IRUA 2WKRA 1TT5A 4WZ6A 3WMRA 1POWA 4EFLA 1RRFA 1AHIA 4WDRA 4D3YA 5JZBA 4MKGA 2X8AA 1HZJA 1XHEA 3ROPA 4AF6A 4RDXA 5KNCD 1T9HA 1KZHA 4B6QA 4MVJA 2ZGVA 4F71A 3FD8A 4DA0A 1U5BB 2WZCA 2OLKA 1BE8A 4JU9A 1FZTA 3K0EA 3HXKA 2V6GA 1NMEA 1UZAA 3AF4A 3IQDB 3MLAA 2GF9A 2ZR0A 1DUVG 3E15A 2XXAB 5EC8A 4B6PA 3E03A 4E88A 1W76A 1SA0B 1NVBA 1MH1A 1WQ4A 3HJCA 4PINA 3ILXA 5AW5A 1AKUA 5AW1A 1A9SA 1NBEA 4DIEA 2C7QA 2IY9A 3Q4GA 3GLGB 4KXYA 3OZDA 2QTLA 2BR5A 2O3TA 2X1VA 4NBTA 4CCYB 1DAHA 1U3DA 3LT4A 1E63A 1KJ8A 1ZGHA 5LP6A 4DV5B 4HQRA 2P1RA 3ETLA 2I2DA 2RAVA 1P4AA 2C1EA 1VFNA 2P78A 4UNSA 3PNMA 2OYRA 4EMTA 4YIHA 4UNPA 1A9OA 1R8XA 5AW3A 2CUKA 2ZIUB 1T1RA 3HBJA 5LZ9A 3R5TA 4I99A 1H2XA 5JZVA 4FR0A 1V37A 4Q16A 3VMMA 3OKCA 2WTAA 4R3UC 1G1MA 3Q3JB 4P58A 1UXHA 1OILA 3I2GA 2QN3A 4CR6A 1RCFA 2HMVA 5EYPB 4CMGA 4V0OA 1Y1TA 2B3DA 1ADCA 3FOWA 3DLBA 1Q7TA 1G8GA 3ZUGA 5C8ZA 2WNSA 4PLVA 1I2CA 1QVZA 2JNWA 1SUSA 5A6SA 2C4VA 3HR7A 2OSBA 4S1VA 4TLMB 5CYFA 1U8XX 3Q7IA 2DY0A 5IBQA 5E9QA 3UV7A 1I4DD 1XDWA 2MYTA 4I9FA 3ME5A 3ZJTA 1H85A 1K66A 1UUFA 3EISA 3MYRA 3SBXA 1VC2A 5DHQA 3JARB 3AJDA 1FYXA 2LIVA 1TUBA 1UBJS 4L2IA 4Y0VA 4YP1A 1CRQA 1O5IA 3KRTA 2ECFA 2C4HA 4UPVA 2PFGA 5AJVB 1RI5A 3TECE 2ZREA 3AO0B 5FOWA 4BMSA 1WJGA 3H04A 2XE7A 4AZWA 1XPJA 2B2NA 4A1OA 2AV6A 2E6KA 1H0HA 4QPCA 5TQ2B 4PNZA 2IIBA 1VKOA 2BGWA 3HZRA 3OZGA 4NS1A 4YMVA 1FJXA 3IPCA 1NI5A 2LDBA 1L1FA 4IJ6A 4FCVA 1IBSA 4KOAA 1GLVA 1XZEA 1VL0A 2QP9X 4JBXA 5FBVB 2D54A 2IBSA 2QM3A 4PSVA 1DJPA 1ZI8A 1Q1EA 2PMBA 1Q0HA 2AJCA 4RCZA 2C0CA 1MR3F 4F1JA 4EAAA 1L4FA 3C5WP 1I7PA 3E7FA 5IMBA 3S2ZA 4P08A 4P83A 3V8BA 1U5CA 1SA0A 2H6EA 5SV2A 5KYUB 2NMVA 1CKEA 5KJFA 2H65A 3KQPA 1QH0A 1YVEI 2IHTA 3B48A 4Q4JA 4R2JA 3WK4A 1SXJB 2XOKA 3CUWA 3FYUC 3NEYA 1JG2A 3OZBA 3N0XA 4XRGA 3G2MA 2PGOA 2QMYA 1AK1A 4RSRA 2CUTA 1YB7A 4J76A 2FZLA 5LXTF 3PX2A 3C48A 4UUPA 3QXJA 1MX3A 3H83A 1E2BA 1E2LA 3QYPA 3HBNA 4LXIA 3TNYA 4DOMA 3BGOS 3R3UA 1I14A 5CXQA 2J5KA 4LN1A 2Y0DA 4MPDA 3ZD8A 3TTUA 4DL9A 2Q6OA 3OAAD 2HA5A 2WU1A 1S2OA 1SU7A 2J6HA 2PV0A 2V4MA 1KVUA 1RKBA 2XCOA 3EEFA 3HV0A 3NBAA 3JXEA 3PKZA 4OAOA 4DUYB 4RDCA 4NLLA 4AZ3A 2IIVA 1BVRA 1P73A 4UXHA 2R1VA 3Q3EA 1KYWA 4BECA 1JVNA 1W25A 2DQSA 3PGVA 4ROTA 3CN9A 5DM2A 3LYUA 5FAKA 4OXXA 1NVEA 4YCDA 2HA4A 3OEEA 1ELOA 1WV1A 3REQA 1PWXA 3CRNA 5BOSA 3NP7A 3FWYA 1W4CA 4YMHA 4CMIA 1EPUA 3MBIA 1J70A 3QFHA 3IE0A 4BWVA 3NH6A 3HSSA 2CV0A 1O95D 2H2IA 2JH9A 2M2IA 3TLJA 3TQFA 1LU9A 2CXOA 5LZ7A 1NUPA 5IVHA 1C1DB 2PX2A 2C92A 2GVDC 3K2BA 4RHTA 2RHMA 2GCGA 1CY1A 1D4AA 2X1MA 3TS1A 3W2GA 1VL2A 2HCRA 1BGVA 4B74A 3G85A 4QEZA 3V7UA 1IBRA 2XGOA 3O47A 4Q7QA 1ECGA 3ONVA 1HA3A 1CR1A 2G4VA 2IZOA 3I2IA 3KU4A 4R83A 4BX9A 2NW6A 3TGPA 4H1WA 4L1KA 2PRJA 1XMXA 1JMKC 2A1IA 5LA6A 1S3SA 3HJNA 3HSYA 3BN3A 4H1VA 4TV9F 2ZIZA 4L50A 2EW2A 2GZ3A 1DWPA 2VJCA 4CLRB 3IO3A 5TMPA 2R0QC 4V1CB 4MYSA 4HUJA 4OQ4A 5IUJC 3EPJA 1E3MA 1QQ6A 2AK2A 3FF1A 5BMVF 5LQKA 2C96A 3I4LA 1ZSYA 1L3IA 2GUWA 5KOJA 2JPDA 4POAA 2XVAA 3GDHA 4C30A 1FU8A 2QTAA 1QRSA 3OTQA 3C2QA 5INTA 3IKLA 2JLWA 1V5GA 2Q1UA 3KZMA 1GG2A 2RK6A 4HAXA 1ABEA 3KYDB 1TZKA 4U1RA 2ZYAA 4E2XA 2IPLA 2O1SA 3DDWA 4JQYA 1T35A 1ZK2A 4WKNA 5F64A 3AUAA 1OWLA 3DZDA 3AG5A 4PIMA 4MVJF 2WNHA 5HP4A 3KR0A 2UUCB 4GXTA 1ETUA 1NW8A 3EIFA 3ZEAA 4I9HA 3CUKA 3MEQA 2GBFA 2EQAA 2SNIE 1TZMA 2FFHA 2XB4A 3A6FA 3QKIA 2NUTA 2H57A 3I62A 2C9OA 2FN7A 1JKMA 1IXRC 1QKIA 3TW6A 3CSSA 3SJCA 4E3ZA 3KBBA 2BGTA 2X5KO 4BPBA 4IO1A 4NH0A 3DGEC 3KYCA 1YS7A 4OBXA 4IDHA 4RC9A 2FFRA 2PWBA 4P32A 1RR6A 3C5HA 5B1HA 5A05A 5JAQA 1M2OA 3UHJA 5KQMA 5MN5A 1VE5A 1NMQA 1SU6A 4YDQA 4R5HA 1IWPB 4EAQA 1ZM7A 4M9SA 1X87A 1L5OA 2YQ4A 5T64A 1EXDA 5IVDA 2LDXA 4HI0E 2MDTA 3IIEA 4FLMA 4BATA 5F5NA 1V3QE 1KO7A 1XZAA 5H9WA 2CF5A 1U7WA 2VK8A 4XVCA 3BOSA 4ZI5A 1K06A 1ZRSA 2CUNA 3ZV5A 5IKEA 2J1LA 2NTNA 1E1KA 3ICCA 3M6IA 2O7RA 2QLBA 2R8OA 2GJ4A 5BSWA 3KPWA 1PWEA 3CH7A 1RXEA 2UVQA 2OHVA 5JAUA 2ZR8A 3MMXA 4NFSA 2JLQA 2VT6A 1RYEA 3NTLA 3QVXA 2ZB8A 5JJIA 5JRJA 1P0PA 4Y1RB 3ZTWA 3SDZA 4KRYA 2ISSD 4HUQB 4ZOLB 3FTFA 1B23P 3G02A 3FJOA 1Y3HA 3TQTA 3KYBA 2GNAA 3OIDA 4YRKA 5AJTA 1GPLA 2YIDA 5KMGB 4BP3A 2FF5A 4MUMA 3T9AA 4DMFA 1GAEO 1RXIA 1QIJA 1UIMA 1TZJA 3A2KA 3HUEA 2A7XA 4BZXA 5HA5A 3E9EA 3PRHA 5KMGA 1HETA 1XTQA 4Q48A 1Z88A 2EZ4A 3M82A 1Z2AA 1GNRA 1SU4A 2GWHA 3JCZA 2O2JA 3E27A 2FEXA 3GQBB 3CLSD 3KYDA 1HT3A 3ZWAA 3DM9B 4P3YA 1UMBA 3BMOA 3R6TA 1ZUIA 4AUKA 2ZUFA 4ARUA 5ALXA 4MDFA 3KWMA 1V7QA 4FGUA 4TGLA 5I9NA 1G20A 3D5TA 3GN2A 3Q7TA 1GQRA 3OLCX 3ND6A 5JEDA 2YTZA 1JYEA 3CVXA 1KQOA 1M2FA 1DXHA 4BE4A 4Z99A 1XYGA 4RK4A 1B8UA 3WIUA 1IQRA 3NDRA 2WZDA 4GMXA 4MGHA 2GSDA 3PEEA 5TPWB 2PUCA 3HK2A 1DO2A 3CNEA 1YOVB 3EB9A 3JQAA 5ADHA 3DXZA 5JJLA 4KXMA 4LDNA 3HCPA 4ALLA 1OU4A 1VSVA 4G3XA 5IWAB 4IWNA 4FOPA 3EE6A 4MA0A 1M6VB 1XJWA 3BS4A 1WUTA 1CRLA 2FQXA 1TF5A 2Q0XA 2ORWA 2YS7A 3I8SA 3ZJ5A 1RQ2A 5CVVA 3BA1A 2ZI9A 5EA2A 3T7KA 1SM4A 2RJOA 3G88A 3W5SA 2WYIA 4RBNA 1K5PA 4GBJA 3TMKA 5F77A 4MYCA 2QY9A 3CNOA 3EIUA 2PZJA 3BQNB 1QRUA 1Z2PX 2M6RA 4IUDS 3QP9A 2BMAA 1B42A 1HURA 1L5HB 2AFIE 3G9QA 3MELA 3LTEA 3QJGA 1P2BA 5JG7A 3I01M 2JFHA 2JK1A 2CCKA 4TXMA 2ZUDA 4AJPA 1DFIA 3FDFA 3QMMA 4FQ8A 4A0HA 4CTOA 1XMQB 3SX4A 1SK8A 1WCIB 1G4AE 3BIJA 1SHLA 3EF0A 1L5GB 5JJ5A 3W6OA 3SQWA 4LOKA 5IVKA 8ADHA 1LBIA 3GVXA 4P82A 3DE1X 1D6SA 3VX4A 3RYHB 2H2WA 2WU4A 4CGYA 2XY4A 5A7GA 3AF0A 2G4CA 2GBPA 2A67A 2OP1A 5DU2A 1HDYA 3O4IA 4JBHA 4QRHA 4RA6A 5AOBA 3EWSA 3X1WA 3RU3A 2FW1A 2QUJA 2JZNA 3JYNA 3LLVA 3H1TA 2ZM6B 5LM3A 1XU7A 4U2DA 2JIPA 1JPUA 1YXMA 2O9JA 1ML3A 1KO4A 1G8HA 3ECAA 3P0RA 2ZRGA 1N6PA 4RACA 4Y1RA 1H4SA 3ZGYA 1DRJA 1T3SA 2H1OA 4BWGA 1RS0A 1RHMA 2RGEA